F491666

General Info

Members Datasets Scaffolds Average Seq Length
1207 452 1200 268

Family's Representative Sequence

Representative Sequence 3300026035|Ga0207703_10008054|Ga0207703_1000805411
Length 303
Sequence MYNFTFHRPTTVRQAAGLLARNPEAKLLAGGHSLLPVMKLRLANPSALIDLSLVEGMSGVEQKGRSVVIGAMTRHADAANSPVLQQVLPGLASVPASVGDPQVRNRGTIGGSVANNDPNADYPAACLGLGATIITNKRRIAADDFFTGMFSTALEDGEIITKISFPIAKKAAYEKFKHPASGFALVGVFVSKRGSEIRVAVTGAGANGVFRVKSFEEALKKRFAAKSLDGMTIPATGMKTAIFTPAQNIAPILSGYWPSGPSQKRRRDATRRNNCGWECVSEPRQQFRSDGALCSYCRFLLSY

Samples

Sample ID Description Type Environment
1 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
2 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
3 2643221734 Bosea sp. Root670 Isolate Unclassified
4 2818991467 Bosea vestrisii 3192 Isolate Unclassified
5 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
6 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
7 2851182111 Bosea sp. Tri-44 Isolate Nodule
8 2909042592 Labrys sp. LIt4 Isolate Nodule
9 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
10 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
11 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
12 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
13 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
14 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
15 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
16 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
17 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
18 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
19 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
20 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
21 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
22 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
23 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
24 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
25 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
26 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
27 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
28 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
29 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
30 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
31 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
32 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
33 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
34 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
35 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
36 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
37 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
38 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
39 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
40 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
41 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
42 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
43 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
44 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
45 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
46 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
47 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
48 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
49 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
50 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
51 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
52 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
53 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
54 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
55 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
56 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
57 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
58 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
59 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
60 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
61 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
62 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
63 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
64 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
65 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
66 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
67 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
68 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
69 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
70 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
71 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
72 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
73 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
74 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
75 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
76 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
77 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
78 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
79 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
80 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
81 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
82 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
83 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
84 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
85 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
86 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
87 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
88 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
89 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
90 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
91 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
92 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
93 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
94 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
95 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
96 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
97 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
98 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
99 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
100 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
101 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
102 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
103 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
104 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
105 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
106 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
107 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
108 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
109 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
110 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
111 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
112 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
113 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
114 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
115 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
116 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
117 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
118 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
119 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
120 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
121 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
122 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
123 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
124 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
125 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
126 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
127 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
128 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
129 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
130 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
131 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
132 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
133 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
134 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
135 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
136 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
137 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
138 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
139 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
140 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
141 3300012492 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 Metagenome Rhizosphere
142 3300012495 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 Metagenome Rhizosphere
143 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
144 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
145 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
146 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
147 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
148 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
149 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
150 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
151 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
152 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
153 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
154 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
155 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
156 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
157 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
158 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
159 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
160 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
161 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
162 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
163 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
164 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
165 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
167 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
168 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
169 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
170 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
236 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
237 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
238 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
242 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
243 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
244 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
245 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
246 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
247 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
248 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
249 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
250 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
251 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
252 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
253 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
254 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
255 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
256 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
257 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
258 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
259 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
260 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
261 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
262 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
263 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
264 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
265 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
266 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
267 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
268 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
269 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
270 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
271 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
272 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
273 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
274 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
275 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
276 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
277 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
278 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
279 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
280 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
281 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
282 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
283 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
284 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
285 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
286 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
287 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
288 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
289 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
290 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
291 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
292 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
293 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
294 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
295 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
296 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
297 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
298 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
299 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
300 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
301 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
302 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
303 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
304 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
305 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
306 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
307 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
308 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
309 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
310 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
311 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
312 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
313 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
314 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
315 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
316 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
317 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
318 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
319 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
320 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
321 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
322 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
323 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
324 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
325 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
326 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
327 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
328 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
329 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
330 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
331 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
332 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
333 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
334 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
335 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
336 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
337 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
338 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
339 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
340 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
341 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
342 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
343 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
344 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
345 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
346 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
347 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
348 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
349 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
350 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
351 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
352 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
353 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
354 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
355 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
356 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
357 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
358 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
359 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
360 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
361 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
362 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
363 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
364 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
365 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
366 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
367 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
368 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
369 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
370 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
371 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
372 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
373 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
374 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
375 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
376 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
377 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
378 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
379 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
380 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
381 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
382 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
383 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
384 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
385 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
386 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
387 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
388 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
389 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
390 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
391 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
392 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
393 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
394 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
395 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
396 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
397 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
398 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
399 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
400 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
401 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
402 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
403 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
404 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
405 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
406 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
407 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
408 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
409 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
410 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
411 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
412 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
413 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
414 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
415 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
416 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
417 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
418 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
419 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
420 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
421 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
422 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
423 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
424 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
425 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
426 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
427 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
428 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
429 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
430 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
431 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
432 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
433 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
434 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
435 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
436 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
437 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
438 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
439 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
440 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
441 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
442 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
443 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
444 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
445 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
446 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
447 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
448 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
449 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
450 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
451 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
452 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.25
Metatranscriptomes 0.17
Isolates 0.58

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.23
Nodule 0.33
Rhizoplane 7.13
Rhizosphere 87.32
Stem 0
Stem Tuber 0
Unclassified 1.99

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 2214544913 2209111006 Bacteria 25171
2 ARcpr5oldR_c000030 3300000041 Bacteria 28909
3 ARSoilYngRDRAFT_c00022 3300000042 Bacteria 23602
4 ARcpr5yngRDRAFT_c000011 3300000043 Bacteria 35549
5 ARSoilOldRDRAFT_c000040 3300000044 Bacteria 28954
6 ARCol0yngRDRAFT_1000028 3300000652 Bacteria 25625
7 JGI24739J22299_10000164 3300001989 Bacteria 21825
8 JGI24737J22298_10004205 3300001990 Bacteria 5033
9 JGI24750J21931_1000178 3300002070 Bacteria 10641
10 JGI24745J21846_1000640 3300002073 Bacteria 3142
11 JGI24738J21930_10000112 3300002075 Bacteria 19038
12 JGI24035J26624_1000424 3300002126 Bacteria 3991
13 JGI24033J26618_1001840 3300002155 Bacteria 2123
14 JGI25151J46595_10000066 3300003187 Bacteria 142963
15 JGI25151J46595_10000311 3300003187 Bacteria 53048
16 Ga0055526_1000051 3300003771 Bacteria 116101
17 Ga0055524_1006832 3300003775 Bacteria 4920
18 Ga0065704_10077858 3300005289 Bacteria 4601
19 Ga0065715_10001682 3300005293 Bacteria 8090
20 Ga0070676_10003775 3300005328 Bacteria 7942
21 Ga0070683_100000376 3300005329 Bacteria 31004
22 Ga0070690_100002745 3300005330 Bacteria 9502
23 Ga0070690_100006745 3300005330 Bacteria 6525
24 Ga0070690_100008317 3300005330 Bacteria 5970
25 Ga0070670_100004417 3300005331 Bacteria 11775
26 Ga0070670_100129375 3300005331 Bacteria 2179
27 Ga0070677_10000049 3300005333 Bacteria 37210
28 Ga0070677_10099367 3300005333 Bacteria 1280
29 Ga0068869_100000523 3300005334 Bacteria 21387
30 Ga0070666_10002781 3300005335 Bacteria 10564
31 Ga0070666_10279884 3300005335 Bacteria 1186
32 Ga0070680_100005313 3300005336 Bacteria 9748
33 Ga0070680_100036737 3300005336 Bacteria 3958
34 Ga0070680_100045410 3300005336 Bacteria 3571
35 Ga0070680_100086664 3300005336 Bacteria 2589
36 Ga0070680_100400114 3300005336 Bacteria 1170
37 Ga0070680_100403209 3300005336 Bacteria 1166
38 Ga0070682_100000141 3300005337 Bacteria 57251
39 Ga0070682_100010927 3300005337 Bacteria 5173
40 Ga0070682_100076162 3300005337 Bacteria 2159
41 Ga0070682_100115378 3300005337 Bacteria 1796
42 Ga0068868_100009105 3300005338 Bacteria 7128
43 Ga0070660_100001073 3300005339 Bacteria 18364
44 Ga0070660_100089025 3300005339 Bacteria 2432
45 Ga0070660_100130758 3300005339 Bacteria 2009
46 Ga0070660_100243176 3300005339 Bacteria 1466
47 Ga0070689_100028024 3300005340 Bacteria 4253
48 Ga0070689_100081166 3300005340 Bacteria 2546
49 Ga0070689_100087747 3300005340 Bacteria 2448
50 Ga0070691_10004687 3300005341 Bacteria 6220
51 Ga0070691_10020023 3300005341 Bacteria 3088
52 Ga0070687_100000212 3300005343 Bacteria 20234
53 Ga0070687_100088613 3300005343 Bacteria 1706
54 Ga0070661_100000242 3300005344 Bacteria 44945
55 Ga0070692_10003806 3300005345 Bacteria 6204
56 Ga0070692_10010557 3300005345 Bacteria 4209
57 Ga0070668_100003395 3300005347 Bacteria 11753
58 Ga0070668_100204842 3300005347 Bacteria 1621
59 Ga0070669_100006805 3300005353 Bacteria 8223
60 Ga0070669_100147979 3300005353 Bacteria 1816
61 Ga0070675_100000165 3300005354 Bacteria 40656
62 Ga0070675_100011029 3300005354 Bacteria 7076
63 Ga0070675_100142606 3300005354 Bacteria 2049
64 Ga0070675_100169015 3300005354 Bacteria 1885
65 Ga0070671_100001907 3300005355 Bacteria 15957
66 Ga0070671_100124562 3300005355 Bacteria 2169
67 Ga0070674_100000450 3300005356 Bacteria 20737
68 Ga0070674_100124608 3300005356 Bacteria 1912
69 Ga0070673_100001190 3300005364 Bacteria 14967
70 Ga0070673_100269588 3300005364 Bacteria 1489
71 Ga0070673_100377892 3300005364 Bacteria 1263
72 Ga0070688_100004815 3300005365 Bacteria 7056
73 Ga0070688_100016577 3300005365 Bacteria 4215
74 Ga0070688_100035808 3300005365 Bacteria 3016
75 Ga0070659_100000988 3300005366 Bacteria 20880
76 Ga0070659_100031422 3300005366 Bacteria 4112
77 Ga0070659_100070846 3300005366 Bacteria 2770
78 Ga0070667_100019884 3300005367 Bacteria 5572
79 Ga0070667_100072875 3300005367 Bacteria 2927
80 Ga0070667_100095000 3300005367 Bacteria 2569
81 Ga0070703_10001274 3300005406 Bacteria 7647
82 Ga0070703_10015056 3300005406 Bacteria 2210
83 Ga0070709_10088128 3300005434 Bacteria 2041
84 Ga0070709_10110858 3300005434 Bacteria 1844
85 Ga0070714_100036808 3300005435 Bacteria 4107
86 Ga0070714_100096255 3300005435 Bacteria 2601
87 Ga0070714_100161493 3300005435 Bacteria 2027
88 Ga0070713_100007886 3300005436 Bacteria 7512
89 Ga0070713_100021911 3300005436 Bacteria 4927
90 Ga0070713_100270860 3300005436 Bacteria 1555
91 Ga0070713_100586696 3300005436 Bacteria 1058
92 Ga0070710_10004737 3300005437 Bacteria 6431
93 Ga0070710_10020849 3300005437 Bacteria 3406
94 Ga0070710_10108647 3300005437 Bacteria 1663
95 Ga0070701_10006218 3300005438 Bacteria 5008
96 Ga0070711_100016051 3300005439 Bacteria 4748
97 Ga0070711_100046246 3300005439 Bacteria 2964
98 Ga0070711_100154569 3300005439 Bacteria 1733
99 Ga0070711_100223464 3300005439 Bacteria 1465
100 Ga0070711_100373822 3300005439 Bacteria 1151
101 Ga0070705_100003041 3300005440 Bacteria 8274
102 Ga0070705_100015515 3300005440 Bacteria 3942
103 Ga0070705_100082775 3300005440 Bacteria 1976
104 Ga0070700_100000364 3300005441 Bacteria 23195
105 Ga0070700_100012444 3300005441 Bacteria 4750
106 Ga0070694_100001077 3300005444 Bacteria 15614
107 Ga0070694_100246067 3300005444 Bacteria 1351
108 Ga0070663_100000417 3300005455 Bacteria 22399
109 Ga0070663_100015967 3300005455 Bacteria 4861
110 Ga0070663_100091393 3300005455 Bacteria 2255
111 Ga0070663_100111194 3300005455 Bacteria 2058
112 Ga0070678_100001012 3300005456 Bacteria 14620
113 Ga0070678_100050152 3300005456 Bacteria 3017
114 Ga0070678_100060421 3300005456 Bacteria 2790
115 Ga0070678_100418488 3300005456 Bacteria 1167
116 Ga0070662_100000796 3300005457 Bacteria 19367
117 Ga0070662_100032145 3300005457 Bacteria 3686
118 Ga0070681_10002475 3300005458 Bacteria 16918
119 Ga0070681_10037631 3300005458 Bacteria 4854
120 Ga0070681_10049230 3300005458 Bacteria 4209
121 Ga0070681_10186025 3300005458 Bacteria 1997
122 Ga0070681_10358405 3300005458 Bacteria 1368
123 Ga0068867_100006779 3300005459 Bacteria 8095
124 Ga0070685_10000547 3300005466 Bacteria 21062
125 Ga0070685_10060757 3300005466 Bacteria 2211
126 Ga0070706_100195631 3300005467 Bacteria 1889
127 Ga0070707_100308853 3300005468 Bacteria 1537
128 Ga0070679_100002268 3300005530 Bacteria 17373
129 Ga0070679_100075945 3300005530 Bacteria 3350
130 Ga0070679_100089819 3300005530 Bacteria 3059
131 Ga0070679_100100033 3300005530 Bacteria 2887
132 Ga0070679_100206516 3300005530 Bacteria 1928
133 Ga0070679_100327434 3300005530 Bacteria 1481
134 Ga0070684_100000755 3300005535 Bacteria 22399
135 Ga0070684_100396824 3300005535 Unclassified 1271
136 Ga0068853_100000483 3300005539 Bacteria 27159
137 Ga0068853_100605614 3300005539 Bacteria 1041
138 Ga0068853_100767834 3300005539 Unclassified 922
139 Ga0070672_100000527 3300005543 Bacteria 22399
140 Ga0070672_100426835 3300005543 Unclassified 1139
141 Ga0070672_100649010 3300005543 Bacteria 922
142 Ga0070686_100004541 3300005544 Bacteria 7655
143 Ga0070686_100028407 3300005544 Bacteria 3392
144 Ga0070695_100005295 3300005545 Bacteria 7594
145 Ga0070695_100016829 3300005545 Bacteria 4431
146 Ga0070695_100124151 3300005545 Bacteria 1771
147 Ga0070695_100217729 3300005545 Unclassified 1374
148 Ga0070696_100004211 3300005546 Bacteria 9581
149 Ga0070696_100181293 3300005546 Bacteria 1562
150 Ga0070693_100000199 3300005547 Bacteria 28265
151 Ga0070693_100042452 3300005547 Bacteria 2562
152 Ga0070693_100067261 3300005547 Bacteria 2100
153 Ga0070665_100633126 3300005548 Bacteria 1083
154 Ga0070704_100000987 3300005549 Bacteria 14504
155 Ga0070704_100116040 3300005549 Bacteria 2047
156 Ga0068855_100004444 3300005563 Bacteria 17127
157 Ga0068855_100015363 3300005563 Bacteria 9217
158 Ga0068855_100054935 3300005563 Bacteria 4679
159 Ga0068855_100193345 3300005563 Bacteria 2293
160 Ga0070664_100000895 3300005564 Bacteria 23168
161 Ga0068857_100001816 3300005577 Bacteria 17161
162 Ga0068857_100084708 3300005577 Bacteria 2833
163 Ga0068854_100001812 3300005578 Bacteria 13001
164 Ga0068856_100002507 3300005614 Bacteria 18898
165 Ga0068856_100062535 3300005614 Bacteria 3678
166 Ga0068856_100167359 3300005614 Bacteria 2210
167 Ga0070702_100005184 3300005615 Bacteria 6036
168 Ga0068852_100003253 3300005616 Bacteria 11339
169 Ga0068859_100001353 3300005617 Bacteria 25014
170 Ga0068859_100221537 3300005617 Bacteria 1979
171 Ga0068859_101108608 3300005617 Bacteria 871
172 Ga0068864_100000227 3300005618 Bacteria 50765
173 Ga0068864_100082790 3300005618 Bacteria 2816
174 Ga0068866_10001093 3300005718 Bacteria 11946
175 Ga0068861_100003517 3300005719 Bacteria 10409
176 Ga0068861_100115406 3300005719 Bacteria 2157
177 Ga0068851_10037270 3300005834 Bacteria 2437
178 Ga0068870_10000062 3300005840 Bacteria 33752
179 Ga0068863_100000495 3300005841 Bacteria 39957
180 Ga0068858_100000783 3300005842 Bacteria 33229
181 Ga0068858_100112690 3300005842 Bacteria 2540
182 Ga0068858_100195456 3300005842 Bacteria 1912
183 Ga0068860_100022350 3300005843 Bacteria 6119
184 Ga0068862_100003647 3300005844 Bacteria 13173
185 Ga0068862_100139944 3300005844 Bacteria 2147
186 Ga0081455_10000204 3300005937 Bacteria 75793
187 Ga0081538_10005964 3300005981 Bacteria 10846
188 Ga0081538_10006841 3300005981 Bacteria 9939
189 Ga0081540_1012611 3300005983 Bacteria 5547
190 Ga0081539_10064755 3300005985 Bacteria 1987
191 Ga0070717_10011080 3300006028 Bacteria 6833
192 Ga0070717_10347463 3300006028 Bacteria 1325
193 Ga0070717_10545487 3300006028 Bacteria 1050
194 Ga0075365_10170226 3300006038 Bacteria 1520
195 Ga0075363_100065816 3300006048 Bacteria 1960
196 Ga0075363_100189473 3300006048 Unclassified 1173
197 Ga0075364_10065740 3300006051 Bacteria 2381
198 Ga0075364_10094181 3300006051 Bacteria 1990
199 Ga0070715_10004439 3300006163 Bacteria 4605
200 Ga0070715_10078408 3300006163 Bacteria 1493
201 Ga0070716_100001496 3300006173 Bacteria 10442
202 Ga0070716_100143669 3300006173 Bacteria 1525
203 Ga0070712_100088257 3300006175 Bacteria 2265
204 Ga0070712_100089481 3300006175 Bacteria 2252
205 Ga0070712_100131262 3300006175 Bacteria 1899
206 Ga0070712_100287399 3300006175 Bacteria 1326
207 Ga0070712_100291413 3300006175 Bacteria 1318
208 Ga0070712_100410798 3300006175 Bacteria 1120
209 Ga0075367_10123283 3300006178 Bacteria 1598
210 Ga0075367_10142658 3300006178 Bacteria 1484
211 Ga0075367_10306648 3300006178 Bacteria 1000
212 Ga0075369_10026213 3300006186 Bacteria 2429
213 Ga0075369_10049002 3300006186 Bacteria 1824
214 Ga0075427_10000244 3300006194 Bacteria 5774
215 Ga0097621_100000010 3300006237 Bacteria 112867
216 Ga0097621_100023529 3300006237 Bacteria 4798
217 Ga0097621_100430511 3300006237 Bacteria 1186
218 Ga0075370_10147377 3300006353 Bacteria 1378
219 Ga0068871_100000034 3300006358 Bacteria 71462
220 Ga0068871_100024903 3300006358 Bacteria 4647
221 Ga0068871_100247916 3300006358 Bacteria 1550
222 Ga0075428_100031223 3300006844 Bacteria 5891
223 Ga0075428_100092372 3300006844 Bacteria 3300
224 Ga0075428_100391600 3300006844 Bacteria 1489
225 Ga0075430_100000342 3300006846 Bacteria 33715
226 Ga0075430_100005373 3300006846 Bacteria 10813
227 Ga0075430_100074548 3300006846 Bacteria 2845
228 Ga0075431_100000004 3300006847 Bacteria 106006
229 Ga0075431_100087697 3300006847 Bacteria 3211
230 Ga0075431_100142954 3300006847 Bacteria 2466
231 Ga0075433_10000774 3300006852 Bacteria 21997
232 Ga0075433_10005737 3300006852 Bacteria 9763
233 Ga0075433_10027741 3300006852 Bacteria 4806
234 Ga0075433_10076722 3300006852 Bacteria 2943
235 Ga0075434_100001700 3300006871 Bacteria 18837
236 Ga0075434_100003565 3300006871 Bacteria 13904
237 Ga0075434_100029000 3300006871 Bacteria 5442
238 Ga0075434_100074508 3300006871 Bacteria 3387
239 Ga0075434_100099878 3300006871 Bacteria 2907
240 Ga0075434_100330032 3300006871 Bacteria 1546
241 Ga0075429_100005048 3300006880 Bacteria 11352
242 Ga0075429_100027666 3300006880 Bacteria 4922
243 Ga0068865_100000230 3300006881 Bacteria 31147
244 Ga0068865_100102449 3300006881 Bacteria 2098
245 Ga0068865_100499780 3300006881 Bacteria 1014
246 Ga0075436_100022521 3300006914 Bacteria 4327
247 Ga0075436_100090174 3300006914 Bacteria 2131
248 Ga0097620_100001353 3300006931 Bacteria 25014
249 Ga0097620_100221535 3300006931 Bacteria 1979
250 Ga0097620_101108663 3300006931 Bacteria 871
251 Ga0075435_100001109 3300007076 Bacteria 17153
252 Ga0075435_100017628 3300007076 Bacteria 5410
253 Ga0075435_100061035 3300007076 Bacteria 3058
254 Ga0075435_100142037 3300007076 Bacteria 2015
255 Ga0099795_10000444 3300007788 Bacteria 7607
256 Ga0099795_10017419 3300007788 Bacteria 2290
257 Ga0105251_10036017 3300009011 Bacteria 2438
258 Ga0105250_10068496 3300009092 Bacteria 1432
259 Ga0105240_10067652 3300009093 Bacteria 4427
260 Ga0105240_10986804 3300009093 Bacteria 902
261 Ga0111539_10000932 3300009094 Bacteria 38323
262 Ga0111539_10002162 3300009094 Bacteria 26296
263 Ga0111539_10011144 3300009094 Bacteria 11310
264 Ga0111539_10398766 3300009094 Bacteria 1602
265 Ga0111539_10506499 3300009094 Bacteria 1406
266 Ga0105245_10000258 3300009098 Bacteria 50464
267 Ga0105245_10446687 3300009098 Unclassified 1301
268 Ga0105245_10654400 3300009098 Bacteria 1081
269 Ga0105247_10015208 3300009101 Bacteria 4614
270 Ga0105247_10182766 3300009101 Bacteria 1400
271 Ga0114129_10000582 3300009147 Bacteria 45047
272 Ga0114129_10004796 3300009147 Bacteria 19116
273 Ga0114129_10009608 3300009147 Bacteria 13796
274 Ga0114129_10032724 3300009147 Bacteria 7347
275 Ga0105243_10000846 3300009148 Bacteria 29054
276 Ga0105243_10014969 3300009148 Bacteria 5872
277 Ga0105243_10023951 3300009148 Bacteria 4651
278 Ga0105241_10001369 3300009174 Bacteria 18579
279 Ga0105241_10044576 3300009174 Bacteria 3361
280 Ga0105241_10168621 3300009174 Bacteria 1806
281 Ga0105242_10000037 3300009176 Bacteria 91293
282 Ga0105242_10033883 3300009176 Bacteria 4093
283 Ga0105248_10000744 3300009177 Bacteria 36599
284 Ga0105248_10150780 3300009177 Bacteria 2623
285 Ga0105237_10020951 3300009545 Bacteria 6730
286 Ga0105237_10112148 3300009545 Bacteria 2719
287 Ga0105237_10422057 3300009545 Bacteria 1339
288 Ga0105238_10066539 3300009551 Bacteria 3605
289 Ga0105238_10183495 3300009551 Bacteria 2069
290 Ga0105249_10000209 3300009553 Bacteria 67037
291 Ga0105249_10221168 3300009553 Bacteria 1863
292 Ga0105249_10401041 3300009553 Bacteria 1402
293 Ga0105249_10558907 3300009553 Bacteria 1196
294 Ga0099796_10024285 3300010159 Bacteria 1902
295 Ga0099796_10053133 3300010159 Bacteria 1413
296 Ga0105239_10001464 3300010375 Bacteria 31391
297 Ga0105239_10096125 3300010375 Bacteria 3273
298 Ga0105239_10179287 3300010375 Bacteria 2370
299 Ga0105239_10306104 3300010375 Bacteria 1790
300 Ga0105239_10404527 3300010375 Bacteria 1545
301 Ga0105246_10026773 3300011119 Bacteria 3772
302 Ga0105246_10256985 3300011119 Bacteria 1389
303 Ga0157335_1001705 3300012492 Bacteria 1242
304 Ga0157323_1001249 3300012495 Bacteria 1244
305 Ga0157347_1003799 3300012502 Bacteria 1375
306 Ga0157316_1000114 3300012510 Bacteria 3720
307 Ga0157327_1003099 3300012512 Bacteria 1202
308 Ga0157373_10122811 3300013100 Bacteria 1825
309 Ga0157374_10000940 3300013296 Bacteria 25358
310 Ga0157374_10053270 3300013296 Bacteria 3771
311 Ga0157378_10001580 3300013297 Bacteria 20573
312 Ga0157378_10364978 3300013297 Bacteria 1414
313 Ga0157378_10832455 3300013297 Bacteria 950
314 Ga0163162_10001677 3300013306 Bacteria 20764
315 Ga0163162_10009932 3300013306 Bacteria 9258
316 Ga0163162_10181453 3300013306 Bacteria 2231
317 Ga0163162_10248485 3300013306 Bacteria 1911
318 Ga0163162_10426580 3300013306 Bacteria 1458
319 Ga0157372_10109839 3300013307 Bacteria 3158
320 Ga0157372_10120543 3300013307 Bacteria 3012
321 Ga0157372_10136646 3300013307 Bacteria 2823
322 Ga0157372_10432571 3300013307 Bacteria 1534
323 Ga0157375_10000263 3300013308 Bacteria 47730
324 Ga0157375_10368869 3300013308 Bacteria 1602
325 Ga0157375_10443267 3300013308 Bacteria 1464
326 Ga0163163_10010830 3300014325 Bacteria 8235
327 Ga0163163_10019201 3300014325 Bacteria 6416
328 Ga0163163_10279272 3300014325 Bacteria 1722
329 Ga0157380_10000294 3300014326 Bacteria 30013
330 Ga0157380_10256788 3300014326 Bacteria 1585
331 Ga0157380_10357126 3300014326 Bacteria 1370
332 Ga0157377_10001222 3300014745 Bacteria 10959
333 Ga0157379_10002453 3300014968 Bacteria 15540
334 Ga0157379_10027532 3300014968 Bacteria 5061
335 Ga0157376_10000342 3300014969 Bacteria 31043
336 Ga0157376_10036312 3300014969 Bacteria 3992
337 Ga0157376_10537685 3300014969 Unclassified 1154
338 Ga0163161_10000523 3300017792 Bacteria 31363
339 Ga0163161_10089663 3300017792 Bacteria 2274
340 Ga0206356_11304508 3300020070 Bacteria 1679
341 Ga0206353_11340620 3300020082 Bacteria 1593
342 Ga0213873_10003810 3300021358 Bacteria 2757
343 Ga0213876_10008326 3300021384 Bacteria 5611
344 Ga0213876_10033853 3300021384 Bacteria 2693
345 Ga0213876_10035248 3300021384 Bacteria 2640
346 Ga0213875_10000825 3300021388 Bacteria 23073
347 Ga0213875_10002635 3300021388 Bacteria 10621
348 Ga0213875_10105892 3300021388 Bacteria 1313
349 Ga0224572_1007436 3300024225 Bacteria 2007
350 Ga0228598_1016262 3300024227 Bacteria 1468
351 Ga0207666_1000010 3300025271 Bacteria 46973
352 Ga0207666_1001035 3300025271 Bacteria 3299
353 Ga0207673_1000164 3300025290 Bacteria 6537
354 Ga0209025_1000008 3300025294 Bacteria 1130876
355 Ga0209564_1000054 3300025295 Bacteria 350653
356 Ga0209256_1000084 3300025299 Bacteria 219257
357 Ga0207697_10000186 3300025315 Bacteria 32405
358 Ga0207697_10023457 3300025315 Bacteria 2526
359 Ga0207653_10008164 3300025885 Bacteria 3263
360 Ga0207682_10000123 3300025893 Bacteria 34953
361 Ga0207682_10252265 3300025893 Bacteria 822
362 Ga0207692_10016864 3300025898 Bacteria 3245
363 Ga0207642_10000263 3300025899 Bacteria 15779
364 Ga0207642_10029564 3300025899 Bacteria 2270
365 Ga0207710_10011053 3300025900 Bacteria 3803
366 Ga0207688_10000889 3300025901 Bacteria 15094
367 Ga0207688_10056265 3300025901 Bacteria 2209
368 Ga0207680_10001117 3300025903 Bacteria 12657
369 Ga0207647_10005506 3300025904 Bacteria 9270
370 Ga0207647_10046296 3300025904 Bacteria 2711
371 Ga0207685_10001241 3300025905 Bacteria 5199
372 Ga0207685_10061083 3300025905 Bacteria 1493
373 Ga0207699_10030475 3300025906 Bacteria 3019
374 Ga0207699_10033740 3300025906 Bacteria 2896
375 Ga0207645_10000023 3300025907 Bacteria 98724
376 Ga0207645_10020930 3300025907 Bacteria 4272
377 Ga0207645_10051083 3300025907 Bacteria 2641
378 Ga0207645_10146612 3300025907 Bacteria 1539
379 Ga0207643_10000007 3300025908 Bacteria 171706
380 Ga0207705_10343463 3300025909 Bacteria 1149
381 Ga0207684_10377781 3300025910 Bacteria 1219
382 Ga0207654_10020224 3300025911 Bacteria 3525
383 Ga0207707_10002015 3300025912 Bacteria 18441
384 Ga0207707_10056334 3300025912 Bacteria 3420
385 Ga0207707_10094416 3300025912 Bacteria 2613
386 Ga0207707_10112364 3300025912 Bacteria 2382
387 Ga0207707_10274147 3300025912 Bacteria 1462
388 Ga0207671_10008841 3300025914 Bacteria 8482
389 Ga0207671_10224341 3300025914 Bacteria 1473
390 Ga0207693_10012859 3300025915 Bacteria 6754
391 Ga0207693_10026757 3300025915 Bacteria 4563
392 Ga0207693_10106248 3300025915 Bacteria 2202
393 Ga0207663_10004450 3300025916 Bacteria 6968
394 Ga0207663_10040066 3300025916 Bacteria 2844
395 Ga0207660_10000393 3300025917 Bacteria 28822
396 Ga0207660_10005747 3300025917 Bacteria 8044
397 Ga0207660_10319859 3300025917 Bacteria 1239
398 Ga0207662_10000136 3300025918 Bacteria 35258
399 Ga0207662_10011289 3300025918 Bacteria 4947
400 Ga0207657_10004997 3300025919 Bacteria 13932
401 Ga0207657_10005004 3300025919 Bacteria 13924
402 Ga0207657_10036159 3300025919 Bacteria 4423
403 Ga0207657_10055737 3300025919 Bacteria 3413
404 Ga0207657_10126241 3300025919 Bacteria 2101
405 Ga0207649_10000434 3300025920 Bacteria 30314
406 Ga0207649_10045166 3300025920 Bacteria 2700
407 Ga0207652_10001720 3300025921 Bacteria 19098
408 Ga0207652_10016915 3300025921 Bacteria 5964
409 Ga0207652_10073555 3300025921 Bacteria 2973
410 Ga0207652_10119473 3300025921 Bacteria 2344
411 Ga0207652_10208954 3300025921 Bacteria 1757
412 Ga0207652_10293503 3300025921 Bacteria 1467
413 Ga0207652_10396771 3300025921 Bacteria 1245
414 Ga0207681_10000273 3300025923 Bacteria 38704
415 Ga0207694_10052606 3300025924 Bacteria 3156
416 Ga0207650_10001932 3300025925 Bacteria 14593
417 Ga0207659_10000097 3300025926 Bacteria 51545
418 Ga0207659_10347128 3300025926 Unclassified 1230
419 Ga0207687_10001031 3300025927 Bacteria 18938
420 Ga0207687_10028160 3300025927 Bacteria 3774
421 Ga0207687_10443508 3300025927 Bacteria 1075
422 Ga0207700_10000167 3300025928 Bacteria 39027
423 Ga0207700_10165040 3300025928 Bacteria 1842
424 Ga0207700_10449947 3300025928 Bacteria 1135
425 Ga0207664_10235393 3300025929 Bacteria 1593
426 Ga0207664_10241893 3300025929 Bacteria 1572
427 Ga0207644_10001738 3300025931 Bacteria 14101
428 Ga0207644_10061366 3300025931 Bacteria 2723
429 Ga0207644_10113559 3300025931 Bacteria 2051
430 Ga0207690_10000962 3300025932 Bacteria 18398
431 Ga0207690_10148791 3300025932 Bacteria 1734
432 Ga0207706_10000867 3300025933 Bacteria 31142
433 Ga0207706_10017224 3300025933 Bacteria 6513
434 Ga0207706_10021114 3300025933 Bacteria 5849
435 Ga0207706_10036344 3300025933 Bacteria 4375
436 Ga0207686_10000329 3300025934 Bacteria 34169
437 Ga0207686_10076863 3300025934 Bacteria 2166
438 Ga0207709_10000419 3300025935 Bacteria 41401
439 Ga0207709_10045024 3300025935 Bacteria 2670
440 Ga0207709_10101156 3300025935 Bacteria 1906
441 Ga0207670_10000536 3300025936 Bacteria 20898
442 Ga0207670_10053680 3300025936 Bacteria 2716
443 Ga0207670_10057775 3300025936 Bacteria 2632
444 Ga0207669_10002798 3300025937 Bacteria 7473
445 Ga0207669_10073675 3300025937 Bacteria 2156
446 Ga0207704_10000599 3300025938 Bacteria 15952
447 Ga0207704_10238297 3300025938 Bacteria 1357
448 Ga0207665_10000417 3300025939 Bacteria 29333
449 Ga0207665_10087336 3300025939 Bacteria 2155
450 Ga0207665_10181293 3300025939 Bacteria 1525
451 Ga0207691_10000544 3300025940 Bacteria 37754
452 Ga0207691_10023702 3300025940 Bacteria 5777
453 Ga0207691_10170474 3300025940 Bacteria 1906
454 Ga0207691_10276461 3300025940 Bacteria 1445
455 Ga0207711_10002468 3300025941 Bacteria 16502
456 Ga0207711_10011061 3300025941 Bacteria 7500
457 Ga0207689_10001743 3300025942 Bacteria 20521
458 Ga0207661_10000428 3300025944 Bacteria 27215
459 Ga0207661_10190004 3300025944 Bacteria 1800
460 Ga0207661_10444628 3300025944 Bacteria 1180
461 Ga0207679_10000029 3300025945 Bacteria 183002
462 Ga0207679_10294834 3300025945 Bacteria 1395
463 Ga0207667_10017999 3300025949 Bacteria 7935
464 Ga0207667_10099408 3300025949 Bacteria 3002
465 Ga0207667_10162685 3300025949 Bacteria 2295
466 Ga0207651_10000083 3300025960 Bacteria 42310
467 Ga0207651_10153671 3300025960 Bacteria 1795
468 Ga0207651_10169369 3300025960 Bacteria 1721
469 Ga0207712_10000471 3300025961 Bacteria 33929
470 Ga0207668_10278102 3300025972 Bacteria 1371
471 Ga0207668_10353156 3300025972 Bacteria 1230
472 Ga0207668_10547276 3300025972 Unclassified 1002
473 Ga0207640_10000637 3300025981 Bacteria 20610
474 Ga0207658_10002203 3300025986 Bacteria 14473
475 Ga0207658_10041282 3300025986 Bacteria 3340
476 Ga0207658_10041634 3300025986 Bacteria 3328
477 Ga0207677_10000992 3300026023 Bacteria 15647
478 Ga0207703_10005165 3300026035 Bacteria 10555
479 Ga0207703_10008054 3300026035 Bacteria 8328
480 Ga0207703_10044170 3300026035 Bacteria 3580
481 Ga0207639_10005126 3300026041 Bacteria 8828
482 Ga0207639_10196984 3300026041 Bacteria 1725
483 Ga0207678_10001568 3300026067 Bacteria 21015
484 Ga0207678_10021304 3300026067 Bacteria 5683
485 Ga0207678_10029617 3300026067 Bacteria 4780
486 Ga0207678_10055746 3300026067 Bacteria 3404
487 Ga0207708_10002060 3300026075 Bacteria 14813
488 Ga0207708_10005462 3300026075 Bacteria 9377
489 Ga0207708_10017276 3300026075 Bacteria 5431
490 Ga0207702_10001921 3300026078 Bacteria 20316
491 Ga0207702_10080985 3300026078 Bacteria 2819
492 Ga0207702_10148084 3300026078 Bacteria 2133
493 Ga0207702_10399832 3300026078 Bacteria 1325
494 Ga0207702_10441331 3300026078 Bacteria 1261
495 Ga0207641_10000510 3300026088 Bacteria 43699
496 Ga0207641_10055508 3300026088 Bacteria 3364
497 Ga0207641_10105109 3300026088 Bacteria 2493
498 Ga0207641_10556277 3300026088 Bacteria 1119
499 Ga0207648_10003487 3300026089 Bacteria 16487
500 Ga0207648_10107529 3300026089 Bacteria 2448
501 Ga0207648_10132084 3300026089 Bacteria 2198
502 Ga0207648_10212920 3300026089 Bacteria 1716
503 Ga0207676_10003788 3300026095 Bacteria 10694
504 Ga0207676_10028269 3300026095 Bacteria 4186
505 Ga0207676_10280307 3300026095 Bacteria 1513
506 Ga0207674_10000608 3300026116 Bacteria 46971
507 Ga0207674_10141868 3300026116 Bacteria 2362
508 Ga0207675_100000805 3300026118 Bacteria 31142
509 Ga0207675_100026921 3300026118 Bacteria 5353
510 Ga0207675_100255789 3300026118 Bacteria 1696
511 Ga0207683_10000082 3300026121 Bacteria 74842
512 Ga0207683_10006710 3300026121 Bacteria 9849
513 Ga0207683_10107197 3300026121 Bacteria 2499
514 Ga0207683_10136999 3300026121 Bacteria 2204
515 Ga0207698_10000377 3300026142 Bacteria 25983
516 Ga0209966_1001565 3300027695 Bacteria 3962
517 Ga0209998_10000947 3300027717 Bacteria 7360
518 Ga0209998_10007515 3300027717 Bacteria 2261
519 Ga0207428_10000124 3300027907 Bacteria 105795
520 Ga0207428_10000420 3300027907 Bacteria 52679
521 Ga0207428_10000703 3300027907 Bacteria 38851
522 Ga0268266_10481125 3300028379 Bacteria 1183
523 Ga0268265_10001170 3300028380 Bacteria 22993
524 Ga0268265_10017735 3300028380 Bacteria 4920
525 Ga0268265_10114144 3300028380 Bacteria 2212
526 Ga0268264_10001878 3300028381 Bacteria 19073
527 Ga0268264_10047711 3300028381 Bacteria 3560
528 Ga0265318_10089108 3300028577 Bacteria 1137
529 Ga0265338_10049901 3300028800 Bacteria 3787
530 Ga0265338_10057435 3300028800 Bacteria 3443
531 Ga0265338_10060308 3300028800 Bacteria 3334
532 Ga0265338_10212403 3300028800 Bacteria 1451
533 Ga0265330_10044496 3300031235 Bacteria 1959
534 Ga0265332_10006885 3300031238 Bacteria 5154
535 Ga0265325_10000105 3300031241 Bacteria 59642
536 Ga0265325_10005333 3300031241 Bacteria 7957
537 Ga0265325_10045207 3300031241 Bacteria 2289
538 Ga0265325_10076800 3300031241 Bacteria 1666
539 Ga0265325_10077344 3300031241 Bacteria 1659
540 Ga0265325_10083128 3300031241 Bacteria 1588
541 Ga0265325_10111979 3300031241 Bacteria 1325
542 Ga0265340_10009649 3300031247 Bacteria 5174
543 Ga0265340_10013695 3300031247 Bacteria 4253
544 Ga0265340_10134342 3300031247 Bacteria 1133
545 Ga0265339_10000071 3300031249 Bacteria 88416
546 Ga0265339_10008527 3300031249 Bacteria 6517
547 Ga0265339_10012221 3300031249 Bacteria 5249
548 Ga0265331_10048341 3300031250 Bacteria 2045
549 Ga0265316_10054466 3300031344 Bacteria 3132
550 Ga0265313_10000041 3300031595 Bacteria 119119
551 Ga0265313_10000123 3300031595 Bacteria 77230
552 Ga0265313_10012778 3300031595 Bacteria 5097
553 Ga0265313_10024353 3300031595 Bacteria 3235
554 Ga0265313_10024680 3300031595 Bacteria 3205
555 Ga0265314_10000279 3300031711 Bacteria 74300
556 Ga0265314_10017694 3300031711 Bacteria 5585
557 Ga0265314_10022543 3300031711 Bacteria 4824
558 Ga0265314_10085557 3300031711 Bacteria 2067
559 Ga0265342_10000287 3300031712 Bacteria 57222
560 Ga0265342_10001077 3300031712 Bacteria 26505
561 Ga0265342_10070433 3300031712 Bacteria 2040
562 Ga0316583_10003152 3300032133 Bacteria 5794
563 Ga0373930_0000680 3300034816 Bacteria 4768
564 Ga0373930_0014455 3300034816 Bacteria 1470
565 Ga0373948_0000196 3300034817 Bacteria 6999
566 Ga0373948_0000995 3300034817 Bacteria 3803
567 Ga0373950_0002735 3300034818 Bacteria 2458
568 Ga0373950_0005433 3300034818 Bacteria 1904
569 Ga0373958_0002069 3300034819 Bacteria 2771
570 Ga0373938_0000092 3300034957 Bacteria 12211
571 Ga0373938_0003487 3300034957 Bacteria 2580
572 Ga0373926_0041110 3300035083 Bacteria 1651
573 Ga0373928_0005526 3300035084 Bacteria 2417
574 Ga0373928_0014169 3300035084 Bacteria 1608
575 Ga0373929_0000128 3300035085 Bacteria 12674
576 Ga0373929_0027650 3300035085 Bacteria 1193
577 Ga0373944_0002646 3300035089 Bacteria 4562
578 Ga0373944_0033163 3300035089 Bacteria 1563
579 Ga0373944_0058012 3300035089 Bacteria 1235
580 Ga0373949_0000715 3300035090 Bacteria 10774
581 Ga0373951_0000531 3300035091 Bacteria 10760
582 Ga0373951_0003670 3300035091 Bacteria 3703
583 Ga0373951_0011160 3300035091 Bacteria 2015
584 Ga0373951_0019087 3300035091 Bacteria 1561
585 Ga0373952_0006526 3300035092 Bacteria 2158
586 Ga0373923_0002485 3300035111 Bacteria 5690
587 Ga0373932_0000076 3300035112 Bacteria 24789
588 Ga0373932_0000597 3300035112 Bacteria 11032
589 Ga0373932_0002240 3300035112 Bacteria 4953
590 Ga0373936_0000549 3300035113 Bacteria 12872
591 Ga0373936_0007526 3300035113 Bacteria 4096
592 Ga0373936_0106982 3300035113 Bacteria 1185
593 Ga0373939_0000361 3300035114 Bacteria 11487
594 Ga0373939_0000377 3300035114 Bacteria 11260
595 Ga0373939_0004881 3300035114 Bacteria 3182
596 Ga0373939_0016420 3300035114 Bacteria 1952
597 Ga0373939_0067916 3300035114 Bacteria 1153
598 Ga0373941_0000785 3300035115 Bacteria 6505
599 Ga0373941_0020117 3300035115 Bacteria 1867
600 Ga0373945_0001243 3300035116 Bacteria 7756
601 Ga0373945_0017475 3300035116 Bacteria 2429
602 Ga0373945_0085606 3300035116 Bacteria 1213
603 Ga0373945_0219268 3300035116 Bacteria 795
604 Ga0373953_0003524 3300035117 Bacteria 4889
605 Ga0373953_0003611 3300035117 Bacteria 4843
606 Ga0373953_0015593 3300035117 Bacteria 2758
607 Ga0373954_0002142 3300035118 Bacteria 8197
608 Ga0373954_0006240 3300035118 Bacteria 5197
609 Ga0373954_0026910 3300035118 Bacteria 2638
610 Ga0373954_0058317 3300035118 Bacteria 1819
611 Ga0373956_0017526 3300035119 Bacteria 3021
612 Ga0373956_0022257 3300035119 Bacteria 2711
613 Ga0373956_0088184 3300035119 Bacteria 1429
614 Ga0373957_0020017 3300035120 Bacteria 2360
615 Ga0373957_0092184 3300035120 Bacteria 1205
616 Ga0373960_0000204 3300035121 Bacteria 10830
617 Ga0373960_0001684 3300035121 Bacteria 4947
618 Ga0373943_0001090 3300035170 Bacteria 12084
619 Ga0373943_0003538 3300035170 Bacteria 7112
620 Ga0373943_0010676 3300035170 Bacteria 4122
621 Ga0373943_0034932 3300035170 Bacteria 2400
622 Ga0373943_0089584 3300035170 Bacteria 1591
623 Ga0373946_0000383 3300035171 Bacteria 14419
624 Ga0373946_0003985 3300035171 Bacteria 5252
625 Ga0373946_0069708 3300035171 Bacteria 1515
626 Ga0373955_0007092 3300035172 Bacteria 5134
627 Ga0373955_0018458 3300035172 Bacteria 3469
628 Ga0373955_0035405 3300035172 Bacteria 2644
629 Ga0373955_0052349 3300035172 Bacteria 2227
630 Ga0373942_0000813 3300035207 Bacteria 8599
631 Ga0373942_0002869 3300035207 Bacteria 4095
632 Ga0373942_0005195 3300035207 Bacteria 3015
633 Ga0373961_0001827 3300035241 Bacteria 5833
634 Ga0373924_0000144 3300035410 Bacteria 20890
635 Ga0373924_0016721 3300035410 Bacteria 2805
636 Ga0373924_0017856 3300035410 Bacteria 2728
637 Ga0373924_0074497 3300035410 Bacteria 1436
638 Ga0373924_0078058 3300035410 Bacteria 1405
639 Ga0373924_0181907 3300035410 Bacteria 925
640 Ga0373931_0000186 3300035691 Bacteria 26950
641 Ga0373931_0002333 3300035691 Bacteria 8383
642 Ga0373931_0023349 3300035691 Bacteria 3121
643 Ga0373931_0037528 3300035691 Bacteria 2530
644 Ga0373935_0000012 3300035692 Bacteria 81961
645 Ga0373935_0016872 3300035692 Bacteria 4422
646 Ga0373935_0067952 3300035692 Bacteria 2292
647 Ga0373935_0107931 3300035692 Bacteria 1844
648 Ga0373935_0445773 3300035692 Bacteria 934
649 Ga0373927_0015740 3300035695 Bacteria 4993
650 Ga0373927_0023216 3300035695 Bacteria 4063
651 Ga0373927_0063603 3300035695 Bacteria 2386
652 Ga0373927_0192362 3300035695 Bacteria 1339
653 Ga0373933_0004023 3300035724 Bacteria 8105
654 Ga0373933_0035272 3300035724 Bacteria 2921
655 Ga0373933_0072189 3300035724 Bacteria 2102
656 Ga0373947_0000380 3300035725 Bacteria 25117
657 Ga0373947_0004569 3300035725 Bacteria 8119
658 Ga0373947_0021639 3300035725 Bacteria 3723
659 Ga0373947_0025874 3300035725 Bacteria 3424
660 Ga0373947_0033626 3300035725 Bacteria 3028
661 Ga0373947_0035530 3300035725 Bacteria 2950
662 Ga0373947_0055936 3300035725 Bacteria 2384
663 Ga0373937_0000054 3300036401 Bacteria 102542
664 Ga0373937_0009657 3300036401 Bacteria 8402
665 Ga0373937_0020252 3300036401 Bacteria 5962
666 Ga0373937_0025502 3300036401 Bacteria 5336
667 Ga0373925_0000018 3300037068 Bacteria 174213
668 Ga0373925_0005307 3300037068 Bacteria 9621
669 Ga0373925_0010134 3300037068 Bacteria 6842
670 Ga0373925_0038959 3300037068 Bacteria 3516
671 Ga0373925_0042928 3300037068 Bacteria 3355
672 Ga0373925_0058062 3300037068 Bacteria 2900
673 Ga0373925_0182199 3300037068 Bacteria 1663
674 Ga0395899_0016580 3300037312 Bacteria 5619
675 Ga0395899_0167027 3300037312 Bacteria 1552
676 Ga0395900_0003491 3300037418 Bacteria 16965
677 Ga0395900_0116374 3300037418 Bacteria 2743
678 Ga0395898_0002609 3300037466 Bacteria 21035
679 Ga0395898_0014973 3300037466 Bacteria 7963
680 Ga0395898_0214886 3300037466 Bacteria 1834
681 Ga0436364_0127012 3300037853 Bacteria 10123
682 Ga0436364_0475448 3300037853 Bacteria 15369
683 Ga0436364_0587111 3300037853 Bacteria 1976
684 Ga0436364_1484132 3300037853 Bacteria 957
685 Ga0395901_0005021 3300038443 Bacteria 13359
686 Ga0395901_0026799 3300038443 Bacteria 5918
687 Ga0395901_0281139 3300038443 Bacteria 1729
688 Ga0436365_0276383 3300039437 Bacteria 13956
689 Ga0436365_0676411 3300039437 Bacteria 1127
690 Ga0436365_0823677 3300039437 Bacteria 2841
691 Ga0436365_1193963 3300039437 Bacteria 12936
692 Ga0436365_1224521 3300039437 Bacteria 865
693 Ga0436365_1440616 3300039437 Bacteria 1706
694 Ga0436365_1657521 3300039437 Bacteria 7302
695 Ga0436363_0190862 3300039450 Bacteria 6053
696 Ga0436362_0536014 3300039453 Bacteria 8978
697 Ga0439453_0000510 3300041408 Bacteria 4289
698 Ga0439443_000600 3300042003 Bacteria 3366
699 Ga0439448_0026308 3300042005 Bacteria 1829
700 Ga0439460_0018303 3300042461 Bacteria 1885
701 Ga0466961_0267115 3300044693 Bacteria 1049
702 Ga0466963_0044582 3300044694 Bacteria 2919
703 Ga0453684_0066809 3300044712 Bacteria 4577
704 Ga0466971_0046483 3300044719 Bacteria 1951
705 Ga0451576_0039893 3300045051 Bacteria 4970
706 Ga0466967_0020740 3300045976 Bacteria 5320
707 Ga0495617_022581 3300046452 Bacteria 2127
708 Ga0495592_0000001 3300046454 Bacteria 305819
709 Ga0495592_0001116 3300046454 Bacteria 18677
710 Ga0495592_0009742 3300046454 Bacteria 7231
711 Ga0495592_0057294 3300046454 Bacteria 2876
712 Ga0495603_0012962 3300046455 Bacteria 5041
713 Ga0495603_0096859 3300046455 Bacteria 1723
714 Ga0495629_0004546 3300046459 Bacteria 10380
715 Ga0495629_0016112 3300046459 Bacteria 5367
716 Ga0495629_0024439 3300046459 Bacteria 4302
717 Ga0495638_0005489 3300046460 Bacteria 9427
718 Ga0495641_0023574 3300046461 Bacteria 3053
719 Ga0495641_0031793 3300046461 Bacteria 2518
720 Ga0495641_0078967 3300046461 Bacteria 1474
721 Ga0495651_0000493 3300046462 Bacteria 30523
722 Ga0495651_0002120 3300046462 Bacteria 15325
723 Ga0495651_0016283 3300046462 Bacteria 5757
724 Ga0495651_0098480 3300046462 Bacteria 2182
725 Ga0495651_0174169 3300046462 Bacteria 1529
726 Ga0495651_0233214 3300046462 Bacteria 1266
727 Ga0495653_0000292 3300046463 Bacteria 40544
728 Ga0495653_0004657 3300046463 Bacteria 11097
729 Ga0495653_0012444 3300046463 Bacteria 6947
730 Ga0495653_0041839 3300046463 Bacteria 3574
731 Ga0495580_0022745 3300046472 Bacteria 4608
732 Ga0495580_0135064 3300046472 Bacteria 1710
733 Ga0495582_0001705 3300046473 Bacteria 12400
734 Ga0495582_0015446 3300046473 Bacteria 4193
735 Ga0495582_0254856 3300046473 Bacteria 1006
736 Ga0495582_0300290 3300046473 Bacteria 923
737 Ga0495639_0019431 3300046475 Bacteria 2965
738 Ga0495639_0033107 3300046475 Bacteria 2307
739 Ga0495639_0109786 3300046475 Unclassified 1308
740 Ga0495662_0001863 3300046476 Bacteria 10566
741 Ga0495662_0009777 3300046476 Bacteria 4711
742 Ga0495662_0023030 3300046476 Bacteria 3007
743 Ga0495664_0000001 3300046477 Bacteria 757730
744 Ga0495664_0001609 3300046477 Bacteria 12011
745 Ga0495664_0042952 3300046477 Bacteria 2678
746 Ga0495664_0052458 3300046477 Bacteria 2423
747 Ga0495664_0072209 3300046477 Bacteria 2062
748 Ga0495584_0048485 3300046491 Bacteria 2141
749 Ga0495584_0181726 3300046491 Bacteria 1069
750 Ga0495584_0213586 3300046491 Bacteria 981
751 Ga0495585_0009128 3300046492 Bacteria 5970
752 Ga0495594_0047336 3300046499 Bacteria 2361
753 Ga0495594_0051362 3300046499 Bacteria 2268
754 Ga0495594_0101905 3300046499 Unclassified 1615
755 Ga0495607_0004288 3300046501 Bacteria 10532
756 Ga0495608_0000050 3300046511 Bacteria 96603
757 Ga0495608_0010562 3300046511 Bacteria 6442
758 Ga0495608_0013937 3300046511 Bacteria 5580
759 Ga0495608_0031723 3300046511 Bacteria 3571
760 Ga0495608_0110542 3300046511 Bacteria 1767
761 Ga0495618_0000045 3300046514 Bacteria 94654
762 Ga0495618_0007452 3300046514 Bacteria 6617
763 Ga0495618_0014982 3300046514 Bacteria 4728
764 Ga0495618_0104793 3300046514 Bacteria 1811
765 Ga0495618_0152558 3300046514 Bacteria 1475
766 Ga0495628_0000003 3300046516 Bacteria 470339
767 Ga0495628_0002046 3300046516 Bacteria 18273
768 Ga0495628_0009974 3300046516 Bacteria 8082
769 Ga0495628_0015110 3300046516 Bacteria 6448
770 Ga0495628_0174495 3300046516 Bacteria 1629
771 Ga0495630_0016265 3300046517 Bacteria 5434
772 Ga0495630_0023584 3300046517 Bacteria 4548
773 Ga0495630_0155120 3300046517 Bacteria 1743
774 Ga0495630_0157643 3300046517 Bacteria 1728
775 Ga0495630_0307552 3300046517 Bacteria 1211
776 Ga0495644_0000514 3300046523 Bacteria 16546
777 Ga0495644_0097456 3300046523 Bacteria 1112
778 Ga0495666_0001847 3300046526 Bacteria 10463
779 Ga0495666_0081428 3300046526 Bacteria 1531
780 Ga0495652_0000001 3300046529 Bacteria 1045081
781 Ga0495652_0020653 3300046529 Bacteria 5854
782 Ga0495652_0032571 3300046529 Bacteria 4557
783 Ga0495652_0043866 3300046529 Bacteria 3852
784 Ga0495652_0260268 3300046529 Unclassified 1281
785 Ga0495665_0006322 3300046531 Bacteria 6389
786 Ga0495665_0052492 3300046531 Bacteria 2158
787 Ga0495640_0000006 3300046533 Bacteria 285419
788 Ga0495640_0057539 3300046533 Bacteria 2653
789 Ga0495640_0075001 3300046533 Bacteria 2260
790 Ga0495640_0081965 3300046533 Bacteria 2144
791 Ga0495640_0099051 3300046533 Bacteria 1915
792 Ga0495586_0010189 3300046535 Bacteria 5001
793 Ga0495586_0027494 3300046535 Bacteria 3044
794 Ga0495586_0044435 3300046535 Bacteria 2394
795 Ga0495587_0000028 3300046536 Bacteria 138663
796 Ga0495587_0000335 3300046536 Bacteria 33563
797 Ga0495587_0027769 3300046536 Bacteria 3445
798 Ga0495587_0280541 3300046536 Bacteria 934
799 Ga0495609_0023913 3300046538 Bacteria 2805
800 Ga0495609_0123127 3300046538 Bacteria 1114
801 Ga0495645_0000004 3300046543 Bacteria 532661
802 Ga0495645_0001781 3300046543 Bacteria 14625
803 Ga0495622_0018802 3300046557 Bacteria 3218
804 Ga0495622_0115086 3300046557 Bacteria 1230
805 Ga0495633_0002107 3300046558 Bacteria 14302
806 Ga0495667_0000001 3300046559 Bacteria 834831
807 Ga0495667_0004928 3300046559 Bacteria 9026
808 Ga0495667_0019211 3300046559 Bacteria 4611
809 Ga0495667_0042835 3300046559 Bacteria 3001
810 Ga0495656_0019735 3300046615 Bacteria 2605
811 Ga0495656_0106492 3300046615 Bacteria 1305
812 Ga0495634_0000531 3300046642 Bacteria 37387
813 Ga0495634_0002372 3300046642 Bacteria 15688
814 Ga0495634_0007696 3300046642 Bacteria 8061
815 Ga0495634_0009588 3300046642 Bacteria 7135
816 Ga0495634_0017766 3300046642 Bacteria 5071
817 Ga0495634_0246960 3300046642 Bacteria 1093
818 Ga0495635_0000007 3300046663 Bacteria 278786
819 Ga0495635_0000736 3300046663 Bacteria 21173
820 Ga0495635_0004379 3300046663 Bacteria 9778
821 Ga0495635_0045113 3300046663 Bacteria 3041
822 Ga0495635_0061837 3300046663 Bacteria 2571
823 Ga0495635_0094383 3300046663 Bacteria 2045
824 Ga0495659_0011224 3300046664 Bacteria 2885
825 Ga0495661_0151950 3300046665 Unclassified 1250
826 Ga0495588_0013623 3300046674 Bacteria 3876
827 Ga0495588_0068823 3300046674 Bacteria 1839
828 Ga0495657_0000136 3300046675 Bacteria 65707
829 Ga0495657_0000836 3300046675 Bacteria 27235
830 Ga0495657_0110571 3300046675 Bacteria 1741
831 Ga0495599_0000002 3300046678 Bacteria 348168
832 Ga0495599_0034592 3300046678 Bacteria 3173
833 Ga0495599_0042654 3300046678 Bacteria 2847
834 Ga0495623_0000052 3300046679 Bacteria 71268
835 Ga0495623_0027709 3300046679 Bacteria 3647
836 Ga0495623_0282093 3300046679 Bacteria 924
837 Ga0495646_0000036 3300046680 Bacteria 81182
838 Ga0495646_0000229 3300046680 Bacteria 27971
839 Ga0495646_0048707 3300046680 Bacteria 2573
840 Ga0495646_0242650 3300046680 Bacteria 968
841 Ga0495646_0244079 3300046680 Bacteria 964
842 Ga0495647_0021862 3300046681 Bacteria 2307
843 Ga0495658_0000591 3300046683 Bacteria 19855
844 Ga0495658_0002748 3300046683 Bacteria 8846
845 Ga0495658_0100698 3300046683 Bacteria 1724
846 Ga0495658_0102362 3300046683 Bacteria 1711
847 Ga0495658_0286263 3300046683 Bacteria 1040
848 Ga0495669_0047505 3300046684 Bacteria 1918
849 Ga0495613_0014232 3300046689 Bacteria 5904
850 Ga0495613_0047264 3300046689 Bacteria 3179
851 Ga0495613_0168922 3300046689 Bacteria 1553
852 Ga0495613_0274225 3300046689 Bacteria 1172
853 Ga0495624_0009422 3300046690 Bacteria 6764
854 Ga0495624_0062347 3300046690 Bacteria 2333
855 Ga0495624_0234940 3300046690 Bacteria 1110
856 Ga0495670_0008959 3300046691 Bacteria 4922
857 Ga0495600_0000037 3300046809 Bacteria 78434
858 Ga0495600_0004219 3300046809 Bacteria 8582
859 Ga0495600_0009757 3300046809 Bacteria 5935
860 Ga0495600_0017312 3300046809 Bacteria 4582
861 Ga0495600_0100651 3300046809 Bacteria 1884
862 Ga0495581_0017156 3300047315 Bacteria 4207
863 Ga0495581_0035361 3300047315 Bacteria 2891
864 Ga0495581_0049412 3300047315 Bacteria 2428
865 Ga0495604_0000594 3300047317 Bacteria 31291
866 Ga0495604_0006384 3300047317 Bacteria 9351
867 Ga0495604_0021677 3300047317 Bacteria 5129
868 Ga0495604_0028471 3300047317 Bacteria 4444
869 Ga0495604_0043834 3300047317 Bacteria 3499
870 Ga0495604_0130187 3300047317 Bacteria 1810
871 Ga0495674_0000001 3300047319 Bacteria 778665
872 Ga0495674_0034790 3300047319 Bacteria 4551
873 Ga0495674_0036722 3300047319 Bacteria 4407
874 Ga0495674_0040549 3300047319 Bacteria 4164
875 Ga0495674_0050397 3300047319 Bacteria 3673
876 Ga0495674_0103570 3300047319 Bacteria 2419
877 Ga0495674_0319885 3300047319 Bacteria 1264
878 Ga0495672_0139233 3300047320 Bacteria 1269
879 Ga0495676_0017949 3300047321 Bacteria 6244
880 Ga0495676_0191256 3300047321 Bacteria 1427
881 Ga0495676_0218008 3300047321 Bacteria 1316
882 Ga0495676_0260847 3300047321 Bacteria 1179
883 Ga0495680_0000705 3300047322 Bacteria 37488
884 Ga0495680_0005567 3300047322 Bacteria 11823
885 Ga0495680_0008046 3300047322 Bacteria 9614
886 Ga0495680_0015939 3300047322 Bacteria 6468
887 Ga0495680_0034691 3300047322 Bacteria 4070
888 Ga0495680_0036864 3300047322 Bacteria 3921
889 Ga0495675_0000049 3300047444 Bacteria 80913
890 Ga0495675_0000139 3300047444 Bacteria 50643
891 Ga0495675_0072601 3300047444 Bacteria 2171
892 Ga0495675_0155658 3300047444 Bacteria 1410
893 Ga0495679_059603 3300047446 Unclassified 1122
894 Ga0495684_0000046 3300047471 Bacteria 92658
895 Ga0495684_0006324 3300047471 Bacteria 9204
896 Ga0495684_0016053 3300047471 Bacteria 5765
897 Ga0495684_0193138 3300047471 Bacteria 1504
898 Ga0495593_0000276 3300047673 Bacteria 27921
899 Ga0495593_0021108 3300047673 Bacteria 3641
900 Ga0495593_0064941 3300047673 Unclassified 1904
901 Ga0495602_0000102 3300048088 Bacteria 81094
902 Ga0495602_0004714 3300048088 Bacteria 14255
903 Ga0495602_0006950 3300048088 Bacteria 11884
904 Ga0495602_0110768 3300048088 Bacteria 2231
905 Ga0495602_0164889 3300048088 Bacteria 1726
906 Ga0495614_0084354 3300048089 Bacteria 1378
907 Ga0496100_0000057 3300048903 Bacteria 67216
908 Ga0496100_0042904 3300048903 Bacteria 2890
909 Ga0496100_0081989 3300048903 Bacteria 2180
910 Ga0496100_0105814 3300048903 Bacteria 1946
911 Ga0496100_0178414 3300048903 Bacteria 1535
912 Ga0496101_0001297 3300048904 Bacteria 14944
913 Ga0496101_0021335 3300048904 Bacteria 4450
914 Ga0496101_0033105 3300048904 Bacteria 3643
915 Ga0496101_0234131 3300048904 Bacteria 1428
916 Ga0496101_0426633 3300048904 Bacteria 1045
917 Ga0496101_0534310 3300048904 Bacteria 927
918 Ga0496102_0001628 3300048905 Bacteria 19791
919 Ga0496102_0028878 3300048905 Bacteria 4958
920 Ga0496102_0066984 3300048905 Bacteria 3292
921 Ga0496102_0595426 3300048905 Bacteria 1029
922 Ga0496103_0003313 3300048906 Bacteria 9851
923 Ga0496103_0016110 3300048906 Bacteria 4460
924 Ga0496103_0055551 3300048906 Bacteria 2456
925 Ga0496103_0126020 3300048906 Bacteria 1633
926 Ga0496103_0168797 3300048906 Unclassified 1404
927 Ga0496103_0200932 3300048906 Bacteria 1282
928 Ga0496104_0000658 3300048907 Bacteria 29624
929 Ga0496104_0025805 3300048907 Bacteria 5419
930 Ga0496104_0063613 3300048907 Bacteria 3499
931 Ga0496104_0143016 3300048907 Bacteria 2298
932 Ga0496104_0156952 3300048907 Bacteria 2183
933 Ga0496104_0163834 3300048907 Bacteria 2132
934 Ga0496104_0167007 3300048907 Bacteria 2110
935 Ga0496104_0208506 3300048907 Bacteria 1866
936 Ga0496104_0416437 3300048907 Bacteria 1256
937 Ga0496105_0003619 3300048908 Bacteria 11480
938 Ga0496105_0007433 3300048908 Bacteria 8478
939 Ga0496105_0036018 3300048908 Bacteria 4075
940 Ga0496105_0051118 3300048908 Bacteria 3415
941 Ga0496105_0105574 3300048908 Bacteria 2325
942 Ga0496105_0128809 3300048908 Bacteria 2087
943 Ga0496106_0000518 3300048909 Bacteria 27401
944 Ga0496106_0013856 3300048909 Bacteria 5957
945 Ga0496106_0016140 3300048909 Bacteria 5524
946 Ga0496106_0047763 3300048909 Bacteria 3222
947 Ga0496106_0144759 3300048909 Bacteria 1871
948 Ga0496106_0254822 3300048909 Bacteria 1404
949 Ga0496106_0707599 3300048909 Bacteria 803
950 Ga0496107_0001129 3300048910 Bacteria 16115
951 Ga0496107_0008616 3300048910 Bacteria 7063
952 Ga0496107_0024896 3300048910 Bacteria 4236
953 Ga0496107_0060839 3300048910 Bacteria 2733
954 Ga0496107_0061873 3300048910 Bacteria 2711
955 Ga0496108_0004254 3300048911 Bacteria 11528
956 Ga0496108_0019135 3300048911 Bacteria 5620
957 Ga0496108_0044088 3300048911 Bacteria 3724
958 Ga0496108_0056121 3300048911 Bacteria 3308
959 Ga0496108_0103051 3300048911 Bacteria 2435
960 Ga0496109_0000390 3300048912 Bacteria 39843
961 Ga0496109_0023523 3300048912 Bacteria 5470
962 Ga0496109_0152330 3300048912 Bacteria 2165
963 Ga0496109_0229402 3300048912 Bacteria 1746
964 Ga0496109_0303985 3300048912 Bacteria 1504
965 Ga0496109_0794210 3300048912 Bacteria 884
966 Ga0496109_0834890 3300048912 Bacteria 859
967 Ga0496110_0005641 3300048913 Bacteria 9824
968 Ga0496110_0014086 3300048913 Bacteria 6630
969 Ga0496110_0134828 3300048913 Bacteria 2231
970 Ga0496110_0472443 3300048913 Bacteria 1142
971 Ga0496110_0505888 3300048913 Bacteria 1100
972 Ga0496111_0020628 3300048914 Bacteria 4590
973 Ga0496111_0027669 3300048914 Bacteria 4014
974 Ga0496112_0025896 3300048915 Bacteria 5636
975 Ga0496112_0083042 3300048915 Bacteria 3168
976 Ga0496112_0102485 3300048915 Bacteria 2832
977 Ga0496112_0146823 3300048915 Bacteria 2327
978 Ga0496112_0714661 3300048915 Bacteria 929
979 Ga0496113_0019170 3300048916 Bacteria 4780
980 Ga0496113_0042842 3300048916 Bacteria 3346
981 Ga0496113_0112080 3300048916 Bacteria 2125
982 Ga0496113_0259097 3300048916 Bacteria 1389
983 Ga0496113_0363296 3300048916 Bacteria 1161
984 Ga0496114_0017408 3300048917 Bacteria 5800
985 Ga0496114_0046938 3300048917 Bacteria 3590
986 Ga0496114_0132574 3300048917 Bacteria 2153
987 Ga0496114_0134615 3300048917 Bacteria 2136
988 Ga0496115_0035160 3300048918 Bacteria 3963
989 Ga0496115_0076771 3300048918 Bacteria 2715
990 Ga0496115_0133400 3300048918 Bacteria 2047
991 Ga0496115_0282997 3300048918 Bacteria 1361
992 Ga0496115_0496336 3300048918 Unclassified 981
993 Ga0496117_0030252 3300048920 Bacteria 4158
994 Ga0496118_0160205 3300048921 Bacteria 1393
995 Ga0496122_0076861 3300048925 Bacteria 2347
996 Ga0501031_0039966 3300049568 Bacteria 3062
997 Ga0501031_0079010 3300049568 Bacteria 2144
998 Ga0501032_0012835 3300049569 Bacteria 5974
999 Ga0501032_0022754 3300049569 Bacteria 4342
1000 Ga0501032_0052659 3300049569 Bacteria 2742
1001 Ga0501033_0007713 3300049570 Bacteria 8348
1002 Ga0501034_0000032 3300049571 Bacteria 243763
1003 Ga0501034_0002292 3300049571 Bacteria 23472
1004 Ga0501034_0020882 3300049571 Bacteria 6685
1005 Ga0501034_0025918 3300049571 Bacteria 5972
1006 Ga0501034_0076586 3300049571 Bacteria 3352
1007 Ga0501034_0204225 3300049571 Bacteria 1933
1008 Ga0501034_0207143 3300049571 Bacteria 1917
1009 Ga0501034_0251449 3300049571 Bacteria 1712
1010 Ga0501034_0299608 3300049571 Bacteria 1544
1011 Ga0501034_0722591 3300049571 Bacteria 893
1012 Ga0501034_0730953 3300049571 Bacteria 886
1013 Ga0501036_0000609 3300049572 Bacteria 25966
1014 Ga0501036_0014893 3300049572 Bacteria 6487
1015 Ga0501036_0054800 3300049572 Bacteria 3378
1016 Ga0501036_0377075 3300049572 Bacteria 1184
1017 Ga0501037_0007571 3300049573 Bacteria 7951
1018 Ga0501037_0073348 3300049573 Bacteria 2488
1019 Ga0501037_0110404 3300049573 Bacteria 1981
1020 Ga0501037_0294719 3300049573 Bacteria 1127
1021 Ga0501037_0438789 3300049573 Bacteria 892
1022 Ga0501038_0016827 3300049574 Bacteria 6618
1023 Ga0501038_0126668 3300049574 Bacteria 2101
1024 Ga0501038_0316124 3300049574 Bacteria 1222
1025 Ga0501038_0390858 3300049574 Bacteria 1077
1026 Ga0501038_0425503 3300049574 Bacteria 1024
1027 Ga0501038_0597506 3300049574 Bacteria 835
1028 Ga0501039_0012258 3300049575 Bacteria 6536
1029 Ga0501039_0038774 3300049575 Bacteria 3679
1030 Ga0501039_0119837 3300049575 Bacteria 2061
1031 Ga0501042_0067234 3300049578 Bacteria 2562
1032 Ga0501042_0084572 3300049578 Bacteria 2275
1033 Ga0501043_0002387 3300049579 Bacteria 15915
1034 Ga0501043_0016255 3300049579 Bacteria 5836
1035 Ga0501043_0195245 3300049579 Bacteria 1573
1036 Ga0501043_0218784 3300049579 Bacteria 1474
1037 Ga0501043_0371185 3300049579 Bacteria 1084
1038 Ga0501043_0382596 3300049579 Bacteria 1065
1039 Ga0501046_0151657 3300049580 Bacteria 1748
1040 Ga0501047_0000228 3300049581 Bacteria 66588
1041 Ga0501047_0013114 3300049581 Bacteria 7849
1042 Ga0501047_0027357 3300049581 Bacteria 5493
1043 Ga0501047_0083218 3300049581 Bacteria 3075
1044 Ga0501047_0090816 3300049581 Bacteria 2931
1045 Ga0501047_0101345 3300049581 Bacteria 2759
1046 Ga0501047_0435531 3300049581 Bacteria 1141
1047 Ga0501048_0000467 3300049582 Bacteria 28373
1048 Ga0501048_0374345 3300049582 Bacteria 1016
1049 Ga0501067_0135133 3300049583 Bacteria 1373
1050 Ga0501069_0081539 3300049585 Bacteria 1822
1051 Ga0501069_0090888 3300049585 Bacteria 1726
1052 Ga0501070_0008372 3300049586 Bacteria 8739
1053 Ga0501070_0008780 3300049586 Bacteria 8545
1054 Ga0501070_0027861 3300049586 Bacteria 4738
1055 Ga0501070_0038930 3300049586 Bacteria 3967
1056 Ga0501070_0046289 3300049586 Bacteria 3617
1057 Ga0501070_0126899 3300049586 Bacteria 2108
1058 Ga0501070_0180504 3300049586 Bacteria 1737
1059 Ga0501070_0226485 3300049586 Bacteria 1532
1060 Ga0501071_0279435 3300049587 Bacteria 1263
1061 Ga0501072_0279283 3300049588 Bacteria 1328
1062 Ga0501072_0321239 3300049588 Bacteria 1230
1063 Ga0501073_0005395 3300049589 Bacteria 9578
1064 Ga0501073_0016516 3300049589 Bacteria 5351
1065 Ga0501073_0016906 3300049589 Bacteria 5283
1066 Ga0501073_0047845 3300049589 Bacteria 3004
1067 Ga0501073_0059193 3300049589 Bacteria 2676
1068 Ga0501073_0167408 3300049589 Bacteria 1522
1069 Ga0501073_0271689 3300049589 Bacteria 1170
1070 Ga0501074_0003305 3300049590 Bacteria 11407
1071 Ga0501074_0119873 3300049590 Bacteria 1881
1072 Ga0501076_0160613 3300049592 Bacteria 1830
1073 Ga0501077_0118487 3300049593 Bacteria 1678
1074 Ga0501077_0312791 3300049593 Bacteria 1001
1075 Ga0501079_0012178 3300049741 Bacteria 6566
1076 Ga0501080_0000112 3300049742 Bacteria 56408
1077 Ga0501080_0013759 3300049742 Bacteria 7450
1078 Ga0501080_0050861 3300049742 Bacteria 3855
1079 Ga0501080_0053206 3300049742 Bacteria 3768
1080 Ga0501080_0420448 3300049742 Bacteria 1201
1081 Ga0501081_0022376 3300049743 Bacteria 4229
1082 Ga0501083_0001098 3300049744 Bacteria 18074
1083 Ga0501083_0011138 3300049744 Bacteria 6313
1084 Ga0501083_0051420 3300049744 Bacteria 2771
1085 Ga0501083_0363135 3300049744 Bacteria 941
1086 Ga0501035_0001573 3300049822 Bacteria 23232
1087 Ga0501035_0012556 3300049822 Bacteria 7826
1088 Ga0501035_0047298 3300049822 Bacteria 3862
1089 Ga0501035_0125846 3300049822 Bacteria 2237
1090 Ga0501035_0222004 3300049822 Bacteria 1613
1091 Ga0501044_0015838 3300049823 Bacteria 8112
1092 Ga0501044_0017602 3300049823 Bacteria 7664
1093 Ga0501044_0059118 3300049823 Bacteria 3928
1094 Ga0501044_0229370 3300049823 Bacteria 1805
1095 Ga0501044_0291111 3300049823 Bacteria 1564
1096 Ga0501044_0346740 3300049823 Bacteria 1405
1097 Ga0501045_0509016 3300049824 Bacteria 894
1098 nmdc:mga03683_118853_c1 3300050489 Bacteria 1174
1099 nmdc:mga03n38_125692_c1 3300050490 Unclassified 1265
1100 nmdc:mga03n38_92959_c1 3300050490 Bacteria 1440
1101 nmdc:mga06z11_98530_c1 3300050494 Bacteria 1600
1102 nmdc:mga07m45_53349_c1 3300050496 Bacteria 2284
1103 nmdc:mga05p37_313858_c1 3300050507 Bacteria 1858
1104 nmdc:mga05p37_45_c1 3300050507 Bacteria 81140
1105 nmdc:mga05p37_9625_c1 3300050507 Bacteria 11448
1106 nmdc:mga09592_1055_c1 3300050508 Bacteria 21846
1107 nmdc:mga09592_16858_c1 3300050508 Bacteria 5978
1108 nmdc:mga0qj67_136078_c1 3300050509 Bacteria 1991
1109 nmdc:mga0qj67_201_c1 3300050509 Bacteria 40409
1110 nmdc:mga0qj67_21795_c1 3300050509 Bacteria 4915
1111 nmdc:mga0qj67_471394_c1 3300050509 Bacteria 1010
1112 nmdc:mga0qj67_701_c1 3300050509 Bacteria 22836
1113 nmdc:mga06r32_119_c1 3300050510 Bacteria 56718
1114 nmdc:mga06r32_227_c1 3300050510 Bacteria 45651
1115 nmdc:mga06r32_538051_c1 3300050510 Bacteria 1143
1116 nmdc:mga06r32_684495_c1 3300050510 Bacteria 992
1117 nmdc:mga08y16_1191_c1 3300050511 Bacteria 25691
1118 nmdc:mga08y16_1666_c1 3300050511 Bacteria 22506
1119 nmdc:mga08y16_359795_c1 3300050511 Bacteria 1494
1120 nmdc:mga08y16_437677_c1 3300050511 Bacteria 1335
1121 nmdc:mga08y16_636_c1 3300050511 Bacteria 32950
1122 nmdc:mga08y16_87220_c1 3300050511 Bacteria 3251
1123 nmdc:mga0n895_147000_c1 3300050512 Bacteria 2387
1124 nmdc:mga0n895_153246_c1 3300050512 Bacteria 2335
1125 nmdc:mga0n895_4930_c1 3300050512 Bacteria 11073
1126 nmdc:mga0n895_50_c1 3300050512 Bacteria 71634
1127 nmdc:mga0rr50_17122_c1 3300050513 Bacteria 4829
1128 nmdc:mga0rr50_19371_c1 3300050513 Bacteria 4592
1129 nmdc:mga0rr50_235652_c1 3300050513 Bacteria 1516
1130 nmdc:mga0rr50_398005_c1 3300050513 Bacteria 1163
1131 nmdc:mga0rr50_511473_c1 3300050513 Bacteria 1021
1132 nmdc:mga0rr50_67221_c1 3300050513 Bacteria 2722
1133 nmdc:mga08x19_107491_c1 3300050514 Bacteria 1857
1134 nmdc:mga08x19_20074_c1 3300050514 Bacteria 4112
1135 nmdc:mga08x19_51336_c1 3300050514 Bacteria 2649
1136 nmdc:mga08x19_73725_c1 3300050514 Bacteria 2229
1137 nmdc:mga0a205_173299_c1 3300050515 Bacteria 2053
1138 nmdc:mga0a205_21352_c1 3300050515 Bacteria 6125
1139 nmdc:mga0a205_2228_c1 3300050515 Bacteria 17060
1140 nmdc:mga0a205_25091_c1 3300050515 Bacteria 4403
1141 nmdc:mga0a205_4901_c1 3300050515 Bacteria 12033
1142 Ga0495601_0000006 3300053077 Bacteria 373770
1143 Ga0495601_0000204 3300053077 Bacteria 31605
1144 Ga0495601_0002295 3300053077 Bacteria 10791
1145 Ga0495601_0002402 3300053077 Bacteria 10631
1146 Ga0495601_0004165 3300053077 Bacteria 8337
1147 Ga0495601_0011343 3300053077 Bacteria 5327
1148 Ga0495601_0056978 3300053077 Bacteria 2475
1149 Ga0495601_0111497 3300053077 Bacteria 1772
1150 Ga0495601_0201861 3300053077 Bacteria 1299
1151 Ga0495612_0000004 3300053078 Bacteria 286946
1152 Ga0495612_0000384 3300053078 Bacteria 17659
1153 Ga0495612_0011006 3300053078 Bacteria 3652
1154 Ga0495612_0012068 3300053078 Bacteria 3480
1155 Ga0495612_0040105 3300053078 Bacteria 1907
1156 Ga0495612_0051614 3300053078 Bacteria 1690
1157 Ga0495655_0015468 3300053083 Bacteria 1622
1158 Ga0495595_0000227 3300053084 Bacteria 22346
1159 Ga0495595_0000577 3300053084 Bacteria 14028
1160 Ga0495595_0000686 3300053084 Bacteria 12928
1161 Ga0495595_0001081 3300053084 Bacteria 10545
1162 Ga0495595_0002024 3300053084 Bacteria 7872
1163 Ga0495595_0023885 3300053084 Bacteria 2696
1164 Ga0495595_0071131 3300053084 Bacteria 1644
1165 Ga0495595_0098390 3300053084 Bacteria 1410
1166 Ga0495595_0214467 3300053084 Bacteria 960
1167 Ga0495619_0000027 3300053085 Bacteria 165001
1168 Ga0495619_0000260 3300053085 Bacteria 38574
1169 Ga0495619_0000655 3300053085 Bacteria 22730
1170 Ga0495619_0015754 3300053085 Bacteria 4785
1171 Ga0495619_0017989 3300053085 Bacteria 4481
1172 Ga0495619_0024139 3300053085 Bacteria 3899
1173 Ga0495619_0061424 3300053085 Bacteria 2501
1174 Ga0495619_0072372 3300053085 Bacteria 2308
1175 Ga0500643_002725 3300053087 Bacteria 8862
1176 Ga0500644_0000577 3300053088 Bacteria 14139
1177 Ga0500651_0016523 3300053093 Bacteria 4542
1178 Ga0500566_0060690 3300053094 Bacteria 2141
1179 Ga0500641_0018081 3300053096 Bacteria 2646
1180 Ga0500562_032073 3300053108 Bacteria 1387
1181 Ga0500595_000144 3300053119 Bacteria 46478
1182 Ga0500595_082593 3300053119 Bacteria 938
1183 Ga0500652_000016 3300053131 Bacteria 126768
1184 Ga0500652_066720 3300053131 Bacteria 1487
1185 Ga0500588_0070355 3300053146 Bacteria 1146
1186 Ga0500616_0000006 3300053153 Bacteria 944738
1187 Ga0500616_0011270 3300053153 Bacteria 5293
1188 Ga0500627_0124195 3300053158 Bacteria 1165
1189 Ga0500636_0021600 3300053177 Bacteria 3810
1190 Ga0500645_001128 3300053730 Bacteria 14550
1191 Ga0501084_0053053 3300054114 Bacteria 3391
1192 Ga0501084_0072817 3300054114 Bacteria 2878
1193 Ga0501084_0212725 3300054114 Bacteria 1631
1194 Ga0501084_0644990 3300054114 Bacteria 894
1195 Ga0501082_0021751 3300060353 Bacteria 5530
1196 Ga0501082_0147860 3300060353 Bacteria 2040
1197 Ga0501082_0239674 3300060353 Bacteria 1578
1198 Ga0501082_0290502 3300060353 Bacteria 1423
1199 Ga0466962_0099785 3300061719 Bacteria 1394
1200 Ga0530510_0107937 3300061734 Bacteria 2038

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046514 Ga0495618_0104793 Ga0495618_0104793_18_761 241
2 3300048904 Ga0496101_0426633 Ga0496101_0426633_31_786 247
3 3300048905 Ga0496102_0595426 Ga0496102_0595426_238_993 247
4 3300049573 Ga0501037_0438789 Ga0501037_0438789_113_856 247
5 3300053146 Ga0500588_0070355 Ga0500588_0070355_17_814 247
6 3300035116 Ga0373945_0219268 Ga0373945_0219268_32_781 249
7 3300047319 Ga0495674_0103570 Ga0495674_0103570_1652_2401 249
8 3300049571 Ga0501034_0722591 Ga0501034_0722591_20_784 249
9 3300048912 Ga0496109_0834890 Ga0496109_0834890_69_830 253
10 3300048909 Ga0496106_0707599 Ga0496106_0707599_13_780 255
11 3300048918 Ga0496115_0282997 Ga0496115_0282997_11_796 255
12 3300049574 Ga0501038_0597506 Ga0501038_0597506_13_780 255
13 3300046491 Ga0495584_0181726 Ga0495584_0181726_35_862 259
14 3300026089 Ga0207648_10212920 Ga0207648_102129203 260
15 iso_pu_bacteria 2909042592 2909043742 261
16 3300049571 Ga0501034_0251449 Ga0501034_0251449_799_1590 262
17 iso_pu_bacteria 2643221547 2643755536 262
18 iso_pu_bacteria 2643221734 2644735199 262
19 iso_pu_bacteria 2818991467 2819720765 262
20 iso_pu_bacteria 2841911363 2841913180 262
21 iso_pu_bacteria 2841917233 2841918927 262
22 iso_pu_bacteria 2851182111 2851184236 262
23 3300026035 Ga0207703_10008054 Ga0207703_1000805411 263
24 3300005340 Ga0070689_100087747 Ga0070689_1000877473 264
25 3300005354 Ga0070675_100142606 Ga0070675_1001426062 264
26 3300005364 Ga0070673_100377892 Ga0070673_1003778922 264
27 3300005456 Ga0070678_100060421 Ga0070678_1000604214 264
28 3300005458 Ga0070681_10186025 Ga0070681_101860252 264
29 3300006237 Ga0097621_100430511 Ga0097621_1004305112 264
30 3300009177 Ga0105248_10150780 Ga0105248_101507803 264
31 3300010159 Ga0099796_10053133 Ga0099796_100531331 264
32 3300010375 Ga0105239_10404527 Ga0105239_104045271 264
33 3300013306 Ga0163162_10248485 Ga0163162_102484852 264
34 3300014325 Ga0163163_10279272 Ga0163163_102792722 264
35 3300014326 Ga0157380_10357126 Ga0157380_103571261 264
36 3300025893 Ga0207682_10252265 Ga0207682_102522651 264
37 3300025899 Ga0207642_10029564 Ga0207642_100295642 264
38 3300025907 Ga0207645_10146612 Ga0207645_101466121 264
39 3300025912 Ga0207707_10274147 Ga0207707_102741472 264
40 3300025931 Ga0207644_10061366 Ga0207644_100613662 264
41 3300025936 Ga0207670_10053680 Ga0207670_100536802 264
42 3300025938 Ga0207704_10238297 Ga0207704_102382972 264
43 3300025940 Ga0207691_10276461 Ga0207691_102764612 264
44 3300025941 Ga0207711_10011061 Ga0207711_100110618 264
45 3300025972 Ga0207668_10353156 Ga0207668_103531562 264
46 3300026095 Ga0207676_10280307 Ga0207676_102803072 264
47 3300026121 Ga0207683_10107197 Ga0207683_101071972 264
48 3300028380 Ga0268265_10114144 Ga0268265_101141443 264
49 3300035119 Ga0373956_0022257 Ga0373956_0022257_30_836 264
50 3300035691 Ga0373931_0023349 Ga0373931_0023349_492_1286 264
51 3300035695 Ga0373927_0192362 Ga0373927_0192362_133_927 264
52 3300039437 Ga0436365_1224521 Ga0436365_1224521_20_814 264
53 3300048906 Ga0496103_0200932 Ga0496103_0200932_396_1190 264
54 3300048909 Ga0496106_0144759 Ga0496106_0144759_513_1307 264
55 3300048910 Ga0496107_0060839 Ga0496107_0060839_154_948 264
56 3300048911 Ga0496108_0056121 Ga0496108_0056121_1159_1953 264
57 3300048912 Ga0496109_0794210 Ga0496109_0794210_40_834 264
58 3300048915 Ga0496112_0714661 Ga0496112_0714661_71_865 264
59 3300048917 Ga0496114_0017408 Ga0496114_0017408_1614_2408 264
60 3300049568 Ga0501031_0039966 Ga0501031_0039966_129_923 264
61 3300049573 Ga0501037_0294719 Ga0501037_0294719_272_1066 264
62 3300049574 Ga0501038_0390858 Ga0501038_0390858_252_1046 264
63 3300049575 Ga0501039_0119837 Ga0501039_0119837_802_1596 264
64 3300049578 Ga0501042_0084572 Ga0501042_0084572_1204_1998 264
65 3300049581 Ga0501047_0435531 Ga0501047_0435531_96_890 264
66 3300049582 Ga0501048_0374345 Ga0501048_0374345_136_930 264
67 3300049585 Ga0501069_0090888 Ga0501069_0090888_836_1630 264
68 3300049586 Ga0501070_0027861 Ga0501070_0027861_3799_4593 264
69 3300049587 Ga0501071_0279435 Ga0501071_0279435_199_993 264
70 3300049742 Ga0501080_0050861 Ga0501080_0050861_900_1694 264
71 3300049744 Ga0501083_0363135 Ga0501083_0363135_47_841 264
72 3300049823 Ga0501044_0346740 Ga0501044_0346740_14_808 264
73 3300053083 Ga0495655_0015468 Ga0495655_0015468_554_1348 264
74 3300054114 Ga0501084_0053053 Ga0501084_0053053_746_1540 264
75 3300054114 Ga0501084_0644990 Ga0501084_0644990_62_856 264
76 3300060353 Ga0501082_0290502 Ga0501082_0290502_492_1286 264
77 3300005548 Ga0070665_100633126 Ga0070665_1006331262 265
78 3300005981 Ga0081538_10006841 Ga0081538_100068412 265
79 3300006028 Ga0070717_10545487 Ga0070717_105454871 265
80 3300006846 Ga0075430_100074548 Ga0075430_1000745482 265
81 3300006871 Ga0075434_100074508 Ga0075434_1000745082 265
82 3300006914 Ga0075436_100022521 Ga0075436_1000225214 265
83 3300006914 Ga0075436_100090174 Ga0075436_1000901742 265
84 3300009545 Ga0105237_10422057 Ga0105237_104220571 265
85 3300031238 Ga0265332_10006885 Ga0265332_100068854 265
86 3300031247 Ga0265340_10009649 Ga0265340_100096495 265
87 3300031249 Ga0265339_10008527 Ga0265339_100085273 265
88 3300031711 Ga0265314_10022543 Ga0265314_100225436 265
89 3300031712 Ga0265342_10000287 Ga0265342_1000028717 265
90 3300035113 Ga0373936_0106982 Ga0373936_0106982_29_826 265
91 3300035117 Ga0373953_0015593 Ga0373953_0015593_1583_2380 265
92 3300035692 Ga0373935_0107931 Ga0373935_0107931_734_1531 265
93 3300037068 Ga0373925_0042928 Ga0373925_0042928_1655_2452 265
94 3300039437 Ga0436365_1440616 Ga0436365_1440616_110_907 265
95 3300046460 Ga0495638_0005489 Ga0495638_0005489_5187_6038 265
96 3300046477 Ga0495664_0072209 Ga0495664_0072209_815_1675 265
97 3300046642 Ga0495634_0246960 Ga0495634_0246960_38_835 265
98 3300046680 Ga0495646_0242650 Ga0495646_0242650_34_831 265
99 3300046680 Ga0495646_0244079 Ga0495646_0244079_25_885 265
100 3300048913 Ga0496110_0134828 Ga0496110_0134828_1033_1842 265
101 3300048917 Ga0496114_0132574 Ga0496114_0132574_158_967 265
102 3300048918 Ga0496115_0035160 Ga0496115_0035160_32_829 265
103 3300049589 Ga0501073_0271689 Ga0501073_0271689_336_1136 265
104 3300050509 nmdc:mga0qj67_136078_c1 nmdc:mga0qj67_136078_c1_10_807 265
105 3300050510 nmdc:mga06r32_684495_c1 nmdc:mga06r32_684495_c1_61_858 265
106 3300050511 nmdc:mga08y16_437677_c1 nmdc:mga08y16_437677_c1_128_925 265
107 3300050514 nmdc:mga08x19_51336_c1 nmdc:mga08x19_51336_c1_163_960 265
108 3300053108 Ga0500562_032073 Ga0500562_032073_414_1265 265
109 2209111006 2214544913 2213593225 266
110 3300000041 ARcpr5oldR_c000030 ARcpr5oldR_0000308 266
111 3300000042 ARSoilYngRDRAFT_c00022 ARSoilYngRDRAFT_0002222 266
112 3300000043 ARcpr5yngRDRAFT_c000011 ARcpr5yngRDRAFT_00001137 266
113 3300000044 ARSoilOldRDRAFT_c000040 ARSoilOldRDRAFT_00004028 266
114 3300000652 ARCol0yngRDRAFT_1000028 ARCol0yngRDRAFT_10000288 266
115 3300001989 JGI24739J22299_10000164 JGI24739J22299_100001649 266
116 3300001990 JGI24737J22298_10004205 JGI24737J22298_100042052 266
117 3300002070 JGI24750J21931_1000178 JGI24750J21931_10001789 266
118 3300002073 JGI24745J21846_1000640 JGI24745J21846_10006402 266
119 3300002075 JGI24738J21930_10000112 JGI24738J21930_100001125 266
120 3300002126 JGI24035J26624_1000424 JGI24035J26624_10004242 266
121 3300002155 JGI24033J26618_1001840 JGI24033J26618_10018402 266
122 3300003187 JGI25151J46595_10000066 JGI25151J46595_1000006630 266
123 3300003187 JGI25151J46595_10000311 JGI25151J46595_1000031116 266
124 3300003771 Ga0055526_1000051 Ga0055526_1000051132 266
125 3300003775 Ga0055524_1006832 Ga0055524_10068322 266
126 3300005289 Ga0065704_10077858 Ga0065704_100778583 266
127 3300005293 Ga0065715_10001682 Ga0065715_1000168210 266
128 3300005328 Ga0070676_10003775 Ga0070676_100037754 266
129 3300005329 Ga0070683_100000376 Ga0070683_10000037617 266
130 3300005330 Ga0070690_100002745 Ga0070690_1000027459 266
131 3300005330 Ga0070690_100006745 Ga0070690_1000067452 266
132 3300005330 Ga0070690_100008317 Ga0070690_1000083177 266
133 3300005331 Ga0070670_100004417 Ga0070670_10000441712 266
134 3300005331 Ga0070670_100129375 Ga0070670_1001293752 266
135 3300005333 Ga0070677_10000049 Ga0070677_100000499 266
136 3300005333 Ga0070677_10099367 Ga0070677_100993671 266
137 3300005334 Ga0068869_100000523 Ga0068869_1000005236 266
138 3300005335 Ga0070666_10002781 Ga0070666_1000278111 266
139 3300005335 Ga0070666_10279884 Ga0070666_102798841 266
140 3300005336 Ga0070680_100005313 Ga0070680_1000053139 266
141 3300005336 Ga0070680_100036737 Ga0070680_1000367373 266
142 3300005336 Ga0070680_100045410 Ga0070680_1000454102 266
143 3300005336 Ga0070680_100086664 Ga0070680_1000866641 266
144 3300005336 Ga0070680_100400114 Ga0070680_1004001142 266
145 3300005336 Ga0070680_100403209 Ga0070680_1004032092 266
146 3300005337 Ga0070682_100000141 Ga0070682_10000014111 266
147 3300005337 Ga0070682_100010927 Ga0070682_1000109276 266
148 3300005337 Ga0070682_100076162 Ga0070682_1000761623 266
149 3300005337 Ga0070682_100115378 Ga0070682_1001153782 266
150 3300005338 Ga0068868_100009105 Ga0068868_1000091052 266
151 3300005339 Ga0070660_100001073 Ga0070660_10000107317 266
152 3300005339 Ga0070660_100089025 Ga0070660_1000890252 266
153 3300005339 Ga0070660_100130758 Ga0070660_1001307582 266
154 3300005339 Ga0070660_100243176 Ga0070660_1002431763 266
155 3300005340 Ga0070689_100028024 Ga0070689_1000280242 266
156 3300005340 Ga0070689_100081166 Ga0070689_1000811662 266
157 3300005341 Ga0070691_10004687 Ga0070691_100046877 266
158 3300005341 Ga0070691_10020023 Ga0070691_100200234 266
159 3300005343 Ga0070687_100000212 Ga0070687_10000021221 266
160 3300005343 Ga0070687_100088613 Ga0070687_1000886133 266
161 3300005344 Ga0070661_100000242 Ga0070661_10000024238 266
162 3300005345 Ga0070692_10003806 Ga0070692_100038066 266
163 3300005345 Ga0070692_10010557 Ga0070692_100105574 266
164 3300005347 Ga0070668_100003395 Ga0070668_1000033959 266
165 3300005347 Ga0070668_100204842 Ga0070668_1002048422 266
166 3300005353 Ga0070669_100006805 Ga0070669_1000068055 266
167 3300005353 Ga0070669_100147979 Ga0070669_1001479791 266
168 3300005354 Ga0070675_100000165 Ga0070675_10000016527 266
169 3300005354 Ga0070675_100011029 Ga0070675_1000110292 266
170 3300005354 Ga0070675_100169015 Ga0070675_1001690152 266
171 3300005355 Ga0070671_100001907 Ga0070671_10000190710 266
172 3300005355 Ga0070671_100124562 Ga0070671_1001245622 266
173 3300005356 Ga0070674_100000450 Ga0070674_1000004506 266
174 3300005356 Ga0070674_100124608 Ga0070674_1001246082 266
175 3300005364 Ga0070673_100001190 Ga0070673_1000011903 266
176 3300005364 Ga0070673_100269588 Ga0070673_1002695882 266
177 3300005365 Ga0070688_100004815 Ga0070688_1000048157 266
178 3300005365 Ga0070688_100016577 Ga0070688_1000165772 266
179 3300005365 Ga0070688_100035808 Ga0070688_1000358083 266
180 3300005366 Ga0070659_100000988 Ga0070659_10000098819 266
181 3300005366 Ga0070659_100031422 Ga0070659_1000314222 266
182 3300005366 Ga0070659_100070846 Ga0070659_1000708463 266
183 3300005367 Ga0070667_100019884 Ga0070667_1000198842 266
184 3300005367 Ga0070667_100072875 Ga0070667_1000728753 266
185 3300005367 Ga0070667_100095000 Ga0070667_1000950002 266
186 3300005406 Ga0070703_10001274 Ga0070703_100012747 266
187 3300005406 Ga0070703_10015056 Ga0070703_100150562 266
188 3300005434 Ga0070709_10088128 Ga0070709_100881283 266
189 3300005434 Ga0070709_10110858 Ga0070709_101108581 266
190 3300005435 Ga0070714_100036808 Ga0070714_1000368081 266
191 3300005435 Ga0070714_100096255 Ga0070714_1000962551 266
192 3300005435 Ga0070714_100161493 Ga0070714_1001614933 266
193 3300005436 Ga0070713_100007886 Ga0070713_1000078862 266
194 3300005436 Ga0070713_100021911 Ga0070713_1000219112 266
195 3300005436 Ga0070713_100270860 Ga0070713_1002708602 266
196 3300005436 Ga0070713_100586696 Ga0070713_1005866961 266
197 3300005437 Ga0070710_10004737 Ga0070710_100047372 266
198 3300005437 Ga0070710_10020849 Ga0070710_100208492 266
199 3300005437 Ga0070710_10108647 Ga0070710_101086472 266
200 3300005438 Ga0070701_10006218 Ga0070701_100062182 266
201 3300005439 Ga0070711_100016051 Ga0070711_1000160513 266
202 3300005439 Ga0070711_100046246 Ga0070711_1000462462 266
203 3300005439 Ga0070711_100154569 Ga0070711_1001545692 266
204 3300005439 Ga0070711_100223464 Ga0070711_1002234641 266
205 3300005439 Ga0070711_100373822 Ga0070711_1003738222 266
206 3300005440 Ga0070705_100003041 Ga0070705_1000030416 266
207 3300005440 Ga0070705_100015515 Ga0070705_1000155152 266
208 3300005440 Ga0070705_100082775 Ga0070705_1000827752 266
209 3300005441 Ga0070700_100000364 Ga0070700_10000036421 266
210 3300005441 Ga0070700_100012444 Ga0070700_1000124444 266
211 3300005444 Ga0070694_100001077 Ga0070694_1000010776 266
212 3300005444 Ga0070694_100246067 Ga0070694_1002460672 266
213 3300005455 Ga0070663_100000417 Ga0070663_1000004176 266
214 3300005455 Ga0070663_100015967 Ga0070663_1000159672 266
215 3300005455 Ga0070663_100091393 Ga0070663_1000913932 266
216 3300005455 Ga0070663_100111194 Ga0070663_1001111942 266
217 3300005456 Ga0070678_100001012 Ga0070678_10000101216 266
218 3300005456 Ga0070678_100050152 Ga0070678_1000501522 266
219 3300005456 Ga0070678_100418488 Ga0070678_1004184882 266
220 3300005457 Ga0070662_100000796 Ga0070662_10000079617 266
221 3300005457 Ga0070662_100032145 Ga0070662_1000321452 266
222 3300005458 Ga0070681_10002475 Ga0070681_1000247516 266
223 3300005458 Ga0070681_10037631 Ga0070681_100376312 266
224 3300005458 Ga0070681_10049230 Ga0070681_100492302 266
225 3300005458 Ga0070681_10358405 Ga0070681_103584052 266
226 3300005459 Ga0068867_100006779 Ga0068867_1000067792 266
227 3300005466 Ga0070685_10000547 Ga0070685_1000054723 266
228 3300005466 Ga0070685_10060757 Ga0070685_100607573 266
229 3300005467 Ga0070706_100195631 Ga0070706_1001956312 266
230 3300005468 Ga0070707_100308853 Ga0070707_1003088532 266
231 3300005530 Ga0070679_100002268 Ga0070679_1000022689 266
232 3300005530 Ga0070679_100075945 Ga0070679_1000759452 266
233 3300005530 Ga0070679_100089819 Ga0070679_1000898192 266
234 3300005530 Ga0070679_100100033 Ga0070679_1001000331 266
235 3300005530 Ga0070679_100206516 Ga0070679_1002065162 266
236 3300005530 Ga0070679_100327434 Ga0070679_1003274341 266
237 3300005535 Ga0070684_100000755 Ga0070684_1000007556 266
238 3300005535 Ga0070684_100396824 Ga0070684_1003968241 266
239 3300005539 Ga0068853_100000483 Ga0068853_1000004832 266
240 3300005539 Ga0068853_100605614 Ga0068853_1006056141 266
241 3300005539 Ga0068853_100767834 Ga0068853_1007678341 266
242 3300005543 Ga0070672_100000527 Ga0070672_1000005276 266
243 3300005543 Ga0070672_100426835 Ga0070672_1004268351 266
244 3300005543 Ga0070672_100649010 Ga0070672_1006490102 266
245 3300005544 Ga0070686_100004541 Ga0070686_1000045417 266
246 3300005544 Ga0070686_100028407 Ga0070686_1000284073 266
247 3300005545 Ga0070695_100005295 Ga0070695_1000052951 266
248 3300005545 Ga0070695_100016829 Ga0070695_1000168295 266
249 3300005545 Ga0070695_100124151 Ga0070695_1001241512 266
250 3300005545 Ga0070695_100217729 Ga0070695_1002177292 266
251 3300005546 Ga0070696_100004211 Ga0070696_1000042112 266
252 3300005546 Ga0070696_100181293 Ga0070696_1001812933 266
253 3300005547 Ga0070693_100000199 Ga0070693_10000019921 266
254 3300005547 Ga0070693_100042452 Ga0070693_1000424523 266
255 3300005547 Ga0070693_100067261 Ga0070693_1000672614 266
256 3300005549 Ga0070704_100000987 Ga0070704_10000098712 266
257 3300005549 Ga0070704_100116040 Ga0070704_1001160401 266
258 3300005563 Ga0068855_100004444 Ga0068855_10000444417 266
259 3300005563 Ga0068855_100015363 Ga0068855_1000153636 266
260 3300005563 Ga0068855_100054935 Ga0068855_1000549353 266
261 3300005563 Ga0068855_100193345 Ga0068855_1001933452 266
262 3300005564 Ga0070664_100000895 Ga0070664_10000089519 266
263 3300005577 Ga0068857_100001816 Ga0068857_1000018162 266
264 3300005577 Ga0068857_100084708 Ga0068857_1000847083 266
265 3300005578 Ga0068854_100001812 Ga0068854_1000018128 266
266 3300005614 Ga0068856_100002507 Ga0068856_1000025077 266
267 3300005614 Ga0068856_100062535 Ga0068856_1000625351 266
268 3300005614 Ga0068856_100167359 Ga0068856_1001673592 266
269 3300005615 Ga0070702_100005184 Ga0070702_1000051844 266
270 3300005616 Ga0068852_100003253 Ga0068852_1000032538 266
271 3300005617 Ga0068859_100001353 Ga0068859_1000013539 266
272 3300005617 Ga0068859_100221537 Ga0068859_1002215373 266
273 3300005617 Ga0068859_101108608 Ga0068859_1011086081 266
274 3300005618 Ga0068864_100000227 Ga0068864_10000022746 266
275 3300005618 Ga0068864_100082790 Ga0068864_1000827902 266
276 3300005718 Ga0068866_10001093 Ga0068866_1000109313 266
277 3300005719 Ga0068861_100003517 Ga0068861_1000035179 266
278 3300005719 Ga0068861_100115406 Ga0068861_1001154062 266
279 3300005834 Ga0068851_10037270 Ga0068851_100372703 266
280 3300005840 Ga0068870_10000062 Ga0068870_1000006239 266
281 3300005841 Ga0068863_100000495 Ga0068863_10000049540 266
282 3300005842 Ga0068858_100000783 Ga0068858_10000078337 266
283 3300005842 Ga0068858_100112690 Ga0068858_1001126904 266
284 3300005842 Ga0068858_100195456 Ga0068858_1001954562 266
285 3300005843 Ga0068860_100022350 Ga0068860_1000223504 266
286 3300005844 Ga0068862_100003647 Ga0068862_1000036478 266
287 3300005844 Ga0068862_100139944 Ga0068862_1001399441 266
288 3300005937 Ga0081455_10000204 Ga0081455_1000020474 266
289 3300005981 Ga0081538_10005964 Ga0081538_100059648 266
290 3300005983 Ga0081540_1012611 Ga0081540_10126112 266
291 3300005985 Ga0081539_10064755 Ga0081539_100647552 266
292 3300006028 Ga0070717_10011080 Ga0070717_100110802 266
293 3300006028 Ga0070717_10347463 Ga0070717_103474633 266
294 3300006038 Ga0075365_10170226 Ga0075365_101702261 266
295 3300006048 Ga0075363_100065816 Ga0075363_1000658162 266
296 3300006048 Ga0075363_100189473 Ga0075363_1001894731 266
297 3300006051 Ga0075364_10065740 Ga0075364_100657401 266
298 3300006051 Ga0075364_10094181 Ga0075364_100941812 266
299 3300006163 Ga0070715_10004439 Ga0070715_100044393 266
300 3300006163 Ga0070715_10078408 Ga0070715_100784082 266
301 3300006173 Ga0070716_100001496 Ga0070716_1000014967 266
302 3300006173 Ga0070716_100143669 Ga0070716_1001436691 266
303 3300006175 Ga0070712_100088257 Ga0070712_1000882572 266
304 3300006175 Ga0070712_100089481 Ga0070712_1000894812 266
305 3300006175 Ga0070712_100131262 Ga0070712_1001312622 266
306 3300006175 Ga0070712_100287399 Ga0070712_1002873992 266
307 3300006175 Ga0070712_100291413 Ga0070712_1002914132 266
308 3300006175 Ga0070712_100410798 Ga0070712_1004107981 266
309 3300006178 Ga0075367_10123283 Ga0075367_101232831 266
310 3300006178 Ga0075367_10142658 Ga0075367_101426582 266
311 3300006178 Ga0075367_10306648 Ga0075367_103066481 266
312 3300006186 Ga0075369_10026213 Ga0075369_100262132 266
313 3300006186 Ga0075369_10049002 Ga0075369_100490021 266
314 3300006194 Ga0075427_10000244 Ga0075427_100002446 266
315 3300006237 Ga0097621_100000010 Ga0097621_10000001043 266
316 3300006237 Ga0097621_100023529 Ga0097621_1000235292 266
317 3300006353 Ga0075370_10147377 Ga0075370_101473771 266
318 3300006358 Ga0068871_100000034 Ga0068871_10000003428 266
319 3300006358 Ga0068871_100024903 Ga0068871_1000249034 266
320 3300006358 Ga0068871_100247916 Ga0068871_1002479162 266
321 3300006844 Ga0075428_100031223 Ga0075428_1000312232 266
322 3300006844 Ga0075428_100092372 Ga0075428_1000923722 266
323 3300006844 Ga0075428_100391600 Ga0075428_1003916002 266
324 3300006846 Ga0075430_100000342 Ga0075430_1000003423 266
325 3300006846 Ga0075430_100005373 Ga0075430_1000053735 266
326 3300006847 Ga0075431_100000004 Ga0075431_10000000434 266
327 3300006847 Ga0075431_100087697 Ga0075431_1000876972 266
328 3300006847 Ga0075431_100142954 Ga0075431_1001429543 266
329 3300006852 Ga0075433_10000774 Ga0075433_100007748 266
330 3300006852 Ga0075433_10005737 Ga0075433_100057377 266
331 3300006852 Ga0075433_10027741 Ga0075433_100277412 266
332 3300006852 Ga0075433_10076722 Ga0075433_100767222 266
333 3300006871 Ga0075434_100001700 Ga0075434_10000170018 266
334 3300006871 Ga0075434_100003565 Ga0075434_10000356512 266
335 3300006871 Ga0075434_100029000 Ga0075434_1000290004 266
336 3300006871 Ga0075434_100099878 Ga0075434_1000998782 266
337 3300006871 Ga0075434_100330032 Ga0075434_1003300322 266
338 3300006880 Ga0075429_100005048 Ga0075429_1000050482 266
339 3300006880 Ga0075429_100027666 Ga0075429_1000276662 266
340 3300006881 Ga0068865_100000230 Ga0068865_10000023030 266
341 3300006881 Ga0068865_100102449 Ga0068865_1001024492 266
342 3300006881 Ga0068865_100499780 Ga0068865_1004997801 266
343 3300006931 Ga0097620_100001353 Ga0097620_1000013539 266
344 3300006931 Ga0097620_100221535 Ga0097620_1002215353 266
345 3300006931 Ga0097620_101108663 Ga0097620_1011086631 266
346 3300007076 Ga0075435_100001109 Ga0075435_1000011099 266
347 3300007076 Ga0075435_100017628 Ga0075435_1000176287 266
348 3300007076 Ga0075435_100061035 Ga0075435_1000610352 266
349 3300007076 Ga0075435_100142037 Ga0075435_1001420372 266
350 3300007788 Ga0099795_10000444 Ga0099795_100004448 266
351 3300007788 Ga0099795_10017419 Ga0099795_100174193 266
352 3300009011 Ga0105251_10036017 Ga0105251_100360172 266
353 3300009092 Ga0105250_10068496 Ga0105250_100684962 266
354 3300009093 Ga0105240_10067652 Ga0105240_100676523 266
355 3300009093 Ga0105240_10986804 Ga0105240_109868041 266
356 3300009094 Ga0111539_10000932 Ga0111539_1000093218 266
357 3300009094 Ga0111539_10002162 Ga0111539_1000216221 266
358 3300009094 Ga0111539_10011144 Ga0111539_1001114411 266
359 3300009094 Ga0111539_10398766 Ga0111539_103987662 266
360 3300009094 Ga0111539_10506499 Ga0111539_105064991 266
361 3300009098 Ga0105245_10000258 Ga0105245_1000025832 266
362 3300009098 Ga0105245_10446687 Ga0105245_104466872 266
363 3300009098 Ga0105245_10654400 Ga0105245_106544001 266
364 3300009101 Ga0105247_10015208 Ga0105247_100152083 266
365 3300009101 Ga0105247_10182766 Ga0105247_101827662 266
366 3300009147 Ga0114129_10000582 Ga0114129_1000058237 266
367 3300009147 Ga0114129_10004796 Ga0114129_100047962 266
368 3300009147 Ga0114129_10009608 Ga0114129_1000960811 266
369 3300009147 Ga0114129_10032724 Ga0114129_100327242 266
370 3300009148 Ga0105243_10000846 Ga0105243_1000084617 266
371 3300009148 Ga0105243_10014969 Ga0105243_100149694 266
372 3300009148 Ga0105243_10023951 Ga0105243_100239516 266
373 3300009174 Ga0105241_10001369 Ga0105241_100013692 266
374 3300009174 Ga0105241_10044576 Ga0105241_100445762 266
375 3300009174 Ga0105241_10168621 Ga0105241_101686211 266
376 3300009176 Ga0105242_10000037 Ga0105242_1000003761 266
377 3300009176 Ga0105242_10033883 Ga0105242_100338834 266
378 3300009177 Ga0105248_10000744 Ga0105248_1000074416 266
379 3300009545 Ga0105237_10020951 Ga0105237_100209516 266
380 3300009545 Ga0105237_10112148 Ga0105237_101121483 266
381 3300009551 Ga0105238_10066539 Ga0105238_100665394 266
382 3300009551 Ga0105238_10183495 Ga0105238_101834952 266
383 3300009553 Ga0105249_10000209 Ga0105249_1000020952 266
384 3300009553 Ga0105249_10221168 Ga0105249_102211682 266
385 3300009553 Ga0105249_10401041 Ga0105249_104010412 266
386 3300009553 Ga0105249_10558907 Ga0105249_105589071 266
387 3300010159 Ga0099796_10024285 Ga0099796_100242852 266
388 3300010375 Ga0105239_10001464 Ga0105239_1000146416 266
389 3300010375 Ga0105239_10096125 Ga0105239_100961254 266
390 3300010375 Ga0105239_10179287 Ga0105239_101792872 266
391 3300010375 Ga0105239_10306104 Ga0105239_103061042 266
392 3300011119 Ga0105246_10026773 Ga0105246_100267732 266
393 3300011119 Ga0105246_10256985 Ga0105246_102569851 266
394 3300012492 Ga0157335_1001705 Ga0157335_10017051 266
395 3300012495 Ga0157323_1001249 Ga0157323_10012492 266
396 3300012502 Ga0157347_1003799 Ga0157347_10037991 266
397 3300012510 Ga0157316_1000114 Ga0157316_10001142 266
398 3300012512 Ga0157327_1003099 Ga0157327_10030993 266
399 3300013100 Ga0157373_10122811 Ga0157373_101228112 266
400 3300013296 Ga0157374_10000940 Ga0157374_100009402 266
401 3300013296 Ga0157374_10053270 Ga0157374_100532702 266
402 3300013297 Ga0157378_10001580 Ga0157378_1000158012 266
403 3300013297 Ga0157378_10364978 Ga0157378_103649782 266
404 3300013297 Ga0157378_10832455 Ga0157378_108324551 266
405 3300013306 Ga0163162_10001677 Ga0163162_100016776 266
406 3300013306 Ga0163162_10009932 Ga0163162_1000993210 266
407 3300013306 Ga0163162_10181453 Ga0163162_101814532 266
408 3300013306 Ga0163162_10426580 Ga0163162_104265802 266
409 3300013307 Ga0157372_10109839 Ga0157372_101098392 266
410 3300013307 Ga0157372_10120543 Ga0157372_101205432 266
411 3300013307 Ga0157372_10136646 Ga0157372_101366462 266
412 3300013307 Ga0157372_10432571 Ga0157372_104325712 266
413 3300013308 Ga0157375_10000263 Ga0157375_1000026356 266
414 3300013308 Ga0157375_10368869 Ga0157375_103688693 266
415 3300013308 Ga0157375_10443267 Ga0157375_104432671 266
416 3300014325 Ga0163163_10010830 Ga0163163_100108302 266
417 3300014325 Ga0163163_10019201 Ga0163163_100192015 266
418 3300014326 Ga0157380_10000294 Ga0157380_1000029421 266
419 3300014326 Ga0157380_10256788 Ga0157380_102567882 266
420 3300014745 Ga0157377_10001222 Ga0157377_1000122212 266
421 3300014968 Ga0157379_10002453 Ga0157379_1000245317 266
422 3300014968 Ga0157379_10027532 Ga0157379_100275322 266
423 3300014969 Ga0157376_10000342 Ga0157376_1000034218 266
424 3300014969 Ga0157376_10036312 Ga0157376_100363123 266
425 3300014969 Ga0157376_10537685 Ga0157376_105376851 266
426 3300017792 Ga0163161_10000523 Ga0163161_1000052324 266
427 3300017792 Ga0163161_10089663 Ga0163161_100896632 266
428 3300020070 Ga0206356_11304508 Ga0206356_113045082 266
429 3300020082 Ga0206353_11340620 Ga0206353_113406201 266
430 3300021358 Ga0213873_10003810 Ga0213873_100038102 266
431 3300021384 Ga0213876_10008326 Ga0213876_100083263 266
432 3300021384 Ga0213876_10033853 Ga0213876_100338532 266
433 3300021384 Ga0213876_10035248 Ga0213876_100352482 266
434 3300021388 Ga0213875_10000825 Ga0213875_100008252 266
435 3300021388 Ga0213875_10002635 Ga0213875_100026353 266
436 3300021388 Ga0213875_10105892 Ga0213875_101058922 266
437 3300024225 Ga0224572_1007436 Ga0224572_10074363 266
438 3300024227 Ga0228598_1016262 Ga0228598_10162622 266
439 3300025271 Ga0207666_1000010 Ga0207666_10000106 266
440 3300025271 Ga0207666_1001035 Ga0207666_10010352 266
441 3300025290 Ga0207673_1000164 Ga0207673_10001647 266
442 3300025294 Ga0209025_1000008 Ga0209025_10000081002 266
443 3300025295 Ga0209564_1000054 Ga0209564_1000054218 266
444 3300025299 Ga0209256_1000084 Ga0209256_1000084106 266
445 3300025315 Ga0207697_10000186 Ga0207697_1000018632 266
446 3300025315 Ga0207697_10023457 Ga0207697_100234573 266
447 3300025885 Ga0207653_10008164 Ga0207653_100081642 266
448 3300025893 Ga0207682_10000123 Ga0207682_1000012324 266
449 3300025898 Ga0207692_10016864 Ga0207692_100168642 266
450 3300025899 Ga0207642_10000263 Ga0207642_1000026311 266
451 3300025900 Ga0207710_10011053 Ga0207710_100110532 266
452 3300025901 Ga0207688_10000889 Ga0207688_100008892 266
453 3300025901 Ga0207688_10056265 Ga0207688_100562653 266
454 3300025903 Ga0207680_10001117 Ga0207680_1000111715 266
455 3300025904 Ga0207647_10005506 Ga0207647_1000550611 266
456 3300025904 Ga0207647_10046296 Ga0207647_100462962 266
457 3300025905 Ga0207685_10001241 Ga0207685_100012412 266
458 3300025905 Ga0207685_10061083 Ga0207685_100610832 266
459 3300025906 Ga0207699_10030475 Ga0207699_100304752 266
460 3300025906 Ga0207699_10033740 Ga0207699_100337402 266
461 3300025907 Ga0207645_10000023 Ga0207645_1000002330 266
462 3300025907 Ga0207645_10020930 Ga0207645_100209303 266
463 3300025907 Ga0207645_10051083 Ga0207645_100510833 266
464 3300025908 Ga0207643_10000007 Ga0207643_1000000721 266
465 3300025909 Ga0207705_10343463 Ga0207705_103434632 266
466 3300025910 Ga0207684_10377781 Ga0207684_103777812 266
467 3300025911 Ga0207654_10020224 Ga0207654_100202242 266
468 3300025912 Ga0207707_10002015 Ga0207707_1000201515 266
469 3300025912 Ga0207707_10056334 Ga0207707_100563342 266
470 3300025912 Ga0207707_10094416 Ga0207707_100944164 266
471 3300025912 Ga0207707_10112364 Ga0207707_101123642 266
472 3300025914 Ga0207671_10008841 Ga0207671_100088416 266
473 3300025914 Ga0207671_10224341 Ga0207671_102243412 266
474 3300025915 Ga0207693_10012859 Ga0207693_100128598 266
475 3300025915 Ga0207693_10026757 Ga0207693_100267572 266
476 3300025915 Ga0207693_10106248 Ga0207693_101062482 266
477 3300025916 Ga0207663_10004450 Ga0207663_100044503 266
478 3300025916 Ga0207663_10040066 Ga0207663_100400665 266
479 3300025917 Ga0207660_10000393 Ga0207660_1000039312 266
480 3300025917 Ga0207660_10005747 Ga0207660_100057477 266
481 3300025917 Ga0207660_10319859 Ga0207660_103198592 266
482 3300025918 Ga0207662_10000136 Ga0207662_1000013638 266
483 3300025918 Ga0207662_10011289 Ga0207662_100112893 266
484 3300025919 Ga0207657_10004997 Ga0207657_1000499713 266
485 3300025919 Ga0207657_10005004 Ga0207657_100050044 266
486 3300025919 Ga0207657_10036159 Ga0207657_100361593 266
487 3300025919 Ga0207657_10055737 Ga0207657_100557372 266
488 3300025919 Ga0207657_10126241 Ga0207657_101262412 266
489 3300025920 Ga0207649_10000434 Ga0207649_1000043418 266
490 3300025920 Ga0207649_10045166 Ga0207649_100451663 266
491 3300025921 Ga0207652_10001720 Ga0207652_1000172018 266
492 3300025921 Ga0207652_10016915 Ga0207652_100169156 266
493 3300025921 Ga0207652_10073555 Ga0207652_100735552 266
494 3300025921 Ga0207652_10119473 Ga0207652_101194732 266
495 3300025921 Ga0207652_10208954 Ga0207652_102089542 266
496 3300025921 Ga0207652_10293503 Ga0207652_102935031 266
497 3300025921 Ga0207652_10396771 Ga0207652_103967711 266
498 3300025923 Ga0207681_10000273 Ga0207681_1000027324 266
499 3300025924 Ga0207694_10052606 Ga0207694_100526064 266
500 3300025925 Ga0207650_10001932 Ga0207650_1000193215 266
501 3300025926 Ga0207659_10000097 Ga0207659_1000009732 266
502 3300025926 Ga0207659_10347128 Ga0207659_103471281 266
503 3300025927 Ga0207687_10001031 Ga0207687_1000103115 266
504 3300025927 Ga0207687_10028160 Ga0207687_100281602 266
505 3300025927 Ga0207687_10443508 Ga0207687_104435081 266
506 3300025928 Ga0207700_10000167 Ga0207700_1000016710 266
507 3300025928 Ga0207700_10165040 Ga0207700_101650402 266
508 3300025928 Ga0207700_10449947 Ga0207700_104499472 266
509 3300025929 Ga0207664_10235393 Ga0207664_102353932 266
510 3300025929 Ga0207664_10241893 Ga0207664_102418932 266
511 3300025931 Ga0207644_10001738 Ga0207644_1000173810 266
512 3300025931 Ga0207644_10113559 Ga0207644_101135592 266
513 3300025932 Ga0207690_10000962 Ga0207690_100009622 266
514 3300025932 Ga0207690_10148791 Ga0207690_101487911 266
515 3300025933 Ga0207706_10000867 Ga0207706_1000086730 266
516 3300025933 Ga0207706_10017224 Ga0207706_100172248 266
517 3300025933 Ga0207706_10021114 Ga0207706_100211147 266
518 3300025933 Ga0207706_10036344 Ga0207706_100363442 266
519 3300025934 Ga0207686_10000329 Ga0207686_1000032935 266
520 3300025934 Ga0207686_10076863 Ga0207686_100768632 266
521 3300025935 Ga0207709_10000419 Ga0207709_100004198 266
522 3300025935 Ga0207709_10045024 Ga0207709_100450242 266
523 3300025935 Ga0207709_10101156 Ga0207709_101011562 266
524 3300025936 Ga0207670_10000536 Ga0207670_1000053621 266
525 3300025936 Ga0207670_10057775 Ga0207670_100577752 266
526 3300025937 Ga0207669_10002798 Ga0207669_100027982 266
527 3300025937 Ga0207669_10073675 Ga0207669_100736752 266
528 3300025938 Ga0207704_10000599 Ga0207704_1000059917 266
529 3300025939 Ga0207665_10000417 Ga0207665_1000041721 266
530 3300025939 Ga0207665_10087336 Ga0207665_100873363 266
531 3300025939 Ga0207665_10181293 Ga0207665_101812932 266
532 3300025940 Ga0207691_10000544 Ga0207691_100005446 266
533 3300025940 Ga0207691_10023702 Ga0207691_100237022 266
534 3300025940 Ga0207691_10170474 Ga0207691_101704741 266
535 3300025941 Ga0207711_10002468 Ga0207711_1000246818 266
536 3300025942 Ga0207689_10001743 Ga0207689_1000174318 266
537 3300025944 Ga0207661_10000428 Ga0207661_1000042824 266
538 3300025944 Ga0207661_10190004 Ga0207661_101900042 266
539 3300025944 Ga0207661_10444628 Ga0207661_104446281 266
540 3300025945 Ga0207679_10000029 Ga0207679_10000029177 266
541 3300025945 Ga0207679_10294834 Ga0207679_102948341 266
542 3300025949 Ga0207667_10017999 Ga0207667_100179997 266
543 3300025949 Ga0207667_10099408 Ga0207667_100994082 266
544 3300025949 Ga0207667_10162685 Ga0207667_101626852 266
545 3300025960 Ga0207651_10000083 Ga0207651_1000008322 266
546 3300025960 Ga0207651_10153671 Ga0207651_101536712 266
547 3300025960 Ga0207651_10169369 Ga0207651_101693692 266
548 3300025961 Ga0207712_10000471 Ga0207712_1000047118 266
549 3300025972 Ga0207668_10278102 Ga0207668_102781023 266
550 3300025972 Ga0207668_10547276 Ga0207668_105472762 266
551 3300025981 Ga0207640_10000637 Ga0207640_1000063716 266
552 3300025986 Ga0207658_10002203 Ga0207658_100022032 266
553 3300025986 Ga0207658_10041282 Ga0207658_100412822 266
554 3300025986 Ga0207658_10041634 Ga0207658_100416342 266
555 3300026023 Ga0207677_10000992 Ga0207677_1000099217 266
556 3300026035 Ga0207703_10005165 Ga0207703_100051655 266
557 3300026035 Ga0207703_10044170 Ga0207703_100441702 266
558 3300026041 Ga0207639_10005126 Ga0207639_100051268 266
559 3300026041 Ga0207639_10196984 Ga0207639_101969842 266
560 3300026067 Ga0207678_10001568 Ga0207678_1000156821 266
561 3300026067 Ga0207678_10021304 Ga0207678_100213047 266
562 3300026067 Ga0207678_10029617 Ga0207678_100296175 266
563 3300026067 Ga0207678_10055746 Ga0207678_100557462 266
564 3300026075 Ga0207708_10002060 Ga0207708_100020606 266
565 3300026075 Ga0207708_10005462 Ga0207708_100054626 266
566 3300026075 Ga0207708_10017276 Ga0207708_100172764 266
567 3300026078 Ga0207702_10001921 Ga0207702_1000192116 266
568 3300026078 Ga0207702_10080985 Ga0207702_100809851 266
569 3300026078 Ga0207702_10148084 Ga0207702_101480842 266
570 3300026078 Ga0207702_10399832 Ga0207702_103998322 266
571 3300026078 Ga0207702_10441331 Ga0207702_104413312 266
572 3300026088 Ga0207641_10000510 Ga0207641_1000051021 266
573 3300026088 Ga0207641_10055508 Ga0207641_100555082 266
574 3300026088 Ga0207641_10105109 Ga0207641_101051092 266
575 3300026088 Ga0207641_10556277 Ga0207641_105562771 266
576 3300026089 Ga0207648_10003487 Ga0207648_100034877 266
577 3300026089 Ga0207648_10107529 Ga0207648_101075293 266
578 3300026089 Ga0207648_10132084 Ga0207648_101320842 266
579 3300026095 Ga0207676_10003788 Ga0207676_1000378812 266
580 3300026095 Ga0207676_10028269 Ga0207676_100282694 266
581 3300026116 Ga0207674_10000608 Ga0207674_100006086 266
582 3300026116 Ga0207674_10141868 Ga0207674_101418682 266
583 3300026118 Ga0207675_100000805 Ga0207675_1000008056 266
584 3300026118 Ga0207675_100026921 Ga0207675_1000269212 266
585 3300026118 Ga0207675_100255789 Ga0207675_1002557891 266
586 3300026121 Ga0207683_10000082 Ga0207683_1000008244 266
587 3300026121 Ga0207683_10006710 Ga0207683_100067104 266
588 3300026121 Ga0207683_10136999 Ga0207683_101369992 266
589 3300026142 Ga0207698_10000377 Ga0207698_1000037713 266
590 3300027695 Ga0209966_1001565 Ga0209966_10015655 266
591 3300027717 Ga0209998_10000947 Ga0209998_100009475 266
592 3300027717 Ga0209998_10007515 Ga0209998_100075152 266
593 3300027907 Ga0207428_10000124 Ga0207428_1000012482 266
594 3300027907 Ga0207428_10000420 Ga0207428_1000042029 266
595 3300027907 Ga0207428_10000703 Ga0207428_1000070327 266
596 3300028379 Ga0268266_10481125 Ga0268266_104811251 266
597 3300028380 Ga0268265_10001170 Ga0268265_100011708 266
598 3300028380 Ga0268265_10017735 Ga0268265_100177353 266
599 3300028381 Ga0268264_10001878 Ga0268264_100018786 266
600 3300028381 Ga0268264_10047711 Ga0268264_100477113 266
601 3300028577 Ga0265318_10089108 Ga0265318_100891082 266
602 3300028800 Ga0265338_10049901 Ga0265338_100499012 266
603 3300028800 Ga0265338_10057435 Ga0265338_100574352 266
604 3300028800 Ga0265338_10060308 Ga0265338_100603083 266
605 3300028800 Ga0265338_10212403 Ga0265338_102124032 266
606 3300031235 Ga0265330_10044496 Ga0265330_100444963 266
607 3300031241 Ga0265325_10000105 Ga0265325_1000010556 266
608 3300031241 Ga0265325_10005333 Ga0265325_100053339 266
609 3300031241 Ga0265325_10045207 Ga0265325_100452072 266
610 3300031241 Ga0265325_10076800 Ga0265325_100768002 266
611 3300031241 Ga0265325_10077344 Ga0265325_100773442 266
612 3300031241 Ga0265325_10083128 Ga0265325_100831282 266
613 3300031241 Ga0265325_10111979 Ga0265325_101119792 266
614 3300031247 Ga0265340_10013695 Ga0265340_100136953 266
615 3300031247 Ga0265340_10134342 Ga0265340_101343422 266
616 3300031249 Ga0265339_10000071 Ga0265339_100000713 266
617 3300031249 Ga0265339_10012221 Ga0265339_100122215 266
618 3300031250 Ga0265331_10048341 Ga0265331_100483412 266
619 3300031344 Ga0265316_10054466 Ga0265316_100544664 266
620 3300031595 Ga0265313_10000041 Ga0265313_1000004151 266
621 3300031595 Ga0265313_10000123 Ga0265313_1000012338 266
622 3300031595 Ga0265313_10012778 Ga0265313_100127782 266
623 3300031595 Ga0265313_10024353 Ga0265313_100243532 266
624 3300031595 Ga0265313_10024680 Ga0265313_100246802 266
625 3300031711 Ga0265314_10000279 Ga0265314_1000027947 266
626 3300031711 Ga0265314_10017694 Ga0265314_100176942 266
627 3300031711 Ga0265314_10085557 Ga0265314_100855571 266
628 3300031712 Ga0265342_10001077 Ga0265342_1000107723 266
629 3300031712 Ga0265342_10070433 Ga0265342_100704332 266
630 3300032133 Ga0316583_10003152 Ga0316583_100031524 266
631 3300034816 Ga0373930_0000680 Ga0373930_0000680_3150_3950 266
632 3300034816 Ga0373930_0014455 Ga0373930_0014455_179_979 266
633 3300034817 Ga0373948_0000196 Ga0373948_0000196_3178_3978 266
634 3300034817 Ga0373948_0000995 Ga0373948_0000995_2757_3557 266
635 3300034818 Ga0373950_0002735 Ga0373950_0002735_592_1392 266
636 3300034818 Ga0373950_0005433 Ga0373950_0005433_233_1075 266
637 3300034819 Ga0373958_0002069 Ga0373958_0002069_823_1623 266
638 3300034957 Ga0373938_0000092 Ga0373938_0000092_741_1541 266
639 3300034957 Ga0373938_0003487 Ga0373938_0003487_261_1061 266
640 3300035083 Ga0373926_0041110 Ga0373926_0041110_766_1566 266
641 3300035084 Ga0373928_0005526 Ga0373928_0005526_90_890 266
642 3300035084 Ga0373928_0014169 Ga0373928_0014169_222_1064 266
643 3300035085 Ga0373929_0000128 Ga0373929_0000128_5810_6610 266
644 3300035085 Ga0373929_0027650 Ga0373929_0027650_106_906 266
645 3300035089 Ga0373944_0002646 Ga0373944_0002646_3160_3960 266
646 3300035089 Ga0373944_0033163 Ga0373944_0033163_601_1401 266
647 3300035089 Ga0373944_0058012 Ga0373944_0058012_29_829 266
648 3300035090 Ga0373949_0000715 Ga0373949_0000715_4644_5486 266
649 3300035091 Ga0373951_0000531 Ga0373951_0000531_8351_9151 266
650 3300035091 Ga0373951_0003670 Ga0373951_0003670_1784_2584 266
651 3300035091 Ga0373951_0011160 Ga0373951_0011160_240_1082 266
652 3300035091 Ga0373951_0019087 Ga0373951_0019087_173_973 266
653 3300035092 Ga0373952_0006526 Ga0373952_0006526_321_1163 266
654 3300035111 Ga0373923_0002485 Ga0373923_0002485_2798_3598 266
655 3300035112 Ga0373932_0000076 Ga0373932_0000076_153_953 266
656 3300035112 Ga0373932_0000597 Ga0373932_0000597_6334_7176 266
657 3300035112 Ga0373932_0002240 Ga0373932_0002240_1433_2233 266
658 3300035113 Ga0373936_0000549 Ga0373936_0000549_1133_1966 266
659 3300035113 Ga0373936_0007526 Ga0373936_0007526_626_1426 266
660 3300035114 Ga0373939_0000361 Ga0373939_0000361_4719_5561 266
661 3300035114 Ga0373939_0000377 Ga0373939_0000377_5131_5931 266
662 3300035114 Ga0373939_0004881 Ga0373939_0004881_1738_2538 266
663 3300035114 Ga0373939_0016420 Ga0373939_0016420_10_810 266
664 3300035114 Ga0373939_0067916 Ga0373939_0067916_68_898 266
665 3300035115 Ga0373941_0000785 Ga0373941_0000785_5392_6192 266
666 3300035115 Ga0373941_0020117 Ga0373941_0020117_267_1109 266
667 3300035116 Ga0373945_0001243 Ga0373945_0001243_4011_4811 266
668 3300035116 Ga0373945_0017475 Ga0373945_0017475_1415_2248 266
669 3300035116 Ga0373945_0085606 Ga0373945_0085606_179_979 266
670 3300035117 Ga0373953_0003524 Ga0373953_0003524_2103_2936 266
671 3300035117 Ga0373953_0003611 Ga0373953_0003611_3775_4575 266
672 3300035118 Ga0373954_0002142 Ga0373954_0002142_2890_3723 266
673 3300035118 Ga0373954_0006240 Ga0373954_0006240_3842_4642 266
674 3300035118 Ga0373954_0026910 Ga0373954_0026910_139_939 266
675 3300035118 Ga0373954_0058317 Ga0373954_0058317_613_1413 266
676 3300035119 Ga0373956_0017526 Ga0373956_0017526_2189_2989 266
677 3300035119 Ga0373956_0088184 Ga0373956_0088184_141_941 266
678 3300035120 Ga0373957_0020017 Ga0373957_0020017_1319_2152 266
679 3300035120 Ga0373957_0092184 Ga0373957_0092184_177_977 266
680 3300035121 Ga0373960_0000204 Ga0373960_0000204_4913_5713 266
681 3300035121 Ga0373960_0001684 Ga0373960_0001684_2629_3471 266
682 3300035170 Ga0373943_0001090 Ga0373943_0001090_10448_11281 266
683 3300035170 Ga0373943_0003538 Ga0373943_0003538_3041_3841 266
684 3300035170 Ga0373943_0010676 Ga0373943_0010676_2212_3012 266
685 3300035170 Ga0373943_0034932 Ga0373943_0034932_363_1163 266
686 3300035170 Ga0373943_0089584 Ga0373943_0089584_631_1431 266
687 3300035171 Ga0373946_0000383 Ga0373946_0000383_11945_12778 266
688 3300035171 Ga0373946_0003985 Ga0373946_0003985_4192_4992 266
689 3300035171 Ga0373946_0069708 Ga0373946_0069708_586_1386 266
690 3300035172 Ga0373955_0007092 Ga0373955_0007092_2754_3554 266
691 3300035172 Ga0373955_0018458 Ga0373955_0018458_2333_3133 266
692 3300035172 Ga0373955_0035405 Ga0373955_0035405_1172_1972 266
693 3300035172 Ga0373955_0052349 Ga0373955_0052349_426_1226 266
694 3300035207 Ga0373942_0000813 Ga0373942_0000813_3069_3869 266
695 3300035207 Ga0373942_0002869 Ga0373942_0002869_801_1643 266
696 3300035207 Ga0373942_0005195 Ga0373942_0005195_622_1422 266
697 3300035241 Ga0373961_0001827 Ga0373961_0001827_2390_3190 266
698 3300035410 Ga0373924_0000144 Ga0373924_0000144_16271_17104 266
699 3300035410 Ga0373924_0016721 Ga0373924_0016721_1441_2241 266
700 3300035410 Ga0373924_0017856 Ga0373924_0017856_1016_1816 266
701 3300035410 Ga0373924_0074497 Ga0373924_0074497_224_1024 266
702 3300035410 Ga0373924_0078058 Ga0373924_0078058_231_1031 266
703 3300035410 Ga0373924_0181907 Ga0373924_0181907_44_844 266
704 3300035691 Ga0373931_0000186 Ga0373931_0000186_11908_12750 266
705 3300035691 Ga0373931_0002333 Ga0373931_0002333_5756_6556 266
706 3300035691 Ga0373931_0037528 Ga0373931_0037528_894_1694 266
707 3300035692 Ga0373935_0000012 Ga0373935_0000012_38897_39730 266
708 3300035692 Ga0373935_0016872 Ga0373935_0016872_3376_4176 266
709 3300035692 Ga0373935_0067952 Ga0373935_0067952_1404_2204 266
710 3300035692 Ga0373935_0445773 Ga0373935_0445773_109_909 266
711 3300035695 Ga0373927_0015740 Ga0373927_0015740_3767_4600 266
712 3300035695 Ga0373927_0023216 Ga0373927_0023216_598_1398 266
713 3300035695 Ga0373927_0063603 Ga0373927_0063603_729_1529 266
714 3300035724 Ga0373933_0004023 Ga0373933_0004023_6800_7600 266
715 3300035724 Ga0373933_0035272 Ga0373933_0035272_1003_1836 266
716 3300035724 Ga0373933_0072189 Ga0373933_0072189_509_1309 266
717 3300035725 Ga0373947_0000380 Ga0373947_0000380_7461_8294 266
718 3300035725 Ga0373947_0004569 Ga0373947_0004569_749_1549 266
719 3300035725 Ga0373947_0021639 Ga0373947_0021639_2135_2935 266
720 3300035725 Ga0373947_0025874 Ga0373947_0025874_2203_3036 266
721 3300035725 Ga0373947_0033626 Ga0373947_0033626_687_1487 266
722 3300035725 Ga0373947_0035530 Ga0373947_0035530_89_889 266
723 3300035725 Ga0373947_0055936 Ga0373947_0055936_1290_2090 266
724 3300036401 Ga0373937_0000054 Ga0373937_0000054_27923_28756 266
725 3300036401 Ga0373937_0009657 Ga0373937_0009657_3003_3803 266
726 3300036401 Ga0373937_0020252 Ga0373937_0020252_1174_1974 266
727 3300036401 Ga0373937_0025502 Ga0373937_0025502_3883_4683 266
728 3300037068 Ga0373925_0000018 Ga0373925_0000018_105462_106295 266
729 3300037068 Ga0373925_0005307 Ga0373925_0005307_970_1770 266
730 3300037068 Ga0373925_0010134 Ga0373925_0010134_3041_3841 266
731 3300037068 Ga0373925_0038959 Ga0373925_0038959_376_1191 266
732 3300037068 Ga0373925_0058062 Ga0373925_0058062_1234_2034 266
733 3300037068 Ga0373925_0182199 Ga0373925_0182199_135_935 266
734 3300037312 Ga0395899_0016580 Ga0395899_0016580_3254_4054 266
735 3300037312 Ga0395899_0167027 Ga0395899_0167027_335_1135 266
736 3300037418 Ga0395900_0003491 Ga0395900_0003491_5451_6251 266
737 3300037418 Ga0395900_0116374 Ga0395900_0116374_345_1145 266
738 3300037466 Ga0395898_0002609 Ga0395898_0002609_1181_1981 266
739 3300037466 Ga0395898_0014973 Ga0395898_0014973_4516_5316 266
740 3300037466 Ga0395898_0214886 Ga0395898_0214886_501_1301 266
741 3300037853 Ga0436364_0127012 Ga0436364_0127012_7880_8683 266
742 3300037853 Ga0436364_0475448 Ga0436364_0475448_13303_14103 266
743 3300037853 Ga0436364_0587111 Ga0436364_0587111_370_1188 266
744 3300037853 Ga0436364_1484132 Ga0436364_1484132_46_846 266
745 3300038443 Ga0395901_0005021 Ga0395901_0005021_11812_12612 266
746 3300038443 Ga0395901_0026799 Ga0395901_0026799_1193_1993 266
747 3300038443 Ga0395901_0281139 Ga0395901_0281139_116_916 266
748 3300039437 Ga0436365_0276383 Ga0436365_0276383_9886_10689 266
749 3300039437 Ga0436365_0676411 Ga0436365_0676411_300_1103 266
750 3300039437 Ga0436365_0823677 Ga0436365_0823677_997_1797 266
751 3300039437 Ga0436365_1193963 Ga0436365_1193963_5554_6357 266
752 3300039437 Ga0436365_1657521 Ga0436365_1657521_5210_6028 266
753 3300039450 Ga0436363_0190862 Ga0436363_0190862_3612_4415 266
754 3300039453 Ga0436362_0536014 Ga0436362_0536014_4542_5345 266
755 3300041408 Ga0439453_0000510 Ga0439453_0000510_2391_3215 266
756 3300042003 Ga0439443_000600 Ga0439443_000600_814_1638 266
757 3300042005 Ga0439448_0026308 Ga0439448_0026308_501_1301 266
758 3300042461 Ga0439460_0018303 Ga0439460_0018303_846_1670 266
759 3300044693 Ga0466961_0267115 Ga0466961_0267115_92_892 266
760 3300044694 Ga0466963_0044582 Ga0466963_0044582_1483_2283 266
761 3300044712 Ga0453684_0066809 Ga0453684_0066809_1439_2239 266
762 3300044719 Ga0466971_0046483 Ga0466971_0046483_1131_1931 266
763 3300045051 Ga0451576_0039893 Ga0451576_0039893_4158_4958 266
764 3300045976 Ga0466967_0020740 Ga0466967_0020740_3444_4244 266
765 3300046452 Ga0495617_022581 Ga0495617_022581_1077_1877 266
766 3300046454 Ga0495592_0000001 Ga0495592_0000001_102103_102936 266
767 3300046454 Ga0495592_0001116 Ga0495592_0001116_12197_12997 266
768 3300046454 Ga0495592_0009742 Ga0495592_0009742_1626_2426 266
769 3300046454 Ga0495592_0057294 Ga0495592_0057294_876_1676 266
770 3300046455 Ga0495603_0012962 Ga0495603_0012962_936_1736 266
771 3300046455 Ga0495603_0096859 Ga0495603_0096859_460_1260 266
772 3300046459 Ga0495629_0004546 Ga0495629_0004546_6823_7656 266
773 3300046459 Ga0495629_0016112 Ga0495629_0016112_127_927 266
774 3300046459 Ga0495629_0024439 Ga0495629_0024439_2121_2921 266
775 3300046461 Ga0495641_0023574 Ga0495641_0023574_1329_2129 266
776 3300046461 Ga0495641_0031793 Ga0495641_0031793_1662_2462 266
777 3300046461 Ga0495641_0078967 Ga0495641_0078967_490_1290 266
778 3300046462 Ga0495651_0000493 Ga0495651_0000493_21895_22695 266
779 3300046462 Ga0495651_0002120 Ga0495651_0002120_7423_8256 266
780 3300046462 Ga0495651_0016283 Ga0495651_0016283_4042_4842 266
781 3300046462 Ga0495651_0098480 Ga0495651_0098480_966_1766 266
782 3300046462 Ga0495651_0174169 Ga0495651_0174169_57_857 266
783 3300046462 Ga0495651_0233214 Ga0495651_0233214_207_1025 266
784 3300046463 Ga0495653_0000292 Ga0495653_0000292_35928_36761 266
785 3300046463 Ga0495653_0004657 Ga0495653_0004657_2653_3453 266
786 3300046463 Ga0495653_0012444 Ga0495653_0012444_3723_4523 266
787 3300046463 Ga0495653_0041839 Ga0495653_0041839_2484_3284 266
788 3300046472 Ga0495580_0022745 Ga0495580_0022745_3175_3975 266
789 3300046472 Ga0495580_0135064 Ga0495580_0135064_584_1384 266
790 3300046473 Ga0495582_0001705 Ga0495582_0001705_1433_2233 266
791 3300046473 Ga0495582_0015446 Ga0495582_0015446_2682_3482 266
792 3300046473 Ga0495582_0254856 Ga0495582_0254856_145_945 266
793 3300046473 Ga0495582_0300290 Ga0495582_0300290_109_909 266
794 3300046475 Ga0495639_0019431 Ga0495639_0019431_1404_2204 266
795 3300046475 Ga0495639_0033107 Ga0495639_0033107_246_1046 266
796 3300046475 Ga0495639_0109786 Ga0495639_0109786_260_1060 266
797 3300046476 Ga0495662_0001863 Ga0495662_0001863_8548_9381 266
798 3300046476 Ga0495662_0009777 Ga0495662_0009777_871_1671 266
799 3300046476 Ga0495662_0023030 Ga0495662_0023030_1016_1816 266
800 3300046477 Ga0495664_0000001 Ga0495664_0000001_213425_214258 266
801 3300046477 Ga0495664_0001609 Ga0495664_0001609_10213_11013 266
802 3300046477 Ga0495664_0042952 Ga0495664_0042952_600_1400 266
803 3300046477 Ga0495664_0052458 Ga0495664_0052458_449_1249 266
804 3300046491 Ga0495584_0048485 Ga0495584_0048485_1251_2051 266
805 3300046491 Ga0495584_0213586 Ga0495584_0213586_79_879 266
806 3300046492 Ga0495585_0009128 Ga0495585_0009128_4299_5099 266
807 3300046499 Ga0495594_0047336 Ga0495594_0047336_900_1700 266
808 3300046499 Ga0495594_0051362 Ga0495594_0051362_470_1270 266
809 3300046499 Ga0495594_0101905 Ga0495594_0101905_781_1581 266
810 3300046501 Ga0495607_0004288 Ga0495607_0004288_2982_3782 266
811 3300046511 Ga0495608_0000050 Ga0495608_0000050_60408_61241 266
812 3300046511 Ga0495608_0010562 Ga0495608_0010562_3322_4122 266
813 3300046511 Ga0495608_0013937 Ga0495608_0013937_2865_3665 266
814 3300046511 Ga0495608_0031723 Ga0495608_0031723_257_1057 266
815 3300046511 Ga0495608_0110542 Ga0495608_0110542_56_856 266
816 3300046514 Ga0495618_0000045 Ga0495618_0000045_51548_52381 266
817 3300046514 Ga0495618_0007452 Ga0495618_0007452_4706_5506 266
818 3300046514 Ga0495618_0014982 Ga0495618_0014982_2399_3199 266
819 3300046514 Ga0495618_0152558 Ga0495618_0152558_149_949 266
820 3300046516 Ga0495628_0000003 Ga0495628_0000003_44482_45315 266
821 3300046516 Ga0495628_0002046 Ga0495628_0002046_2653_3453 266
822 3300046516 Ga0495628_0009974 Ga0495628_0009974_2074_2874 266
823 3300046516 Ga0495628_0015110 Ga0495628_0015110_278_1078 266
824 3300046516 Ga0495628_0174495 Ga0495628_0174495_28_843 266
825 3300046517 Ga0495630_0016265 Ga0495630_0016265_3522_4355 266
826 3300046517 Ga0495630_0023584 Ga0495630_0023584_873_1673 266
827 3300046517 Ga0495630_0155120 Ga0495630_0155120_788_1603 266
828 3300046517 Ga0495630_0157643 Ga0495630_0157643_720_1520 266
829 3300046517 Ga0495630_0307552 Ga0495630_0307552_57_857 266
830 3300046523 Ga0495644_0000514 Ga0495644_0000514_7762_8562 266
831 3300046523 Ga0495644_0097456 Ga0495644_0097456_231_1046 266
832 3300046526 Ga0495666_0001847 Ga0495666_0001847_6590_7390 266
833 3300046526 Ga0495666_0081428 Ga0495666_0081428_252_1052 266
834 3300046529 Ga0495652_0000001 Ga0495652_0000001_612907_613740 266
835 3300046529 Ga0495652_0020653 Ga0495652_0020653_1149_1949 266
836 3300046529 Ga0495652_0032571 Ga0495652_0032571_497_1297 266
837 3300046529 Ga0495652_0043866 Ga0495652_0043866_3003_3803 266
838 3300046529 Ga0495652_0260268 Ga0495652_0260268_243_1043 266
839 3300046531 Ga0495665_0006322 Ga0495665_0006322_4828_5628 266
840 3300046531 Ga0495665_0052492 Ga0495665_0052492_730_1530 266
841 3300046533 Ga0495640_0000006 Ga0495640_0000006_60543_61376 266
842 3300046533 Ga0495640_0057539 Ga0495640_0057539_1700_2500 266
843 3300046533 Ga0495640_0075001 Ga0495640_0075001_339_1139 266
844 3300046533 Ga0495640_0081965 Ga0495640_0081965_772_1572 266
845 3300046533 Ga0495640_0099051 Ga0495640_0099051_169_984 266
846 3300046535 Ga0495586_0010189 Ga0495586_0010189_54_854 266
847 3300046535 Ga0495586_0027494 Ga0495586_0027494_1611_2444 266
848 3300046535 Ga0495586_0044435 Ga0495586_0044435_1296_2096 266
849 3300046536 Ga0495587_0000028 Ga0495587_0000028_119520_120353 266
850 3300046536 Ga0495587_0000335 Ga0495587_0000335_29442_30242 266
851 3300046536 Ga0495587_0027769 Ga0495587_0027769_1853_2653 266
852 3300046536 Ga0495587_0280541 Ga0495587_0280541_11_811 266
853 3300046538 Ga0495609_0023913 Ga0495609_0023913_934_1734 266
854 3300046538 Ga0495609_0123127 Ga0495609_0123127_89_889 266
855 3300046543 Ga0495645_0000004 Ga0495645_0000004_106931_107764 266
856 3300046543 Ga0495645_0001781 Ga0495645_0001781_4134_4934 266
857 3300046557 Ga0495622_0018802 Ga0495622_0018802_2114_2914 266
858 3300046557 Ga0495622_0115086 Ga0495622_0115086_163_963 266
859 3300046558 Ga0495633_0002107 Ga0495633_0002107_572_1372 266
860 3300046559 Ga0495667_0000001 Ga0495667_0000001_452875_453708 266
861 3300046559 Ga0495667_0004928 Ga0495667_0004928_1717_2517 266
862 3300046559 Ga0495667_0019211 Ga0495667_0019211_2857_3657 266
863 3300046559 Ga0495667_0042835 Ga0495667_0042835_283_1083 266
864 3300046615 Ga0495656_0019735 Ga0495656_0019735_935_1735 266
865 3300046615 Ga0495656_0106492 Ga0495656_0106492_303_1118 266
866 3300046642 Ga0495634_0000531 Ga0495634_0000531_35678_36511 266
867 3300046642 Ga0495634_0002372 Ga0495634_0002372_9964_10776 266
868 3300046642 Ga0495634_0007696 Ga0495634_0007696_2421_3221 266
869 3300046642 Ga0495634_0009588 Ga0495634_0009588_3245_4060 266
870 3300046642 Ga0495634_0017766 Ga0495634_0017766_1196_1996 266
871 3300046663 Ga0495635_0000007 Ga0495635_0000007_237959_238792 266
872 3300046663 Ga0495635_0000736 Ga0495635_0000736_3728_4528 266
873 3300046663 Ga0495635_0004379 Ga0495635_0004379_2400_3200 266
874 3300046663 Ga0495635_0045113 Ga0495635_0045113_1439_2239 266
875 3300046663 Ga0495635_0061837 Ga0495635_0061837_1126_1926 266
876 3300046663 Ga0495635_0094383 Ga0495635_0094383_927_1727 266
877 3300046664 Ga0495659_0011224 Ga0495659_0011224_1808_2608 266
878 3300046665 Ga0495661_0151950 Ga0495661_0151950_198_998 266
879 3300046674 Ga0495588_0013623 Ga0495588_0013623_2652_3452 266
880 3300046674 Ga0495588_0068823 Ga0495588_0068823_72_872 266
881 3300046675 Ga0495657_0000136 Ga0495657_0000136_44474_45307 266
882 3300046675 Ga0495657_0000836 Ga0495657_0000836_2401_3201 266
883 3300046675 Ga0495657_0110571 Ga0495657_0110571_78_878 266
884 3300046678 Ga0495599_0000002 Ga0495599_0000002_305011_305844 266
885 3300046678 Ga0495599_0034592 Ga0495599_0034592_2193_2993 266
886 3300046678 Ga0495599_0042654 Ga0495599_0042654_1742_2542 266
887 3300046679 Ga0495623_0000052 Ga0495623_0000052_35905_36738 266
888 3300046679 Ga0495623_0027709 Ga0495623_0027709_1668_2468 266
889 3300046679 Ga0495623_0282093 Ga0495623_0282093_86_886 266
890 3300046680 Ga0495646_0000036 Ga0495646_0000036_44597_45430 266
891 3300046680 Ga0495646_0000229 Ga0495646_0000229_9692_10492 266
892 3300046680 Ga0495646_0048707 Ga0495646_0048707_1491_2306 266
893 3300046681 Ga0495647_0021862 Ga0495647_0021862_299_1099 266
894 3300046683 Ga0495658_0000591 Ga0495658_0000591_1391_2191 266
895 3300046683 Ga0495658_0002748 Ga0495658_0002748_426_1226 266
896 3300046683 Ga0495658_0100698 Ga0495658_0100698_228_1028 266
897 3300046683 Ga0495658_0102362 Ga0495658_0102362_874_1689 266
898 3300046683 Ga0495658_0286263 Ga0495658_0286263_187_987 266
899 3300046684 Ga0495669_0047505 Ga0495669_0047505_903_1745 266
900 3300046689 Ga0495613_0014232 Ga0495613_0014232_2424_3257 266
901 3300046689 Ga0495613_0047264 Ga0495613_0047264_314_1114 266
902 3300046689 Ga0495613_0168922 Ga0495613_0168922_605_1420 266
903 3300046689 Ga0495613_0274225 Ga0495613_0274225_341_1141 266
904 3300046690 Ga0495624_0009422 Ga0495624_0009422_5204_6004 266
905 3300046690 Ga0495624_0062347 Ga0495624_0062347_1212_2045 266
906 3300046690 Ga0495624_0234940 Ga0495624_0234940_216_1031 266
907 3300046691 Ga0495670_0008959 Ga0495670_0008959_1476_2276 266
908 3300046809 Ga0495600_0000037 Ga0495600_0000037_35737_36570 266
909 3300046809 Ga0495600_0004219 Ga0495600_0004219_2322_3122 266
910 3300046809 Ga0495600_0009757 Ga0495600_0009757_4837_5637 266
911 3300046809 Ga0495600_0017312 Ga0495600_0017312_3760_4560 266
912 3300046809 Ga0495600_0100651 Ga0495600_0100651_57_875 266
913 3300047315 Ga0495581_0017156 Ga0495581_0017156_761_1561 266
914 3300047315 Ga0495581_0035361 Ga0495581_0035361_1034_1834 266
915 3300047315 Ga0495581_0049412 Ga0495581_0049412_1339_2139 266
916 3300047317 Ga0495604_0000594 Ga0495604_0000594_11246_12079 266
917 3300047317 Ga0495604_0006384 Ga0495604_0006384_7941_8741 266
918 3300047317 Ga0495604_0021677 Ga0495604_0021677_299_1099 266
919 3300047317 Ga0495604_0028471 Ga0495604_0028471_864_1664 266
920 3300047317 Ga0495604_0043834 Ga0495604_0043834_305_1105 266
921 3300047317 Ga0495604_0130187 Ga0495604_0130187_188_1006 266
922 3300047319 Ga0495674_0000001 Ga0495674_0000001_413362_414195 266
923 3300047319 Ga0495674_0034790 Ga0495674_0034790_2004_2804 266
924 3300047319 Ga0495674_0036722 Ga0495674_0036722_672_1472 266
925 3300047319 Ga0495674_0040549 Ga0495674_0040549_1658_2458 266
926 3300047319 Ga0495674_0050397 Ga0495674_0050397_1163_1963 266
927 3300047319 Ga0495674_0319885 Ga0495674_0319885_119_937 266
928 3300047320 Ga0495672_0139233 Ga0495672_0139233_48_902 266
929 3300047321 Ga0495676_0017949 Ga0495676_0017949_1365_2165 266
930 3300047321 Ga0495676_0191256 Ga0495676_0191256_598_1398 266
931 3300047321 Ga0495676_0218008 Ga0495676_0218008_46_846 266
932 3300047321 Ga0495676_0260847 Ga0495676_0260847_130_936 266
933 3300047322 Ga0495680_0000705 Ga0495680_0000705_16289_17122 266
934 3300047322 Ga0495680_0005567 Ga0495680_0005567_10561_11361 266
935 3300047322 Ga0495680_0008046 Ga0495680_0008046_762_1562 266
936 3300047322 Ga0495680_0015939 Ga0495680_0015939_121_921 266
937 3300047322 Ga0495680_0034691 Ga0495680_0034691_534_1334 266
938 3300047322 Ga0495680_0036864 Ga0495680_0036864_2853_3653 266
939 3300047444 Ga0495675_0000049 Ga0495675_0000049_44368_45201 266
940 3300047444 Ga0495675_0000139 Ga0495675_0000139_1717_2517 266
941 3300047444 Ga0495675_0072601 Ga0495675_0072601_740_1540 266
942 3300047444 Ga0495675_0155658 Ga0495675_0155658_208_1026 266
943 3300047446 Ga0495679_059603 Ga0495679_059603_283_1083 266
944 3300047471 Ga0495684_0000046 Ga0495684_0000046_63525_64358 266
945 3300047471 Ga0495684_0006324 Ga0495684_0006324_1404_2204 266
946 3300047471 Ga0495684_0016053 Ga0495684_0016053_2702_3502 266
947 3300047471 Ga0495684_0193138 Ga0495684_0193138_561_1379 266
948 3300047673 Ga0495593_0000276 Ga0495593_0000276_10795_11628 266
949 3300047673 Ga0495593_0021108 Ga0495593_0021108_537_1337 266
950 3300047673 Ga0495593_0064941 Ga0495593_0064941_373_1173 266
951 3300048088 Ga0495602_0000102 Ga0495602_0000102_44519_45352 266
952 3300048088 Ga0495602_0004714 Ga0495602_0004714_4070_4870 266
953 3300048088 Ga0495602_0006950 Ga0495602_0006950_1916_2716 266
954 3300048088 Ga0495602_0110768 Ga0495602_0110768_941_1741 266
955 3300048088 Ga0495602_0164889 Ga0495602_0164889_758_1558 266
956 3300048089 Ga0495614_0084354 Ga0495614_0084354_170_970 266
957 3300048903 Ga0496100_0000057 Ga0496100_0000057_14769_15611 266
958 3300048903 Ga0496100_0042904 Ga0496100_0042904_1809_2609 266
959 3300048903 Ga0496100_0081989 Ga0496100_0081989_281_1081 266
960 3300048903 Ga0496100_0105814 Ga0496100_0105814_566_1366 266
961 3300048903 Ga0496100_0178414 Ga0496100_0178414_386_1201 266
962 3300048904 Ga0496101_0001297 Ga0496101_0001297_2195_3037 266
963 3300048904 Ga0496101_0021335 Ga0496101_0021335_129_929 266
964 3300048904 Ga0496101_0033105 Ga0496101_0033105_178_978 266
965 3300048904 Ga0496101_0234131 Ga0496101_0234131_487_1287 266
966 3300048904 Ga0496101_0534310 Ga0496101_0534310_90_890 266
967 3300048905 Ga0496102_0001628 Ga0496102_0001628_5999_6841 266
968 3300048905 Ga0496102_0028878 Ga0496102_0028878_3696_4514 266
969 3300048905 Ga0496102_0066984 Ga0496102_0066984_351_1151 266
970 3300048906 Ga0496103_0003313 Ga0496103_0003313_8082_8924 266
971 3300048906 Ga0496103_0016110 Ga0496103_0016110_1546_2346 266
972 3300048906 Ga0496103_0055551 Ga0496103_0055551_1207_2007 266
973 3300048906 Ga0496103_0126020 Ga0496103_0126020_547_1347 266
974 3300048906 Ga0496103_0168797 Ga0496103_0168797_303_1103 266
975 3300048907 Ga0496104_0000658 Ga0496104_0000658_27321_28121 266
976 3300048907 Ga0496104_0025805 Ga0496104_0025805_4457_5257 266
977 3300048907 Ga0496104_0063613 Ga0496104_0063613_1282_2082 266
978 3300048907 Ga0496104_0143016 Ga0496104_0143016_1362_2204 266
979 3300048907 Ga0496104_0156952 Ga0496104_0156952_314_1114 266
980 3300048907 Ga0496104_0163834 Ga0496104_0163834_395_1213 266
981 3300048907 Ga0496104_0167007 Ga0496104_0167007_785_1600 266
982 3300048907 Ga0496104_0208506 Ga0496104_0208506_913_1731 266
983 3300048907 Ga0496104_0416437 Ga0496104_0416437_415_1233 266
984 3300048908 Ga0496105_0003619 Ga0496105_0003619_4481_5281 266
985 3300048908 Ga0496105_0007433 Ga0496105_0007433_4378_5178 266
986 3300048908 Ga0496105_0036018 Ga0496105_0036018_303_1118 266
987 3300048908 Ga0496105_0051118 Ga0496105_0051118_1736_2578 266
988 3300048908 Ga0496105_0105574 Ga0496105_0105574_590_1390 266
989 3300048908 Ga0496105_0128809 Ga0496105_0128809_160_1002 266
990 3300048909 Ga0496106_0000518 Ga0496106_0000518_11908_12750 266
991 3300048909 Ga0496106_0013856 Ga0496106_0013856_5074_5874 266
992 3300048909 Ga0496106_0016140 Ga0496106_0016140_2141_2941 266
993 3300048909 Ga0496106_0047763 Ga0496106_0047763_1710_2525 266
994 3300048909 Ga0496106_0254822 Ga0496106_0254822_252_1052 266
995 3300048910 Ga0496107_0001129 Ga0496107_0001129_2195_3037 266
996 3300048910 Ga0496107_0008616 Ga0496107_0008616_3862_4662 266
997 3300048910 Ga0496107_0024896 Ga0496107_0024896_3041_3841 266
998 3300048910 Ga0496107_0061873 Ga0496107_0061873_670_1470 266
999 3300048911 Ga0496108_0004254 Ga0496108_0004254_9224_10066 266
1000 3300048911 Ga0496108_0019135 Ga0496108_0019135_4173_4973 266
1001 3300048911 Ga0496108_0044088 Ga0496108_0044088_2733_3533 266
1002 3300048911 Ga0496108_0103051 Ga0496108_0103051_1004_1804 266
1003 3300048912 Ga0496109_0000390 Ga0496109_0000390_26835_27677 266
1004 3300048912 Ga0496109_0023523 Ga0496109_0023523_2418_3218 266
1005 3300048912 Ga0496109_0152330 Ga0496109_0152330_664_1464 266
1006 3300048912 Ga0496109_0229402 Ga0496109_0229402_302_1102 266
1007 3300048912 Ga0496109_0303985 Ga0496109_0303985_147_965 266
1008 3300048913 Ga0496110_0005641 Ga0496110_0005641_5101_5943 266
1009 3300048913 Ga0496110_0014086 Ga0496110_0014086_3607_4407 266
1010 3300048913 Ga0496110_0472443 Ga0496110_0472443_203_1003 266
1011 3300048913 Ga0496110_0505888 Ga0496110_0505888_106_912 266
1012 3300048914 Ga0496111_0020628 Ga0496111_0020628_2907_3749 266
1013 3300048914 Ga0496111_0027669 Ga0496111_0027669_3147_3989 266
1014 3300048915 Ga0496112_0025896 Ga0496112_0025896_2989_3789 266
1015 3300048915 Ga0496112_0083042 Ga0496112_0083042_1992_2834 266
1016 3300048915 Ga0496112_0102485 Ga0496112_0102485_199_1017 266
1017 3300048915 Ga0496112_0146823 Ga0496112_0146823_111_911 266
1018 3300048916 Ga0496113_0019170 Ga0496113_0019170_1031_1873 266
1019 3300048916 Ga0496113_0042842 Ga0496113_0042842_2203_3045 266
1020 3300048916 Ga0496113_0112080 Ga0496113_0112080_607_1425 266
1021 3300048916 Ga0496113_0259097 Ga0496113_0259097_147_947 266
1022 3300048916 Ga0496113_0363296 Ga0496113_0363296_278_1078 266
1023 3300048917 Ga0496114_0046938 Ga0496114_0046938_2521_3321 266
1024 3300048917 Ga0496114_0134615 Ga0496114_0134615_237_1037 266
1025 3300048918 Ga0496115_0076771 Ga0496115_0076771_1582_2382 266
1026 3300048918 Ga0496115_0133400 Ga0496115_0133400_282_1124 266
1027 3300048918 Ga0496115_0496336 Ga0496115_0496336_67_867 266
1028 3300048920 Ga0496117_0030252 Ga0496117_0030252_1514_2320 266
1029 3300048921 Ga0496118_0160205 Ga0496118_0160205_322_1128 266
1030 3300048925 Ga0496122_0076861 Ga0496122_0076861_117_923 266
1031 3300049568 Ga0501031_0079010 Ga0501031_0079010_657_1457 266
1032 3300049569 Ga0501032_0012835 Ga0501032_0012835_793_1593 266
1033 3300049569 Ga0501032_0022754 Ga0501032_0022754_1255_2055 266
1034 3300049569 Ga0501032_0052659 Ga0501032_0052659_213_1013 266
1035 3300049570 Ga0501033_0007713 Ga0501033_0007713_1716_2525 266
1036 3300049571 Ga0501034_0000032 Ga0501034_0000032_180167_180967 266
1037 3300049571 Ga0501034_0002292 Ga0501034_0002292_8636_9436 266
1038 3300049571 Ga0501034_0020882 Ga0501034_0020882_3718_4521 266
1039 3300049571 Ga0501034_0025918 Ga0501034_0025918_3452_4252 266
1040 3300049571 Ga0501034_0076586 Ga0501034_0076586_1704_2504 266
1041 3300049571 Ga0501034_0204225 Ga0501034_0204225_482_1285 266
1042 3300049571 Ga0501034_0207143 Ga0501034_0207143_322_1122 266
1043 3300049571 Ga0501034_0299608 Ga0501034_0299608_515_1315 266
1044 3300049571 Ga0501034_0730953 Ga0501034_0730953_68_868 266
1045 3300049572 Ga0501036_0000609 Ga0501036_0000609_673_1473 266
1046 3300049572 Ga0501036_0014893 Ga0501036_0014893_517_1317 266
1047 3300049572 Ga0501036_0054800 Ga0501036_0054800_1294_2094 266
1048 3300049572 Ga0501036_0377075 Ga0501036_0377075_177_986 266
1049 3300049573 Ga0501037_0007571 Ga0501037_0007571_2884_3684 266
1050 3300049573 Ga0501037_0073348 Ga0501037_0073348_348_1148 266
1051 3300049573 Ga0501037_0110404 Ga0501037_0110404_459_1259 266
1052 3300049574 Ga0501038_0016827 Ga0501038_0016827_1782_2582 266
1053 3300049574 Ga0501038_0126668 Ga0501038_0126668_344_1144 266
1054 3300049574 Ga0501038_0316124 Ga0501038_0316124_276_1085 266
1055 3300049574 Ga0501038_0425503 Ga0501038_0425503_133_942 266
1056 3300049575 Ga0501039_0012258 Ga0501039_0012258_609_1409 266
1057 3300049575 Ga0501039_0038774 Ga0501039_0038774_709_1509 266
1058 3300049578 Ga0501042_0067234 Ga0501042_0067234_1660_2469 266
1059 3300049579 Ga0501043_0002387 Ga0501043_0002387_14162_14962 266
1060 3300049579 Ga0501043_0016255 Ga0501043_0016255_819_1619 266
1061 3300049579 Ga0501043_0195245 Ga0501043_0195245_170_979 266
1062 3300049579 Ga0501043_0218784 Ga0501043_0218784_628_1431 266
1063 3300049579 Ga0501043_0371185 Ga0501043_0371185_243_1043 266
1064 3300049579 Ga0501043_0382596 Ga0501043_0382596_21_824 266
1065 3300049580 Ga0501046_0151657 Ga0501046_0151657_32_832 266
1066 3300049581 Ga0501047_0000228 Ga0501047_0000228_13285_14085 266
1067 3300049581 Ga0501047_0013114 Ga0501047_0013114_40_840 266
1068 3300049581 Ga0501047_0027357 Ga0501047_0027357_679_1479 266
1069 3300049581 Ga0501047_0083218 Ga0501047_0083218_2170_2970 266
1070 3300049581 Ga0501047_0090816 Ga0501047_0090816_785_1588 266
1071 3300049581 Ga0501047_0101345 Ga0501047_0101345_1822_2622 266
1072 3300049582 Ga0501048_0000467 Ga0501048_0000467_13285_14085 266
1073 3300049583 Ga0501067_0135133 Ga0501067_0135133_13_813 266
1074 3300049585 Ga0501069_0081539 Ga0501069_0081539_419_1219 266
1075 3300049586 Ga0501070_0008372 Ga0501070_0008372_4757_5557 266
1076 3300049586 Ga0501070_0008780 Ga0501070_0008780_903_1703 266
1077 3300049586 Ga0501070_0038930 Ga0501070_0038930_958_1758 266
1078 3300049586 Ga0501070_0046289 Ga0501070_0046289_2588_3388 266
1079 3300049586 Ga0501070_0126899 Ga0501070_0126899_338_1138 266
1080 3300049586 Ga0501070_0180504 Ga0501070_0180504_159_968 266
1081 3300049586 Ga0501070_0226485 Ga0501070_0226485_283_1083 266
1082 3300049588 Ga0501072_0279283 Ga0501072_0279283_271_1071 266
1083 3300049588 Ga0501072_0321239 Ga0501072_0321239_206_1006 266
1084 3300049589 Ga0501073_0005395 Ga0501073_0005395_7642_8442 266
1085 3300049589 Ga0501073_0016516 Ga0501073_0016516_483_1283 266
1086 3300049589 Ga0501073_0016906 Ga0501073_0016906_3967_4767 266
1087 3300049589 Ga0501073_0047845 Ga0501073_0047845_1426_2226 266
1088 3300049589 Ga0501073_0059193 Ga0501073_0059193_96_896 266
1089 3300049589 Ga0501073_0167408 Ga0501073_0167408_632_1435 266
1090 3300049590 Ga0501074_0003305 Ga0501074_0003305_2638_3438 266
1091 3300049590 Ga0501074_0119873 Ga0501074_0119873_1042_1842 266
1092 3300049592 Ga0501076_0160613 Ga0501076_0160613_218_1027 266
1093 3300049593 Ga0501077_0118487 Ga0501077_0118487_261_1061 266
1094 3300049593 Ga0501077_0312791 Ga0501077_0312791_45_845 266
1095 3300049741 Ga0501079_0012178 Ga0501079_0012178_934_1743 266
1096 3300049742 Ga0501080_0000112 Ga0501080_0000112_41845_42645 266
1097 3300049742 Ga0501080_0013759 Ga0501080_0013759_5850_6650 266
1098 3300049742 Ga0501080_0053206 Ga0501080_0053206_1574_2374 266
1099 3300049742 Ga0501080_0420448 Ga0501080_0420448_34_837 266
1100 3300049743 Ga0501081_0022376 Ga0501081_0022376_1124_1933 266
1101 3300049744 Ga0501083_0001098 Ga0501083_0001098_4101_4901 266
1102 3300049744 Ga0501083_0011138 Ga0501083_0011138_2081_2899 266
1103 3300049744 Ga0501083_0051420 Ga0501083_0051420_1774_2574 266
1104 3300049822 Ga0501035_0001573 Ga0501035_0001573_19917_20717 266
1105 3300049822 Ga0501035_0012556 Ga0501035_0012556_2953_3753 266
1106 3300049822 Ga0501035_0047298 Ga0501035_0047298_1728_2531 266
1107 3300049822 Ga0501035_0125846 Ga0501035_0125846_1237_2037 266
1108 3300049822 Ga0501035_0222004 Ga0501035_0222004_385_1188 266
1109 3300049823 Ga0501044_0015838 Ga0501044_0015838_503_1303 266
1110 3300049823 Ga0501044_0017602 Ga0501044_0017602_1473_2273 266
1111 3300049823 Ga0501044_0059118 Ga0501044_0059118_1864_2664 266
1112 3300049823 Ga0501044_0229370 Ga0501044_0229370_759_1562 266
1113 3300049823 Ga0501044_0291111 Ga0501044_0291111_299_1099 266
1114 3300049824 Ga0501045_0509016 Ga0501045_0509016_16_825 266
1115 3300050489 nmdc:mga03683_118853_c1 nmdc:mga03683_118853_c1_41_868 266
1116 3300050490 nmdc:mga03n38_125692_c1 nmdc:mga03n38_125692_c1_153_953 266
1117 3300050490 nmdc:mga03n38_92959_c1 nmdc:mga03n38_92959_c1_456_1259 266
1118 3300050494 nmdc:mga06z11_98530_c1 nmdc:mga06z11_98530_c1_128_928 266
1119 3300050496 nmdc:mga07m45_53349_c1 nmdc:mga07m45_53349_c1_1278_2081 266
1120 3300050507 nmdc:mga05p37_313858_c1 nmdc:mga05p37_313858_c1_561_1361 266
1121 3300050507 nmdc:mga05p37_45_c1 nmdc:mga05p37_45_c1_76729_77529 266
1122 3300050507 nmdc:mga05p37_9625_c1 nmdc:mga05p37_9625_c1_4573_5373 266
1123 3300050508 nmdc:mga09592_1055_c1 nmdc:mga09592_1055_c1_5833_6633 266
1124 3300050508 nmdc:mga09592_16858_c1 nmdc:mga09592_16858_c1_4047_4907 266
1125 3300050509 nmdc:mga0qj67_201_c1 nmdc:mga0qj67_201_c1_38269_39069 266
1126 3300050509 nmdc:mga0qj67_21795_c1 nmdc:mga0qj67_21795_c1_1507_2367 266
1127 3300050509 nmdc:mga0qj67_471394_c1 nmdc:mga0qj67_471394_c1_160_960 266
1128 3300050509 nmdc:mga0qj67_701_c1 nmdc:mga0qj67_701_c1_12432_13232 266
1129 3300050510 nmdc:mga06r32_119_c1 nmdc:mga06r32_119_c1_8080_8940 266
1130 3300050510 nmdc:mga06r32_227_c1 nmdc:mga06r32_227_c1_11575_12375 266
1131 3300050510 nmdc:mga06r32_538051_c1 nmdc:mga06r32_538051_c1_155_982 266
1132 3300050511 nmdc:mga08y16_1191_c1 nmdc:mga08y16_1191_c1_441_1241 266
1133 3300050511 nmdc:mga08y16_1666_c1 nmdc:mga08y16_1666_c1_2447_3247 266
1134 3300050511 nmdc:mga08y16_359795_c1 nmdc:mga08y16_359795_c1_468_1268 266
1135 3300050511 nmdc:mga08y16_636_c1 nmdc:mga08y16_636_c1_4876_5736 266
1136 3300050511 nmdc:mga08y16_87220_c1 nmdc:mga08y16_87220_c1_1137_1937 266
1137 3300050512 nmdc:mga0n895_147000_c1 nmdc:mga0n895_147000_c1_214_1014 266
1138 3300050512 nmdc:mga0n895_153246_c1 nmdc:mga0n895_153246_c1_174_974 266
1139 3300050512 nmdc:mga0n895_4930_c1 nmdc:mga0n895_4930_c1_8061_8903 266
1140 3300050512 nmdc:mga0n895_50_c1 nmdc:mga0n895_50_c1_55413_56213 266
1141 3300050513 nmdc:mga0rr50_17122_c1 nmdc:mga0rr50_17122_c1_3724_4524 266
1142 3300050513 nmdc:mga0rr50_19371_c1 nmdc:mga0rr50_19371_c1_788_1588 266
1143 3300050513 nmdc:mga0rr50_235652_c1 nmdc:mga0rr50_235652_c1_463_1263 266
1144 3300050513 nmdc:mga0rr50_398005_c1 nmdc:mga0rr50_398005_c1_241_1041 266
1145 3300050513 nmdc:mga0rr50_511473_c1 nmdc:mga0rr50_511473_c1_41_841 266
1146 3300050513 nmdc:mga0rr50_67221_c1 nmdc:mga0rr50_67221_c1_1290_2090 266
1147 3300050514 nmdc:mga08x19_107491_c1 nmdc:mga08x19_107491_c1_385_1185 266
1148 3300050514 nmdc:mga08x19_20074_c1 nmdc:mga08x19_20074_c1_1697_2497 266
1149 3300050514 nmdc:mga08x19_73725_c1 nmdc:mga08x19_73725_c1_668_1468 266
1150 3300050515 nmdc:mga0a205_173299_c1 nmdc:mga0a205_173299_c1_44_844 266
1151 3300050515 nmdc:mga0a205_21352_c1 nmdc:mga0a205_21352_c1_4189_4989 266
1152 3300050515 nmdc:mga0a205_2228_c1 nmdc:mga0a205_2228_c1_13260_14102 266
1153 3300050515 nmdc:mga0a205_25091_c1 nmdc:mga0a205_25091_c1_2166_2993 266
1154 3300050515 nmdc:mga0a205_4901_c1 nmdc:mga0a205_4901_c1_8915_9715 266
1155 3300053077 Ga0495601_0000006 Ga0495601_0000006_253412_254245 266
1156 3300053077 Ga0495601_0000204 Ga0495601_0000204_3006_3806 266
1157 3300053077 Ga0495601_0002295 Ga0495601_0002295_7266_8066 266
1158 3300053077 Ga0495601_0002402 Ga0495601_0002402_6510_7310 266
1159 3300053077 Ga0495601_0004165 Ga0495601_0004165_3563_4378 266
1160 3300053077 Ga0495601_0011343 Ga0495601_0011343_623_1423 266
1161 3300053077 Ga0495601_0056978 Ga0495601_0056978_572_1390 266
1162 3300053077 Ga0495601_0111497 Ga0495601_0111497_259_1059 266
1163 3300053077 Ga0495601_0201861 Ga0495601_0201861_457_1257 266
1164 3300053078 Ga0495612_0000004 Ga0495612_0000004_60415_61248 266
1165 3300053078 Ga0495612_0000384 Ga0495612_0000384_13926_14726 266
1166 3300053078 Ga0495612_0011006 Ga0495612_0011006_305_1105 266
1167 3300053078 Ga0495612_0012068 Ga0495612_0012068_1442_2242 266
1168 3300053078 Ga0495612_0040105 Ga0495612_0040105_448_1266 266
1169 3300053078 Ga0495612_0051614 Ga0495612_0051614_229_1029 266
1170 3300053084 Ga0495595_0000227 Ga0495595_0000227_20714_21547 266
1171 3300053084 Ga0495595_0000577 Ga0495595_0000577_1238_2038 266
1172 3300053084 Ga0495595_0000686 Ga0495595_0000686_1569_2369 266
1173 3300053084 Ga0495595_0001081 Ga0495595_0001081_6157_6957 266
1174 3300053084 Ga0495595_0002024 Ga0495595_0002024_3190_3990 266
1175 3300053084 Ga0495595_0023885 Ga0495595_0023885_537_1337 266
1176 3300053084 Ga0495595_0071131 Ga0495595_0071131_714_1514 266
1177 3300053084 Ga0495595_0098390 Ga0495595_0098390_52_852 266
1178 3300053084 Ga0495595_0214467 Ga0495595_0214467_23_823 266
1179 3300053085 Ga0495619_0000027 Ga0495619_0000027_44670_45503 266
1180 3300053085 Ga0495619_0000260 Ga0495619_0000260_21835_22635 266
1181 3300053085 Ga0495619_0000655 Ga0495619_0000655_9010_9810 266
1182 3300053085 Ga0495619_0015754 Ga0495619_0015754_2169_2987 266
1183 3300053085 Ga0495619_0017989 Ga0495619_0017989_2403_3203 266
1184 3300053085 Ga0495619_0024139 Ga0495619_0024139_2187_2987 266
1185 3300053085 Ga0495619_0061424 Ga0495619_0061424_1635_2435 266
1186 3300053085 Ga0495619_0072372 Ga0495619_0072372_411_1211 266
1187 3300053087 Ga0500643_002725 Ga0500643_002725_513_1313 266
1188 3300053088 Ga0500644_0000577 Ga0500644_0000577_6867_7667 266
1189 3300053093 Ga0500651_0016523 Ga0500651_0016523_1168_1968 266
1190 3300053094 Ga0500566_0060690 Ga0500566_0060690_920_1720 266
1191 3300053096 Ga0500641_0018081 Ga0500641_0018081_818_1618 266
1192 3300053119 Ga0500595_000144 Ga0500595_000144_23004_23804 266
1193 3300053119 Ga0500595_082593 Ga0500595_082593_56_856 266
1194 3300053131 Ga0500652_000016 Ga0500652_000016_16118_16918 266
1195 3300053131 Ga0500652_066720 Ga0500652_066720_85_885 266
1196 3300053153 Ga0500616_0000006 Ga0500616_0000006_413422_414222 266
1197 3300053153 Ga0500616_0011270 Ga0500616_0011270_2860_3660 266
1198 3300053158 Ga0500627_0124195 Ga0500627_0124195_271_1074 266
1199 3300053177 Ga0500636_0021600 Ga0500636_0021600_368_1168 266
1200 3300053730 Ga0500645_001128 Ga0500645_001128_6830_7630 266
1201 3300054114 Ga0501084_0072817 Ga0501084_0072817_2041_2859 266
1202 3300054114 Ga0501084_0212725 Ga0501084_0212725_113_913 266
1203 3300060353 Ga0501082_0021751 Ga0501082_0021751_2588_3388 266
1204 3300060353 Ga0501082_0147860 Ga0501082_0147860_1054_1863 266
1205 3300060353 Ga0501082_0239674 Ga0501082_0239674_515_1315 266
1206 3300061719 Ga0466962_0099785 Ga0466962_0099785_334_1134 266
1207 3300061734 Ga0530510_0107937 Ga0530510_0107937_786_1595 266

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00941

FAD_binding_5

FAD binding domain in molybdopterin dehydrogenase

2

168

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
7dqx-assembly1.cif.gz_B crystal structure of xanthine dehydrogenase family protein 0.8555 4 264
7dqx-assembly1.cif.gz_E crystal structure of xanthine dehydrogenase family protein 0.8453 4 264
1ffv-assembly1.cif.gz_F carbon monoxide dehydrogenase from hydrogenophaga pseudoflava 0.8397 3 265
7dqx-assembly1.cif.gz_B crystal structure of xanthine dehydrogenase family protein 0.8375 4 264
1ffu-assembly1.cif.gz_F carbon monoxide dehydrogenase from hydrogenophaga pseudoflava which lacks the mo-pyranopterin moiety of the molybdenum cofactor 0.8358 3 265
ID Description Score Start End Superfamily
1t3qF02 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; 0.936 55 167 3.30.465.10
1ffvC03 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; 0.9156 57 166 3.30.465.10
af_I6Y7N2_57_165_3.30.465.10 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; 0.9129 62 166 3.30.465.10
af_Q46800_56_173_3.30.465.10 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; 0.8919 56 166 3.30.465.10
1t3qF02 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; 0.8906 55 167 3.30.465.10
ID Description Score Start End GO Terms
AF-A0A527DEU0-F1-model_v4 Carbon monoxide dehydrogenase 0.9798 133 266
AF-A0A1H8YRK0-F1-model_v4 Carbon-monoxide dehydrogenase medium subunit 0.9756 169 264
AF-A0A1M7TWS0-F1-model_v4 Carbon-monoxide dehydrogenase medium subunit 0.9741 148 264
AF-A0A3S1U3F1-F1-model_v4 deleted 0.9739 146 266
AF-A0A2S6TG65-F1-model_v4 FAD-binding PCMH-type domain-containing protein 0.9736 56 262 GO:0016491
GO:0071949

Feature Viewer

pLDDT pTM Quality
89.18 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map