F491666
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1207 | 452 | 1200 | 268 |
Family's Representative Sequence
| Representative Sequence | 3300026035|Ga0207703_10008054|Ga0207703_1000805411 |
| Length | 303 |
| Sequence | MYNFTFHRPTTVRQAAGLLARNPEAKLLAGGHSLLPVMKLRLANPSALIDLSLVEGMSGVEQKGRSVVIGAMTRHADAANSPVLQQVLPGLASVPASVGDPQVRNRGTIGGSVANNDPNADYPAACLGLGATIITNKRRIAADDFFTGMFSTALEDGEIITKISFPIAKKAAYEKFKHPASGFALVGVFVSKRGSEIRVAVTGAGANGVFRVKSFEEALKKRFAAKSLDGMTIPATGMKTAIFTPAQNIAPILSGYWPSGPSQKRRRDATRRNNCGWECVSEPRQQFRSDGALCSYCRFLLSY |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 2 | 2643221547 | Pseudolabrys sp. Root1462 | Isolate | Unclassified |
| 3 | 2643221734 | Bosea sp. Root670 | Isolate | Unclassified |
| 4 | 2818991467 | Bosea vestrisii 3192 | Isolate | Unclassified |
| 5 | 2841911363 | Bosea caraganae RCAM04685 | Isolate | Nodule |
| 6 | 2841917233 | Bosea caraganae RCAM04680 | Isolate | Nodule |
| 7 | 2851182111 | Bosea sp. Tri-44 | Isolate | Nodule |
| 8 | 2909042592 | Labrys sp. LIt4 | Isolate | Nodule |
| 9 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 10 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 11 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 12 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 13 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 14 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 15 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 16 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 17 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 18 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 19 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 20 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 21 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 22 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 23 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 24 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 25 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 26 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 32 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 36 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 38 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 49 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 65 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 66 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 67 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 68 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 70 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 71 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 72 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 74 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 75 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 80 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 82 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 83 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 84 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 86 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 87 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 88 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 89 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 90 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 91 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 92 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 93 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 94 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 95 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 96 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 97 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 98 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 99 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 100 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 101 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 102 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 103 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 104 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 105 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 106 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 107 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 108 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 109 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 110 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 112 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 113 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 114 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 115 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 116 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 117 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 118 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 119 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 120 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 121 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 123 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 124 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 139 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300012492 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 | Metagenome | Rhizosphere |
| 142 | 3300012495 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 | Metagenome | Rhizosphere |
| 143 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 144 | 3300012510 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 | Metagenome | Rhizosphere |
| 145 | 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Metagenome | Rhizosphere |
| 146 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 159 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 160 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 161 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 162 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 163 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 164 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 165 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 168 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 169 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 170 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 238 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 242 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 243 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 244 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 245 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 246 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 247 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 248 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 249 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 250 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 251 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 252 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 253 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 254 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 255 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 256 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 257 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 258 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 259 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 260 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 261 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 262 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 263 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 264 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 265 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 266 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 267 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 268 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 269 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 270 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 271 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 272 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 273 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 274 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 275 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 276 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 277 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 278 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 279 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 280 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 281 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 282 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 283 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 284 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 285 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 286 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 287 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 288 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 289 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 290 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 291 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 292 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 293 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 294 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 295 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 296 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 297 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 298 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 299 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 300 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 301 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 302 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 303 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 304 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 305 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 306 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 307 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 308 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 371 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 372 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 373 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 374 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 375 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 376 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 377 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 378 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 379 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 380 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 381 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 382 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 383 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 384 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 385 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 386 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 387 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 388 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 389 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 390 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 391 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 392 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 393 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 394 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 395 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 396 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 397 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 398 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 399 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 400 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 401 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 402 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 403 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 404 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 405 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 406 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 407 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 408 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 409 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 410 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 411 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 412 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 413 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 414 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 415 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 416 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 417 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 418 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 419 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 420 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 421 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 422 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 423 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 424 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 425 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 426 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 427 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 428 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 429 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 430 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 431 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 437 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 438 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 439 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 440 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 441 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 442 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 443 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 444 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 445 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 446 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 447 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 448 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 449 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 450 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 451 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 452 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.25 |
| Metatranscriptomes | 0.17 |
| Isolates | 0.58 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.23 |
| Nodule | 0.33 |
| Rhizoplane | 7.13 |
| Rhizosphere | 87.32 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.99 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | 2214544913 | 2209111006 | Bacteria | 25171 |
| 2 | ARcpr5oldR_c000030 | 3300000041 | Bacteria | 28909 |
| 3 | ARSoilYngRDRAFT_c00022 | 3300000042 | Bacteria | 23602 |
| 4 | ARcpr5yngRDRAFT_c000011 | 3300000043 | Bacteria | 35549 |
| 5 | ARSoilOldRDRAFT_c000040 | 3300000044 | Bacteria | 28954 |
| 6 | ARCol0yngRDRAFT_1000028 | 3300000652 | Bacteria | 25625 |
| 7 | JGI24739J22299_10000164 | 3300001989 | Bacteria | 21825 |
| 8 | JGI24737J22298_10004205 | 3300001990 | Bacteria | 5033 |
| 9 | JGI24750J21931_1000178 | 3300002070 | Bacteria | 10641 |
| 10 | JGI24745J21846_1000640 | 3300002073 | Bacteria | 3142 |
| 11 | JGI24738J21930_10000112 | 3300002075 | Bacteria | 19038 |
| 12 | JGI24035J26624_1000424 | 3300002126 | Bacteria | 3991 |
| 13 | JGI24033J26618_1001840 | 3300002155 | Bacteria | 2123 |
| 14 | JGI25151J46595_10000066 | 3300003187 | Bacteria | 142963 |
| 15 | JGI25151J46595_10000311 | 3300003187 | Bacteria | 53048 |
| 16 | Ga0055526_1000051 | 3300003771 | Bacteria | 116101 |
| 17 | Ga0055524_1006832 | 3300003775 | Bacteria | 4920 |
| 18 | Ga0065704_10077858 | 3300005289 | Bacteria | 4601 |
| 19 | Ga0065715_10001682 | 3300005293 | Bacteria | 8090 |
| 20 | Ga0070676_10003775 | 3300005328 | Bacteria | 7942 |
| 21 | Ga0070683_100000376 | 3300005329 | Bacteria | 31004 |
| 22 | Ga0070690_100002745 | 3300005330 | Bacteria | 9502 |
| 23 | Ga0070690_100006745 | 3300005330 | Bacteria | 6525 |
| 24 | Ga0070690_100008317 | 3300005330 | Bacteria | 5970 |
| 25 | Ga0070670_100004417 | 3300005331 | Bacteria | 11775 |
| 26 | Ga0070670_100129375 | 3300005331 | Bacteria | 2179 |
| 27 | Ga0070677_10000049 | 3300005333 | Bacteria | 37210 |
| 28 | Ga0070677_10099367 | 3300005333 | Bacteria | 1280 |
| 29 | Ga0068869_100000523 | 3300005334 | Bacteria | 21387 |
| 30 | Ga0070666_10002781 | 3300005335 | Bacteria | 10564 |
| 31 | Ga0070666_10279884 | 3300005335 | Bacteria | 1186 |
| 32 | Ga0070680_100005313 | 3300005336 | Bacteria | 9748 |
| 33 | Ga0070680_100036737 | 3300005336 | Bacteria | 3958 |
| 34 | Ga0070680_100045410 | 3300005336 | Bacteria | 3571 |
| 35 | Ga0070680_100086664 | 3300005336 | Bacteria | 2589 |
| 36 | Ga0070680_100400114 | 3300005336 | Bacteria | 1170 |
| 37 | Ga0070680_100403209 | 3300005336 | Bacteria | 1166 |
| 38 | Ga0070682_100000141 | 3300005337 | Bacteria | 57251 |
| 39 | Ga0070682_100010927 | 3300005337 | Bacteria | 5173 |
| 40 | Ga0070682_100076162 | 3300005337 | Bacteria | 2159 |
| 41 | Ga0070682_100115378 | 3300005337 | Bacteria | 1796 |
| 42 | Ga0068868_100009105 | 3300005338 | Bacteria | 7128 |
| 43 | Ga0070660_100001073 | 3300005339 | Bacteria | 18364 |
| 44 | Ga0070660_100089025 | 3300005339 | Bacteria | 2432 |
| 45 | Ga0070660_100130758 | 3300005339 | Bacteria | 2009 |
| 46 | Ga0070660_100243176 | 3300005339 | Bacteria | 1466 |
| 47 | Ga0070689_100028024 | 3300005340 | Bacteria | 4253 |
| 48 | Ga0070689_100081166 | 3300005340 | Bacteria | 2546 |
| 49 | Ga0070689_100087747 | 3300005340 | Bacteria | 2448 |
| 50 | Ga0070691_10004687 | 3300005341 | Bacteria | 6220 |
| 51 | Ga0070691_10020023 | 3300005341 | Bacteria | 3088 |
| 52 | Ga0070687_100000212 | 3300005343 | Bacteria | 20234 |
| 53 | Ga0070687_100088613 | 3300005343 | Bacteria | 1706 |
| 54 | Ga0070661_100000242 | 3300005344 | Bacteria | 44945 |
| 55 | Ga0070692_10003806 | 3300005345 | Bacteria | 6204 |
| 56 | Ga0070692_10010557 | 3300005345 | Bacteria | 4209 |
| 57 | Ga0070668_100003395 | 3300005347 | Bacteria | 11753 |
| 58 | Ga0070668_100204842 | 3300005347 | Bacteria | 1621 |
| 59 | Ga0070669_100006805 | 3300005353 | Bacteria | 8223 |
| 60 | Ga0070669_100147979 | 3300005353 | Bacteria | 1816 |
| 61 | Ga0070675_100000165 | 3300005354 | Bacteria | 40656 |
| 62 | Ga0070675_100011029 | 3300005354 | Bacteria | 7076 |
| 63 | Ga0070675_100142606 | 3300005354 | Bacteria | 2049 |
| 64 | Ga0070675_100169015 | 3300005354 | Bacteria | 1885 |
| 65 | Ga0070671_100001907 | 3300005355 | Bacteria | 15957 |
| 66 | Ga0070671_100124562 | 3300005355 | Bacteria | 2169 |
| 67 | Ga0070674_100000450 | 3300005356 | Bacteria | 20737 |
| 68 | Ga0070674_100124608 | 3300005356 | Bacteria | 1912 |
| 69 | Ga0070673_100001190 | 3300005364 | Bacteria | 14967 |
| 70 | Ga0070673_100269588 | 3300005364 | Bacteria | 1489 |
| 71 | Ga0070673_100377892 | 3300005364 | Bacteria | 1263 |
| 72 | Ga0070688_100004815 | 3300005365 | Bacteria | 7056 |
| 73 | Ga0070688_100016577 | 3300005365 | Bacteria | 4215 |
| 74 | Ga0070688_100035808 | 3300005365 | Bacteria | 3016 |
| 75 | Ga0070659_100000988 | 3300005366 | Bacteria | 20880 |
| 76 | Ga0070659_100031422 | 3300005366 | Bacteria | 4112 |
| 77 | Ga0070659_100070846 | 3300005366 | Bacteria | 2770 |
| 78 | Ga0070667_100019884 | 3300005367 | Bacteria | 5572 |
| 79 | Ga0070667_100072875 | 3300005367 | Bacteria | 2927 |
| 80 | Ga0070667_100095000 | 3300005367 | Bacteria | 2569 |
| 81 | Ga0070703_10001274 | 3300005406 | Bacteria | 7647 |
| 82 | Ga0070703_10015056 | 3300005406 | Bacteria | 2210 |
| 83 | Ga0070709_10088128 | 3300005434 | Bacteria | 2041 |
| 84 | Ga0070709_10110858 | 3300005434 | Bacteria | 1844 |
| 85 | Ga0070714_100036808 | 3300005435 | Bacteria | 4107 |
| 86 | Ga0070714_100096255 | 3300005435 | Bacteria | 2601 |
| 87 | Ga0070714_100161493 | 3300005435 | Bacteria | 2027 |
| 88 | Ga0070713_100007886 | 3300005436 | Bacteria | 7512 |
| 89 | Ga0070713_100021911 | 3300005436 | Bacteria | 4927 |
| 90 | Ga0070713_100270860 | 3300005436 | Bacteria | 1555 |
| 91 | Ga0070713_100586696 | 3300005436 | Bacteria | 1058 |
| 92 | Ga0070710_10004737 | 3300005437 | Bacteria | 6431 |
| 93 | Ga0070710_10020849 | 3300005437 | Bacteria | 3406 |
| 94 | Ga0070710_10108647 | 3300005437 | Bacteria | 1663 |
| 95 | Ga0070701_10006218 | 3300005438 | Bacteria | 5008 |
| 96 | Ga0070711_100016051 | 3300005439 | Bacteria | 4748 |
| 97 | Ga0070711_100046246 | 3300005439 | Bacteria | 2964 |
| 98 | Ga0070711_100154569 | 3300005439 | Bacteria | 1733 |
| 99 | Ga0070711_100223464 | 3300005439 | Bacteria | 1465 |
| 100 | Ga0070711_100373822 | 3300005439 | Bacteria | 1151 |
| 101 | Ga0070705_100003041 | 3300005440 | Bacteria | 8274 |
| 102 | Ga0070705_100015515 | 3300005440 | Bacteria | 3942 |
| 103 | Ga0070705_100082775 | 3300005440 | Bacteria | 1976 |
| 104 | Ga0070700_100000364 | 3300005441 | Bacteria | 23195 |
| 105 | Ga0070700_100012444 | 3300005441 | Bacteria | 4750 |
| 106 | Ga0070694_100001077 | 3300005444 | Bacteria | 15614 |
| 107 | Ga0070694_100246067 | 3300005444 | Bacteria | 1351 |
| 108 | Ga0070663_100000417 | 3300005455 | Bacteria | 22399 |
| 109 | Ga0070663_100015967 | 3300005455 | Bacteria | 4861 |
| 110 | Ga0070663_100091393 | 3300005455 | Bacteria | 2255 |
| 111 | Ga0070663_100111194 | 3300005455 | Bacteria | 2058 |
| 112 | Ga0070678_100001012 | 3300005456 | Bacteria | 14620 |
| 113 | Ga0070678_100050152 | 3300005456 | Bacteria | 3017 |
| 114 | Ga0070678_100060421 | 3300005456 | Bacteria | 2790 |
| 115 | Ga0070678_100418488 | 3300005456 | Bacteria | 1167 |
| 116 | Ga0070662_100000796 | 3300005457 | Bacteria | 19367 |
| 117 | Ga0070662_100032145 | 3300005457 | Bacteria | 3686 |
| 118 | Ga0070681_10002475 | 3300005458 | Bacteria | 16918 |
| 119 | Ga0070681_10037631 | 3300005458 | Bacteria | 4854 |
| 120 | Ga0070681_10049230 | 3300005458 | Bacteria | 4209 |
| 121 | Ga0070681_10186025 | 3300005458 | Bacteria | 1997 |
| 122 | Ga0070681_10358405 | 3300005458 | Bacteria | 1368 |
| 123 | Ga0068867_100006779 | 3300005459 | Bacteria | 8095 |
| 124 | Ga0070685_10000547 | 3300005466 | Bacteria | 21062 |
| 125 | Ga0070685_10060757 | 3300005466 | Bacteria | 2211 |
| 126 | Ga0070706_100195631 | 3300005467 | Bacteria | 1889 |
| 127 | Ga0070707_100308853 | 3300005468 | Bacteria | 1537 |
| 128 | Ga0070679_100002268 | 3300005530 | Bacteria | 17373 |
| 129 | Ga0070679_100075945 | 3300005530 | Bacteria | 3350 |
| 130 | Ga0070679_100089819 | 3300005530 | Bacteria | 3059 |
| 131 | Ga0070679_100100033 | 3300005530 | Bacteria | 2887 |
| 132 | Ga0070679_100206516 | 3300005530 | Bacteria | 1928 |
| 133 | Ga0070679_100327434 | 3300005530 | Bacteria | 1481 |
| 134 | Ga0070684_100000755 | 3300005535 | Bacteria | 22399 |
| 135 | Ga0070684_100396824 | 3300005535 | Unclassified | 1271 |
| 136 | Ga0068853_100000483 | 3300005539 | Bacteria | 27159 |
| 137 | Ga0068853_100605614 | 3300005539 | Bacteria | 1041 |
| 138 | Ga0068853_100767834 | 3300005539 | Unclassified | 922 |
| 139 | Ga0070672_100000527 | 3300005543 | Bacteria | 22399 |
| 140 | Ga0070672_100426835 | 3300005543 | Unclassified | 1139 |
| 141 | Ga0070672_100649010 | 3300005543 | Bacteria | 922 |
| 142 | Ga0070686_100004541 | 3300005544 | Bacteria | 7655 |
| 143 | Ga0070686_100028407 | 3300005544 | Bacteria | 3392 |
| 144 | Ga0070695_100005295 | 3300005545 | Bacteria | 7594 |
| 145 | Ga0070695_100016829 | 3300005545 | Bacteria | 4431 |
| 146 | Ga0070695_100124151 | 3300005545 | Bacteria | 1771 |
| 147 | Ga0070695_100217729 | 3300005545 | Unclassified | 1374 |
| 148 | Ga0070696_100004211 | 3300005546 | Bacteria | 9581 |
| 149 | Ga0070696_100181293 | 3300005546 | Bacteria | 1562 |
| 150 | Ga0070693_100000199 | 3300005547 | Bacteria | 28265 |
| 151 | Ga0070693_100042452 | 3300005547 | Bacteria | 2562 |
| 152 | Ga0070693_100067261 | 3300005547 | Bacteria | 2100 |
| 153 | Ga0070665_100633126 | 3300005548 | Bacteria | 1083 |
| 154 | Ga0070704_100000987 | 3300005549 | Bacteria | 14504 |
| 155 | Ga0070704_100116040 | 3300005549 | Bacteria | 2047 |
| 156 | Ga0068855_100004444 | 3300005563 | Bacteria | 17127 |
| 157 | Ga0068855_100015363 | 3300005563 | Bacteria | 9217 |
| 158 | Ga0068855_100054935 | 3300005563 | Bacteria | 4679 |
| 159 | Ga0068855_100193345 | 3300005563 | Bacteria | 2293 |
| 160 | Ga0070664_100000895 | 3300005564 | Bacteria | 23168 |
| 161 | Ga0068857_100001816 | 3300005577 | Bacteria | 17161 |
| 162 | Ga0068857_100084708 | 3300005577 | Bacteria | 2833 |
| 163 | Ga0068854_100001812 | 3300005578 | Bacteria | 13001 |
| 164 | Ga0068856_100002507 | 3300005614 | Bacteria | 18898 |
| 165 | Ga0068856_100062535 | 3300005614 | Bacteria | 3678 |
| 166 | Ga0068856_100167359 | 3300005614 | Bacteria | 2210 |
| 167 | Ga0070702_100005184 | 3300005615 | Bacteria | 6036 |
| 168 | Ga0068852_100003253 | 3300005616 | Bacteria | 11339 |
| 169 | Ga0068859_100001353 | 3300005617 | Bacteria | 25014 |
| 170 | Ga0068859_100221537 | 3300005617 | Bacteria | 1979 |
| 171 | Ga0068859_101108608 | 3300005617 | Bacteria | 871 |
| 172 | Ga0068864_100000227 | 3300005618 | Bacteria | 50765 |
| 173 | Ga0068864_100082790 | 3300005618 | Bacteria | 2816 |
| 174 | Ga0068866_10001093 | 3300005718 | Bacteria | 11946 |
| 175 | Ga0068861_100003517 | 3300005719 | Bacteria | 10409 |
| 176 | Ga0068861_100115406 | 3300005719 | Bacteria | 2157 |
| 177 | Ga0068851_10037270 | 3300005834 | Bacteria | 2437 |
| 178 | Ga0068870_10000062 | 3300005840 | Bacteria | 33752 |
| 179 | Ga0068863_100000495 | 3300005841 | Bacteria | 39957 |
| 180 | Ga0068858_100000783 | 3300005842 | Bacteria | 33229 |
| 181 | Ga0068858_100112690 | 3300005842 | Bacteria | 2540 |
| 182 | Ga0068858_100195456 | 3300005842 | Bacteria | 1912 |
| 183 | Ga0068860_100022350 | 3300005843 | Bacteria | 6119 |
| 184 | Ga0068862_100003647 | 3300005844 | Bacteria | 13173 |
| 185 | Ga0068862_100139944 | 3300005844 | Bacteria | 2147 |
| 186 | Ga0081455_10000204 | 3300005937 | Bacteria | 75793 |
| 187 | Ga0081538_10005964 | 3300005981 | Bacteria | 10846 |
| 188 | Ga0081538_10006841 | 3300005981 | Bacteria | 9939 |
| 189 | Ga0081540_1012611 | 3300005983 | Bacteria | 5547 |
| 190 | Ga0081539_10064755 | 3300005985 | Bacteria | 1987 |
| 191 | Ga0070717_10011080 | 3300006028 | Bacteria | 6833 |
| 192 | Ga0070717_10347463 | 3300006028 | Bacteria | 1325 |
| 193 | Ga0070717_10545487 | 3300006028 | Bacteria | 1050 |
| 194 | Ga0075365_10170226 | 3300006038 | Bacteria | 1520 |
| 195 | Ga0075363_100065816 | 3300006048 | Bacteria | 1960 |
| 196 | Ga0075363_100189473 | 3300006048 | Unclassified | 1173 |
| 197 | Ga0075364_10065740 | 3300006051 | Bacteria | 2381 |
| 198 | Ga0075364_10094181 | 3300006051 | Bacteria | 1990 |
| 199 | Ga0070715_10004439 | 3300006163 | Bacteria | 4605 |
| 200 | Ga0070715_10078408 | 3300006163 | Bacteria | 1493 |
| 201 | Ga0070716_100001496 | 3300006173 | Bacteria | 10442 |
| 202 | Ga0070716_100143669 | 3300006173 | Bacteria | 1525 |
| 203 | Ga0070712_100088257 | 3300006175 | Bacteria | 2265 |
| 204 | Ga0070712_100089481 | 3300006175 | Bacteria | 2252 |
| 205 | Ga0070712_100131262 | 3300006175 | Bacteria | 1899 |
| 206 | Ga0070712_100287399 | 3300006175 | Bacteria | 1326 |
| 207 | Ga0070712_100291413 | 3300006175 | Bacteria | 1318 |
| 208 | Ga0070712_100410798 | 3300006175 | Bacteria | 1120 |
| 209 | Ga0075367_10123283 | 3300006178 | Bacteria | 1598 |
| 210 | Ga0075367_10142658 | 3300006178 | Bacteria | 1484 |
| 211 | Ga0075367_10306648 | 3300006178 | Bacteria | 1000 |
| 212 | Ga0075369_10026213 | 3300006186 | Bacteria | 2429 |
| 213 | Ga0075369_10049002 | 3300006186 | Bacteria | 1824 |
| 214 | Ga0075427_10000244 | 3300006194 | Bacteria | 5774 |
| 215 | Ga0097621_100000010 | 3300006237 | Bacteria | 112867 |
| 216 | Ga0097621_100023529 | 3300006237 | Bacteria | 4798 |
| 217 | Ga0097621_100430511 | 3300006237 | Bacteria | 1186 |
| 218 | Ga0075370_10147377 | 3300006353 | Bacteria | 1378 |
| 219 | Ga0068871_100000034 | 3300006358 | Bacteria | 71462 |
| 220 | Ga0068871_100024903 | 3300006358 | Bacteria | 4647 |
| 221 | Ga0068871_100247916 | 3300006358 | Bacteria | 1550 |
| 222 | Ga0075428_100031223 | 3300006844 | Bacteria | 5891 |
| 223 | Ga0075428_100092372 | 3300006844 | Bacteria | 3300 |
| 224 | Ga0075428_100391600 | 3300006844 | Bacteria | 1489 |
| 225 | Ga0075430_100000342 | 3300006846 | Bacteria | 33715 |
| 226 | Ga0075430_100005373 | 3300006846 | Bacteria | 10813 |
| 227 | Ga0075430_100074548 | 3300006846 | Bacteria | 2845 |
| 228 | Ga0075431_100000004 | 3300006847 | Bacteria | 106006 |
| 229 | Ga0075431_100087697 | 3300006847 | Bacteria | 3211 |
| 230 | Ga0075431_100142954 | 3300006847 | Bacteria | 2466 |
| 231 | Ga0075433_10000774 | 3300006852 | Bacteria | 21997 |
| 232 | Ga0075433_10005737 | 3300006852 | Bacteria | 9763 |
| 233 | Ga0075433_10027741 | 3300006852 | Bacteria | 4806 |
| 234 | Ga0075433_10076722 | 3300006852 | Bacteria | 2943 |
| 235 | Ga0075434_100001700 | 3300006871 | Bacteria | 18837 |
| 236 | Ga0075434_100003565 | 3300006871 | Bacteria | 13904 |
| 237 | Ga0075434_100029000 | 3300006871 | Bacteria | 5442 |
| 238 | Ga0075434_100074508 | 3300006871 | Bacteria | 3387 |
| 239 | Ga0075434_100099878 | 3300006871 | Bacteria | 2907 |
| 240 | Ga0075434_100330032 | 3300006871 | Bacteria | 1546 |
| 241 | Ga0075429_100005048 | 3300006880 | Bacteria | 11352 |
| 242 | Ga0075429_100027666 | 3300006880 | Bacteria | 4922 |
| 243 | Ga0068865_100000230 | 3300006881 | Bacteria | 31147 |
| 244 | Ga0068865_100102449 | 3300006881 | Bacteria | 2098 |
| 245 | Ga0068865_100499780 | 3300006881 | Bacteria | 1014 |
| 246 | Ga0075436_100022521 | 3300006914 | Bacteria | 4327 |
| 247 | Ga0075436_100090174 | 3300006914 | Bacteria | 2131 |
| 248 | Ga0097620_100001353 | 3300006931 | Bacteria | 25014 |
| 249 | Ga0097620_100221535 | 3300006931 | Bacteria | 1979 |
| 250 | Ga0097620_101108663 | 3300006931 | Bacteria | 871 |
| 251 | Ga0075435_100001109 | 3300007076 | Bacteria | 17153 |
| 252 | Ga0075435_100017628 | 3300007076 | Bacteria | 5410 |
| 253 | Ga0075435_100061035 | 3300007076 | Bacteria | 3058 |
| 254 | Ga0075435_100142037 | 3300007076 | Bacteria | 2015 |
| 255 | Ga0099795_10000444 | 3300007788 | Bacteria | 7607 |
| 256 | Ga0099795_10017419 | 3300007788 | Bacteria | 2290 |
| 257 | Ga0105251_10036017 | 3300009011 | Bacteria | 2438 |
| 258 | Ga0105250_10068496 | 3300009092 | Bacteria | 1432 |
| 259 | Ga0105240_10067652 | 3300009093 | Bacteria | 4427 |
| 260 | Ga0105240_10986804 | 3300009093 | Bacteria | 902 |
| 261 | Ga0111539_10000932 | 3300009094 | Bacteria | 38323 |
| 262 | Ga0111539_10002162 | 3300009094 | Bacteria | 26296 |
| 263 | Ga0111539_10011144 | 3300009094 | Bacteria | 11310 |
| 264 | Ga0111539_10398766 | 3300009094 | Bacteria | 1602 |
| 265 | Ga0111539_10506499 | 3300009094 | Bacteria | 1406 |
| 266 | Ga0105245_10000258 | 3300009098 | Bacteria | 50464 |
| 267 | Ga0105245_10446687 | 3300009098 | Unclassified | 1301 |
| 268 | Ga0105245_10654400 | 3300009098 | Bacteria | 1081 |
| 269 | Ga0105247_10015208 | 3300009101 | Bacteria | 4614 |
| 270 | Ga0105247_10182766 | 3300009101 | Bacteria | 1400 |
| 271 | Ga0114129_10000582 | 3300009147 | Bacteria | 45047 |
| 272 | Ga0114129_10004796 | 3300009147 | Bacteria | 19116 |
| 273 | Ga0114129_10009608 | 3300009147 | Bacteria | 13796 |
| 274 | Ga0114129_10032724 | 3300009147 | Bacteria | 7347 |
| 275 | Ga0105243_10000846 | 3300009148 | Bacteria | 29054 |
| 276 | Ga0105243_10014969 | 3300009148 | Bacteria | 5872 |
| 277 | Ga0105243_10023951 | 3300009148 | Bacteria | 4651 |
| 278 | Ga0105241_10001369 | 3300009174 | Bacteria | 18579 |
| 279 | Ga0105241_10044576 | 3300009174 | Bacteria | 3361 |
| 280 | Ga0105241_10168621 | 3300009174 | Bacteria | 1806 |
| 281 | Ga0105242_10000037 | 3300009176 | Bacteria | 91293 |
| 282 | Ga0105242_10033883 | 3300009176 | Bacteria | 4093 |
| 283 | Ga0105248_10000744 | 3300009177 | Bacteria | 36599 |
| 284 | Ga0105248_10150780 | 3300009177 | Bacteria | 2623 |
| 285 | Ga0105237_10020951 | 3300009545 | Bacteria | 6730 |
| 286 | Ga0105237_10112148 | 3300009545 | Bacteria | 2719 |
| 287 | Ga0105237_10422057 | 3300009545 | Bacteria | 1339 |
| 288 | Ga0105238_10066539 | 3300009551 | Bacteria | 3605 |
| 289 | Ga0105238_10183495 | 3300009551 | Bacteria | 2069 |
| 290 | Ga0105249_10000209 | 3300009553 | Bacteria | 67037 |
| 291 | Ga0105249_10221168 | 3300009553 | Bacteria | 1863 |
| 292 | Ga0105249_10401041 | 3300009553 | Bacteria | 1402 |
| 293 | Ga0105249_10558907 | 3300009553 | Bacteria | 1196 |
| 294 | Ga0099796_10024285 | 3300010159 | Bacteria | 1902 |
| 295 | Ga0099796_10053133 | 3300010159 | Bacteria | 1413 |
| 296 | Ga0105239_10001464 | 3300010375 | Bacteria | 31391 |
| 297 | Ga0105239_10096125 | 3300010375 | Bacteria | 3273 |
| 298 | Ga0105239_10179287 | 3300010375 | Bacteria | 2370 |
| 299 | Ga0105239_10306104 | 3300010375 | Bacteria | 1790 |
| 300 | Ga0105239_10404527 | 3300010375 | Bacteria | 1545 |
| 301 | Ga0105246_10026773 | 3300011119 | Bacteria | 3772 |
| 302 | Ga0105246_10256985 | 3300011119 | Bacteria | 1389 |
| 303 | Ga0157335_1001705 | 3300012492 | Bacteria | 1242 |
| 304 | Ga0157323_1001249 | 3300012495 | Bacteria | 1244 |
| 305 | Ga0157347_1003799 | 3300012502 | Bacteria | 1375 |
| 306 | Ga0157316_1000114 | 3300012510 | Bacteria | 3720 |
| 307 | Ga0157327_1003099 | 3300012512 | Bacteria | 1202 |
| 308 | Ga0157373_10122811 | 3300013100 | Bacteria | 1825 |
| 309 | Ga0157374_10000940 | 3300013296 | Bacteria | 25358 |
| 310 | Ga0157374_10053270 | 3300013296 | Bacteria | 3771 |
| 311 | Ga0157378_10001580 | 3300013297 | Bacteria | 20573 |
| 312 | Ga0157378_10364978 | 3300013297 | Bacteria | 1414 |
| 313 | Ga0157378_10832455 | 3300013297 | Bacteria | 950 |
| 314 | Ga0163162_10001677 | 3300013306 | Bacteria | 20764 |
| 315 | Ga0163162_10009932 | 3300013306 | Bacteria | 9258 |
| 316 | Ga0163162_10181453 | 3300013306 | Bacteria | 2231 |
| 317 | Ga0163162_10248485 | 3300013306 | Bacteria | 1911 |
| 318 | Ga0163162_10426580 | 3300013306 | Bacteria | 1458 |
| 319 | Ga0157372_10109839 | 3300013307 | Bacteria | 3158 |
| 320 | Ga0157372_10120543 | 3300013307 | Bacteria | 3012 |
| 321 | Ga0157372_10136646 | 3300013307 | Bacteria | 2823 |
| 322 | Ga0157372_10432571 | 3300013307 | Bacteria | 1534 |
| 323 | Ga0157375_10000263 | 3300013308 | Bacteria | 47730 |
| 324 | Ga0157375_10368869 | 3300013308 | Bacteria | 1602 |
| 325 | Ga0157375_10443267 | 3300013308 | Bacteria | 1464 |
| 326 | Ga0163163_10010830 | 3300014325 | Bacteria | 8235 |
| 327 | Ga0163163_10019201 | 3300014325 | Bacteria | 6416 |
| 328 | Ga0163163_10279272 | 3300014325 | Bacteria | 1722 |
| 329 | Ga0157380_10000294 | 3300014326 | Bacteria | 30013 |
| 330 | Ga0157380_10256788 | 3300014326 | Bacteria | 1585 |
| 331 | Ga0157380_10357126 | 3300014326 | Bacteria | 1370 |
| 332 | Ga0157377_10001222 | 3300014745 | Bacteria | 10959 |
| 333 | Ga0157379_10002453 | 3300014968 | Bacteria | 15540 |
| 334 | Ga0157379_10027532 | 3300014968 | Bacteria | 5061 |
| 335 | Ga0157376_10000342 | 3300014969 | Bacteria | 31043 |
| 336 | Ga0157376_10036312 | 3300014969 | Bacteria | 3992 |
| 337 | Ga0157376_10537685 | 3300014969 | Unclassified | 1154 |
| 338 | Ga0163161_10000523 | 3300017792 | Bacteria | 31363 |
| 339 | Ga0163161_10089663 | 3300017792 | Bacteria | 2274 |
| 340 | Ga0206356_11304508 | 3300020070 | Bacteria | 1679 |
| 341 | Ga0206353_11340620 | 3300020082 | Bacteria | 1593 |
| 342 | Ga0213873_10003810 | 3300021358 | Bacteria | 2757 |
| 343 | Ga0213876_10008326 | 3300021384 | Bacteria | 5611 |
| 344 | Ga0213876_10033853 | 3300021384 | Bacteria | 2693 |
| 345 | Ga0213876_10035248 | 3300021384 | Bacteria | 2640 |
| 346 | Ga0213875_10000825 | 3300021388 | Bacteria | 23073 |
| 347 | Ga0213875_10002635 | 3300021388 | Bacteria | 10621 |
| 348 | Ga0213875_10105892 | 3300021388 | Bacteria | 1313 |
| 349 | Ga0224572_1007436 | 3300024225 | Bacteria | 2007 |
| 350 | Ga0228598_1016262 | 3300024227 | Bacteria | 1468 |
| 351 | Ga0207666_1000010 | 3300025271 | Bacteria | 46973 |
| 352 | Ga0207666_1001035 | 3300025271 | Bacteria | 3299 |
| 353 | Ga0207673_1000164 | 3300025290 | Bacteria | 6537 |
| 354 | Ga0209025_1000008 | 3300025294 | Bacteria | 1130876 |
| 355 | Ga0209564_1000054 | 3300025295 | Bacteria | 350653 |
| 356 | Ga0209256_1000084 | 3300025299 | Bacteria | 219257 |
| 357 | Ga0207697_10000186 | 3300025315 | Bacteria | 32405 |
| 358 | Ga0207697_10023457 | 3300025315 | Bacteria | 2526 |
| 359 | Ga0207653_10008164 | 3300025885 | Bacteria | 3263 |
| 360 | Ga0207682_10000123 | 3300025893 | Bacteria | 34953 |
| 361 | Ga0207682_10252265 | 3300025893 | Bacteria | 822 |
| 362 | Ga0207692_10016864 | 3300025898 | Bacteria | 3245 |
| 363 | Ga0207642_10000263 | 3300025899 | Bacteria | 15779 |
| 364 | Ga0207642_10029564 | 3300025899 | Bacteria | 2270 |
| 365 | Ga0207710_10011053 | 3300025900 | Bacteria | 3803 |
| 366 | Ga0207688_10000889 | 3300025901 | Bacteria | 15094 |
| 367 | Ga0207688_10056265 | 3300025901 | Bacteria | 2209 |
| 368 | Ga0207680_10001117 | 3300025903 | Bacteria | 12657 |
| 369 | Ga0207647_10005506 | 3300025904 | Bacteria | 9270 |
| 370 | Ga0207647_10046296 | 3300025904 | Bacteria | 2711 |
| 371 | Ga0207685_10001241 | 3300025905 | Bacteria | 5199 |
| 372 | Ga0207685_10061083 | 3300025905 | Bacteria | 1493 |
| 373 | Ga0207699_10030475 | 3300025906 | Bacteria | 3019 |
| 374 | Ga0207699_10033740 | 3300025906 | Bacteria | 2896 |
| 375 | Ga0207645_10000023 | 3300025907 | Bacteria | 98724 |
| 376 | Ga0207645_10020930 | 3300025907 | Bacteria | 4272 |
| 377 | Ga0207645_10051083 | 3300025907 | Bacteria | 2641 |
| 378 | Ga0207645_10146612 | 3300025907 | Bacteria | 1539 |
| 379 | Ga0207643_10000007 | 3300025908 | Bacteria | 171706 |
| 380 | Ga0207705_10343463 | 3300025909 | Bacteria | 1149 |
| 381 | Ga0207684_10377781 | 3300025910 | Bacteria | 1219 |
| 382 | Ga0207654_10020224 | 3300025911 | Bacteria | 3525 |
| 383 | Ga0207707_10002015 | 3300025912 | Bacteria | 18441 |
| 384 | Ga0207707_10056334 | 3300025912 | Bacteria | 3420 |
| 385 | Ga0207707_10094416 | 3300025912 | Bacteria | 2613 |
| 386 | Ga0207707_10112364 | 3300025912 | Bacteria | 2382 |
| 387 | Ga0207707_10274147 | 3300025912 | Bacteria | 1462 |
| 388 | Ga0207671_10008841 | 3300025914 | Bacteria | 8482 |
| 389 | Ga0207671_10224341 | 3300025914 | Bacteria | 1473 |
| 390 | Ga0207693_10012859 | 3300025915 | Bacteria | 6754 |
| 391 | Ga0207693_10026757 | 3300025915 | Bacteria | 4563 |
| 392 | Ga0207693_10106248 | 3300025915 | Bacteria | 2202 |
| 393 | Ga0207663_10004450 | 3300025916 | Bacteria | 6968 |
| 394 | Ga0207663_10040066 | 3300025916 | Bacteria | 2844 |
| 395 | Ga0207660_10000393 | 3300025917 | Bacteria | 28822 |
| 396 | Ga0207660_10005747 | 3300025917 | Bacteria | 8044 |
| 397 | Ga0207660_10319859 | 3300025917 | Bacteria | 1239 |
| 398 | Ga0207662_10000136 | 3300025918 | Bacteria | 35258 |
| 399 | Ga0207662_10011289 | 3300025918 | Bacteria | 4947 |
| 400 | Ga0207657_10004997 | 3300025919 | Bacteria | 13932 |
| 401 | Ga0207657_10005004 | 3300025919 | Bacteria | 13924 |
| 402 | Ga0207657_10036159 | 3300025919 | Bacteria | 4423 |
| 403 | Ga0207657_10055737 | 3300025919 | Bacteria | 3413 |
| 404 | Ga0207657_10126241 | 3300025919 | Bacteria | 2101 |
| 405 | Ga0207649_10000434 | 3300025920 | Bacteria | 30314 |
| 406 | Ga0207649_10045166 | 3300025920 | Bacteria | 2700 |
| 407 | Ga0207652_10001720 | 3300025921 | Bacteria | 19098 |
| 408 | Ga0207652_10016915 | 3300025921 | Bacteria | 5964 |
| 409 | Ga0207652_10073555 | 3300025921 | Bacteria | 2973 |
| 410 | Ga0207652_10119473 | 3300025921 | Bacteria | 2344 |
| 411 | Ga0207652_10208954 | 3300025921 | Bacteria | 1757 |
| 412 | Ga0207652_10293503 | 3300025921 | Bacteria | 1467 |
| 413 | Ga0207652_10396771 | 3300025921 | Bacteria | 1245 |
| 414 | Ga0207681_10000273 | 3300025923 | Bacteria | 38704 |
| 415 | Ga0207694_10052606 | 3300025924 | Bacteria | 3156 |
| 416 | Ga0207650_10001932 | 3300025925 | Bacteria | 14593 |
| 417 | Ga0207659_10000097 | 3300025926 | Bacteria | 51545 |
| 418 | Ga0207659_10347128 | 3300025926 | Unclassified | 1230 |
| 419 | Ga0207687_10001031 | 3300025927 | Bacteria | 18938 |
| 420 | Ga0207687_10028160 | 3300025927 | Bacteria | 3774 |
| 421 | Ga0207687_10443508 | 3300025927 | Bacteria | 1075 |
| 422 | Ga0207700_10000167 | 3300025928 | Bacteria | 39027 |
| 423 | Ga0207700_10165040 | 3300025928 | Bacteria | 1842 |
| 424 | Ga0207700_10449947 | 3300025928 | Bacteria | 1135 |
| 425 | Ga0207664_10235393 | 3300025929 | Bacteria | 1593 |
| 426 | Ga0207664_10241893 | 3300025929 | Bacteria | 1572 |
| 427 | Ga0207644_10001738 | 3300025931 | Bacteria | 14101 |
| 428 | Ga0207644_10061366 | 3300025931 | Bacteria | 2723 |
| 429 | Ga0207644_10113559 | 3300025931 | Bacteria | 2051 |
| 430 | Ga0207690_10000962 | 3300025932 | Bacteria | 18398 |
| 431 | Ga0207690_10148791 | 3300025932 | Bacteria | 1734 |
| 432 | Ga0207706_10000867 | 3300025933 | Bacteria | 31142 |
| 433 | Ga0207706_10017224 | 3300025933 | Bacteria | 6513 |
| 434 | Ga0207706_10021114 | 3300025933 | Bacteria | 5849 |
| 435 | Ga0207706_10036344 | 3300025933 | Bacteria | 4375 |
| 436 | Ga0207686_10000329 | 3300025934 | Bacteria | 34169 |
| 437 | Ga0207686_10076863 | 3300025934 | Bacteria | 2166 |
| 438 | Ga0207709_10000419 | 3300025935 | Bacteria | 41401 |
| 439 | Ga0207709_10045024 | 3300025935 | Bacteria | 2670 |
| 440 | Ga0207709_10101156 | 3300025935 | Bacteria | 1906 |
| 441 | Ga0207670_10000536 | 3300025936 | Bacteria | 20898 |
| 442 | Ga0207670_10053680 | 3300025936 | Bacteria | 2716 |
| 443 | Ga0207670_10057775 | 3300025936 | Bacteria | 2632 |
| 444 | Ga0207669_10002798 | 3300025937 | Bacteria | 7473 |
| 445 | Ga0207669_10073675 | 3300025937 | Bacteria | 2156 |
| 446 | Ga0207704_10000599 | 3300025938 | Bacteria | 15952 |
| 447 | Ga0207704_10238297 | 3300025938 | Bacteria | 1357 |
| 448 | Ga0207665_10000417 | 3300025939 | Bacteria | 29333 |
| 449 | Ga0207665_10087336 | 3300025939 | Bacteria | 2155 |
| 450 | Ga0207665_10181293 | 3300025939 | Bacteria | 1525 |
| 451 | Ga0207691_10000544 | 3300025940 | Bacteria | 37754 |
| 452 | Ga0207691_10023702 | 3300025940 | Bacteria | 5777 |
| 453 | Ga0207691_10170474 | 3300025940 | Bacteria | 1906 |
| 454 | Ga0207691_10276461 | 3300025940 | Bacteria | 1445 |
| 455 | Ga0207711_10002468 | 3300025941 | Bacteria | 16502 |
| 456 | Ga0207711_10011061 | 3300025941 | Bacteria | 7500 |
| 457 | Ga0207689_10001743 | 3300025942 | Bacteria | 20521 |
| 458 | Ga0207661_10000428 | 3300025944 | Bacteria | 27215 |
| 459 | Ga0207661_10190004 | 3300025944 | Bacteria | 1800 |
| 460 | Ga0207661_10444628 | 3300025944 | Bacteria | 1180 |
| 461 | Ga0207679_10000029 | 3300025945 | Bacteria | 183002 |
| 462 | Ga0207679_10294834 | 3300025945 | Bacteria | 1395 |
| 463 | Ga0207667_10017999 | 3300025949 | Bacteria | 7935 |
| 464 | Ga0207667_10099408 | 3300025949 | Bacteria | 3002 |
| 465 | Ga0207667_10162685 | 3300025949 | Bacteria | 2295 |
| 466 | Ga0207651_10000083 | 3300025960 | Bacteria | 42310 |
| 467 | Ga0207651_10153671 | 3300025960 | Bacteria | 1795 |
| 468 | Ga0207651_10169369 | 3300025960 | Bacteria | 1721 |
| 469 | Ga0207712_10000471 | 3300025961 | Bacteria | 33929 |
| 470 | Ga0207668_10278102 | 3300025972 | Bacteria | 1371 |
| 471 | Ga0207668_10353156 | 3300025972 | Bacteria | 1230 |
| 472 | Ga0207668_10547276 | 3300025972 | Unclassified | 1002 |
| 473 | Ga0207640_10000637 | 3300025981 | Bacteria | 20610 |
| 474 | Ga0207658_10002203 | 3300025986 | Bacteria | 14473 |
| 475 | Ga0207658_10041282 | 3300025986 | Bacteria | 3340 |
| 476 | Ga0207658_10041634 | 3300025986 | Bacteria | 3328 |
| 477 | Ga0207677_10000992 | 3300026023 | Bacteria | 15647 |
| 478 | Ga0207703_10005165 | 3300026035 | Bacteria | 10555 |
| 479 | Ga0207703_10008054 | 3300026035 | Bacteria | 8328 |
| 480 | Ga0207703_10044170 | 3300026035 | Bacteria | 3580 |
| 481 | Ga0207639_10005126 | 3300026041 | Bacteria | 8828 |
| 482 | Ga0207639_10196984 | 3300026041 | Bacteria | 1725 |
| 483 | Ga0207678_10001568 | 3300026067 | Bacteria | 21015 |
| 484 | Ga0207678_10021304 | 3300026067 | Bacteria | 5683 |
| 485 | Ga0207678_10029617 | 3300026067 | Bacteria | 4780 |
| 486 | Ga0207678_10055746 | 3300026067 | Bacteria | 3404 |
| 487 | Ga0207708_10002060 | 3300026075 | Bacteria | 14813 |
| 488 | Ga0207708_10005462 | 3300026075 | Bacteria | 9377 |
| 489 | Ga0207708_10017276 | 3300026075 | Bacteria | 5431 |
| 490 | Ga0207702_10001921 | 3300026078 | Bacteria | 20316 |
| 491 | Ga0207702_10080985 | 3300026078 | Bacteria | 2819 |
| 492 | Ga0207702_10148084 | 3300026078 | Bacteria | 2133 |
| 493 | Ga0207702_10399832 | 3300026078 | Bacteria | 1325 |
| 494 | Ga0207702_10441331 | 3300026078 | Bacteria | 1261 |
| 495 | Ga0207641_10000510 | 3300026088 | Bacteria | 43699 |
| 496 | Ga0207641_10055508 | 3300026088 | Bacteria | 3364 |
| 497 | Ga0207641_10105109 | 3300026088 | Bacteria | 2493 |
| 498 | Ga0207641_10556277 | 3300026088 | Bacteria | 1119 |
| 499 | Ga0207648_10003487 | 3300026089 | Bacteria | 16487 |
| 500 | Ga0207648_10107529 | 3300026089 | Bacteria | 2448 |
| 501 | Ga0207648_10132084 | 3300026089 | Bacteria | 2198 |
| 502 | Ga0207648_10212920 | 3300026089 | Bacteria | 1716 |
| 503 | Ga0207676_10003788 | 3300026095 | Bacteria | 10694 |
| 504 | Ga0207676_10028269 | 3300026095 | Bacteria | 4186 |
| 505 | Ga0207676_10280307 | 3300026095 | Bacteria | 1513 |
| 506 | Ga0207674_10000608 | 3300026116 | Bacteria | 46971 |
| 507 | Ga0207674_10141868 | 3300026116 | Bacteria | 2362 |
| 508 | Ga0207675_100000805 | 3300026118 | Bacteria | 31142 |
| 509 | Ga0207675_100026921 | 3300026118 | Bacteria | 5353 |
| 510 | Ga0207675_100255789 | 3300026118 | Bacteria | 1696 |
| 511 | Ga0207683_10000082 | 3300026121 | Bacteria | 74842 |
| 512 | Ga0207683_10006710 | 3300026121 | Bacteria | 9849 |
| 513 | Ga0207683_10107197 | 3300026121 | Bacteria | 2499 |
| 514 | Ga0207683_10136999 | 3300026121 | Bacteria | 2204 |
| 515 | Ga0207698_10000377 | 3300026142 | Bacteria | 25983 |
| 516 | Ga0209966_1001565 | 3300027695 | Bacteria | 3962 |
| 517 | Ga0209998_10000947 | 3300027717 | Bacteria | 7360 |
| 518 | Ga0209998_10007515 | 3300027717 | Bacteria | 2261 |
| 519 | Ga0207428_10000124 | 3300027907 | Bacteria | 105795 |
| 520 | Ga0207428_10000420 | 3300027907 | Bacteria | 52679 |
| 521 | Ga0207428_10000703 | 3300027907 | Bacteria | 38851 |
| 522 | Ga0268266_10481125 | 3300028379 | Bacteria | 1183 |
| 523 | Ga0268265_10001170 | 3300028380 | Bacteria | 22993 |
| 524 | Ga0268265_10017735 | 3300028380 | Bacteria | 4920 |
| 525 | Ga0268265_10114144 | 3300028380 | Bacteria | 2212 |
| 526 | Ga0268264_10001878 | 3300028381 | Bacteria | 19073 |
| 527 | Ga0268264_10047711 | 3300028381 | Bacteria | 3560 |
| 528 | Ga0265318_10089108 | 3300028577 | Bacteria | 1137 |
| 529 | Ga0265338_10049901 | 3300028800 | Bacteria | 3787 |
| 530 | Ga0265338_10057435 | 3300028800 | Bacteria | 3443 |
| 531 | Ga0265338_10060308 | 3300028800 | Bacteria | 3334 |
| 532 | Ga0265338_10212403 | 3300028800 | Bacteria | 1451 |
| 533 | Ga0265330_10044496 | 3300031235 | Bacteria | 1959 |
| 534 | Ga0265332_10006885 | 3300031238 | Bacteria | 5154 |
| 535 | Ga0265325_10000105 | 3300031241 | Bacteria | 59642 |
| 536 | Ga0265325_10005333 | 3300031241 | Bacteria | 7957 |
| 537 | Ga0265325_10045207 | 3300031241 | Bacteria | 2289 |
| 538 | Ga0265325_10076800 | 3300031241 | Bacteria | 1666 |
| 539 | Ga0265325_10077344 | 3300031241 | Bacteria | 1659 |
| 540 | Ga0265325_10083128 | 3300031241 | Bacteria | 1588 |
| 541 | Ga0265325_10111979 | 3300031241 | Bacteria | 1325 |
| 542 | Ga0265340_10009649 | 3300031247 | Bacteria | 5174 |
| 543 | Ga0265340_10013695 | 3300031247 | Bacteria | 4253 |
| 544 | Ga0265340_10134342 | 3300031247 | Bacteria | 1133 |
| 545 | Ga0265339_10000071 | 3300031249 | Bacteria | 88416 |
| 546 | Ga0265339_10008527 | 3300031249 | Bacteria | 6517 |
| 547 | Ga0265339_10012221 | 3300031249 | Bacteria | 5249 |
| 548 | Ga0265331_10048341 | 3300031250 | Bacteria | 2045 |
| 549 | Ga0265316_10054466 | 3300031344 | Bacteria | 3132 |
| 550 | Ga0265313_10000041 | 3300031595 | Bacteria | 119119 |
| 551 | Ga0265313_10000123 | 3300031595 | Bacteria | 77230 |
| 552 | Ga0265313_10012778 | 3300031595 | Bacteria | 5097 |
| 553 | Ga0265313_10024353 | 3300031595 | Bacteria | 3235 |
| 554 | Ga0265313_10024680 | 3300031595 | Bacteria | 3205 |
| 555 | Ga0265314_10000279 | 3300031711 | Bacteria | 74300 |
| 556 | Ga0265314_10017694 | 3300031711 | Bacteria | 5585 |
| 557 | Ga0265314_10022543 | 3300031711 | Bacteria | 4824 |
| 558 | Ga0265314_10085557 | 3300031711 | Bacteria | 2067 |
| 559 | Ga0265342_10000287 | 3300031712 | Bacteria | 57222 |
| 560 | Ga0265342_10001077 | 3300031712 | Bacteria | 26505 |
| 561 | Ga0265342_10070433 | 3300031712 | Bacteria | 2040 |
| 562 | Ga0316583_10003152 | 3300032133 | Bacteria | 5794 |
| 563 | Ga0373930_0000680 | 3300034816 | Bacteria | 4768 |
| 564 | Ga0373930_0014455 | 3300034816 | Bacteria | 1470 |
| 565 | Ga0373948_0000196 | 3300034817 | Bacteria | 6999 |
| 566 | Ga0373948_0000995 | 3300034817 | Bacteria | 3803 |
| 567 | Ga0373950_0002735 | 3300034818 | Bacteria | 2458 |
| 568 | Ga0373950_0005433 | 3300034818 | Bacteria | 1904 |
| 569 | Ga0373958_0002069 | 3300034819 | Bacteria | 2771 |
| 570 | Ga0373938_0000092 | 3300034957 | Bacteria | 12211 |
| 571 | Ga0373938_0003487 | 3300034957 | Bacteria | 2580 |
| 572 | Ga0373926_0041110 | 3300035083 | Bacteria | 1651 |
| 573 | Ga0373928_0005526 | 3300035084 | Bacteria | 2417 |
| 574 | Ga0373928_0014169 | 3300035084 | Bacteria | 1608 |
| 575 | Ga0373929_0000128 | 3300035085 | Bacteria | 12674 |
| 576 | Ga0373929_0027650 | 3300035085 | Bacteria | 1193 |
| 577 | Ga0373944_0002646 | 3300035089 | Bacteria | 4562 |
| 578 | Ga0373944_0033163 | 3300035089 | Bacteria | 1563 |
| 579 | Ga0373944_0058012 | 3300035089 | Bacteria | 1235 |
| 580 | Ga0373949_0000715 | 3300035090 | Bacteria | 10774 |
| 581 | Ga0373951_0000531 | 3300035091 | Bacteria | 10760 |
| 582 | Ga0373951_0003670 | 3300035091 | Bacteria | 3703 |
| 583 | Ga0373951_0011160 | 3300035091 | Bacteria | 2015 |
| 584 | Ga0373951_0019087 | 3300035091 | Bacteria | 1561 |
| 585 | Ga0373952_0006526 | 3300035092 | Bacteria | 2158 |
| 586 | Ga0373923_0002485 | 3300035111 | Bacteria | 5690 |
| 587 | Ga0373932_0000076 | 3300035112 | Bacteria | 24789 |
| 588 | Ga0373932_0000597 | 3300035112 | Bacteria | 11032 |
| 589 | Ga0373932_0002240 | 3300035112 | Bacteria | 4953 |
| 590 | Ga0373936_0000549 | 3300035113 | Bacteria | 12872 |
| 591 | Ga0373936_0007526 | 3300035113 | Bacteria | 4096 |
| 592 | Ga0373936_0106982 | 3300035113 | Bacteria | 1185 |
| 593 | Ga0373939_0000361 | 3300035114 | Bacteria | 11487 |
| 594 | Ga0373939_0000377 | 3300035114 | Bacteria | 11260 |
| 595 | Ga0373939_0004881 | 3300035114 | Bacteria | 3182 |
| 596 | Ga0373939_0016420 | 3300035114 | Bacteria | 1952 |
| 597 | Ga0373939_0067916 | 3300035114 | Bacteria | 1153 |
| 598 | Ga0373941_0000785 | 3300035115 | Bacteria | 6505 |
| 599 | Ga0373941_0020117 | 3300035115 | Bacteria | 1867 |
| 600 | Ga0373945_0001243 | 3300035116 | Bacteria | 7756 |
| 601 | Ga0373945_0017475 | 3300035116 | Bacteria | 2429 |
| 602 | Ga0373945_0085606 | 3300035116 | Bacteria | 1213 |
| 603 | Ga0373945_0219268 | 3300035116 | Bacteria | 795 |
| 604 | Ga0373953_0003524 | 3300035117 | Bacteria | 4889 |
| 605 | Ga0373953_0003611 | 3300035117 | Bacteria | 4843 |
| 606 | Ga0373953_0015593 | 3300035117 | Bacteria | 2758 |
| 607 | Ga0373954_0002142 | 3300035118 | Bacteria | 8197 |
| 608 | Ga0373954_0006240 | 3300035118 | Bacteria | 5197 |
| 609 | Ga0373954_0026910 | 3300035118 | Bacteria | 2638 |
| 610 | Ga0373954_0058317 | 3300035118 | Bacteria | 1819 |
| 611 | Ga0373956_0017526 | 3300035119 | Bacteria | 3021 |
| 612 | Ga0373956_0022257 | 3300035119 | Bacteria | 2711 |
| 613 | Ga0373956_0088184 | 3300035119 | Bacteria | 1429 |
| 614 | Ga0373957_0020017 | 3300035120 | Bacteria | 2360 |
| 615 | Ga0373957_0092184 | 3300035120 | Bacteria | 1205 |
| 616 | Ga0373960_0000204 | 3300035121 | Bacteria | 10830 |
| 617 | Ga0373960_0001684 | 3300035121 | Bacteria | 4947 |
| 618 | Ga0373943_0001090 | 3300035170 | Bacteria | 12084 |
| 619 | Ga0373943_0003538 | 3300035170 | Bacteria | 7112 |
| 620 | Ga0373943_0010676 | 3300035170 | Bacteria | 4122 |
| 621 | Ga0373943_0034932 | 3300035170 | Bacteria | 2400 |
| 622 | Ga0373943_0089584 | 3300035170 | Bacteria | 1591 |
| 623 | Ga0373946_0000383 | 3300035171 | Bacteria | 14419 |
| 624 | Ga0373946_0003985 | 3300035171 | Bacteria | 5252 |
| 625 | Ga0373946_0069708 | 3300035171 | Bacteria | 1515 |
| 626 | Ga0373955_0007092 | 3300035172 | Bacteria | 5134 |
| 627 | Ga0373955_0018458 | 3300035172 | Bacteria | 3469 |
| 628 | Ga0373955_0035405 | 3300035172 | Bacteria | 2644 |
| 629 | Ga0373955_0052349 | 3300035172 | Bacteria | 2227 |
| 630 | Ga0373942_0000813 | 3300035207 | Bacteria | 8599 |
| 631 | Ga0373942_0002869 | 3300035207 | Bacteria | 4095 |
| 632 | Ga0373942_0005195 | 3300035207 | Bacteria | 3015 |
| 633 | Ga0373961_0001827 | 3300035241 | Bacteria | 5833 |
| 634 | Ga0373924_0000144 | 3300035410 | Bacteria | 20890 |
| 635 | Ga0373924_0016721 | 3300035410 | Bacteria | 2805 |
| 636 | Ga0373924_0017856 | 3300035410 | Bacteria | 2728 |
| 637 | Ga0373924_0074497 | 3300035410 | Bacteria | 1436 |
| 638 | Ga0373924_0078058 | 3300035410 | Bacteria | 1405 |
| 639 | Ga0373924_0181907 | 3300035410 | Bacteria | 925 |
| 640 | Ga0373931_0000186 | 3300035691 | Bacteria | 26950 |
| 641 | Ga0373931_0002333 | 3300035691 | Bacteria | 8383 |
| 642 | Ga0373931_0023349 | 3300035691 | Bacteria | 3121 |
| 643 | Ga0373931_0037528 | 3300035691 | Bacteria | 2530 |
| 644 | Ga0373935_0000012 | 3300035692 | Bacteria | 81961 |
| 645 | Ga0373935_0016872 | 3300035692 | Bacteria | 4422 |
| 646 | Ga0373935_0067952 | 3300035692 | Bacteria | 2292 |
| 647 | Ga0373935_0107931 | 3300035692 | Bacteria | 1844 |
| 648 | Ga0373935_0445773 | 3300035692 | Bacteria | 934 |
| 649 | Ga0373927_0015740 | 3300035695 | Bacteria | 4993 |
| 650 | Ga0373927_0023216 | 3300035695 | Bacteria | 4063 |
| 651 | Ga0373927_0063603 | 3300035695 | Bacteria | 2386 |
| 652 | Ga0373927_0192362 | 3300035695 | Bacteria | 1339 |
| 653 | Ga0373933_0004023 | 3300035724 | Bacteria | 8105 |
| 654 | Ga0373933_0035272 | 3300035724 | Bacteria | 2921 |
| 655 | Ga0373933_0072189 | 3300035724 | Bacteria | 2102 |
| 656 | Ga0373947_0000380 | 3300035725 | Bacteria | 25117 |
| 657 | Ga0373947_0004569 | 3300035725 | Bacteria | 8119 |
| 658 | Ga0373947_0021639 | 3300035725 | Bacteria | 3723 |
| 659 | Ga0373947_0025874 | 3300035725 | Bacteria | 3424 |
| 660 | Ga0373947_0033626 | 3300035725 | Bacteria | 3028 |
| 661 | Ga0373947_0035530 | 3300035725 | Bacteria | 2950 |
| 662 | Ga0373947_0055936 | 3300035725 | Bacteria | 2384 |
| 663 | Ga0373937_0000054 | 3300036401 | Bacteria | 102542 |
| 664 | Ga0373937_0009657 | 3300036401 | Bacteria | 8402 |
| 665 | Ga0373937_0020252 | 3300036401 | Bacteria | 5962 |
| 666 | Ga0373937_0025502 | 3300036401 | Bacteria | 5336 |
| 667 | Ga0373925_0000018 | 3300037068 | Bacteria | 174213 |
| 668 | Ga0373925_0005307 | 3300037068 | Bacteria | 9621 |
| 669 | Ga0373925_0010134 | 3300037068 | Bacteria | 6842 |
| 670 | Ga0373925_0038959 | 3300037068 | Bacteria | 3516 |
| 671 | Ga0373925_0042928 | 3300037068 | Bacteria | 3355 |
| 672 | Ga0373925_0058062 | 3300037068 | Bacteria | 2900 |
| 673 | Ga0373925_0182199 | 3300037068 | Bacteria | 1663 |
| 674 | Ga0395899_0016580 | 3300037312 | Bacteria | 5619 |
| 675 | Ga0395899_0167027 | 3300037312 | Bacteria | 1552 |
| 676 | Ga0395900_0003491 | 3300037418 | Bacteria | 16965 |
| 677 | Ga0395900_0116374 | 3300037418 | Bacteria | 2743 |
| 678 | Ga0395898_0002609 | 3300037466 | Bacteria | 21035 |
| 679 | Ga0395898_0014973 | 3300037466 | Bacteria | 7963 |
| 680 | Ga0395898_0214886 | 3300037466 | Bacteria | 1834 |
| 681 | Ga0436364_0127012 | 3300037853 | Bacteria | 10123 |
| 682 | Ga0436364_0475448 | 3300037853 | Bacteria | 15369 |
| 683 | Ga0436364_0587111 | 3300037853 | Bacteria | 1976 |
| 684 | Ga0436364_1484132 | 3300037853 | Bacteria | 957 |
| 685 | Ga0395901_0005021 | 3300038443 | Bacteria | 13359 |
| 686 | Ga0395901_0026799 | 3300038443 | Bacteria | 5918 |
| 687 | Ga0395901_0281139 | 3300038443 | Bacteria | 1729 |
| 688 | Ga0436365_0276383 | 3300039437 | Bacteria | 13956 |
| 689 | Ga0436365_0676411 | 3300039437 | Bacteria | 1127 |
| 690 | Ga0436365_0823677 | 3300039437 | Bacteria | 2841 |
| 691 | Ga0436365_1193963 | 3300039437 | Bacteria | 12936 |
| 692 | Ga0436365_1224521 | 3300039437 | Bacteria | 865 |
| 693 | Ga0436365_1440616 | 3300039437 | Bacteria | 1706 |
| 694 | Ga0436365_1657521 | 3300039437 | Bacteria | 7302 |
| 695 | Ga0436363_0190862 | 3300039450 | Bacteria | 6053 |
| 696 | Ga0436362_0536014 | 3300039453 | Bacteria | 8978 |
| 697 | Ga0439453_0000510 | 3300041408 | Bacteria | 4289 |
| 698 | Ga0439443_000600 | 3300042003 | Bacteria | 3366 |
| 699 | Ga0439448_0026308 | 3300042005 | Bacteria | 1829 |
| 700 | Ga0439460_0018303 | 3300042461 | Bacteria | 1885 |
| 701 | Ga0466961_0267115 | 3300044693 | Bacteria | 1049 |
| 702 | Ga0466963_0044582 | 3300044694 | Bacteria | 2919 |
| 703 | Ga0453684_0066809 | 3300044712 | Bacteria | 4577 |
| 704 | Ga0466971_0046483 | 3300044719 | Bacteria | 1951 |
| 705 | Ga0451576_0039893 | 3300045051 | Bacteria | 4970 |
| 706 | Ga0466967_0020740 | 3300045976 | Bacteria | 5320 |
| 707 | Ga0495617_022581 | 3300046452 | Bacteria | 2127 |
| 708 | Ga0495592_0000001 | 3300046454 | Bacteria | 305819 |
| 709 | Ga0495592_0001116 | 3300046454 | Bacteria | 18677 |
| 710 | Ga0495592_0009742 | 3300046454 | Bacteria | 7231 |
| 711 | Ga0495592_0057294 | 3300046454 | Bacteria | 2876 |
| 712 | Ga0495603_0012962 | 3300046455 | Bacteria | 5041 |
| 713 | Ga0495603_0096859 | 3300046455 | Bacteria | 1723 |
| 714 | Ga0495629_0004546 | 3300046459 | Bacteria | 10380 |
| 715 | Ga0495629_0016112 | 3300046459 | Bacteria | 5367 |
| 716 | Ga0495629_0024439 | 3300046459 | Bacteria | 4302 |
| 717 | Ga0495638_0005489 | 3300046460 | Bacteria | 9427 |
| 718 | Ga0495641_0023574 | 3300046461 | Bacteria | 3053 |
| 719 | Ga0495641_0031793 | 3300046461 | Bacteria | 2518 |
| 720 | Ga0495641_0078967 | 3300046461 | Bacteria | 1474 |
| 721 | Ga0495651_0000493 | 3300046462 | Bacteria | 30523 |
| 722 | Ga0495651_0002120 | 3300046462 | Bacteria | 15325 |
| 723 | Ga0495651_0016283 | 3300046462 | Bacteria | 5757 |
| 724 | Ga0495651_0098480 | 3300046462 | Bacteria | 2182 |
| 725 | Ga0495651_0174169 | 3300046462 | Bacteria | 1529 |
| 726 | Ga0495651_0233214 | 3300046462 | Bacteria | 1266 |
| 727 | Ga0495653_0000292 | 3300046463 | Bacteria | 40544 |
| 728 | Ga0495653_0004657 | 3300046463 | Bacteria | 11097 |
| 729 | Ga0495653_0012444 | 3300046463 | Bacteria | 6947 |
| 730 | Ga0495653_0041839 | 3300046463 | Bacteria | 3574 |
| 731 | Ga0495580_0022745 | 3300046472 | Bacteria | 4608 |
| 732 | Ga0495580_0135064 | 3300046472 | Bacteria | 1710 |
| 733 | Ga0495582_0001705 | 3300046473 | Bacteria | 12400 |
| 734 | Ga0495582_0015446 | 3300046473 | Bacteria | 4193 |
| 735 | Ga0495582_0254856 | 3300046473 | Bacteria | 1006 |
| 736 | Ga0495582_0300290 | 3300046473 | Bacteria | 923 |
| 737 | Ga0495639_0019431 | 3300046475 | Bacteria | 2965 |
| 738 | Ga0495639_0033107 | 3300046475 | Bacteria | 2307 |
| 739 | Ga0495639_0109786 | 3300046475 | Unclassified | 1308 |
| 740 | Ga0495662_0001863 | 3300046476 | Bacteria | 10566 |
| 741 | Ga0495662_0009777 | 3300046476 | Bacteria | 4711 |
| 742 | Ga0495662_0023030 | 3300046476 | Bacteria | 3007 |
| 743 | Ga0495664_0000001 | 3300046477 | Bacteria | 757730 |
| 744 | Ga0495664_0001609 | 3300046477 | Bacteria | 12011 |
| 745 | Ga0495664_0042952 | 3300046477 | Bacteria | 2678 |
| 746 | Ga0495664_0052458 | 3300046477 | Bacteria | 2423 |
| 747 | Ga0495664_0072209 | 3300046477 | Bacteria | 2062 |
| 748 | Ga0495584_0048485 | 3300046491 | Bacteria | 2141 |
| 749 | Ga0495584_0181726 | 3300046491 | Bacteria | 1069 |
| 750 | Ga0495584_0213586 | 3300046491 | Bacteria | 981 |
| 751 | Ga0495585_0009128 | 3300046492 | Bacteria | 5970 |
| 752 | Ga0495594_0047336 | 3300046499 | Bacteria | 2361 |
| 753 | Ga0495594_0051362 | 3300046499 | Bacteria | 2268 |
| 754 | Ga0495594_0101905 | 3300046499 | Unclassified | 1615 |
| 755 | Ga0495607_0004288 | 3300046501 | Bacteria | 10532 |
| 756 | Ga0495608_0000050 | 3300046511 | Bacteria | 96603 |
| 757 | Ga0495608_0010562 | 3300046511 | Bacteria | 6442 |
| 758 | Ga0495608_0013937 | 3300046511 | Bacteria | 5580 |
| 759 | Ga0495608_0031723 | 3300046511 | Bacteria | 3571 |
| 760 | Ga0495608_0110542 | 3300046511 | Bacteria | 1767 |
| 761 | Ga0495618_0000045 | 3300046514 | Bacteria | 94654 |
| 762 | Ga0495618_0007452 | 3300046514 | Bacteria | 6617 |
| 763 | Ga0495618_0014982 | 3300046514 | Bacteria | 4728 |
| 764 | Ga0495618_0104793 | 3300046514 | Bacteria | 1811 |
| 765 | Ga0495618_0152558 | 3300046514 | Bacteria | 1475 |
| 766 | Ga0495628_0000003 | 3300046516 | Bacteria | 470339 |
| 767 | Ga0495628_0002046 | 3300046516 | Bacteria | 18273 |
| 768 | Ga0495628_0009974 | 3300046516 | Bacteria | 8082 |
| 769 | Ga0495628_0015110 | 3300046516 | Bacteria | 6448 |
| 770 | Ga0495628_0174495 | 3300046516 | Bacteria | 1629 |
| 771 | Ga0495630_0016265 | 3300046517 | Bacteria | 5434 |
| 772 | Ga0495630_0023584 | 3300046517 | Bacteria | 4548 |
| 773 | Ga0495630_0155120 | 3300046517 | Bacteria | 1743 |
| 774 | Ga0495630_0157643 | 3300046517 | Bacteria | 1728 |
| 775 | Ga0495630_0307552 | 3300046517 | Bacteria | 1211 |
| 776 | Ga0495644_0000514 | 3300046523 | Bacteria | 16546 |
| 777 | Ga0495644_0097456 | 3300046523 | Bacteria | 1112 |
| 778 | Ga0495666_0001847 | 3300046526 | Bacteria | 10463 |
| 779 | Ga0495666_0081428 | 3300046526 | Bacteria | 1531 |
| 780 | Ga0495652_0000001 | 3300046529 | Bacteria | 1045081 |
| 781 | Ga0495652_0020653 | 3300046529 | Bacteria | 5854 |
| 782 | Ga0495652_0032571 | 3300046529 | Bacteria | 4557 |
| 783 | Ga0495652_0043866 | 3300046529 | Bacteria | 3852 |
| 784 | Ga0495652_0260268 | 3300046529 | Unclassified | 1281 |
| 785 | Ga0495665_0006322 | 3300046531 | Bacteria | 6389 |
| 786 | Ga0495665_0052492 | 3300046531 | Bacteria | 2158 |
| 787 | Ga0495640_0000006 | 3300046533 | Bacteria | 285419 |
| 788 | Ga0495640_0057539 | 3300046533 | Bacteria | 2653 |
| 789 | Ga0495640_0075001 | 3300046533 | Bacteria | 2260 |
| 790 | Ga0495640_0081965 | 3300046533 | Bacteria | 2144 |
| 791 | Ga0495640_0099051 | 3300046533 | Bacteria | 1915 |
| 792 | Ga0495586_0010189 | 3300046535 | Bacteria | 5001 |
| 793 | Ga0495586_0027494 | 3300046535 | Bacteria | 3044 |
| 794 | Ga0495586_0044435 | 3300046535 | Bacteria | 2394 |
| 795 | Ga0495587_0000028 | 3300046536 | Bacteria | 138663 |
| 796 | Ga0495587_0000335 | 3300046536 | Bacteria | 33563 |
| 797 | Ga0495587_0027769 | 3300046536 | Bacteria | 3445 |
| 798 | Ga0495587_0280541 | 3300046536 | Bacteria | 934 |
| 799 | Ga0495609_0023913 | 3300046538 | Bacteria | 2805 |
| 800 | Ga0495609_0123127 | 3300046538 | Bacteria | 1114 |
| 801 | Ga0495645_0000004 | 3300046543 | Bacteria | 532661 |
| 802 | Ga0495645_0001781 | 3300046543 | Bacteria | 14625 |
| 803 | Ga0495622_0018802 | 3300046557 | Bacteria | 3218 |
| 804 | Ga0495622_0115086 | 3300046557 | Bacteria | 1230 |
| 805 | Ga0495633_0002107 | 3300046558 | Bacteria | 14302 |
| 806 | Ga0495667_0000001 | 3300046559 | Bacteria | 834831 |
| 807 | Ga0495667_0004928 | 3300046559 | Bacteria | 9026 |
| 808 | Ga0495667_0019211 | 3300046559 | Bacteria | 4611 |
| 809 | Ga0495667_0042835 | 3300046559 | Bacteria | 3001 |
| 810 | Ga0495656_0019735 | 3300046615 | Bacteria | 2605 |
| 811 | Ga0495656_0106492 | 3300046615 | Bacteria | 1305 |
| 812 | Ga0495634_0000531 | 3300046642 | Bacteria | 37387 |
| 813 | Ga0495634_0002372 | 3300046642 | Bacteria | 15688 |
| 814 | Ga0495634_0007696 | 3300046642 | Bacteria | 8061 |
| 815 | Ga0495634_0009588 | 3300046642 | Bacteria | 7135 |
| 816 | Ga0495634_0017766 | 3300046642 | Bacteria | 5071 |
| 817 | Ga0495634_0246960 | 3300046642 | Bacteria | 1093 |
| 818 | Ga0495635_0000007 | 3300046663 | Bacteria | 278786 |
| 819 | Ga0495635_0000736 | 3300046663 | Bacteria | 21173 |
| 820 | Ga0495635_0004379 | 3300046663 | Bacteria | 9778 |
| 821 | Ga0495635_0045113 | 3300046663 | Bacteria | 3041 |
| 822 | Ga0495635_0061837 | 3300046663 | Bacteria | 2571 |
| 823 | Ga0495635_0094383 | 3300046663 | Bacteria | 2045 |
| 824 | Ga0495659_0011224 | 3300046664 | Bacteria | 2885 |
| 825 | Ga0495661_0151950 | 3300046665 | Unclassified | 1250 |
| 826 | Ga0495588_0013623 | 3300046674 | Bacteria | 3876 |
| 827 | Ga0495588_0068823 | 3300046674 | Bacteria | 1839 |
| 828 | Ga0495657_0000136 | 3300046675 | Bacteria | 65707 |
| 829 | Ga0495657_0000836 | 3300046675 | Bacteria | 27235 |
| 830 | Ga0495657_0110571 | 3300046675 | Bacteria | 1741 |
| 831 | Ga0495599_0000002 | 3300046678 | Bacteria | 348168 |
| 832 | Ga0495599_0034592 | 3300046678 | Bacteria | 3173 |
| 833 | Ga0495599_0042654 | 3300046678 | Bacteria | 2847 |
| 834 | Ga0495623_0000052 | 3300046679 | Bacteria | 71268 |
| 835 | Ga0495623_0027709 | 3300046679 | Bacteria | 3647 |
| 836 | Ga0495623_0282093 | 3300046679 | Bacteria | 924 |
| 837 | Ga0495646_0000036 | 3300046680 | Bacteria | 81182 |
| 838 | Ga0495646_0000229 | 3300046680 | Bacteria | 27971 |
| 839 | Ga0495646_0048707 | 3300046680 | Bacteria | 2573 |
| 840 | Ga0495646_0242650 | 3300046680 | Bacteria | 968 |
| 841 | Ga0495646_0244079 | 3300046680 | Bacteria | 964 |
| 842 | Ga0495647_0021862 | 3300046681 | Bacteria | 2307 |
| 843 | Ga0495658_0000591 | 3300046683 | Bacteria | 19855 |
| 844 | Ga0495658_0002748 | 3300046683 | Bacteria | 8846 |
| 845 | Ga0495658_0100698 | 3300046683 | Bacteria | 1724 |
| 846 | Ga0495658_0102362 | 3300046683 | Bacteria | 1711 |
| 847 | Ga0495658_0286263 | 3300046683 | Bacteria | 1040 |
| 848 | Ga0495669_0047505 | 3300046684 | Bacteria | 1918 |
| 849 | Ga0495613_0014232 | 3300046689 | Bacteria | 5904 |
| 850 | Ga0495613_0047264 | 3300046689 | Bacteria | 3179 |
| 851 | Ga0495613_0168922 | 3300046689 | Bacteria | 1553 |
| 852 | Ga0495613_0274225 | 3300046689 | Bacteria | 1172 |
| 853 | Ga0495624_0009422 | 3300046690 | Bacteria | 6764 |
| 854 | Ga0495624_0062347 | 3300046690 | Bacteria | 2333 |
| 855 | Ga0495624_0234940 | 3300046690 | Bacteria | 1110 |
| 856 | Ga0495670_0008959 | 3300046691 | Bacteria | 4922 |
| 857 | Ga0495600_0000037 | 3300046809 | Bacteria | 78434 |
| 858 | Ga0495600_0004219 | 3300046809 | Bacteria | 8582 |
| 859 | Ga0495600_0009757 | 3300046809 | Bacteria | 5935 |
| 860 | Ga0495600_0017312 | 3300046809 | Bacteria | 4582 |
| 861 | Ga0495600_0100651 | 3300046809 | Bacteria | 1884 |
| 862 | Ga0495581_0017156 | 3300047315 | Bacteria | 4207 |
| 863 | Ga0495581_0035361 | 3300047315 | Bacteria | 2891 |
| 864 | Ga0495581_0049412 | 3300047315 | Bacteria | 2428 |
| 865 | Ga0495604_0000594 | 3300047317 | Bacteria | 31291 |
| 866 | Ga0495604_0006384 | 3300047317 | Bacteria | 9351 |
| 867 | Ga0495604_0021677 | 3300047317 | Bacteria | 5129 |
| 868 | Ga0495604_0028471 | 3300047317 | Bacteria | 4444 |
| 869 | Ga0495604_0043834 | 3300047317 | Bacteria | 3499 |
| 870 | Ga0495604_0130187 | 3300047317 | Bacteria | 1810 |
| 871 | Ga0495674_0000001 | 3300047319 | Bacteria | 778665 |
| 872 | Ga0495674_0034790 | 3300047319 | Bacteria | 4551 |
| 873 | Ga0495674_0036722 | 3300047319 | Bacteria | 4407 |
| 874 | Ga0495674_0040549 | 3300047319 | Bacteria | 4164 |
| 875 | Ga0495674_0050397 | 3300047319 | Bacteria | 3673 |
| 876 | Ga0495674_0103570 | 3300047319 | Bacteria | 2419 |
| 877 | Ga0495674_0319885 | 3300047319 | Bacteria | 1264 |
| 878 | Ga0495672_0139233 | 3300047320 | Bacteria | 1269 |
| 879 | Ga0495676_0017949 | 3300047321 | Bacteria | 6244 |
| 880 | Ga0495676_0191256 | 3300047321 | Bacteria | 1427 |
| 881 | Ga0495676_0218008 | 3300047321 | Bacteria | 1316 |
| 882 | Ga0495676_0260847 | 3300047321 | Bacteria | 1179 |
| 883 | Ga0495680_0000705 | 3300047322 | Bacteria | 37488 |
| 884 | Ga0495680_0005567 | 3300047322 | Bacteria | 11823 |
| 885 | Ga0495680_0008046 | 3300047322 | Bacteria | 9614 |
| 886 | Ga0495680_0015939 | 3300047322 | Bacteria | 6468 |
| 887 | Ga0495680_0034691 | 3300047322 | Bacteria | 4070 |
| 888 | Ga0495680_0036864 | 3300047322 | Bacteria | 3921 |
| 889 | Ga0495675_0000049 | 3300047444 | Bacteria | 80913 |
| 890 | Ga0495675_0000139 | 3300047444 | Bacteria | 50643 |
| 891 | Ga0495675_0072601 | 3300047444 | Bacteria | 2171 |
| 892 | Ga0495675_0155658 | 3300047444 | Bacteria | 1410 |
| 893 | Ga0495679_059603 | 3300047446 | Unclassified | 1122 |
| 894 | Ga0495684_0000046 | 3300047471 | Bacteria | 92658 |
| 895 | Ga0495684_0006324 | 3300047471 | Bacteria | 9204 |
| 896 | Ga0495684_0016053 | 3300047471 | Bacteria | 5765 |
| 897 | Ga0495684_0193138 | 3300047471 | Bacteria | 1504 |
| 898 | Ga0495593_0000276 | 3300047673 | Bacteria | 27921 |
| 899 | Ga0495593_0021108 | 3300047673 | Bacteria | 3641 |
| 900 | Ga0495593_0064941 | 3300047673 | Unclassified | 1904 |
| 901 | Ga0495602_0000102 | 3300048088 | Bacteria | 81094 |
| 902 | Ga0495602_0004714 | 3300048088 | Bacteria | 14255 |
| 903 | Ga0495602_0006950 | 3300048088 | Bacteria | 11884 |
| 904 | Ga0495602_0110768 | 3300048088 | Bacteria | 2231 |
| 905 | Ga0495602_0164889 | 3300048088 | Bacteria | 1726 |
| 906 | Ga0495614_0084354 | 3300048089 | Bacteria | 1378 |
| 907 | Ga0496100_0000057 | 3300048903 | Bacteria | 67216 |
| 908 | Ga0496100_0042904 | 3300048903 | Bacteria | 2890 |
| 909 | Ga0496100_0081989 | 3300048903 | Bacteria | 2180 |
| 910 | Ga0496100_0105814 | 3300048903 | Bacteria | 1946 |
| 911 | Ga0496100_0178414 | 3300048903 | Bacteria | 1535 |
| 912 | Ga0496101_0001297 | 3300048904 | Bacteria | 14944 |
| 913 | Ga0496101_0021335 | 3300048904 | Bacteria | 4450 |
| 914 | Ga0496101_0033105 | 3300048904 | Bacteria | 3643 |
| 915 | Ga0496101_0234131 | 3300048904 | Bacteria | 1428 |
| 916 | Ga0496101_0426633 | 3300048904 | Bacteria | 1045 |
| 917 | Ga0496101_0534310 | 3300048904 | Bacteria | 927 |
| 918 | Ga0496102_0001628 | 3300048905 | Bacteria | 19791 |
| 919 | Ga0496102_0028878 | 3300048905 | Bacteria | 4958 |
| 920 | Ga0496102_0066984 | 3300048905 | Bacteria | 3292 |
| 921 | Ga0496102_0595426 | 3300048905 | Bacteria | 1029 |
| 922 | Ga0496103_0003313 | 3300048906 | Bacteria | 9851 |
| 923 | Ga0496103_0016110 | 3300048906 | Bacteria | 4460 |
| 924 | Ga0496103_0055551 | 3300048906 | Bacteria | 2456 |
| 925 | Ga0496103_0126020 | 3300048906 | Bacteria | 1633 |
| 926 | Ga0496103_0168797 | 3300048906 | Unclassified | 1404 |
| 927 | Ga0496103_0200932 | 3300048906 | Bacteria | 1282 |
| 928 | Ga0496104_0000658 | 3300048907 | Bacteria | 29624 |
| 929 | Ga0496104_0025805 | 3300048907 | Bacteria | 5419 |
| 930 | Ga0496104_0063613 | 3300048907 | Bacteria | 3499 |
| 931 | Ga0496104_0143016 | 3300048907 | Bacteria | 2298 |
| 932 | Ga0496104_0156952 | 3300048907 | Bacteria | 2183 |
| 933 | Ga0496104_0163834 | 3300048907 | Bacteria | 2132 |
| 934 | Ga0496104_0167007 | 3300048907 | Bacteria | 2110 |
| 935 | Ga0496104_0208506 | 3300048907 | Bacteria | 1866 |
| 936 | Ga0496104_0416437 | 3300048907 | Bacteria | 1256 |
| 937 | Ga0496105_0003619 | 3300048908 | Bacteria | 11480 |
| 938 | Ga0496105_0007433 | 3300048908 | Bacteria | 8478 |
| 939 | Ga0496105_0036018 | 3300048908 | Bacteria | 4075 |
| 940 | Ga0496105_0051118 | 3300048908 | Bacteria | 3415 |
| 941 | Ga0496105_0105574 | 3300048908 | Bacteria | 2325 |
| 942 | Ga0496105_0128809 | 3300048908 | Bacteria | 2087 |
| 943 | Ga0496106_0000518 | 3300048909 | Bacteria | 27401 |
| 944 | Ga0496106_0013856 | 3300048909 | Bacteria | 5957 |
| 945 | Ga0496106_0016140 | 3300048909 | Bacteria | 5524 |
| 946 | Ga0496106_0047763 | 3300048909 | Bacteria | 3222 |
| 947 | Ga0496106_0144759 | 3300048909 | Bacteria | 1871 |
| 948 | Ga0496106_0254822 | 3300048909 | Bacteria | 1404 |
| 949 | Ga0496106_0707599 | 3300048909 | Bacteria | 803 |
| 950 | Ga0496107_0001129 | 3300048910 | Bacteria | 16115 |
| 951 | Ga0496107_0008616 | 3300048910 | Bacteria | 7063 |
| 952 | Ga0496107_0024896 | 3300048910 | Bacteria | 4236 |
| 953 | Ga0496107_0060839 | 3300048910 | Bacteria | 2733 |
| 954 | Ga0496107_0061873 | 3300048910 | Bacteria | 2711 |
| 955 | Ga0496108_0004254 | 3300048911 | Bacteria | 11528 |
| 956 | Ga0496108_0019135 | 3300048911 | Bacteria | 5620 |
| 957 | Ga0496108_0044088 | 3300048911 | Bacteria | 3724 |
| 958 | Ga0496108_0056121 | 3300048911 | Bacteria | 3308 |
| 959 | Ga0496108_0103051 | 3300048911 | Bacteria | 2435 |
| 960 | Ga0496109_0000390 | 3300048912 | Bacteria | 39843 |
| 961 | Ga0496109_0023523 | 3300048912 | Bacteria | 5470 |
| 962 | Ga0496109_0152330 | 3300048912 | Bacteria | 2165 |
| 963 | Ga0496109_0229402 | 3300048912 | Bacteria | 1746 |
| 964 | Ga0496109_0303985 | 3300048912 | Bacteria | 1504 |
| 965 | Ga0496109_0794210 | 3300048912 | Bacteria | 884 |
| 966 | Ga0496109_0834890 | 3300048912 | Bacteria | 859 |
| 967 | Ga0496110_0005641 | 3300048913 | Bacteria | 9824 |
| 968 | Ga0496110_0014086 | 3300048913 | Bacteria | 6630 |
| 969 | Ga0496110_0134828 | 3300048913 | Bacteria | 2231 |
| 970 | Ga0496110_0472443 | 3300048913 | Bacteria | 1142 |
| 971 | Ga0496110_0505888 | 3300048913 | Bacteria | 1100 |
| 972 | Ga0496111_0020628 | 3300048914 | Bacteria | 4590 |
| 973 | Ga0496111_0027669 | 3300048914 | Bacteria | 4014 |
| 974 | Ga0496112_0025896 | 3300048915 | Bacteria | 5636 |
| 975 | Ga0496112_0083042 | 3300048915 | Bacteria | 3168 |
| 976 | Ga0496112_0102485 | 3300048915 | Bacteria | 2832 |
| 977 | Ga0496112_0146823 | 3300048915 | Bacteria | 2327 |
| 978 | Ga0496112_0714661 | 3300048915 | Bacteria | 929 |
| 979 | Ga0496113_0019170 | 3300048916 | Bacteria | 4780 |
| 980 | Ga0496113_0042842 | 3300048916 | Bacteria | 3346 |
| 981 | Ga0496113_0112080 | 3300048916 | Bacteria | 2125 |
| 982 | Ga0496113_0259097 | 3300048916 | Bacteria | 1389 |
| 983 | Ga0496113_0363296 | 3300048916 | Bacteria | 1161 |
| 984 | Ga0496114_0017408 | 3300048917 | Bacteria | 5800 |
| 985 | Ga0496114_0046938 | 3300048917 | Bacteria | 3590 |
| 986 | Ga0496114_0132574 | 3300048917 | Bacteria | 2153 |
| 987 | Ga0496114_0134615 | 3300048917 | Bacteria | 2136 |
| 988 | Ga0496115_0035160 | 3300048918 | Bacteria | 3963 |
| 989 | Ga0496115_0076771 | 3300048918 | Bacteria | 2715 |
| 990 | Ga0496115_0133400 | 3300048918 | Bacteria | 2047 |
| 991 | Ga0496115_0282997 | 3300048918 | Bacteria | 1361 |
| 992 | Ga0496115_0496336 | 3300048918 | Unclassified | 981 |
| 993 | Ga0496117_0030252 | 3300048920 | Bacteria | 4158 |
| 994 | Ga0496118_0160205 | 3300048921 | Bacteria | 1393 |
| 995 | Ga0496122_0076861 | 3300048925 | Bacteria | 2347 |
| 996 | Ga0501031_0039966 | 3300049568 | Bacteria | 3062 |
| 997 | Ga0501031_0079010 | 3300049568 | Bacteria | 2144 |
| 998 | Ga0501032_0012835 | 3300049569 | Bacteria | 5974 |
| 999 | Ga0501032_0022754 | 3300049569 | Bacteria | 4342 |
| 1000 | Ga0501032_0052659 | 3300049569 | Bacteria | 2742 |
| 1001 | Ga0501033_0007713 | 3300049570 | Bacteria | 8348 |
| 1002 | Ga0501034_0000032 | 3300049571 | Bacteria | 243763 |
| 1003 | Ga0501034_0002292 | 3300049571 | Bacteria | 23472 |
| 1004 | Ga0501034_0020882 | 3300049571 | Bacteria | 6685 |
| 1005 | Ga0501034_0025918 | 3300049571 | Bacteria | 5972 |
| 1006 | Ga0501034_0076586 | 3300049571 | Bacteria | 3352 |
| 1007 | Ga0501034_0204225 | 3300049571 | Bacteria | 1933 |
| 1008 | Ga0501034_0207143 | 3300049571 | Bacteria | 1917 |
| 1009 | Ga0501034_0251449 | 3300049571 | Bacteria | 1712 |
| 1010 | Ga0501034_0299608 | 3300049571 | Bacteria | 1544 |
| 1011 | Ga0501034_0722591 | 3300049571 | Bacteria | 893 |
| 1012 | Ga0501034_0730953 | 3300049571 | Bacteria | 886 |
| 1013 | Ga0501036_0000609 | 3300049572 | Bacteria | 25966 |
| 1014 | Ga0501036_0014893 | 3300049572 | Bacteria | 6487 |
| 1015 | Ga0501036_0054800 | 3300049572 | Bacteria | 3378 |
| 1016 | Ga0501036_0377075 | 3300049572 | Bacteria | 1184 |
| 1017 | Ga0501037_0007571 | 3300049573 | Bacteria | 7951 |
| 1018 | Ga0501037_0073348 | 3300049573 | Bacteria | 2488 |
| 1019 | Ga0501037_0110404 | 3300049573 | Bacteria | 1981 |
| 1020 | Ga0501037_0294719 | 3300049573 | Bacteria | 1127 |
| 1021 | Ga0501037_0438789 | 3300049573 | Bacteria | 892 |
| 1022 | Ga0501038_0016827 | 3300049574 | Bacteria | 6618 |
| 1023 | Ga0501038_0126668 | 3300049574 | Bacteria | 2101 |
| 1024 | Ga0501038_0316124 | 3300049574 | Bacteria | 1222 |
| 1025 | Ga0501038_0390858 | 3300049574 | Bacteria | 1077 |
| 1026 | Ga0501038_0425503 | 3300049574 | Bacteria | 1024 |
| 1027 | Ga0501038_0597506 | 3300049574 | Bacteria | 835 |
| 1028 | Ga0501039_0012258 | 3300049575 | Bacteria | 6536 |
| 1029 | Ga0501039_0038774 | 3300049575 | Bacteria | 3679 |
| 1030 | Ga0501039_0119837 | 3300049575 | Bacteria | 2061 |
| 1031 | Ga0501042_0067234 | 3300049578 | Bacteria | 2562 |
| 1032 | Ga0501042_0084572 | 3300049578 | Bacteria | 2275 |
| 1033 | Ga0501043_0002387 | 3300049579 | Bacteria | 15915 |
| 1034 | Ga0501043_0016255 | 3300049579 | Bacteria | 5836 |
| 1035 | Ga0501043_0195245 | 3300049579 | Bacteria | 1573 |
| 1036 | Ga0501043_0218784 | 3300049579 | Bacteria | 1474 |
| 1037 | Ga0501043_0371185 | 3300049579 | Bacteria | 1084 |
| 1038 | Ga0501043_0382596 | 3300049579 | Bacteria | 1065 |
| 1039 | Ga0501046_0151657 | 3300049580 | Bacteria | 1748 |
| 1040 | Ga0501047_0000228 | 3300049581 | Bacteria | 66588 |
| 1041 | Ga0501047_0013114 | 3300049581 | Bacteria | 7849 |
| 1042 | Ga0501047_0027357 | 3300049581 | Bacteria | 5493 |
| 1043 | Ga0501047_0083218 | 3300049581 | Bacteria | 3075 |
| 1044 | Ga0501047_0090816 | 3300049581 | Bacteria | 2931 |
| 1045 | Ga0501047_0101345 | 3300049581 | Bacteria | 2759 |
| 1046 | Ga0501047_0435531 | 3300049581 | Bacteria | 1141 |
| 1047 | Ga0501048_0000467 | 3300049582 | Bacteria | 28373 |
| 1048 | Ga0501048_0374345 | 3300049582 | Bacteria | 1016 |
| 1049 | Ga0501067_0135133 | 3300049583 | Bacteria | 1373 |
| 1050 | Ga0501069_0081539 | 3300049585 | Bacteria | 1822 |
| 1051 | Ga0501069_0090888 | 3300049585 | Bacteria | 1726 |
| 1052 | Ga0501070_0008372 | 3300049586 | Bacteria | 8739 |
| 1053 | Ga0501070_0008780 | 3300049586 | Bacteria | 8545 |
| 1054 | Ga0501070_0027861 | 3300049586 | Bacteria | 4738 |
| 1055 | Ga0501070_0038930 | 3300049586 | Bacteria | 3967 |
| 1056 | Ga0501070_0046289 | 3300049586 | Bacteria | 3617 |
| 1057 | Ga0501070_0126899 | 3300049586 | Bacteria | 2108 |
| 1058 | Ga0501070_0180504 | 3300049586 | Bacteria | 1737 |
| 1059 | Ga0501070_0226485 | 3300049586 | Bacteria | 1532 |
| 1060 | Ga0501071_0279435 | 3300049587 | Bacteria | 1263 |
| 1061 | Ga0501072_0279283 | 3300049588 | Bacteria | 1328 |
| 1062 | Ga0501072_0321239 | 3300049588 | Bacteria | 1230 |
| 1063 | Ga0501073_0005395 | 3300049589 | Bacteria | 9578 |
| 1064 | Ga0501073_0016516 | 3300049589 | Bacteria | 5351 |
| 1065 | Ga0501073_0016906 | 3300049589 | Bacteria | 5283 |
| 1066 | Ga0501073_0047845 | 3300049589 | Bacteria | 3004 |
| 1067 | Ga0501073_0059193 | 3300049589 | Bacteria | 2676 |
| 1068 | Ga0501073_0167408 | 3300049589 | Bacteria | 1522 |
| 1069 | Ga0501073_0271689 | 3300049589 | Bacteria | 1170 |
| 1070 | Ga0501074_0003305 | 3300049590 | Bacteria | 11407 |
| 1071 | Ga0501074_0119873 | 3300049590 | Bacteria | 1881 |
| 1072 | Ga0501076_0160613 | 3300049592 | Bacteria | 1830 |
| 1073 | Ga0501077_0118487 | 3300049593 | Bacteria | 1678 |
| 1074 | Ga0501077_0312791 | 3300049593 | Bacteria | 1001 |
| 1075 | Ga0501079_0012178 | 3300049741 | Bacteria | 6566 |
| 1076 | Ga0501080_0000112 | 3300049742 | Bacteria | 56408 |
| 1077 | Ga0501080_0013759 | 3300049742 | Bacteria | 7450 |
| 1078 | Ga0501080_0050861 | 3300049742 | Bacteria | 3855 |
| 1079 | Ga0501080_0053206 | 3300049742 | Bacteria | 3768 |
| 1080 | Ga0501080_0420448 | 3300049742 | Bacteria | 1201 |
| 1081 | Ga0501081_0022376 | 3300049743 | Bacteria | 4229 |
| 1082 | Ga0501083_0001098 | 3300049744 | Bacteria | 18074 |
| 1083 | Ga0501083_0011138 | 3300049744 | Bacteria | 6313 |
| 1084 | Ga0501083_0051420 | 3300049744 | Bacteria | 2771 |
| 1085 | Ga0501083_0363135 | 3300049744 | Bacteria | 941 |
| 1086 | Ga0501035_0001573 | 3300049822 | Bacteria | 23232 |
| 1087 | Ga0501035_0012556 | 3300049822 | Bacteria | 7826 |
| 1088 | Ga0501035_0047298 | 3300049822 | Bacteria | 3862 |
| 1089 | Ga0501035_0125846 | 3300049822 | Bacteria | 2237 |
| 1090 | Ga0501035_0222004 | 3300049822 | Bacteria | 1613 |
| 1091 | Ga0501044_0015838 | 3300049823 | Bacteria | 8112 |
| 1092 | Ga0501044_0017602 | 3300049823 | Bacteria | 7664 |
| 1093 | Ga0501044_0059118 | 3300049823 | Bacteria | 3928 |
| 1094 | Ga0501044_0229370 | 3300049823 | Bacteria | 1805 |
| 1095 | Ga0501044_0291111 | 3300049823 | Bacteria | 1564 |
| 1096 | Ga0501044_0346740 | 3300049823 | Bacteria | 1405 |
| 1097 | Ga0501045_0509016 | 3300049824 | Bacteria | 894 |
| 1098 | nmdc:mga03683_118853_c1 | 3300050489 | Bacteria | 1174 |
| 1099 | nmdc:mga03n38_125692_c1 | 3300050490 | Unclassified | 1265 |
| 1100 | nmdc:mga03n38_92959_c1 | 3300050490 | Bacteria | 1440 |
| 1101 | nmdc:mga06z11_98530_c1 | 3300050494 | Bacteria | 1600 |
| 1102 | nmdc:mga07m45_53349_c1 | 3300050496 | Bacteria | 2284 |
| 1103 | nmdc:mga05p37_313858_c1 | 3300050507 | Bacteria | 1858 |
| 1104 | nmdc:mga05p37_45_c1 | 3300050507 | Bacteria | 81140 |
| 1105 | nmdc:mga05p37_9625_c1 | 3300050507 | Bacteria | 11448 |
| 1106 | nmdc:mga09592_1055_c1 | 3300050508 | Bacteria | 21846 |
| 1107 | nmdc:mga09592_16858_c1 | 3300050508 | Bacteria | 5978 |
| 1108 | nmdc:mga0qj67_136078_c1 | 3300050509 | Bacteria | 1991 |
| 1109 | nmdc:mga0qj67_201_c1 | 3300050509 | Bacteria | 40409 |
| 1110 | nmdc:mga0qj67_21795_c1 | 3300050509 | Bacteria | 4915 |
| 1111 | nmdc:mga0qj67_471394_c1 | 3300050509 | Bacteria | 1010 |
| 1112 | nmdc:mga0qj67_701_c1 | 3300050509 | Bacteria | 22836 |
| 1113 | nmdc:mga06r32_119_c1 | 3300050510 | Bacteria | 56718 |
| 1114 | nmdc:mga06r32_227_c1 | 3300050510 | Bacteria | 45651 |
| 1115 | nmdc:mga06r32_538051_c1 | 3300050510 | Bacteria | 1143 |
| 1116 | nmdc:mga06r32_684495_c1 | 3300050510 | Bacteria | 992 |
| 1117 | nmdc:mga08y16_1191_c1 | 3300050511 | Bacteria | 25691 |
| 1118 | nmdc:mga08y16_1666_c1 | 3300050511 | Bacteria | 22506 |
| 1119 | nmdc:mga08y16_359795_c1 | 3300050511 | Bacteria | 1494 |
| 1120 | nmdc:mga08y16_437677_c1 | 3300050511 | Bacteria | 1335 |
| 1121 | nmdc:mga08y16_636_c1 | 3300050511 | Bacteria | 32950 |
| 1122 | nmdc:mga08y16_87220_c1 | 3300050511 | Bacteria | 3251 |
| 1123 | nmdc:mga0n895_147000_c1 | 3300050512 | Bacteria | 2387 |
| 1124 | nmdc:mga0n895_153246_c1 | 3300050512 | Bacteria | 2335 |
| 1125 | nmdc:mga0n895_4930_c1 | 3300050512 | Bacteria | 11073 |
| 1126 | nmdc:mga0n895_50_c1 | 3300050512 | Bacteria | 71634 |
| 1127 | nmdc:mga0rr50_17122_c1 | 3300050513 | Bacteria | 4829 |
| 1128 | nmdc:mga0rr50_19371_c1 | 3300050513 | Bacteria | 4592 |
| 1129 | nmdc:mga0rr50_235652_c1 | 3300050513 | Bacteria | 1516 |
| 1130 | nmdc:mga0rr50_398005_c1 | 3300050513 | Bacteria | 1163 |
| 1131 | nmdc:mga0rr50_511473_c1 | 3300050513 | Bacteria | 1021 |
| 1132 | nmdc:mga0rr50_67221_c1 | 3300050513 | Bacteria | 2722 |
| 1133 | nmdc:mga08x19_107491_c1 | 3300050514 | Bacteria | 1857 |
| 1134 | nmdc:mga08x19_20074_c1 | 3300050514 | Bacteria | 4112 |
| 1135 | nmdc:mga08x19_51336_c1 | 3300050514 | Bacteria | 2649 |
| 1136 | nmdc:mga08x19_73725_c1 | 3300050514 | Bacteria | 2229 |
| 1137 | nmdc:mga0a205_173299_c1 | 3300050515 | Bacteria | 2053 |
| 1138 | nmdc:mga0a205_21352_c1 | 3300050515 | Bacteria | 6125 |
| 1139 | nmdc:mga0a205_2228_c1 | 3300050515 | Bacteria | 17060 |
| 1140 | nmdc:mga0a205_25091_c1 | 3300050515 | Bacteria | 4403 |
| 1141 | nmdc:mga0a205_4901_c1 | 3300050515 | Bacteria | 12033 |
| 1142 | Ga0495601_0000006 | 3300053077 | Bacteria | 373770 |
| 1143 | Ga0495601_0000204 | 3300053077 | Bacteria | 31605 |
| 1144 | Ga0495601_0002295 | 3300053077 | Bacteria | 10791 |
| 1145 | Ga0495601_0002402 | 3300053077 | Bacteria | 10631 |
| 1146 | Ga0495601_0004165 | 3300053077 | Bacteria | 8337 |
| 1147 | Ga0495601_0011343 | 3300053077 | Bacteria | 5327 |
| 1148 | Ga0495601_0056978 | 3300053077 | Bacteria | 2475 |
| 1149 | Ga0495601_0111497 | 3300053077 | Bacteria | 1772 |
| 1150 | Ga0495601_0201861 | 3300053077 | Bacteria | 1299 |
| 1151 | Ga0495612_0000004 | 3300053078 | Bacteria | 286946 |
| 1152 | Ga0495612_0000384 | 3300053078 | Bacteria | 17659 |
| 1153 | Ga0495612_0011006 | 3300053078 | Bacteria | 3652 |
| 1154 | Ga0495612_0012068 | 3300053078 | Bacteria | 3480 |
| 1155 | Ga0495612_0040105 | 3300053078 | Bacteria | 1907 |
| 1156 | Ga0495612_0051614 | 3300053078 | Bacteria | 1690 |
| 1157 | Ga0495655_0015468 | 3300053083 | Bacteria | 1622 |
| 1158 | Ga0495595_0000227 | 3300053084 | Bacteria | 22346 |
| 1159 | Ga0495595_0000577 | 3300053084 | Bacteria | 14028 |
| 1160 | Ga0495595_0000686 | 3300053084 | Bacteria | 12928 |
| 1161 | Ga0495595_0001081 | 3300053084 | Bacteria | 10545 |
| 1162 | Ga0495595_0002024 | 3300053084 | Bacteria | 7872 |
| 1163 | Ga0495595_0023885 | 3300053084 | Bacteria | 2696 |
| 1164 | Ga0495595_0071131 | 3300053084 | Bacteria | 1644 |
| 1165 | Ga0495595_0098390 | 3300053084 | Bacteria | 1410 |
| 1166 | Ga0495595_0214467 | 3300053084 | Bacteria | 960 |
| 1167 | Ga0495619_0000027 | 3300053085 | Bacteria | 165001 |
| 1168 | Ga0495619_0000260 | 3300053085 | Bacteria | 38574 |
| 1169 | Ga0495619_0000655 | 3300053085 | Bacteria | 22730 |
| 1170 | Ga0495619_0015754 | 3300053085 | Bacteria | 4785 |
| 1171 | Ga0495619_0017989 | 3300053085 | Bacteria | 4481 |
| 1172 | Ga0495619_0024139 | 3300053085 | Bacteria | 3899 |
| 1173 | Ga0495619_0061424 | 3300053085 | Bacteria | 2501 |
| 1174 | Ga0495619_0072372 | 3300053085 | Bacteria | 2308 |
| 1175 | Ga0500643_002725 | 3300053087 | Bacteria | 8862 |
| 1176 | Ga0500644_0000577 | 3300053088 | Bacteria | 14139 |
| 1177 | Ga0500651_0016523 | 3300053093 | Bacteria | 4542 |
| 1178 | Ga0500566_0060690 | 3300053094 | Bacteria | 2141 |
| 1179 | Ga0500641_0018081 | 3300053096 | Bacteria | 2646 |
| 1180 | Ga0500562_032073 | 3300053108 | Bacteria | 1387 |
| 1181 | Ga0500595_000144 | 3300053119 | Bacteria | 46478 |
| 1182 | Ga0500595_082593 | 3300053119 | Bacteria | 938 |
| 1183 | Ga0500652_000016 | 3300053131 | Bacteria | 126768 |
| 1184 | Ga0500652_066720 | 3300053131 | Bacteria | 1487 |
| 1185 | Ga0500588_0070355 | 3300053146 | Bacteria | 1146 |
| 1186 | Ga0500616_0000006 | 3300053153 | Bacteria | 944738 |
| 1187 | Ga0500616_0011270 | 3300053153 | Bacteria | 5293 |
| 1188 | Ga0500627_0124195 | 3300053158 | Bacteria | 1165 |
| 1189 | Ga0500636_0021600 | 3300053177 | Bacteria | 3810 |
| 1190 | Ga0500645_001128 | 3300053730 | Bacteria | 14550 |
| 1191 | Ga0501084_0053053 | 3300054114 | Bacteria | 3391 |
| 1192 | Ga0501084_0072817 | 3300054114 | Bacteria | 2878 |
| 1193 | Ga0501084_0212725 | 3300054114 | Bacteria | 1631 |
| 1194 | Ga0501084_0644990 | 3300054114 | Bacteria | 894 |
| 1195 | Ga0501082_0021751 | 3300060353 | Bacteria | 5530 |
| 1196 | Ga0501082_0147860 | 3300060353 | Bacteria | 2040 |
| 1197 | Ga0501082_0239674 | 3300060353 | Bacteria | 1578 |
| 1198 | Ga0501082_0290502 | 3300060353 | Bacteria | 1423 |
| 1199 | Ga0466962_0099785 | 3300061719 | Bacteria | 1394 |
| 1200 | Ga0530510_0107937 | 3300061734 | Bacteria | 2038 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046514 | Ga0495618_0104793 | Ga0495618_0104793_18_761 | 241 |
| 2 | 3300048904 | Ga0496101_0426633 | Ga0496101_0426633_31_786 | 247 |
| 3 | 3300048905 | Ga0496102_0595426 | Ga0496102_0595426_238_993 | 247 |
| 4 | 3300049573 | Ga0501037_0438789 | Ga0501037_0438789_113_856 | 247 |
| 5 | 3300053146 | Ga0500588_0070355 | Ga0500588_0070355_17_814 | 247 |
| 6 | 3300035116 | Ga0373945_0219268 | Ga0373945_0219268_32_781 | 249 |
| 7 | 3300047319 | Ga0495674_0103570 | Ga0495674_0103570_1652_2401 | 249 |
| 8 | 3300049571 | Ga0501034_0722591 | Ga0501034_0722591_20_784 | 249 |
| 9 | 3300048912 | Ga0496109_0834890 | Ga0496109_0834890_69_830 | 253 |
| 10 | 3300048909 | Ga0496106_0707599 | Ga0496106_0707599_13_780 | 255 |
| 11 | 3300048918 | Ga0496115_0282997 | Ga0496115_0282997_11_796 | 255 |
| 12 | 3300049574 | Ga0501038_0597506 | Ga0501038_0597506_13_780 | 255 |
| 13 | 3300046491 | Ga0495584_0181726 | Ga0495584_0181726_35_862 | 259 |
| 14 | 3300026089 | Ga0207648_10212920 | Ga0207648_102129203 | 260 |
| 15 | iso_pu_bacteria | 2909042592 | 2909043742 | 261 |
| 16 | 3300049571 | Ga0501034_0251449 | Ga0501034_0251449_799_1590 | 262 |
| 17 | iso_pu_bacteria | 2643221547 | 2643755536 | 262 |
| 18 | iso_pu_bacteria | 2643221734 | 2644735199 | 262 |
| 19 | iso_pu_bacteria | 2818991467 | 2819720765 | 262 |
| 20 | iso_pu_bacteria | 2841911363 | 2841913180 | 262 |
| 21 | iso_pu_bacteria | 2841917233 | 2841918927 | 262 |
| 22 | iso_pu_bacteria | 2851182111 | 2851184236 | 262 |
| 23 | 3300026035 | Ga0207703_10008054 | Ga0207703_1000805411 | 263 |
| 24 | 3300005340 | Ga0070689_100087747 | Ga0070689_1000877473 | 264 |
| 25 | 3300005354 | Ga0070675_100142606 | Ga0070675_1001426062 | 264 |
| 26 | 3300005364 | Ga0070673_100377892 | Ga0070673_1003778922 | 264 |
| 27 | 3300005456 | Ga0070678_100060421 | Ga0070678_1000604214 | 264 |
| 28 | 3300005458 | Ga0070681_10186025 | Ga0070681_101860252 | 264 |
| 29 | 3300006237 | Ga0097621_100430511 | Ga0097621_1004305112 | 264 |
| 30 | 3300009177 | Ga0105248_10150780 | Ga0105248_101507803 | 264 |
| 31 | 3300010159 | Ga0099796_10053133 | Ga0099796_100531331 | 264 |
| 32 | 3300010375 | Ga0105239_10404527 | Ga0105239_104045271 | 264 |
| 33 | 3300013306 | Ga0163162_10248485 | Ga0163162_102484852 | 264 |
| 34 | 3300014325 | Ga0163163_10279272 | Ga0163163_102792722 | 264 |
| 35 | 3300014326 | Ga0157380_10357126 | Ga0157380_103571261 | 264 |
| 36 | 3300025893 | Ga0207682_10252265 | Ga0207682_102522651 | 264 |
| 37 | 3300025899 | Ga0207642_10029564 | Ga0207642_100295642 | 264 |
| 38 | 3300025907 | Ga0207645_10146612 | Ga0207645_101466121 | 264 |
| 39 | 3300025912 | Ga0207707_10274147 | Ga0207707_102741472 | 264 |
| 40 | 3300025931 | Ga0207644_10061366 | Ga0207644_100613662 | 264 |
| 41 | 3300025936 | Ga0207670_10053680 | Ga0207670_100536802 | 264 |
| 42 | 3300025938 | Ga0207704_10238297 | Ga0207704_102382972 | 264 |
| 43 | 3300025940 | Ga0207691_10276461 | Ga0207691_102764612 | 264 |
| 44 | 3300025941 | Ga0207711_10011061 | Ga0207711_100110618 | 264 |
| 45 | 3300025972 | Ga0207668_10353156 | Ga0207668_103531562 | 264 |
| 46 | 3300026095 | Ga0207676_10280307 | Ga0207676_102803072 | 264 |
| 47 | 3300026121 | Ga0207683_10107197 | Ga0207683_101071972 | 264 |
| 48 | 3300028380 | Ga0268265_10114144 | Ga0268265_101141443 | 264 |
| 49 | 3300035119 | Ga0373956_0022257 | Ga0373956_0022257_30_836 | 264 |
| 50 | 3300035691 | Ga0373931_0023349 | Ga0373931_0023349_492_1286 | 264 |
| 51 | 3300035695 | Ga0373927_0192362 | Ga0373927_0192362_133_927 | 264 |
| 52 | 3300039437 | Ga0436365_1224521 | Ga0436365_1224521_20_814 | 264 |
| 53 | 3300048906 | Ga0496103_0200932 | Ga0496103_0200932_396_1190 | 264 |
| 54 | 3300048909 | Ga0496106_0144759 | Ga0496106_0144759_513_1307 | 264 |
| 55 | 3300048910 | Ga0496107_0060839 | Ga0496107_0060839_154_948 | 264 |
| 56 | 3300048911 | Ga0496108_0056121 | Ga0496108_0056121_1159_1953 | 264 |
| 57 | 3300048912 | Ga0496109_0794210 | Ga0496109_0794210_40_834 | 264 |
| 58 | 3300048915 | Ga0496112_0714661 | Ga0496112_0714661_71_865 | 264 |
| 59 | 3300048917 | Ga0496114_0017408 | Ga0496114_0017408_1614_2408 | 264 |
| 60 | 3300049568 | Ga0501031_0039966 | Ga0501031_0039966_129_923 | 264 |
| 61 | 3300049573 | Ga0501037_0294719 | Ga0501037_0294719_272_1066 | 264 |
| 62 | 3300049574 | Ga0501038_0390858 | Ga0501038_0390858_252_1046 | 264 |
| 63 | 3300049575 | Ga0501039_0119837 | Ga0501039_0119837_802_1596 | 264 |
| 64 | 3300049578 | Ga0501042_0084572 | Ga0501042_0084572_1204_1998 | 264 |
| 65 | 3300049581 | Ga0501047_0435531 | Ga0501047_0435531_96_890 | 264 |
| 66 | 3300049582 | Ga0501048_0374345 | Ga0501048_0374345_136_930 | 264 |
| 67 | 3300049585 | Ga0501069_0090888 | Ga0501069_0090888_836_1630 | 264 |
| 68 | 3300049586 | Ga0501070_0027861 | Ga0501070_0027861_3799_4593 | 264 |
| 69 | 3300049587 | Ga0501071_0279435 | Ga0501071_0279435_199_993 | 264 |
| 70 | 3300049742 | Ga0501080_0050861 | Ga0501080_0050861_900_1694 | 264 |
| 71 | 3300049744 | Ga0501083_0363135 | Ga0501083_0363135_47_841 | 264 |
| 72 | 3300049823 | Ga0501044_0346740 | Ga0501044_0346740_14_808 | 264 |
| 73 | 3300053083 | Ga0495655_0015468 | Ga0495655_0015468_554_1348 | 264 |
| 74 | 3300054114 | Ga0501084_0053053 | Ga0501084_0053053_746_1540 | 264 |
| 75 | 3300054114 | Ga0501084_0644990 | Ga0501084_0644990_62_856 | 264 |
| 76 | 3300060353 | Ga0501082_0290502 | Ga0501082_0290502_492_1286 | 264 |
| 77 | 3300005548 | Ga0070665_100633126 | Ga0070665_1006331262 | 265 |
| 78 | 3300005981 | Ga0081538_10006841 | Ga0081538_100068412 | 265 |
| 79 | 3300006028 | Ga0070717_10545487 | Ga0070717_105454871 | 265 |
| 80 | 3300006846 | Ga0075430_100074548 | Ga0075430_1000745482 | 265 |
| 81 | 3300006871 | Ga0075434_100074508 | Ga0075434_1000745082 | 265 |
| 82 | 3300006914 | Ga0075436_100022521 | Ga0075436_1000225214 | 265 |
| 83 | 3300006914 | Ga0075436_100090174 | Ga0075436_1000901742 | 265 |
| 84 | 3300009545 | Ga0105237_10422057 | Ga0105237_104220571 | 265 |
| 85 | 3300031238 | Ga0265332_10006885 | Ga0265332_100068854 | 265 |
| 86 | 3300031247 | Ga0265340_10009649 | Ga0265340_100096495 | 265 |
| 87 | 3300031249 | Ga0265339_10008527 | Ga0265339_100085273 | 265 |
| 88 | 3300031711 | Ga0265314_10022543 | Ga0265314_100225436 | 265 |
| 89 | 3300031712 | Ga0265342_10000287 | Ga0265342_1000028717 | 265 |
| 90 | 3300035113 | Ga0373936_0106982 | Ga0373936_0106982_29_826 | 265 |
| 91 | 3300035117 | Ga0373953_0015593 | Ga0373953_0015593_1583_2380 | 265 |
| 92 | 3300035692 | Ga0373935_0107931 | Ga0373935_0107931_734_1531 | 265 |
| 93 | 3300037068 | Ga0373925_0042928 | Ga0373925_0042928_1655_2452 | 265 |
| 94 | 3300039437 | Ga0436365_1440616 | Ga0436365_1440616_110_907 | 265 |
| 95 | 3300046460 | Ga0495638_0005489 | Ga0495638_0005489_5187_6038 | 265 |
| 96 | 3300046477 | Ga0495664_0072209 | Ga0495664_0072209_815_1675 | 265 |
| 97 | 3300046642 | Ga0495634_0246960 | Ga0495634_0246960_38_835 | 265 |
| 98 | 3300046680 | Ga0495646_0242650 | Ga0495646_0242650_34_831 | 265 |
| 99 | 3300046680 | Ga0495646_0244079 | Ga0495646_0244079_25_885 | 265 |
| 100 | 3300048913 | Ga0496110_0134828 | Ga0496110_0134828_1033_1842 | 265 |
| 101 | 3300048917 | Ga0496114_0132574 | Ga0496114_0132574_158_967 | 265 |
| 102 | 3300048918 | Ga0496115_0035160 | Ga0496115_0035160_32_829 | 265 |
| 103 | 3300049589 | Ga0501073_0271689 | Ga0501073_0271689_336_1136 | 265 |
| 104 | 3300050509 | nmdc:mga0qj67_136078_c1 | nmdc:mga0qj67_136078_c1_10_807 | 265 |
| 105 | 3300050510 | nmdc:mga06r32_684495_c1 | nmdc:mga06r32_684495_c1_61_858 | 265 |
| 106 | 3300050511 | nmdc:mga08y16_437677_c1 | nmdc:mga08y16_437677_c1_128_925 | 265 |
| 107 | 3300050514 | nmdc:mga08x19_51336_c1 | nmdc:mga08x19_51336_c1_163_960 | 265 |
| 108 | 3300053108 | Ga0500562_032073 | Ga0500562_032073_414_1265 | 265 |
| 109 | 2209111006 | 2214544913 | 2213593225 | 266 |
| 110 | 3300000041 | ARcpr5oldR_c000030 | ARcpr5oldR_0000308 | 266 |
| 111 | 3300000042 | ARSoilYngRDRAFT_c00022 | ARSoilYngRDRAFT_0002222 | 266 |
| 112 | 3300000043 | ARcpr5yngRDRAFT_c000011 | ARcpr5yngRDRAFT_00001137 | 266 |
| 113 | 3300000044 | ARSoilOldRDRAFT_c000040 | ARSoilOldRDRAFT_00004028 | 266 |
| 114 | 3300000652 | ARCol0yngRDRAFT_1000028 | ARCol0yngRDRAFT_10000288 | 266 |
| 115 | 3300001989 | JGI24739J22299_10000164 | JGI24739J22299_100001649 | 266 |
| 116 | 3300001990 | JGI24737J22298_10004205 | JGI24737J22298_100042052 | 266 |
| 117 | 3300002070 | JGI24750J21931_1000178 | JGI24750J21931_10001789 | 266 |
| 118 | 3300002073 | JGI24745J21846_1000640 | JGI24745J21846_10006402 | 266 |
| 119 | 3300002075 | JGI24738J21930_10000112 | JGI24738J21930_100001125 | 266 |
| 120 | 3300002126 | JGI24035J26624_1000424 | JGI24035J26624_10004242 | 266 |
| 121 | 3300002155 | JGI24033J26618_1001840 | JGI24033J26618_10018402 | 266 |
| 122 | 3300003187 | JGI25151J46595_10000066 | JGI25151J46595_1000006630 | 266 |
| 123 | 3300003187 | JGI25151J46595_10000311 | JGI25151J46595_1000031116 | 266 |
| 124 | 3300003771 | Ga0055526_1000051 | Ga0055526_1000051132 | 266 |
| 125 | 3300003775 | Ga0055524_1006832 | Ga0055524_10068322 | 266 |
| 126 | 3300005289 | Ga0065704_10077858 | Ga0065704_100778583 | 266 |
| 127 | 3300005293 | Ga0065715_10001682 | Ga0065715_1000168210 | 266 |
| 128 | 3300005328 | Ga0070676_10003775 | Ga0070676_100037754 | 266 |
| 129 | 3300005329 | Ga0070683_100000376 | Ga0070683_10000037617 | 266 |
| 130 | 3300005330 | Ga0070690_100002745 | Ga0070690_1000027459 | 266 |
| 131 | 3300005330 | Ga0070690_100006745 | Ga0070690_1000067452 | 266 |
| 132 | 3300005330 | Ga0070690_100008317 | Ga0070690_1000083177 | 266 |
| 133 | 3300005331 | Ga0070670_100004417 | Ga0070670_10000441712 | 266 |
| 134 | 3300005331 | Ga0070670_100129375 | Ga0070670_1001293752 | 266 |
| 135 | 3300005333 | Ga0070677_10000049 | Ga0070677_100000499 | 266 |
| 136 | 3300005333 | Ga0070677_10099367 | Ga0070677_100993671 | 266 |
| 137 | 3300005334 | Ga0068869_100000523 | Ga0068869_1000005236 | 266 |
| 138 | 3300005335 | Ga0070666_10002781 | Ga0070666_1000278111 | 266 |
| 139 | 3300005335 | Ga0070666_10279884 | Ga0070666_102798841 | 266 |
| 140 | 3300005336 | Ga0070680_100005313 | Ga0070680_1000053139 | 266 |
| 141 | 3300005336 | Ga0070680_100036737 | Ga0070680_1000367373 | 266 |
| 142 | 3300005336 | Ga0070680_100045410 | Ga0070680_1000454102 | 266 |
| 143 | 3300005336 | Ga0070680_100086664 | Ga0070680_1000866641 | 266 |
| 144 | 3300005336 | Ga0070680_100400114 | Ga0070680_1004001142 | 266 |
| 145 | 3300005336 | Ga0070680_100403209 | Ga0070680_1004032092 | 266 |
| 146 | 3300005337 | Ga0070682_100000141 | Ga0070682_10000014111 | 266 |
| 147 | 3300005337 | Ga0070682_100010927 | Ga0070682_1000109276 | 266 |
| 148 | 3300005337 | Ga0070682_100076162 | Ga0070682_1000761623 | 266 |
| 149 | 3300005337 | Ga0070682_100115378 | Ga0070682_1001153782 | 266 |
| 150 | 3300005338 | Ga0068868_100009105 | Ga0068868_1000091052 | 266 |
| 151 | 3300005339 | Ga0070660_100001073 | Ga0070660_10000107317 | 266 |
| 152 | 3300005339 | Ga0070660_100089025 | Ga0070660_1000890252 | 266 |
| 153 | 3300005339 | Ga0070660_100130758 | Ga0070660_1001307582 | 266 |
| 154 | 3300005339 | Ga0070660_100243176 | Ga0070660_1002431763 | 266 |
| 155 | 3300005340 | Ga0070689_100028024 | Ga0070689_1000280242 | 266 |
| 156 | 3300005340 | Ga0070689_100081166 | Ga0070689_1000811662 | 266 |
| 157 | 3300005341 | Ga0070691_10004687 | Ga0070691_100046877 | 266 |
| 158 | 3300005341 | Ga0070691_10020023 | Ga0070691_100200234 | 266 |
| 159 | 3300005343 | Ga0070687_100000212 | Ga0070687_10000021221 | 266 |
| 160 | 3300005343 | Ga0070687_100088613 | Ga0070687_1000886133 | 266 |
| 161 | 3300005344 | Ga0070661_100000242 | Ga0070661_10000024238 | 266 |
| 162 | 3300005345 | Ga0070692_10003806 | Ga0070692_100038066 | 266 |
| 163 | 3300005345 | Ga0070692_10010557 | Ga0070692_100105574 | 266 |
| 164 | 3300005347 | Ga0070668_100003395 | Ga0070668_1000033959 | 266 |
| 165 | 3300005347 | Ga0070668_100204842 | Ga0070668_1002048422 | 266 |
| 166 | 3300005353 | Ga0070669_100006805 | Ga0070669_1000068055 | 266 |
| 167 | 3300005353 | Ga0070669_100147979 | Ga0070669_1001479791 | 266 |
| 168 | 3300005354 | Ga0070675_100000165 | Ga0070675_10000016527 | 266 |
| 169 | 3300005354 | Ga0070675_100011029 | Ga0070675_1000110292 | 266 |
| 170 | 3300005354 | Ga0070675_100169015 | Ga0070675_1001690152 | 266 |
| 171 | 3300005355 | Ga0070671_100001907 | Ga0070671_10000190710 | 266 |
| 172 | 3300005355 | Ga0070671_100124562 | Ga0070671_1001245622 | 266 |
| 173 | 3300005356 | Ga0070674_100000450 | Ga0070674_1000004506 | 266 |
| 174 | 3300005356 | Ga0070674_100124608 | Ga0070674_1001246082 | 266 |
| 175 | 3300005364 | Ga0070673_100001190 | Ga0070673_1000011903 | 266 |
| 176 | 3300005364 | Ga0070673_100269588 | Ga0070673_1002695882 | 266 |
| 177 | 3300005365 | Ga0070688_100004815 | Ga0070688_1000048157 | 266 |
| 178 | 3300005365 | Ga0070688_100016577 | Ga0070688_1000165772 | 266 |
| 179 | 3300005365 | Ga0070688_100035808 | Ga0070688_1000358083 | 266 |
| 180 | 3300005366 | Ga0070659_100000988 | Ga0070659_10000098819 | 266 |
| 181 | 3300005366 | Ga0070659_100031422 | Ga0070659_1000314222 | 266 |
| 182 | 3300005366 | Ga0070659_100070846 | Ga0070659_1000708463 | 266 |
| 183 | 3300005367 | Ga0070667_100019884 | Ga0070667_1000198842 | 266 |
| 184 | 3300005367 | Ga0070667_100072875 | Ga0070667_1000728753 | 266 |
| 185 | 3300005367 | Ga0070667_100095000 | Ga0070667_1000950002 | 266 |
| 186 | 3300005406 | Ga0070703_10001274 | Ga0070703_100012747 | 266 |
| 187 | 3300005406 | Ga0070703_10015056 | Ga0070703_100150562 | 266 |
| 188 | 3300005434 | Ga0070709_10088128 | Ga0070709_100881283 | 266 |
| 189 | 3300005434 | Ga0070709_10110858 | Ga0070709_101108581 | 266 |
| 190 | 3300005435 | Ga0070714_100036808 | Ga0070714_1000368081 | 266 |
| 191 | 3300005435 | Ga0070714_100096255 | Ga0070714_1000962551 | 266 |
| 192 | 3300005435 | Ga0070714_100161493 | Ga0070714_1001614933 | 266 |
| 193 | 3300005436 | Ga0070713_100007886 | Ga0070713_1000078862 | 266 |
| 194 | 3300005436 | Ga0070713_100021911 | Ga0070713_1000219112 | 266 |
| 195 | 3300005436 | Ga0070713_100270860 | Ga0070713_1002708602 | 266 |
| 196 | 3300005436 | Ga0070713_100586696 | Ga0070713_1005866961 | 266 |
| 197 | 3300005437 | Ga0070710_10004737 | Ga0070710_100047372 | 266 |
| 198 | 3300005437 | Ga0070710_10020849 | Ga0070710_100208492 | 266 |
| 199 | 3300005437 | Ga0070710_10108647 | Ga0070710_101086472 | 266 |
| 200 | 3300005438 | Ga0070701_10006218 | Ga0070701_100062182 | 266 |
| 201 | 3300005439 | Ga0070711_100016051 | Ga0070711_1000160513 | 266 |
| 202 | 3300005439 | Ga0070711_100046246 | Ga0070711_1000462462 | 266 |
| 203 | 3300005439 | Ga0070711_100154569 | Ga0070711_1001545692 | 266 |
| 204 | 3300005439 | Ga0070711_100223464 | Ga0070711_1002234641 | 266 |
| 205 | 3300005439 | Ga0070711_100373822 | Ga0070711_1003738222 | 266 |
| 206 | 3300005440 | Ga0070705_100003041 | Ga0070705_1000030416 | 266 |
| 207 | 3300005440 | Ga0070705_100015515 | Ga0070705_1000155152 | 266 |
| 208 | 3300005440 | Ga0070705_100082775 | Ga0070705_1000827752 | 266 |
| 209 | 3300005441 | Ga0070700_100000364 | Ga0070700_10000036421 | 266 |
| 210 | 3300005441 | Ga0070700_100012444 | Ga0070700_1000124444 | 266 |
| 211 | 3300005444 | Ga0070694_100001077 | Ga0070694_1000010776 | 266 |
| 212 | 3300005444 | Ga0070694_100246067 | Ga0070694_1002460672 | 266 |
| 213 | 3300005455 | Ga0070663_100000417 | Ga0070663_1000004176 | 266 |
| 214 | 3300005455 | Ga0070663_100015967 | Ga0070663_1000159672 | 266 |
| 215 | 3300005455 | Ga0070663_100091393 | Ga0070663_1000913932 | 266 |
| 216 | 3300005455 | Ga0070663_100111194 | Ga0070663_1001111942 | 266 |
| 217 | 3300005456 | Ga0070678_100001012 | Ga0070678_10000101216 | 266 |
| 218 | 3300005456 | Ga0070678_100050152 | Ga0070678_1000501522 | 266 |
| 219 | 3300005456 | Ga0070678_100418488 | Ga0070678_1004184882 | 266 |
| 220 | 3300005457 | Ga0070662_100000796 | Ga0070662_10000079617 | 266 |
| 221 | 3300005457 | Ga0070662_100032145 | Ga0070662_1000321452 | 266 |
| 222 | 3300005458 | Ga0070681_10002475 | Ga0070681_1000247516 | 266 |
| 223 | 3300005458 | Ga0070681_10037631 | Ga0070681_100376312 | 266 |
| 224 | 3300005458 | Ga0070681_10049230 | Ga0070681_100492302 | 266 |
| 225 | 3300005458 | Ga0070681_10358405 | Ga0070681_103584052 | 266 |
| 226 | 3300005459 | Ga0068867_100006779 | Ga0068867_1000067792 | 266 |
| 227 | 3300005466 | Ga0070685_10000547 | Ga0070685_1000054723 | 266 |
| 228 | 3300005466 | Ga0070685_10060757 | Ga0070685_100607573 | 266 |
| 229 | 3300005467 | Ga0070706_100195631 | Ga0070706_1001956312 | 266 |
| 230 | 3300005468 | Ga0070707_100308853 | Ga0070707_1003088532 | 266 |
| 231 | 3300005530 | Ga0070679_100002268 | Ga0070679_1000022689 | 266 |
| 232 | 3300005530 | Ga0070679_100075945 | Ga0070679_1000759452 | 266 |
| 233 | 3300005530 | Ga0070679_100089819 | Ga0070679_1000898192 | 266 |
| 234 | 3300005530 | Ga0070679_100100033 | Ga0070679_1001000331 | 266 |
| 235 | 3300005530 | Ga0070679_100206516 | Ga0070679_1002065162 | 266 |
| 236 | 3300005530 | Ga0070679_100327434 | Ga0070679_1003274341 | 266 |
| 237 | 3300005535 | Ga0070684_100000755 | Ga0070684_1000007556 | 266 |
| 238 | 3300005535 | Ga0070684_100396824 | Ga0070684_1003968241 | 266 |
| 239 | 3300005539 | Ga0068853_100000483 | Ga0068853_1000004832 | 266 |
| 240 | 3300005539 | Ga0068853_100605614 | Ga0068853_1006056141 | 266 |
| 241 | 3300005539 | Ga0068853_100767834 | Ga0068853_1007678341 | 266 |
| 242 | 3300005543 | Ga0070672_100000527 | Ga0070672_1000005276 | 266 |
| 243 | 3300005543 | Ga0070672_100426835 | Ga0070672_1004268351 | 266 |
| 244 | 3300005543 | Ga0070672_100649010 | Ga0070672_1006490102 | 266 |
| 245 | 3300005544 | Ga0070686_100004541 | Ga0070686_1000045417 | 266 |
| 246 | 3300005544 | Ga0070686_100028407 | Ga0070686_1000284073 | 266 |
| 247 | 3300005545 | Ga0070695_100005295 | Ga0070695_1000052951 | 266 |
| 248 | 3300005545 | Ga0070695_100016829 | Ga0070695_1000168295 | 266 |
| 249 | 3300005545 | Ga0070695_100124151 | Ga0070695_1001241512 | 266 |
| 250 | 3300005545 | Ga0070695_100217729 | Ga0070695_1002177292 | 266 |
| 251 | 3300005546 | Ga0070696_100004211 | Ga0070696_1000042112 | 266 |
| 252 | 3300005546 | Ga0070696_100181293 | Ga0070696_1001812933 | 266 |
| 253 | 3300005547 | Ga0070693_100000199 | Ga0070693_10000019921 | 266 |
| 254 | 3300005547 | Ga0070693_100042452 | Ga0070693_1000424523 | 266 |
| 255 | 3300005547 | Ga0070693_100067261 | Ga0070693_1000672614 | 266 |
| 256 | 3300005549 | Ga0070704_100000987 | Ga0070704_10000098712 | 266 |
| 257 | 3300005549 | Ga0070704_100116040 | Ga0070704_1001160401 | 266 |
| 258 | 3300005563 | Ga0068855_100004444 | Ga0068855_10000444417 | 266 |
| 259 | 3300005563 | Ga0068855_100015363 | Ga0068855_1000153636 | 266 |
| 260 | 3300005563 | Ga0068855_100054935 | Ga0068855_1000549353 | 266 |
| 261 | 3300005563 | Ga0068855_100193345 | Ga0068855_1001933452 | 266 |
| 262 | 3300005564 | Ga0070664_100000895 | Ga0070664_10000089519 | 266 |
| 263 | 3300005577 | Ga0068857_100001816 | Ga0068857_1000018162 | 266 |
| 264 | 3300005577 | Ga0068857_100084708 | Ga0068857_1000847083 | 266 |
| 265 | 3300005578 | Ga0068854_100001812 | Ga0068854_1000018128 | 266 |
| 266 | 3300005614 | Ga0068856_100002507 | Ga0068856_1000025077 | 266 |
| 267 | 3300005614 | Ga0068856_100062535 | Ga0068856_1000625351 | 266 |
| 268 | 3300005614 | Ga0068856_100167359 | Ga0068856_1001673592 | 266 |
| 269 | 3300005615 | Ga0070702_100005184 | Ga0070702_1000051844 | 266 |
| 270 | 3300005616 | Ga0068852_100003253 | Ga0068852_1000032538 | 266 |
| 271 | 3300005617 | Ga0068859_100001353 | Ga0068859_1000013539 | 266 |
| 272 | 3300005617 | Ga0068859_100221537 | Ga0068859_1002215373 | 266 |
| 273 | 3300005617 | Ga0068859_101108608 | Ga0068859_1011086081 | 266 |
| 274 | 3300005618 | Ga0068864_100000227 | Ga0068864_10000022746 | 266 |
| 275 | 3300005618 | Ga0068864_100082790 | Ga0068864_1000827902 | 266 |
| 276 | 3300005718 | Ga0068866_10001093 | Ga0068866_1000109313 | 266 |
| 277 | 3300005719 | Ga0068861_100003517 | Ga0068861_1000035179 | 266 |
| 278 | 3300005719 | Ga0068861_100115406 | Ga0068861_1001154062 | 266 |
| 279 | 3300005834 | Ga0068851_10037270 | Ga0068851_100372703 | 266 |
| 280 | 3300005840 | Ga0068870_10000062 | Ga0068870_1000006239 | 266 |
| 281 | 3300005841 | Ga0068863_100000495 | Ga0068863_10000049540 | 266 |
| 282 | 3300005842 | Ga0068858_100000783 | Ga0068858_10000078337 | 266 |
| 283 | 3300005842 | Ga0068858_100112690 | Ga0068858_1001126904 | 266 |
| 284 | 3300005842 | Ga0068858_100195456 | Ga0068858_1001954562 | 266 |
| 285 | 3300005843 | Ga0068860_100022350 | Ga0068860_1000223504 | 266 |
| 286 | 3300005844 | Ga0068862_100003647 | Ga0068862_1000036478 | 266 |
| 287 | 3300005844 | Ga0068862_100139944 | Ga0068862_1001399441 | 266 |
| 288 | 3300005937 | Ga0081455_10000204 | Ga0081455_1000020474 | 266 |
| 289 | 3300005981 | Ga0081538_10005964 | Ga0081538_100059648 | 266 |
| 290 | 3300005983 | Ga0081540_1012611 | Ga0081540_10126112 | 266 |
| 291 | 3300005985 | Ga0081539_10064755 | Ga0081539_100647552 | 266 |
| 292 | 3300006028 | Ga0070717_10011080 | Ga0070717_100110802 | 266 |
| 293 | 3300006028 | Ga0070717_10347463 | Ga0070717_103474633 | 266 |
| 294 | 3300006038 | Ga0075365_10170226 | Ga0075365_101702261 | 266 |
| 295 | 3300006048 | Ga0075363_100065816 | Ga0075363_1000658162 | 266 |
| 296 | 3300006048 | Ga0075363_100189473 | Ga0075363_1001894731 | 266 |
| 297 | 3300006051 | Ga0075364_10065740 | Ga0075364_100657401 | 266 |
| 298 | 3300006051 | Ga0075364_10094181 | Ga0075364_100941812 | 266 |
| 299 | 3300006163 | Ga0070715_10004439 | Ga0070715_100044393 | 266 |
| 300 | 3300006163 | Ga0070715_10078408 | Ga0070715_100784082 | 266 |
| 301 | 3300006173 | Ga0070716_100001496 | Ga0070716_1000014967 | 266 |
| 302 | 3300006173 | Ga0070716_100143669 | Ga0070716_1001436691 | 266 |
| 303 | 3300006175 | Ga0070712_100088257 | Ga0070712_1000882572 | 266 |
| 304 | 3300006175 | Ga0070712_100089481 | Ga0070712_1000894812 | 266 |
| 305 | 3300006175 | Ga0070712_100131262 | Ga0070712_1001312622 | 266 |
| 306 | 3300006175 | Ga0070712_100287399 | Ga0070712_1002873992 | 266 |
| 307 | 3300006175 | Ga0070712_100291413 | Ga0070712_1002914132 | 266 |
| 308 | 3300006175 | Ga0070712_100410798 | Ga0070712_1004107981 | 266 |
| 309 | 3300006178 | Ga0075367_10123283 | Ga0075367_101232831 | 266 |
| 310 | 3300006178 | Ga0075367_10142658 | Ga0075367_101426582 | 266 |
| 311 | 3300006178 | Ga0075367_10306648 | Ga0075367_103066481 | 266 |
| 312 | 3300006186 | Ga0075369_10026213 | Ga0075369_100262132 | 266 |
| 313 | 3300006186 | Ga0075369_10049002 | Ga0075369_100490021 | 266 |
| 314 | 3300006194 | Ga0075427_10000244 | Ga0075427_100002446 | 266 |
| 315 | 3300006237 | Ga0097621_100000010 | Ga0097621_10000001043 | 266 |
| 316 | 3300006237 | Ga0097621_100023529 | Ga0097621_1000235292 | 266 |
| 317 | 3300006353 | Ga0075370_10147377 | Ga0075370_101473771 | 266 |
| 318 | 3300006358 | Ga0068871_100000034 | Ga0068871_10000003428 | 266 |
| 319 | 3300006358 | Ga0068871_100024903 | Ga0068871_1000249034 | 266 |
| 320 | 3300006358 | Ga0068871_100247916 | Ga0068871_1002479162 | 266 |
| 321 | 3300006844 | Ga0075428_100031223 | Ga0075428_1000312232 | 266 |
| 322 | 3300006844 | Ga0075428_100092372 | Ga0075428_1000923722 | 266 |
| 323 | 3300006844 | Ga0075428_100391600 | Ga0075428_1003916002 | 266 |
| 324 | 3300006846 | Ga0075430_100000342 | Ga0075430_1000003423 | 266 |
| 325 | 3300006846 | Ga0075430_100005373 | Ga0075430_1000053735 | 266 |
| 326 | 3300006847 | Ga0075431_100000004 | Ga0075431_10000000434 | 266 |
| 327 | 3300006847 | Ga0075431_100087697 | Ga0075431_1000876972 | 266 |
| 328 | 3300006847 | Ga0075431_100142954 | Ga0075431_1001429543 | 266 |
| 329 | 3300006852 | Ga0075433_10000774 | Ga0075433_100007748 | 266 |
| 330 | 3300006852 | Ga0075433_10005737 | Ga0075433_100057377 | 266 |
| 331 | 3300006852 | Ga0075433_10027741 | Ga0075433_100277412 | 266 |
| 332 | 3300006852 | Ga0075433_10076722 | Ga0075433_100767222 | 266 |
| 333 | 3300006871 | Ga0075434_100001700 | Ga0075434_10000170018 | 266 |
| 334 | 3300006871 | Ga0075434_100003565 | Ga0075434_10000356512 | 266 |
| 335 | 3300006871 | Ga0075434_100029000 | Ga0075434_1000290004 | 266 |
| 336 | 3300006871 | Ga0075434_100099878 | Ga0075434_1000998782 | 266 |
| 337 | 3300006871 | Ga0075434_100330032 | Ga0075434_1003300322 | 266 |
| 338 | 3300006880 | Ga0075429_100005048 | Ga0075429_1000050482 | 266 |
| 339 | 3300006880 | Ga0075429_100027666 | Ga0075429_1000276662 | 266 |
| 340 | 3300006881 | Ga0068865_100000230 | Ga0068865_10000023030 | 266 |
| 341 | 3300006881 | Ga0068865_100102449 | Ga0068865_1001024492 | 266 |
| 342 | 3300006881 | Ga0068865_100499780 | Ga0068865_1004997801 | 266 |
| 343 | 3300006931 | Ga0097620_100001353 | Ga0097620_1000013539 | 266 |
| 344 | 3300006931 | Ga0097620_100221535 | Ga0097620_1002215353 | 266 |
| 345 | 3300006931 | Ga0097620_101108663 | Ga0097620_1011086631 | 266 |
| 346 | 3300007076 | Ga0075435_100001109 | Ga0075435_1000011099 | 266 |
| 347 | 3300007076 | Ga0075435_100017628 | Ga0075435_1000176287 | 266 |
| 348 | 3300007076 | Ga0075435_100061035 | Ga0075435_1000610352 | 266 |
| 349 | 3300007076 | Ga0075435_100142037 | Ga0075435_1001420372 | 266 |
| 350 | 3300007788 | Ga0099795_10000444 | Ga0099795_100004448 | 266 |
| 351 | 3300007788 | Ga0099795_10017419 | Ga0099795_100174193 | 266 |
| 352 | 3300009011 | Ga0105251_10036017 | Ga0105251_100360172 | 266 |
| 353 | 3300009092 | Ga0105250_10068496 | Ga0105250_100684962 | 266 |
| 354 | 3300009093 | Ga0105240_10067652 | Ga0105240_100676523 | 266 |
| 355 | 3300009093 | Ga0105240_10986804 | Ga0105240_109868041 | 266 |
| 356 | 3300009094 | Ga0111539_10000932 | Ga0111539_1000093218 | 266 |
| 357 | 3300009094 | Ga0111539_10002162 | Ga0111539_1000216221 | 266 |
| 358 | 3300009094 | Ga0111539_10011144 | Ga0111539_1001114411 | 266 |
| 359 | 3300009094 | Ga0111539_10398766 | Ga0111539_103987662 | 266 |
| 360 | 3300009094 | Ga0111539_10506499 | Ga0111539_105064991 | 266 |
| 361 | 3300009098 | Ga0105245_10000258 | Ga0105245_1000025832 | 266 |
| 362 | 3300009098 | Ga0105245_10446687 | Ga0105245_104466872 | 266 |
| 363 | 3300009098 | Ga0105245_10654400 | Ga0105245_106544001 | 266 |
| 364 | 3300009101 | Ga0105247_10015208 | Ga0105247_100152083 | 266 |
| 365 | 3300009101 | Ga0105247_10182766 | Ga0105247_101827662 | 266 |
| 366 | 3300009147 | Ga0114129_10000582 | Ga0114129_1000058237 | 266 |
| 367 | 3300009147 | Ga0114129_10004796 | Ga0114129_100047962 | 266 |
| 368 | 3300009147 | Ga0114129_10009608 | Ga0114129_1000960811 | 266 |
| 369 | 3300009147 | Ga0114129_10032724 | Ga0114129_100327242 | 266 |
| 370 | 3300009148 | Ga0105243_10000846 | Ga0105243_1000084617 | 266 |
| 371 | 3300009148 | Ga0105243_10014969 | Ga0105243_100149694 | 266 |
| 372 | 3300009148 | Ga0105243_10023951 | Ga0105243_100239516 | 266 |
| 373 | 3300009174 | Ga0105241_10001369 | Ga0105241_100013692 | 266 |
| 374 | 3300009174 | Ga0105241_10044576 | Ga0105241_100445762 | 266 |
| 375 | 3300009174 | Ga0105241_10168621 | Ga0105241_101686211 | 266 |
| 376 | 3300009176 | Ga0105242_10000037 | Ga0105242_1000003761 | 266 |
| 377 | 3300009176 | Ga0105242_10033883 | Ga0105242_100338834 | 266 |
| 378 | 3300009177 | Ga0105248_10000744 | Ga0105248_1000074416 | 266 |
| 379 | 3300009545 | Ga0105237_10020951 | Ga0105237_100209516 | 266 |
| 380 | 3300009545 | Ga0105237_10112148 | Ga0105237_101121483 | 266 |
| 381 | 3300009551 | Ga0105238_10066539 | Ga0105238_100665394 | 266 |
| 382 | 3300009551 | Ga0105238_10183495 | Ga0105238_101834952 | 266 |
| 383 | 3300009553 | Ga0105249_10000209 | Ga0105249_1000020952 | 266 |
| 384 | 3300009553 | Ga0105249_10221168 | Ga0105249_102211682 | 266 |
| 385 | 3300009553 | Ga0105249_10401041 | Ga0105249_104010412 | 266 |
| 386 | 3300009553 | Ga0105249_10558907 | Ga0105249_105589071 | 266 |
| 387 | 3300010159 | Ga0099796_10024285 | Ga0099796_100242852 | 266 |
| 388 | 3300010375 | Ga0105239_10001464 | Ga0105239_1000146416 | 266 |
| 389 | 3300010375 | Ga0105239_10096125 | Ga0105239_100961254 | 266 |
| 390 | 3300010375 | Ga0105239_10179287 | Ga0105239_101792872 | 266 |
| 391 | 3300010375 | Ga0105239_10306104 | Ga0105239_103061042 | 266 |
| 392 | 3300011119 | Ga0105246_10026773 | Ga0105246_100267732 | 266 |
| 393 | 3300011119 | Ga0105246_10256985 | Ga0105246_102569851 | 266 |
| 394 | 3300012492 | Ga0157335_1001705 | Ga0157335_10017051 | 266 |
| 395 | 3300012495 | Ga0157323_1001249 | Ga0157323_10012492 | 266 |
| 396 | 3300012502 | Ga0157347_1003799 | Ga0157347_10037991 | 266 |
| 397 | 3300012510 | Ga0157316_1000114 | Ga0157316_10001142 | 266 |
| 398 | 3300012512 | Ga0157327_1003099 | Ga0157327_10030993 | 266 |
| 399 | 3300013100 | Ga0157373_10122811 | Ga0157373_101228112 | 266 |
| 400 | 3300013296 | Ga0157374_10000940 | Ga0157374_100009402 | 266 |
| 401 | 3300013296 | Ga0157374_10053270 | Ga0157374_100532702 | 266 |
| 402 | 3300013297 | Ga0157378_10001580 | Ga0157378_1000158012 | 266 |
| 403 | 3300013297 | Ga0157378_10364978 | Ga0157378_103649782 | 266 |
| 404 | 3300013297 | Ga0157378_10832455 | Ga0157378_108324551 | 266 |
| 405 | 3300013306 | Ga0163162_10001677 | Ga0163162_100016776 | 266 |
| 406 | 3300013306 | Ga0163162_10009932 | Ga0163162_1000993210 | 266 |
| 407 | 3300013306 | Ga0163162_10181453 | Ga0163162_101814532 | 266 |
| 408 | 3300013306 | Ga0163162_10426580 | Ga0163162_104265802 | 266 |
| 409 | 3300013307 | Ga0157372_10109839 | Ga0157372_101098392 | 266 |
| 410 | 3300013307 | Ga0157372_10120543 | Ga0157372_101205432 | 266 |
| 411 | 3300013307 | Ga0157372_10136646 | Ga0157372_101366462 | 266 |
| 412 | 3300013307 | Ga0157372_10432571 | Ga0157372_104325712 | 266 |
| 413 | 3300013308 | Ga0157375_10000263 | Ga0157375_1000026356 | 266 |
| 414 | 3300013308 | Ga0157375_10368869 | Ga0157375_103688693 | 266 |
| 415 | 3300013308 | Ga0157375_10443267 | Ga0157375_104432671 | 266 |
| 416 | 3300014325 | Ga0163163_10010830 | Ga0163163_100108302 | 266 |
| 417 | 3300014325 | Ga0163163_10019201 | Ga0163163_100192015 | 266 |
| 418 | 3300014326 | Ga0157380_10000294 | Ga0157380_1000029421 | 266 |
| 419 | 3300014326 | Ga0157380_10256788 | Ga0157380_102567882 | 266 |
| 420 | 3300014745 | Ga0157377_10001222 | Ga0157377_1000122212 | 266 |
| 421 | 3300014968 | Ga0157379_10002453 | Ga0157379_1000245317 | 266 |
| 422 | 3300014968 | Ga0157379_10027532 | Ga0157379_100275322 | 266 |
| 423 | 3300014969 | Ga0157376_10000342 | Ga0157376_1000034218 | 266 |
| 424 | 3300014969 | Ga0157376_10036312 | Ga0157376_100363123 | 266 |
| 425 | 3300014969 | Ga0157376_10537685 | Ga0157376_105376851 | 266 |
| 426 | 3300017792 | Ga0163161_10000523 | Ga0163161_1000052324 | 266 |
| 427 | 3300017792 | Ga0163161_10089663 | Ga0163161_100896632 | 266 |
| 428 | 3300020070 | Ga0206356_11304508 | Ga0206356_113045082 | 266 |
| 429 | 3300020082 | Ga0206353_11340620 | Ga0206353_113406201 | 266 |
| 430 | 3300021358 | Ga0213873_10003810 | Ga0213873_100038102 | 266 |
| 431 | 3300021384 | Ga0213876_10008326 | Ga0213876_100083263 | 266 |
| 432 | 3300021384 | Ga0213876_10033853 | Ga0213876_100338532 | 266 |
| 433 | 3300021384 | Ga0213876_10035248 | Ga0213876_100352482 | 266 |
| 434 | 3300021388 | Ga0213875_10000825 | Ga0213875_100008252 | 266 |
| 435 | 3300021388 | Ga0213875_10002635 | Ga0213875_100026353 | 266 |
| 436 | 3300021388 | Ga0213875_10105892 | Ga0213875_101058922 | 266 |
| 437 | 3300024225 | Ga0224572_1007436 | Ga0224572_10074363 | 266 |
| 438 | 3300024227 | Ga0228598_1016262 | Ga0228598_10162622 | 266 |
| 439 | 3300025271 | Ga0207666_1000010 | Ga0207666_10000106 | 266 |
| 440 | 3300025271 | Ga0207666_1001035 | Ga0207666_10010352 | 266 |
| 441 | 3300025290 | Ga0207673_1000164 | Ga0207673_10001647 | 266 |
| 442 | 3300025294 | Ga0209025_1000008 | Ga0209025_10000081002 | 266 |
| 443 | 3300025295 | Ga0209564_1000054 | Ga0209564_1000054218 | 266 |
| 444 | 3300025299 | Ga0209256_1000084 | Ga0209256_1000084106 | 266 |
| 445 | 3300025315 | Ga0207697_10000186 | Ga0207697_1000018632 | 266 |
| 446 | 3300025315 | Ga0207697_10023457 | Ga0207697_100234573 | 266 |
| 447 | 3300025885 | Ga0207653_10008164 | Ga0207653_100081642 | 266 |
| 448 | 3300025893 | Ga0207682_10000123 | Ga0207682_1000012324 | 266 |
| 449 | 3300025898 | Ga0207692_10016864 | Ga0207692_100168642 | 266 |
| 450 | 3300025899 | Ga0207642_10000263 | Ga0207642_1000026311 | 266 |
| 451 | 3300025900 | Ga0207710_10011053 | Ga0207710_100110532 | 266 |
| 452 | 3300025901 | Ga0207688_10000889 | Ga0207688_100008892 | 266 |
| 453 | 3300025901 | Ga0207688_10056265 | Ga0207688_100562653 | 266 |
| 454 | 3300025903 | Ga0207680_10001117 | Ga0207680_1000111715 | 266 |
| 455 | 3300025904 | Ga0207647_10005506 | Ga0207647_1000550611 | 266 |
| 456 | 3300025904 | Ga0207647_10046296 | Ga0207647_100462962 | 266 |
| 457 | 3300025905 | Ga0207685_10001241 | Ga0207685_100012412 | 266 |
| 458 | 3300025905 | Ga0207685_10061083 | Ga0207685_100610832 | 266 |
| 459 | 3300025906 | Ga0207699_10030475 | Ga0207699_100304752 | 266 |
| 460 | 3300025906 | Ga0207699_10033740 | Ga0207699_100337402 | 266 |
| 461 | 3300025907 | Ga0207645_10000023 | Ga0207645_1000002330 | 266 |
| 462 | 3300025907 | Ga0207645_10020930 | Ga0207645_100209303 | 266 |
| 463 | 3300025907 | Ga0207645_10051083 | Ga0207645_100510833 | 266 |
| 464 | 3300025908 | Ga0207643_10000007 | Ga0207643_1000000721 | 266 |
| 465 | 3300025909 | Ga0207705_10343463 | Ga0207705_103434632 | 266 |
| 466 | 3300025910 | Ga0207684_10377781 | Ga0207684_103777812 | 266 |
| 467 | 3300025911 | Ga0207654_10020224 | Ga0207654_100202242 | 266 |
| 468 | 3300025912 | Ga0207707_10002015 | Ga0207707_1000201515 | 266 |
| 469 | 3300025912 | Ga0207707_10056334 | Ga0207707_100563342 | 266 |
| 470 | 3300025912 | Ga0207707_10094416 | Ga0207707_100944164 | 266 |
| 471 | 3300025912 | Ga0207707_10112364 | Ga0207707_101123642 | 266 |
| 472 | 3300025914 | Ga0207671_10008841 | Ga0207671_100088416 | 266 |
| 473 | 3300025914 | Ga0207671_10224341 | Ga0207671_102243412 | 266 |
| 474 | 3300025915 | Ga0207693_10012859 | Ga0207693_100128598 | 266 |
| 475 | 3300025915 | Ga0207693_10026757 | Ga0207693_100267572 | 266 |
| 476 | 3300025915 | Ga0207693_10106248 | Ga0207693_101062482 | 266 |
| 477 | 3300025916 | Ga0207663_10004450 | Ga0207663_100044503 | 266 |
| 478 | 3300025916 | Ga0207663_10040066 | Ga0207663_100400665 | 266 |
| 479 | 3300025917 | Ga0207660_10000393 | Ga0207660_1000039312 | 266 |
| 480 | 3300025917 | Ga0207660_10005747 | Ga0207660_100057477 | 266 |
| 481 | 3300025917 | Ga0207660_10319859 | Ga0207660_103198592 | 266 |
| 482 | 3300025918 | Ga0207662_10000136 | Ga0207662_1000013638 | 266 |
| 483 | 3300025918 | Ga0207662_10011289 | Ga0207662_100112893 | 266 |
| 484 | 3300025919 | Ga0207657_10004997 | Ga0207657_1000499713 | 266 |
| 485 | 3300025919 | Ga0207657_10005004 | Ga0207657_100050044 | 266 |
| 486 | 3300025919 | Ga0207657_10036159 | Ga0207657_100361593 | 266 |
| 487 | 3300025919 | Ga0207657_10055737 | Ga0207657_100557372 | 266 |
| 488 | 3300025919 | Ga0207657_10126241 | Ga0207657_101262412 | 266 |
| 489 | 3300025920 | Ga0207649_10000434 | Ga0207649_1000043418 | 266 |
| 490 | 3300025920 | Ga0207649_10045166 | Ga0207649_100451663 | 266 |
| 491 | 3300025921 | Ga0207652_10001720 | Ga0207652_1000172018 | 266 |
| 492 | 3300025921 | Ga0207652_10016915 | Ga0207652_100169156 | 266 |
| 493 | 3300025921 | Ga0207652_10073555 | Ga0207652_100735552 | 266 |
| 494 | 3300025921 | Ga0207652_10119473 | Ga0207652_101194732 | 266 |
| 495 | 3300025921 | Ga0207652_10208954 | Ga0207652_102089542 | 266 |
| 496 | 3300025921 | Ga0207652_10293503 | Ga0207652_102935031 | 266 |
| 497 | 3300025921 | Ga0207652_10396771 | Ga0207652_103967711 | 266 |
| 498 | 3300025923 | Ga0207681_10000273 | Ga0207681_1000027324 | 266 |
| 499 | 3300025924 | Ga0207694_10052606 | Ga0207694_100526064 | 266 |
| 500 | 3300025925 | Ga0207650_10001932 | Ga0207650_1000193215 | 266 |
| 501 | 3300025926 | Ga0207659_10000097 | Ga0207659_1000009732 | 266 |
| 502 | 3300025926 | Ga0207659_10347128 | Ga0207659_103471281 | 266 |
| 503 | 3300025927 | Ga0207687_10001031 | Ga0207687_1000103115 | 266 |
| 504 | 3300025927 | Ga0207687_10028160 | Ga0207687_100281602 | 266 |
| 505 | 3300025927 | Ga0207687_10443508 | Ga0207687_104435081 | 266 |
| 506 | 3300025928 | Ga0207700_10000167 | Ga0207700_1000016710 | 266 |
| 507 | 3300025928 | Ga0207700_10165040 | Ga0207700_101650402 | 266 |
| 508 | 3300025928 | Ga0207700_10449947 | Ga0207700_104499472 | 266 |
| 509 | 3300025929 | Ga0207664_10235393 | Ga0207664_102353932 | 266 |
| 510 | 3300025929 | Ga0207664_10241893 | Ga0207664_102418932 | 266 |
| 511 | 3300025931 | Ga0207644_10001738 | Ga0207644_1000173810 | 266 |
| 512 | 3300025931 | Ga0207644_10113559 | Ga0207644_101135592 | 266 |
| 513 | 3300025932 | Ga0207690_10000962 | Ga0207690_100009622 | 266 |
| 514 | 3300025932 | Ga0207690_10148791 | Ga0207690_101487911 | 266 |
| 515 | 3300025933 | Ga0207706_10000867 | Ga0207706_1000086730 | 266 |
| 516 | 3300025933 | Ga0207706_10017224 | Ga0207706_100172248 | 266 |
| 517 | 3300025933 | Ga0207706_10021114 | Ga0207706_100211147 | 266 |
| 518 | 3300025933 | Ga0207706_10036344 | Ga0207706_100363442 | 266 |
| 519 | 3300025934 | Ga0207686_10000329 | Ga0207686_1000032935 | 266 |
| 520 | 3300025934 | Ga0207686_10076863 | Ga0207686_100768632 | 266 |
| 521 | 3300025935 | Ga0207709_10000419 | Ga0207709_100004198 | 266 |
| 522 | 3300025935 | Ga0207709_10045024 | Ga0207709_100450242 | 266 |
| 523 | 3300025935 | Ga0207709_10101156 | Ga0207709_101011562 | 266 |
| 524 | 3300025936 | Ga0207670_10000536 | Ga0207670_1000053621 | 266 |
| 525 | 3300025936 | Ga0207670_10057775 | Ga0207670_100577752 | 266 |
| 526 | 3300025937 | Ga0207669_10002798 | Ga0207669_100027982 | 266 |
| 527 | 3300025937 | Ga0207669_10073675 | Ga0207669_100736752 | 266 |
| 528 | 3300025938 | Ga0207704_10000599 | Ga0207704_1000059917 | 266 |
| 529 | 3300025939 | Ga0207665_10000417 | Ga0207665_1000041721 | 266 |
| 530 | 3300025939 | Ga0207665_10087336 | Ga0207665_100873363 | 266 |
| 531 | 3300025939 | Ga0207665_10181293 | Ga0207665_101812932 | 266 |
| 532 | 3300025940 | Ga0207691_10000544 | Ga0207691_100005446 | 266 |
| 533 | 3300025940 | Ga0207691_10023702 | Ga0207691_100237022 | 266 |
| 534 | 3300025940 | Ga0207691_10170474 | Ga0207691_101704741 | 266 |
| 535 | 3300025941 | Ga0207711_10002468 | Ga0207711_1000246818 | 266 |
| 536 | 3300025942 | Ga0207689_10001743 | Ga0207689_1000174318 | 266 |
| 537 | 3300025944 | Ga0207661_10000428 | Ga0207661_1000042824 | 266 |
| 538 | 3300025944 | Ga0207661_10190004 | Ga0207661_101900042 | 266 |
| 539 | 3300025944 | Ga0207661_10444628 | Ga0207661_104446281 | 266 |
| 540 | 3300025945 | Ga0207679_10000029 | Ga0207679_10000029177 | 266 |
| 541 | 3300025945 | Ga0207679_10294834 | Ga0207679_102948341 | 266 |
| 542 | 3300025949 | Ga0207667_10017999 | Ga0207667_100179997 | 266 |
| 543 | 3300025949 | Ga0207667_10099408 | Ga0207667_100994082 | 266 |
| 544 | 3300025949 | Ga0207667_10162685 | Ga0207667_101626852 | 266 |
| 545 | 3300025960 | Ga0207651_10000083 | Ga0207651_1000008322 | 266 |
| 546 | 3300025960 | Ga0207651_10153671 | Ga0207651_101536712 | 266 |
| 547 | 3300025960 | Ga0207651_10169369 | Ga0207651_101693692 | 266 |
| 548 | 3300025961 | Ga0207712_10000471 | Ga0207712_1000047118 | 266 |
| 549 | 3300025972 | Ga0207668_10278102 | Ga0207668_102781023 | 266 |
| 550 | 3300025972 | Ga0207668_10547276 | Ga0207668_105472762 | 266 |
| 551 | 3300025981 | Ga0207640_10000637 | Ga0207640_1000063716 | 266 |
| 552 | 3300025986 | Ga0207658_10002203 | Ga0207658_100022032 | 266 |
| 553 | 3300025986 | Ga0207658_10041282 | Ga0207658_100412822 | 266 |
| 554 | 3300025986 | Ga0207658_10041634 | Ga0207658_100416342 | 266 |
| 555 | 3300026023 | Ga0207677_10000992 | Ga0207677_1000099217 | 266 |
| 556 | 3300026035 | Ga0207703_10005165 | Ga0207703_100051655 | 266 |
| 557 | 3300026035 | Ga0207703_10044170 | Ga0207703_100441702 | 266 |
| 558 | 3300026041 | Ga0207639_10005126 | Ga0207639_100051268 | 266 |
| 559 | 3300026041 | Ga0207639_10196984 | Ga0207639_101969842 | 266 |
| 560 | 3300026067 | Ga0207678_10001568 | Ga0207678_1000156821 | 266 |
| 561 | 3300026067 | Ga0207678_10021304 | Ga0207678_100213047 | 266 |
| 562 | 3300026067 | Ga0207678_10029617 | Ga0207678_100296175 | 266 |
| 563 | 3300026067 | Ga0207678_10055746 | Ga0207678_100557462 | 266 |
| 564 | 3300026075 | Ga0207708_10002060 | Ga0207708_100020606 | 266 |
| 565 | 3300026075 | Ga0207708_10005462 | Ga0207708_100054626 | 266 |
| 566 | 3300026075 | Ga0207708_10017276 | Ga0207708_100172764 | 266 |
| 567 | 3300026078 | Ga0207702_10001921 | Ga0207702_1000192116 | 266 |
| 568 | 3300026078 | Ga0207702_10080985 | Ga0207702_100809851 | 266 |
| 569 | 3300026078 | Ga0207702_10148084 | Ga0207702_101480842 | 266 |
| 570 | 3300026078 | Ga0207702_10399832 | Ga0207702_103998322 | 266 |
| 571 | 3300026078 | Ga0207702_10441331 | Ga0207702_104413312 | 266 |
| 572 | 3300026088 | Ga0207641_10000510 | Ga0207641_1000051021 | 266 |
| 573 | 3300026088 | Ga0207641_10055508 | Ga0207641_100555082 | 266 |
| 574 | 3300026088 | Ga0207641_10105109 | Ga0207641_101051092 | 266 |
| 575 | 3300026088 | Ga0207641_10556277 | Ga0207641_105562771 | 266 |
| 576 | 3300026089 | Ga0207648_10003487 | Ga0207648_100034877 | 266 |
| 577 | 3300026089 | Ga0207648_10107529 | Ga0207648_101075293 | 266 |
| 578 | 3300026089 | Ga0207648_10132084 | Ga0207648_101320842 | 266 |
| 579 | 3300026095 | Ga0207676_10003788 | Ga0207676_1000378812 | 266 |
| 580 | 3300026095 | Ga0207676_10028269 | Ga0207676_100282694 | 266 |
| 581 | 3300026116 | Ga0207674_10000608 | Ga0207674_100006086 | 266 |
| 582 | 3300026116 | Ga0207674_10141868 | Ga0207674_101418682 | 266 |
| 583 | 3300026118 | Ga0207675_100000805 | Ga0207675_1000008056 | 266 |
| 584 | 3300026118 | Ga0207675_100026921 | Ga0207675_1000269212 | 266 |
| 585 | 3300026118 | Ga0207675_100255789 | Ga0207675_1002557891 | 266 |
| 586 | 3300026121 | Ga0207683_10000082 | Ga0207683_1000008244 | 266 |
| 587 | 3300026121 | Ga0207683_10006710 | Ga0207683_100067104 | 266 |
| 588 | 3300026121 | Ga0207683_10136999 | Ga0207683_101369992 | 266 |
| 589 | 3300026142 | Ga0207698_10000377 | Ga0207698_1000037713 | 266 |
| 590 | 3300027695 | Ga0209966_1001565 | Ga0209966_10015655 | 266 |
| 591 | 3300027717 | Ga0209998_10000947 | Ga0209998_100009475 | 266 |
| 592 | 3300027717 | Ga0209998_10007515 | Ga0209998_100075152 | 266 |
| 593 | 3300027907 | Ga0207428_10000124 | Ga0207428_1000012482 | 266 |
| 594 | 3300027907 | Ga0207428_10000420 | Ga0207428_1000042029 | 266 |
| 595 | 3300027907 | Ga0207428_10000703 | Ga0207428_1000070327 | 266 |
| 596 | 3300028379 | Ga0268266_10481125 | Ga0268266_104811251 | 266 |
| 597 | 3300028380 | Ga0268265_10001170 | Ga0268265_100011708 | 266 |
| 598 | 3300028380 | Ga0268265_10017735 | Ga0268265_100177353 | 266 |
| 599 | 3300028381 | Ga0268264_10001878 | Ga0268264_100018786 | 266 |
| 600 | 3300028381 | Ga0268264_10047711 | Ga0268264_100477113 | 266 |
| 601 | 3300028577 | Ga0265318_10089108 | Ga0265318_100891082 | 266 |
| 602 | 3300028800 | Ga0265338_10049901 | Ga0265338_100499012 | 266 |
| 603 | 3300028800 | Ga0265338_10057435 | Ga0265338_100574352 | 266 |
| 604 | 3300028800 | Ga0265338_10060308 | Ga0265338_100603083 | 266 |
| 605 | 3300028800 | Ga0265338_10212403 | Ga0265338_102124032 | 266 |
| 606 | 3300031235 | Ga0265330_10044496 | Ga0265330_100444963 | 266 |
| 607 | 3300031241 | Ga0265325_10000105 | Ga0265325_1000010556 | 266 |
| 608 | 3300031241 | Ga0265325_10005333 | Ga0265325_100053339 | 266 |
| 609 | 3300031241 | Ga0265325_10045207 | Ga0265325_100452072 | 266 |
| 610 | 3300031241 | Ga0265325_10076800 | Ga0265325_100768002 | 266 |
| 611 | 3300031241 | Ga0265325_10077344 | Ga0265325_100773442 | 266 |
| 612 | 3300031241 | Ga0265325_10083128 | Ga0265325_100831282 | 266 |
| 613 | 3300031241 | Ga0265325_10111979 | Ga0265325_101119792 | 266 |
| 614 | 3300031247 | Ga0265340_10013695 | Ga0265340_100136953 | 266 |
| 615 | 3300031247 | Ga0265340_10134342 | Ga0265340_101343422 | 266 |
| 616 | 3300031249 | Ga0265339_10000071 | Ga0265339_100000713 | 266 |
| 617 | 3300031249 | Ga0265339_10012221 | Ga0265339_100122215 | 266 |
| 618 | 3300031250 | Ga0265331_10048341 | Ga0265331_100483412 | 266 |
| 619 | 3300031344 | Ga0265316_10054466 | Ga0265316_100544664 | 266 |
| 620 | 3300031595 | Ga0265313_10000041 | Ga0265313_1000004151 | 266 |
| 621 | 3300031595 | Ga0265313_10000123 | Ga0265313_1000012338 | 266 |
| 622 | 3300031595 | Ga0265313_10012778 | Ga0265313_100127782 | 266 |
| 623 | 3300031595 | Ga0265313_10024353 | Ga0265313_100243532 | 266 |
| 624 | 3300031595 | Ga0265313_10024680 | Ga0265313_100246802 | 266 |
| 625 | 3300031711 | Ga0265314_10000279 | Ga0265314_1000027947 | 266 |
| 626 | 3300031711 | Ga0265314_10017694 | Ga0265314_100176942 | 266 |
| 627 | 3300031711 | Ga0265314_10085557 | Ga0265314_100855571 | 266 |
| 628 | 3300031712 | Ga0265342_10001077 | Ga0265342_1000107723 | 266 |
| 629 | 3300031712 | Ga0265342_10070433 | Ga0265342_100704332 | 266 |
| 630 | 3300032133 | Ga0316583_10003152 | Ga0316583_100031524 | 266 |
| 631 | 3300034816 | Ga0373930_0000680 | Ga0373930_0000680_3150_3950 | 266 |
| 632 | 3300034816 | Ga0373930_0014455 | Ga0373930_0014455_179_979 | 266 |
| 633 | 3300034817 | Ga0373948_0000196 | Ga0373948_0000196_3178_3978 | 266 |
| 634 | 3300034817 | Ga0373948_0000995 | Ga0373948_0000995_2757_3557 | 266 |
| 635 | 3300034818 | Ga0373950_0002735 | Ga0373950_0002735_592_1392 | 266 |
| 636 | 3300034818 | Ga0373950_0005433 | Ga0373950_0005433_233_1075 | 266 |
| 637 | 3300034819 | Ga0373958_0002069 | Ga0373958_0002069_823_1623 | 266 |
| 638 | 3300034957 | Ga0373938_0000092 | Ga0373938_0000092_741_1541 | 266 |
| 639 | 3300034957 | Ga0373938_0003487 | Ga0373938_0003487_261_1061 | 266 |
| 640 | 3300035083 | Ga0373926_0041110 | Ga0373926_0041110_766_1566 | 266 |
| 641 | 3300035084 | Ga0373928_0005526 | Ga0373928_0005526_90_890 | 266 |
| 642 | 3300035084 | Ga0373928_0014169 | Ga0373928_0014169_222_1064 | 266 |
| 643 | 3300035085 | Ga0373929_0000128 | Ga0373929_0000128_5810_6610 | 266 |
| 644 | 3300035085 | Ga0373929_0027650 | Ga0373929_0027650_106_906 | 266 |
| 645 | 3300035089 | Ga0373944_0002646 | Ga0373944_0002646_3160_3960 | 266 |
| 646 | 3300035089 | Ga0373944_0033163 | Ga0373944_0033163_601_1401 | 266 |
| 647 | 3300035089 | Ga0373944_0058012 | Ga0373944_0058012_29_829 | 266 |
| 648 | 3300035090 | Ga0373949_0000715 | Ga0373949_0000715_4644_5486 | 266 |
| 649 | 3300035091 | Ga0373951_0000531 | Ga0373951_0000531_8351_9151 | 266 |
| 650 | 3300035091 | Ga0373951_0003670 | Ga0373951_0003670_1784_2584 | 266 |
| 651 | 3300035091 | Ga0373951_0011160 | Ga0373951_0011160_240_1082 | 266 |
| 652 | 3300035091 | Ga0373951_0019087 | Ga0373951_0019087_173_973 | 266 |
| 653 | 3300035092 | Ga0373952_0006526 | Ga0373952_0006526_321_1163 | 266 |
| 654 | 3300035111 | Ga0373923_0002485 | Ga0373923_0002485_2798_3598 | 266 |
| 655 | 3300035112 | Ga0373932_0000076 | Ga0373932_0000076_153_953 | 266 |
| 656 | 3300035112 | Ga0373932_0000597 | Ga0373932_0000597_6334_7176 | 266 |
| 657 | 3300035112 | Ga0373932_0002240 | Ga0373932_0002240_1433_2233 | 266 |
| 658 | 3300035113 | Ga0373936_0000549 | Ga0373936_0000549_1133_1966 | 266 |
| 659 | 3300035113 | Ga0373936_0007526 | Ga0373936_0007526_626_1426 | 266 |
| 660 | 3300035114 | Ga0373939_0000361 | Ga0373939_0000361_4719_5561 | 266 |
| 661 | 3300035114 | Ga0373939_0000377 | Ga0373939_0000377_5131_5931 | 266 |
| 662 | 3300035114 | Ga0373939_0004881 | Ga0373939_0004881_1738_2538 | 266 |
| 663 | 3300035114 | Ga0373939_0016420 | Ga0373939_0016420_10_810 | 266 |
| 664 | 3300035114 | Ga0373939_0067916 | Ga0373939_0067916_68_898 | 266 |
| 665 | 3300035115 | Ga0373941_0000785 | Ga0373941_0000785_5392_6192 | 266 |
| 666 | 3300035115 | Ga0373941_0020117 | Ga0373941_0020117_267_1109 | 266 |
| 667 | 3300035116 | Ga0373945_0001243 | Ga0373945_0001243_4011_4811 | 266 |
| 668 | 3300035116 | Ga0373945_0017475 | Ga0373945_0017475_1415_2248 | 266 |
| 669 | 3300035116 | Ga0373945_0085606 | Ga0373945_0085606_179_979 | 266 |
| 670 | 3300035117 | Ga0373953_0003524 | Ga0373953_0003524_2103_2936 | 266 |
| 671 | 3300035117 | Ga0373953_0003611 | Ga0373953_0003611_3775_4575 | 266 |
| 672 | 3300035118 | Ga0373954_0002142 | Ga0373954_0002142_2890_3723 | 266 |
| 673 | 3300035118 | Ga0373954_0006240 | Ga0373954_0006240_3842_4642 | 266 |
| 674 | 3300035118 | Ga0373954_0026910 | Ga0373954_0026910_139_939 | 266 |
| 675 | 3300035118 | Ga0373954_0058317 | Ga0373954_0058317_613_1413 | 266 |
| 676 | 3300035119 | Ga0373956_0017526 | Ga0373956_0017526_2189_2989 | 266 |
| 677 | 3300035119 | Ga0373956_0088184 | Ga0373956_0088184_141_941 | 266 |
| 678 | 3300035120 | Ga0373957_0020017 | Ga0373957_0020017_1319_2152 | 266 |
| 679 | 3300035120 | Ga0373957_0092184 | Ga0373957_0092184_177_977 | 266 |
| 680 | 3300035121 | Ga0373960_0000204 | Ga0373960_0000204_4913_5713 | 266 |
| 681 | 3300035121 | Ga0373960_0001684 | Ga0373960_0001684_2629_3471 | 266 |
| 682 | 3300035170 | Ga0373943_0001090 | Ga0373943_0001090_10448_11281 | 266 |
| 683 | 3300035170 | Ga0373943_0003538 | Ga0373943_0003538_3041_3841 | 266 |
| 684 | 3300035170 | Ga0373943_0010676 | Ga0373943_0010676_2212_3012 | 266 |
| 685 | 3300035170 | Ga0373943_0034932 | Ga0373943_0034932_363_1163 | 266 |
| 686 | 3300035170 | Ga0373943_0089584 | Ga0373943_0089584_631_1431 | 266 |
| 687 | 3300035171 | Ga0373946_0000383 | Ga0373946_0000383_11945_12778 | 266 |
| 688 | 3300035171 | Ga0373946_0003985 | Ga0373946_0003985_4192_4992 | 266 |
| 689 | 3300035171 | Ga0373946_0069708 | Ga0373946_0069708_586_1386 | 266 |
| 690 | 3300035172 | Ga0373955_0007092 | Ga0373955_0007092_2754_3554 | 266 |
| 691 | 3300035172 | Ga0373955_0018458 | Ga0373955_0018458_2333_3133 | 266 |
| 692 | 3300035172 | Ga0373955_0035405 | Ga0373955_0035405_1172_1972 | 266 |
| 693 | 3300035172 | Ga0373955_0052349 | Ga0373955_0052349_426_1226 | 266 |
| 694 | 3300035207 | Ga0373942_0000813 | Ga0373942_0000813_3069_3869 | 266 |
| 695 | 3300035207 | Ga0373942_0002869 | Ga0373942_0002869_801_1643 | 266 |
| 696 | 3300035207 | Ga0373942_0005195 | Ga0373942_0005195_622_1422 | 266 |
| 697 | 3300035241 | Ga0373961_0001827 | Ga0373961_0001827_2390_3190 | 266 |
| 698 | 3300035410 | Ga0373924_0000144 | Ga0373924_0000144_16271_17104 | 266 |
| 699 | 3300035410 | Ga0373924_0016721 | Ga0373924_0016721_1441_2241 | 266 |
| 700 | 3300035410 | Ga0373924_0017856 | Ga0373924_0017856_1016_1816 | 266 |
| 701 | 3300035410 | Ga0373924_0074497 | Ga0373924_0074497_224_1024 | 266 |
| 702 | 3300035410 | Ga0373924_0078058 | Ga0373924_0078058_231_1031 | 266 |
| 703 | 3300035410 | Ga0373924_0181907 | Ga0373924_0181907_44_844 | 266 |
| 704 | 3300035691 | Ga0373931_0000186 | Ga0373931_0000186_11908_12750 | 266 |
| 705 | 3300035691 | Ga0373931_0002333 | Ga0373931_0002333_5756_6556 | 266 |
| 706 | 3300035691 | Ga0373931_0037528 | Ga0373931_0037528_894_1694 | 266 |
| 707 | 3300035692 | Ga0373935_0000012 | Ga0373935_0000012_38897_39730 | 266 |
| 708 | 3300035692 | Ga0373935_0016872 | Ga0373935_0016872_3376_4176 | 266 |
| 709 | 3300035692 | Ga0373935_0067952 | Ga0373935_0067952_1404_2204 | 266 |
| 710 | 3300035692 | Ga0373935_0445773 | Ga0373935_0445773_109_909 | 266 |
| 711 | 3300035695 | Ga0373927_0015740 | Ga0373927_0015740_3767_4600 | 266 |
| 712 | 3300035695 | Ga0373927_0023216 | Ga0373927_0023216_598_1398 | 266 |
| 713 | 3300035695 | Ga0373927_0063603 | Ga0373927_0063603_729_1529 | 266 |
| 714 | 3300035724 | Ga0373933_0004023 | Ga0373933_0004023_6800_7600 | 266 |
| 715 | 3300035724 | Ga0373933_0035272 | Ga0373933_0035272_1003_1836 | 266 |
| 716 | 3300035724 | Ga0373933_0072189 | Ga0373933_0072189_509_1309 | 266 |
| 717 | 3300035725 | Ga0373947_0000380 | Ga0373947_0000380_7461_8294 | 266 |
| 718 | 3300035725 | Ga0373947_0004569 | Ga0373947_0004569_749_1549 | 266 |
| 719 | 3300035725 | Ga0373947_0021639 | Ga0373947_0021639_2135_2935 | 266 |
| 720 | 3300035725 | Ga0373947_0025874 | Ga0373947_0025874_2203_3036 | 266 |
| 721 | 3300035725 | Ga0373947_0033626 | Ga0373947_0033626_687_1487 | 266 |
| 722 | 3300035725 | Ga0373947_0035530 | Ga0373947_0035530_89_889 | 266 |
| 723 | 3300035725 | Ga0373947_0055936 | Ga0373947_0055936_1290_2090 | 266 |
| 724 | 3300036401 | Ga0373937_0000054 | Ga0373937_0000054_27923_28756 | 266 |
| 725 | 3300036401 | Ga0373937_0009657 | Ga0373937_0009657_3003_3803 | 266 |
| 726 | 3300036401 | Ga0373937_0020252 | Ga0373937_0020252_1174_1974 | 266 |
| 727 | 3300036401 | Ga0373937_0025502 | Ga0373937_0025502_3883_4683 | 266 |
| 728 | 3300037068 | Ga0373925_0000018 | Ga0373925_0000018_105462_106295 | 266 |
| 729 | 3300037068 | Ga0373925_0005307 | Ga0373925_0005307_970_1770 | 266 |
| 730 | 3300037068 | Ga0373925_0010134 | Ga0373925_0010134_3041_3841 | 266 |
| 731 | 3300037068 | Ga0373925_0038959 | Ga0373925_0038959_376_1191 | 266 |
| 732 | 3300037068 | Ga0373925_0058062 | Ga0373925_0058062_1234_2034 | 266 |
| 733 | 3300037068 | Ga0373925_0182199 | Ga0373925_0182199_135_935 | 266 |
| 734 | 3300037312 | Ga0395899_0016580 | Ga0395899_0016580_3254_4054 | 266 |
| 735 | 3300037312 | Ga0395899_0167027 | Ga0395899_0167027_335_1135 | 266 |
| 736 | 3300037418 | Ga0395900_0003491 | Ga0395900_0003491_5451_6251 | 266 |
| 737 | 3300037418 | Ga0395900_0116374 | Ga0395900_0116374_345_1145 | 266 |
| 738 | 3300037466 | Ga0395898_0002609 | Ga0395898_0002609_1181_1981 | 266 |
| 739 | 3300037466 | Ga0395898_0014973 | Ga0395898_0014973_4516_5316 | 266 |
| 740 | 3300037466 | Ga0395898_0214886 | Ga0395898_0214886_501_1301 | 266 |
| 741 | 3300037853 | Ga0436364_0127012 | Ga0436364_0127012_7880_8683 | 266 |
| 742 | 3300037853 | Ga0436364_0475448 | Ga0436364_0475448_13303_14103 | 266 |
| 743 | 3300037853 | Ga0436364_0587111 | Ga0436364_0587111_370_1188 | 266 |
| 744 | 3300037853 | Ga0436364_1484132 | Ga0436364_1484132_46_846 | 266 |
| 745 | 3300038443 | Ga0395901_0005021 | Ga0395901_0005021_11812_12612 | 266 |
| 746 | 3300038443 | Ga0395901_0026799 | Ga0395901_0026799_1193_1993 | 266 |
| 747 | 3300038443 | Ga0395901_0281139 | Ga0395901_0281139_116_916 | 266 |
| 748 | 3300039437 | Ga0436365_0276383 | Ga0436365_0276383_9886_10689 | 266 |
| 749 | 3300039437 | Ga0436365_0676411 | Ga0436365_0676411_300_1103 | 266 |
| 750 | 3300039437 | Ga0436365_0823677 | Ga0436365_0823677_997_1797 | 266 |
| 751 | 3300039437 | Ga0436365_1193963 | Ga0436365_1193963_5554_6357 | 266 |
| 752 | 3300039437 | Ga0436365_1657521 | Ga0436365_1657521_5210_6028 | 266 |
| 753 | 3300039450 | Ga0436363_0190862 | Ga0436363_0190862_3612_4415 | 266 |
| 754 | 3300039453 | Ga0436362_0536014 | Ga0436362_0536014_4542_5345 | 266 |
| 755 | 3300041408 | Ga0439453_0000510 | Ga0439453_0000510_2391_3215 | 266 |
| 756 | 3300042003 | Ga0439443_000600 | Ga0439443_000600_814_1638 | 266 |
| 757 | 3300042005 | Ga0439448_0026308 | Ga0439448_0026308_501_1301 | 266 |
| 758 | 3300042461 | Ga0439460_0018303 | Ga0439460_0018303_846_1670 | 266 |
| 759 | 3300044693 | Ga0466961_0267115 | Ga0466961_0267115_92_892 | 266 |
| 760 | 3300044694 | Ga0466963_0044582 | Ga0466963_0044582_1483_2283 | 266 |
| 761 | 3300044712 | Ga0453684_0066809 | Ga0453684_0066809_1439_2239 | 266 |
| 762 | 3300044719 | Ga0466971_0046483 | Ga0466971_0046483_1131_1931 | 266 |
| 763 | 3300045051 | Ga0451576_0039893 | Ga0451576_0039893_4158_4958 | 266 |
| 764 | 3300045976 | Ga0466967_0020740 | Ga0466967_0020740_3444_4244 | 266 |
| 765 | 3300046452 | Ga0495617_022581 | Ga0495617_022581_1077_1877 | 266 |
| 766 | 3300046454 | Ga0495592_0000001 | Ga0495592_0000001_102103_102936 | 266 |
| 767 | 3300046454 | Ga0495592_0001116 | Ga0495592_0001116_12197_12997 | 266 |
| 768 | 3300046454 | Ga0495592_0009742 | Ga0495592_0009742_1626_2426 | 266 |
| 769 | 3300046454 | Ga0495592_0057294 | Ga0495592_0057294_876_1676 | 266 |
| 770 | 3300046455 | Ga0495603_0012962 | Ga0495603_0012962_936_1736 | 266 |
| 771 | 3300046455 | Ga0495603_0096859 | Ga0495603_0096859_460_1260 | 266 |
| 772 | 3300046459 | Ga0495629_0004546 | Ga0495629_0004546_6823_7656 | 266 |
| 773 | 3300046459 | Ga0495629_0016112 | Ga0495629_0016112_127_927 | 266 |
| 774 | 3300046459 | Ga0495629_0024439 | Ga0495629_0024439_2121_2921 | 266 |
| 775 | 3300046461 | Ga0495641_0023574 | Ga0495641_0023574_1329_2129 | 266 |
| 776 | 3300046461 | Ga0495641_0031793 | Ga0495641_0031793_1662_2462 | 266 |
| 777 | 3300046461 | Ga0495641_0078967 | Ga0495641_0078967_490_1290 | 266 |
| 778 | 3300046462 | Ga0495651_0000493 | Ga0495651_0000493_21895_22695 | 266 |
| 779 | 3300046462 | Ga0495651_0002120 | Ga0495651_0002120_7423_8256 | 266 |
| 780 | 3300046462 | Ga0495651_0016283 | Ga0495651_0016283_4042_4842 | 266 |
| 781 | 3300046462 | Ga0495651_0098480 | Ga0495651_0098480_966_1766 | 266 |
| 782 | 3300046462 | Ga0495651_0174169 | Ga0495651_0174169_57_857 | 266 |
| 783 | 3300046462 | Ga0495651_0233214 | Ga0495651_0233214_207_1025 | 266 |
| 784 | 3300046463 | Ga0495653_0000292 | Ga0495653_0000292_35928_36761 | 266 |
| 785 | 3300046463 | Ga0495653_0004657 | Ga0495653_0004657_2653_3453 | 266 |
| 786 | 3300046463 | Ga0495653_0012444 | Ga0495653_0012444_3723_4523 | 266 |
| 787 | 3300046463 | Ga0495653_0041839 | Ga0495653_0041839_2484_3284 | 266 |
| 788 | 3300046472 | Ga0495580_0022745 | Ga0495580_0022745_3175_3975 | 266 |
| 789 | 3300046472 | Ga0495580_0135064 | Ga0495580_0135064_584_1384 | 266 |
| 790 | 3300046473 | Ga0495582_0001705 | Ga0495582_0001705_1433_2233 | 266 |
| 791 | 3300046473 | Ga0495582_0015446 | Ga0495582_0015446_2682_3482 | 266 |
| 792 | 3300046473 | Ga0495582_0254856 | Ga0495582_0254856_145_945 | 266 |
| 793 | 3300046473 | Ga0495582_0300290 | Ga0495582_0300290_109_909 | 266 |
| 794 | 3300046475 | Ga0495639_0019431 | Ga0495639_0019431_1404_2204 | 266 |
| 795 | 3300046475 | Ga0495639_0033107 | Ga0495639_0033107_246_1046 | 266 |
| 796 | 3300046475 | Ga0495639_0109786 | Ga0495639_0109786_260_1060 | 266 |
| 797 | 3300046476 | Ga0495662_0001863 | Ga0495662_0001863_8548_9381 | 266 |
| 798 | 3300046476 | Ga0495662_0009777 | Ga0495662_0009777_871_1671 | 266 |
| 799 | 3300046476 | Ga0495662_0023030 | Ga0495662_0023030_1016_1816 | 266 |
| 800 | 3300046477 | Ga0495664_0000001 | Ga0495664_0000001_213425_214258 | 266 |
| 801 | 3300046477 | Ga0495664_0001609 | Ga0495664_0001609_10213_11013 | 266 |
| 802 | 3300046477 | Ga0495664_0042952 | Ga0495664_0042952_600_1400 | 266 |
| 803 | 3300046477 | Ga0495664_0052458 | Ga0495664_0052458_449_1249 | 266 |
| 804 | 3300046491 | Ga0495584_0048485 | Ga0495584_0048485_1251_2051 | 266 |
| 805 | 3300046491 | Ga0495584_0213586 | Ga0495584_0213586_79_879 | 266 |
| 806 | 3300046492 | Ga0495585_0009128 | Ga0495585_0009128_4299_5099 | 266 |
| 807 | 3300046499 | Ga0495594_0047336 | Ga0495594_0047336_900_1700 | 266 |
| 808 | 3300046499 | Ga0495594_0051362 | Ga0495594_0051362_470_1270 | 266 |
| 809 | 3300046499 | Ga0495594_0101905 | Ga0495594_0101905_781_1581 | 266 |
| 810 | 3300046501 | Ga0495607_0004288 | Ga0495607_0004288_2982_3782 | 266 |
| 811 | 3300046511 | Ga0495608_0000050 | Ga0495608_0000050_60408_61241 | 266 |
| 812 | 3300046511 | Ga0495608_0010562 | Ga0495608_0010562_3322_4122 | 266 |
| 813 | 3300046511 | Ga0495608_0013937 | Ga0495608_0013937_2865_3665 | 266 |
| 814 | 3300046511 | Ga0495608_0031723 | Ga0495608_0031723_257_1057 | 266 |
| 815 | 3300046511 | Ga0495608_0110542 | Ga0495608_0110542_56_856 | 266 |
| 816 | 3300046514 | Ga0495618_0000045 | Ga0495618_0000045_51548_52381 | 266 |
| 817 | 3300046514 | Ga0495618_0007452 | Ga0495618_0007452_4706_5506 | 266 |
| 818 | 3300046514 | Ga0495618_0014982 | Ga0495618_0014982_2399_3199 | 266 |
| 819 | 3300046514 | Ga0495618_0152558 | Ga0495618_0152558_149_949 | 266 |
| 820 | 3300046516 | Ga0495628_0000003 | Ga0495628_0000003_44482_45315 | 266 |
| 821 | 3300046516 | Ga0495628_0002046 | Ga0495628_0002046_2653_3453 | 266 |
| 822 | 3300046516 | Ga0495628_0009974 | Ga0495628_0009974_2074_2874 | 266 |
| 823 | 3300046516 | Ga0495628_0015110 | Ga0495628_0015110_278_1078 | 266 |
| 824 | 3300046516 | Ga0495628_0174495 | Ga0495628_0174495_28_843 | 266 |
| 825 | 3300046517 | Ga0495630_0016265 | Ga0495630_0016265_3522_4355 | 266 |
| 826 | 3300046517 | Ga0495630_0023584 | Ga0495630_0023584_873_1673 | 266 |
| 827 | 3300046517 | Ga0495630_0155120 | Ga0495630_0155120_788_1603 | 266 |
| 828 | 3300046517 | Ga0495630_0157643 | Ga0495630_0157643_720_1520 | 266 |
| 829 | 3300046517 | Ga0495630_0307552 | Ga0495630_0307552_57_857 | 266 |
| 830 | 3300046523 | Ga0495644_0000514 | Ga0495644_0000514_7762_8562 | 266 |
| 831 | 3300046523 | Ga0495644_0097456 | Ga0495644_0097456_231_1046 | 266 |
| 832 | 3300046526 | Ga0495666_0001847 | Ga0495666_0001847_6590_7390 | 266 |
| 833 | 3300046526 | Ga0495666_0081428 | Ga0495666_0081428_252_1052 | 266 |
| 834 | 3300046529 | Ga0495652_0000001 | Ga0495652_0000001_612907_613740 | 266 |
| 835 | 3300046529 | Ga0495652_0020653 | Ga0495652_0020653_1149_1949 | 266 |
| 836 | 3300046529 | Ga0495652_0032571 | Ga0495652_0032571_497_1297 | 266 |
| 837 | 3300046529 | Ga0495652_0043866 | Ga0495652_0043866_3003_3803 | 266 |
| 838 | 3300046529 | Ga0495652_0260268 | Ga0495652_0260268_243_1043 | 266 |
| 839 | 3300046531 | Ga0495665_0006322 | Ga0495665_0006322_4828_5628 | 266 |
| 840 | 3300046531 | Ga0495665_0052492 | Ga0495665_0052492_730_1530 | 266 |
| 841 | 3300046533 | Ga0495640_0000006 | Ga0495640_0000006_60543_61376 | 266 |
| 842 | 3300046533 | Ga0495640_0057539 | Ga0495640_0057539_1700_2500 | 266 |
| 843 | 3300046533 | Ga0495640_0075001 | Ga0495640_0075001_339_1139 | 266 |
| 844 | 3300046533 | Ga0495640_0081965 | Ga0495640_0081965_772_1572 | 266 |
| 845 | 3300046533 | Ga0495640_0099051 | Ga0495640_0099051_169_984 | 266 |
| 846 | 3300046535 | Ga0495586_0010189 | Ga0495586_0010189_54_854 | 266 |
| 847 | 3300046535 | Ga0495586_0027494 | Ga0495586_0027494_1611_2444 | 266 |
| 848 | 3300046535 | Ga0495586_0044435 | Ga0495586_0044435_1296_2096 | 266 |
| 849 | 3300046536 | Ga0495587_0000028 | Ga0495587_0000028_119520_120353 | 266 |
| 850 | 3300046536 | Ga0495587_0000335 | Ga0495587_0000335_29442_30242 | 266 |
| 851 | 3300046536 | Ga0495587_0027769 | Ga0495587_0027769_1853_2653 | 266 |
| 852 | 3300046536 | Ga0495587_0280541 | Ga0495587_0280541_11_811 | 266 |
| 853 | 3300046538 | Ga0495609_0023913 | Ga0495609_0023913_934_1734 | 266 |
| 854 | 3300046538 | Ga0495609_0123127 | Ga0495609_0123127_89_889 | 266 |
| 855 | 3300046543 | Ga0495645_0000004 | Ga0495645_0000004_106931_107764 | 266 |
| 856 | 3300046543 | Ga0495645_0001781 | Ga0495645_0001781_4134_4934 | 266 |
| 857 | 3300046557 | Ga0495622_0018802 | Ga0495622_0018802_2114_2914 | 266 |
| 858 | 3300046557 | Ga0495622_0115086 | Ga0495622_0115086_163_963 | 266 |
| 859 | 3300046558 | Ga0495633_0002107 | Ga0495633_0002107_572_1372 | 266 |
| 860 | 3300046559 | Ga0495667_0000001 | Ga0495667_0000001_452875_453708 | 266 |
| 861 | 3300046559 | Ga0495667_0004928 | Ga0495667_0004928_1717_2517 | 266 |
| 862 | 3300046559 | Ga0495667_0019211 | Ga0495667_0019211_2857_3657 | 266 |
| 863 | 3300046559 | Ga0495667_0042835 | Ga0495667_0042835_283_1083 | 266 |
| 864 | 3300046615 | Ga0495656_0019735 | Ga0495656_0019735_935_1735 | 266 |
| 865 | 3300046615 | Ga0495656_0106492 | Ga0495656_0106492_303_1118 | 266 |
| 866 | 3300046642 | Ga0495634_0000531 | Ga0495634_0000531_35678_36511 | 266 |
| 867 | 3300046642 | Ga0495634_0002372 | Ga0495634_0002372_9964_10776 | 266 |
| 868 | 3300046642 | Ga0495634_0007696 | Ga0495634_0007696_2421_3221 | 266 |
| 869 | 3300046642 | Ga0495634_0009588 | Ga0495634_0009588_3245_4060 | 266 |
| 870 | 3300046642 | Ga0495634_0017766 | Ga0495634_0017766_1196_1996 | 266 |
| 871 | 3300046663 | Ga0495635_0000007 | Ga0495635_0000007_237959_238792 | 266 |
| 872 | 3300046663 | Ga0495635_0000736 | Ga0495635_0000736_3728_4528 | 266 |
| 873 | 3300046663 | Ga0495635_0004379 | Ga0495635_0004379_2400_3200 | 266 |
| 874 | 3300046663 | Ga0495635_0045113 | Ga0495635_0045113_1439_2239 | 266 |
| 875 | 3300046663 | Ga0495635_0061837 | Ga0495635_0061837_1126_1926 | 266 |
| 876 | 3300046663 | Ga0495635_0094383 | Ga0495635_0094383_927_1727 | 266 |
| 877 | 3300046664 | Ga0495659_0011224 | Ga0495659_0011224_1808_2608 | 266 |
| 878 | 3300046665 | Ga0495661_0151950 | Ga0495661_0151950_198_998 | 266 |
| 879 | 3300046674 | Ga0495588_0013623 | Ga0495588_0013623_2652_3452 | 266 |
| 880 | 3300046674 | Ga0495588_0068823 | Ga0495588_0068823_72_872 | 266 |
| 881 | 3300046675 | Ga0495657_0000136 | Ga0495657_0000136_44474_45307 | 266 |
| 882 | 3300046675 | Ga0495657_0000836 | Ga0495657_0000836_2401_3201 | 266 |
| 883 | 3300046675 | Ga0495657_0110571 | Ga0495657_0110571_78_878 | 266 |
| 884 | 3300046678 | Ga0495599_0000002 | Ga0495599_0000002_305011_305844 | 266 |
| 885 | 3300046678 | Ga0495599_0034592 | Ga0495599_0034592_2193_2993 | 266 |
| 886 | 3300046678 | Ga0495599_0042654 | Ga0495599_0042654_1742_2542 | 266 |
| 887 | 3300046679 | Ga0495623_0000052 | Ga0495623_0000052_35905_36738 | 266 |
| 888 | 3300046679 | Ga0495623_0027709 | Ga0495623_0027709_1668_2468 | 266 |
| 889 | 3300046679 | Ga0495623_0282093 | Ga0495623_0282093_86_886 | 266 |
| 890 | 3300046680 | Ga0495646_0000036 | Ga0495646_0000036_44597_45430 | 266 |
| 891 | 3300046680 | Ga0495646_0000229 | Ga0495646_0000229_9692_10492 | 266 |
| 892 | 3300046680 | Ga0495646_0048707 | Ga0495646_0048707_1491_2306 | 266 |
| 893 | 3300046681 | Ga0495647_0021862 | Ga0495647_0021862_299_1099 | 266 |
| 894 | 3300046683 | Ga0495658_0000591 | Ga0495658_0000591_1391_2191 | 266 |
| 895 | 3300046683 | Ga0495658_0002748 | Ga0495658_0002748_426_1226 | 266 |
| 896 | 3300046683 | Ga0495658_0100698 | Ga0495658_0100698_228_1028 | 266 |
| 897 | 3300046683 | Ga0495658_0102362 | Ga0495658_0102362_874_1689 | 266 |
| 898 | 3300046683 | Ga0495658_0286263 | Ga0495658_0286263_187_987 | 266 |
| 899 | 3300046684 | Ga0495669_0047505 | Ga0495669_0047505_903_1745 | 266 |
| 900 | 3300046689 | Ga0495613_0014232 | Ga0495613_0014232_2424_3257 | 266 |
| 901 | 3300046689 | Ga0495613_0047264 | Ga0495613_0047264_314_1114 | 266 |
| 902 | 3300046689 | Ga0495613_0168922 | Ga0495613_0168922_605_1420 | 266 |
| 903 | 3300046689 | Ga0495613_0274225 | Ga0495613_0274225_341_1141 | 266 |
| 904 | 3300046690 | Ga0495624_0009422 | Ga0495624_0009422_5204_6004 | 266 |
| 905 | 3300046690 | Ga0495624_0062347 | Ga0495624_0062347_1212_2045 | 266 |
| 906 | 3300046690 | Ga0495624_0234940 | Ga0495624_0234940_216_1031 | 266 |
| 907 | 3300046691 | Ga0495670_0008959 | Ga0495670_0008959_1476_2276 | 266 |
| 908 | 3300046809 | Ga0495600_0000037 | Ga0495600_0000037_35737_36570 | 266 |
| 909 | 3300046809 | Ga0495600_0004219 | Ga0495600_0004219_2322_3122 | 266 |
| 910 | 3300046809 | Ga0495600_0009757 | Ga0495600_0009757_4837_5637 | 266 |
| 911 | 3300046809 | Ga0495600_0017312 | Ga0495600_0017312_3760_4560 | 266 |
| 912 | 3300046809 | Ga0495600_0100651 | Ga0495600_0100651_57_875 | 266 |
| 913 | 3300047315 | Ga0495581_0017156 | Ga0495581_0017156_761_1561 | 266 |
| 914 | 3300047315 | Ga0495581_0035361 | Ga0495581_0035361_1034_1834 | 266 |
| 915 | 3300047315 | Ga0495581_0049412 | Ga0495581_0049412_1339_2139 | 266 |
| 916 | 3300047317 | Ga0495604_0000594 | Ga0495604_0000594_11246_12079 | 266 |
| 917 | 3300047317 | Ga0495604_0006384 | Ga0495604_0006384_7941_8741 | 266 |
| 918 | 3300047317 | Ga0495604_0021677 | Ga0495604_0021677_299_1099 | 266 |
| 919 | 3300047317 | Ga0495604_0028471 | Ga0495604_0028471_864_1664 | 266 |
| 920 | 3300047317 | Ga0495604_0043834 | Ga0495604_0043834_305_1105 | 266 |
| 921 | 3300047317 | Ga0495604_0130187 | Ga0495604_0130187_188_1006 | 266 |
| 922 | 3300047319 | Ga0495674_0000001 | Ga0495674_0000001_413362_414195 | 266 |
| 923 | 3300047319 | Ga0495674_0034790 | Ga0495674_0034790_2004_2804 | 266 |
| 924 | 3300047319 | Ga0495674_0036722 | Ga0495674_0036722_672_1472 | 266 |
| 925 | 3300047319 | Ga0495674_0040549 | Ga0495674_0040549_1658_2458 | 266 |
| 926 | 3300047319 | Ga0495674_0050397 | Ga0495674_0050397_1163_1963 | 266 |
| 927 | 3300047319 | Ga0495674_0319885 | Ga0495674_0319885_119_937 | 266 |
| 928 | 3300047320 | Ga0495672_0139233 | Ga0495672_0139233_48_902 | 266 |
| 929 | 3300047321 | Ga0495676_0017949 | Ga0495676_0017949_1365_2165 | 266 |
| 930 | 3300047321 | Ga0495676_0191256 | Ga0495676_0191256_598_1398 | 266 |
| 931 | 3300047321 | Ga0495676_0218008 | Ga0495676_0218008_46_846 | 266 |
| 932 | 3300047321 | Ga0495676_0260847 | Ga0495676_0260847_130_936 | 266 |
| 933 | 3300047322 | Ga0495680_0000705 | Ga0495680_0000705_16289_17122 | 266 |
| 934 | 3300047322 | Ga0495680_0005567 | Ga0495680_0005567_10561_11361 | 266 |
| 935 | 3300047322 | Ga0495680_0008046 | Ga0495680_0008046_762_1562 | 266 |
| 936 | 3300047322 | Ga0495680_0015939 | Ga0495680_0015939_121_921 | 266 |
| 937 | 3300047322 | Ga0495680_0034691 | Ga0495680_0034691_534_1334 | 266 |
| 938 | 3300047322 | Ga0495680_0036864 | Ga0495680_0036864_2853_3653 | 266 |
| 939 | 3300047444 | Ga0495675_0000049 | Ga0495675_0000049_44368_45201 | 266 |
| 940 | 3300047444 | Ga0495675_0000139 | Ga0495675_0000139_1717_2517 | 266 |
| 941 | 3300047444 | Ga0495675_0072601 | Ga0495675_0072601_740_1540 | 266 |
| 942 | 3300047444 | Ga0495675_0155658 | Ga0495675_0155658_208_1026 | 266 |
| 943 | 3300047446 | Ga0495679_059603 | Ga0495679_059603_283_1083 | 266 |
| 944 | 3300047471 | Ga0495684_0000046 | Ga0495684_0000046_63525_64358 | 266 |
| 945 | 3300047471 | Ga0495684_0006324 | Ga0495684_0006324_1404_2204 | 266 |
| 946 | 3300047471 | Ga0495684_0016053 | Ga0495684_0016053_2702_3502 | 266 |
| 947 | 3300047471 | Ga0495684_0193138 | Ga0495684_0193138_561_1379 | 266 |
| 948 | 3300047673 | Ga0495593_0000276 | Ga0495593_0000276_10795_11628 | 266 |
| 949 | 3300047673 | Ga0495593_0021108 | Ga0495593_0021108_537_1337 | 266 |
| 950 | 3300047673 | Ga0495593_0064941 | Ga0495593_0064941_373_1173 | 266 |
| 951 | 3300048088 | Ga0495602_0000102 | Ga0495602_0000102_44519_45352 | 266 |
| 952 | 3300048088 | Ga0495602_0004714 | Ga0495602_0004714_4070_4870 | 266 |
| 953 | 3300048088 | Ga0495602_0006950 | Ga0495602_0006950_1916_2716 | 266 |
| 954 | 3300048088 | Ga0495602_0110768 | Ga0495602_0110768_941_1741 | 266 |
| 955 | 3300048088 | Ga0495602_0164889 | Ga0495602_0164889_758_1558 | 266 |
| 956 | 3300048089 | Ga0495614_0084354 | Ga0495614_0084354_170_970 | 266 |
| 957 | 3300048903 | Ga0496100_0000057 | Ga0496100_0000057_14769_15611 | 266 |
| 958 | 3300048903 | Ga0496100_0042904 | Ga0496100_0042904_1809_2609 | 266 |
| 959 | 3300048903 | Ga0496100_0081989 | Ga0496100_0081989_281_1081 | 266 |
| 960 | 3300048903 | Ga0496100_0105814 | Ga0496100_0105814_566_1366 | 266 |
| 961 | 3300048903 | Ga0496100_0178414 | Ga0496100_0178414_386_1201 | 266 |
| 962 | 3300048904 | Ga0496101_0001297 | Ga0496101_0001297_2195_3037 | 266 |
| 963 | 3300048904 | Ga0496101_0021335 | Ga0496101_0021335_129_929 | 266 |
| 964 | 3300048904 | Ga0496101_0033105 | Ga0496101_0033105_178_978 | 266 |
| 965 | 3300048904 | Ga0496101_0234131 | Ga0496101_0234131_487_1287 | 266 |
| 966 | 3300048904 | Ga0496101_0534310 | Ga0496101_0534310_90_890 | 266 |
| 967 | 3300048905 | Ga0496102_0001628 | Ga0496102_0001628_5999_6841 | 266 |
| 968 | 3300048905 | Ga0496102_0028878 | Ga0496102_0028878_3696_4514 | 266 |
| 969 | 3300048905 | Ga0496102_0066984 | Ga0496102_0066984_351_1151 | 266 |
| 970 | 3300048906 | Ga0496103_0003313 | Ga0496103_0003313_8082_8924 | 266 |
| 971 | 3300048906 | Ga0496103_0016110 | Ga0496103_0016110_1546_2346 | 266 |
| 972 | 3300048906 | Ga0496103_0055551 | Ga0496103_0055551_1207_2007 | 266 |
| 973 | 3300048906 | Ga0496103_0126020 | Ga0496103_0126020_547_1347 | 266 |
| 974 | 3300048906 | Ga0496103_0168797 | Ga0496103_0168797_303_1103 | 266 |
| 975 | 3300048907 | Ga0496104_0000658 | Ga0496104_0000658_27321_28121 | 266 |
| 976 | 3300048907 | Ga0496104_0025805 | Ga0496104_0025805_4457_5257 | 266 |
| 977 | 3300048907 | Ga0496104_0063613 | Ga0496104_0063613_1282_2082 | 266 |
| 978 | 3300048907 | Ga0496104_0143016 | Ga0496104_0143016_1362_2204 | 266 |
| 979 | 3300048907 | Ga0496104_0156952 | Ga0496104_0156952_314_1114 | 266 |
| 980 | 3300048907 | Ga0496104_0163834 | Ga0496104_0163834_395_1213 | 266 |
| 981 | 3300048907 | Ga0496104_0167007 | Ga0496104_0167007_785_1600 | 266 |
| 982 | 3300048907 | Ga0496104_0208506 | Ga0496104_0208506_913_1731 | 266 |
| 983 | 3300048907 | Ga0496104_0416437 | Ga0496104_0416437_415_1233 | 266 |
| 984 | 3300048908 | Ga0496105_0003619 | Ga0496105_0003619_4481_5281 | 266 |
| 985 | 3300048908 | Ga0496105_0007433 | Ga0496105_0007433_4378_5178 | 266 |
| 986 | 3300048908 | Ga0496105_0036018 | Ga0496105_0036018_303_1118 | 266 |
| 987 | 3300048908 | Ga0496105_0051118 | Ga0496105_0051118_1736_2578 | 266 |
| 988 | 3300048908 | Ga0496105_0105574 | Ga0496105_0105574_590_1390 | 266 |
| 989 | 3300048908 | Ga0496105_0128809 | Ga0496105_0128809_160_1002 | 266 |
| 990 | 3300048909 | Ga0496106_0000518 | Ga0496106_0000518_11908_12750 | 266 |
| 991 | 3300048909 | Ga0496106_0013856 | Ga0496106_0013856_5074_5874 | 266 |
| 992 | 3300048909 | Ga0496106_0016140 | Ga0496106_0016140_2141_2941 | 266 |
| 993 | 3300048909 | Ga0496106_0047763 | Ga0496106_0047763_1710_2525 | 266 |
| 994 | 3300048909 | Ga0496106_0254822 | Ga0496106_0254822_252_1052 | 266 |
| 995 | 3300048910 | Ga0496107_0001129 | Ga0496107_0001129_2195_3037 | 266 |
| 996 | 3300048910 | Ga0496107_0008616 | Ga0496107_0008616_3862_4662 | 266 |
| 997 | 3300048910 | Ga0496107_0024896 | Ga0496107_0024896_3041_3841 | 266 |
| 998 | 3300048910 | Ga0496107_0061873 | Ga0496107_0061873_670_1470 | 266 |
| 999 | 3300048911 | Ga0496108_0004254 | Ga0496108_0004254_9224_10066 | 266 |
| 1000 | 3300048911 | Ga0496108_0019135 | Ga0496108_0019135_4173_4973 | 266 |
| 1001 | 3300048911 | Ga0496108_0044088 | Ga0496108_0044088_2733_3533 | 266 |
| 1002 | 3300048911 | Ga0496108_0103051 | Ga0496108_0103051_1004_1804 | 266 |
| 1003 | 3300048912 | Ga0496109_0000390 | Ga0496109_0000390_26835_27677 | 266 |
| 1004 | 3300048912 | Ga0496109_0023523 | Ga0496109_0023523_2418_3218 | 266 |
| 1005 | 3300048912 | Ga0496109_0152330 | Ga0496109_0152330_664_1464 | 266 |
| 1006 | 3300048912 | Ga0496109_0229402 | Ga0496109_0229402_302_1102 | 266 |
| 1007 | 3300048912 | Ga0496109_0303985 | Ga0496109_0303985_147_965 | 266 |
| 1008 | 3300048913 | Ga0496110_0005641 | Ga0496110_0005641_5101_5943 | 266 |
| 1009 | 3300048913 | Ga0496110_0014086 | Ga0496110_0014086_3607_4407 | 266 |
| 1010 | 3300048913 | Ga0496110_0472443 | Ga0496110_0472443_203_1003 | 266 |
| 1011 | 3300048913 | Ga0496110_0505888 | Ga0496110_0505888_106_912 | 266 |
| 1012 | 3300048914 | Ga0496111_0020628 | Ga0496111_0020628_2907_3749 | 266 |
| 1013 | 3300048914 | Ga0496111_0027669 | Ga0496111_0027669_3147_3989 | 266 |
| 1014 | 3300048915 | Ga0496112_0025896 | Ga0496112_0025896_2989_3789 | 266 |
| 1015 | 3300048915 | Ga0496112_0083042 | Ga0496112_0083042_1992_2834 | 266 |
| 1016 | 3300048915 | Ga0496112_0102485 | Ga0496112_0102485_199_1017 | 266 |
| 1017 | 3300048915 | Ga0496112_0146823 | Ga0496112_0146823_111_911 | 266 |
| 1018 | 3300048916 | Ga0496113_0019170 | Ga0496113_0019170_1031_1873 | 266 |
| 1019 | 3300048916 | Ga0496113_0042842 | Ga0496113_0042842_2203_3045 | 266 |
| 1020 | 3300048916 | Ga0496113_0112080 | Ga0496113_0112080_607_1425 | 266 |
| 1021 | 3300048916 | Ga0496113_0259097 | Ga0496113_0259097_147_947 | 266 |
| 1022 | 3300048916 | Ga0496113_0363296 | Ga0496113_0363296_278_1078 | 266 |
| 1023 | 3300048917 | Ga0496114_0046938 | Ga0496114_0046938_2521_3321 | 266 |
| 1024 | 3300048917 | Ga0496114_0134615 | Ga0496114_0134615_237_1037 | 266 |
| 1025 | 3300048918 | Ga0496115_0076771 | Ga0496115_0076771_1582_2382 | 266 |
| 1026 | 3300048918 | Ga0496115_0133400 | Ga0496115_0133400_282_1124 | 266 |
| 1027 | 3300048918 | Ga0496115_0496336 | Ga0496115_0496336_67_867 | 266 |
| 1028 | 3300048920 | Ga0496117_0030252 | Ga0496117_0030252_1514_2320 | 266 |
| 1029 | 3300048921 | Ga0496118_0160205 | Ga0496118_0160205_322_1128 | 266 |
| 1030 | 3300048925 | Ga0496122_0076861 | Ga0496122_0076861_117_923 | 266 |
| 1031 | 3300049568 | Ga0501031_0079010 | Ga0501031_0079010_657_1457 | 266 |
| 1032 | 3300049569 | Ga0501032_0012835 | Ga0501032_0012835_793_1593 | 266 |
| 1033 | 3300049569 | Ga0501032_0022754 | Ga0501032_0022754_1255_2055 | 266 |
| 1034 | 3300049569 | Ga0501032_0052659 | Ga0501032_0052659_213_1013 | 266 |
| 1035 | 3300049570 | Ga0501033_0007713 | Ga0501033_0007713_1716_2525 | 266 |
| 1036 | 3300049571 | Ga0501034_0000032 | Ga0501034_0000032_180167_180967 | 266 |
| 1037 | 3300049571 | Ga0501034_0002292 | Ga0501034_0002292_8636_9436 | 266 |
| 1038 | 3300049571 | Ga0501034_0020882 | Ga0501034_0020882_3718_4521 | 266 |
| 1039 | 3300049571 | Ga0501034_0025918 | Ga0501034_0025918_3452_4252 | 266 |
| 1040 | 3300049571 | Ga0501034_0076586 | Ga0501034_0076586_1704_2504 | 266 |
| 1041 | 3300049571 | Ga0501034_0204225 | Ga0501034_0204225_482_1285 | 266 |
| 1042 | 3300049571 | Ga0501034_0207143 | Ga0501034_0207143_322_1122 | 266 |
| 1043 | 3300049571 | Ga0501034_0299608 | Ga0501034_0299608_515_1315 | 266 |
| 1044 | 3300049571 | Ga0501034_0730953 | Ga0501034_0730953_68_868 | 266 |
| 1045 | 3300049572 | Ga0501036_0000609 | Ga0501036_0000609_673_1473 | 266 |
| 1046 | 3300049572 | Ga0501036_0014893 | Ga0501036_0014893_517_1317 | 266 |
| 1047 | 3300049572 | Ga0501036_0054800 | Ga0501036_0054800_1294_2094 | 266 |
| 1048 | 3300049572 | Ga0501036_0377075 | Ga0501036_0377075_177_986 | 266 |
| 1049 | 3300049573 | Ga0501037_0007571 | Ga0501037_0007571_2884_3684 | 266 |
| 1050 | 3300049573 | Ga0501037_0073348 | Ga0501037_0073348_348_1148 | 266 |
| 1051 | 3300049573 | Ga0501037_0110404 | Ga0501037_0110404_459_1259 | 266 |
| 1052 | 3300049574 | Ga0501038_0016827 | Ga0501038_0016827_1782_2582 | 266 |
| 1053 | 3300049574 | Ga0501038_0126668 | Ga0501038_0126668_344_1144 | 266 |
| 1054 | 3300049574 | Ga0501038_0316124 | Ga0501038_0316124_276_1085 | 266 |
| 1055 | 3300049574 | Ga0501038_0425503 | Ga0501038_0425503_133_942 | 266 |
| 1056 | 3300049575 | Ga0501039_0012258 | Ga0501039_0012258_609_1409 | 266 |
| 1057 | 3300049575 | Ga0501039_0038774 | Ga0501039_0038774_709_1509 | 266 |
| 1058 | 3300049578 | Ga0501042_0067234 | Ga0501042_0067234_1660_2469 | 266 |
| 1059 | 3300049579 | Ga0501043_0002387 | Ga0501043_0002387_14162_14962 | 266 |
| 1060 | 3300049579 | Ga0501043_0016255 | Ga0501043_0016255_819_1619 | 266 |
| 1061 | 3300049579 | Ga0501043_0195245 | Ga0501043_0195245_170_979 | 266 |
| 1062 | 3300049579 | Ga0501043_0218784 | Ga0501043_0218784_628_1431 | 266 |
| 1063 | 3300049579 | Ga0501043_0371185 | Ga0501043_0371185_243_1043 | 266 |
| 1064 | 3300049579 | Ga0501043_0382596 | Ga0501043_0382596_21_824 | 266 |
| 1065 | 3300049580 | Ga0501046_0151657 | Ga0501046_0151657_32_832 | 266 |
| 1066 | 3300049581 | Ga0501047_0000228 | Ga0501047_0000228_13285_14085 | 266 |
| 1067 | 3300049581 | Ga0501047_0013114 | Ga0501047_0013114_40_840 | 266 |
| 1068 | 3300049581 | Ga0501047_0027357 | Ga0501047_0027357_679_1479 | 266 |
| 1069 | 3300049581 | Ga0501047_0083218 | Ga0501047_0083218_2170_2970 | 266 |
| 1070 | 3300049581 | Ga0501047_0090816 | Ga0501047_0090816_785_1588 | 266 |
| 1071 | 3300049581 | Ga0501047_0101345 | Ga0501047_0101345_1822_2622 | 266 |
| 1072 | 3300049582 | Ga0501048_0000467 | Ga0501048_0000467_13285_14085 | 266 |
| 1073 | 3300049583 | Ga0501067_0135133 | Ga0501067_0135133_13_813 | 266 |
| 1074 | 3300049585 | Ga0501069_0081539 | Ga0501069_0081539_419_1219 | 266 |
| 1075 | 3300049586 | Ga0501070_0008372 | Ga0501070_0008372_4757_5557 | 266 |
| 1076 | 3300049586 | Ga0501070_0008780 | Ga0501070_0008780_903_1703 | 266 |
| 1077 | 3300049586 | Ga0501070_0038930 | Ga0501070_0038930_958_1758 | 266 |
| 1078 | 3300049586 | Ga0501070_0046289 | Ga0501070_0046289_2588_3388 | 266 |
| 1079 | 3300049586 | Ga0501070_0126899 | Ga0501070_0126899_338_1138 | 266 |
| 1080 | 3300049586 | Ga0501070_0180504 | Ga0501070_0180504_159_968 | 266 |
| 1081 | 3300049586 | Ga0501070_0226485 | Ga0501070_0226485_283_1083 | 266 |
| 1082 | 3300049588 | Ga0501072_0279283 | Ga0501072_0279283_271_1071 | 266 |
| 1083 | 3300049588 | Ga0501072_0321239 | Ga0501072_0321239_206_1006 | 266 |
| 1084 | 3300049589 | Ga0501073_0005395 | Ga0501073_0005395_7642_8442 | 266 |
| 1085 | 3300049589 | Ga0501073_0016516 | Ga0501073_0016516_483_1283 | 266 |
| 1086 | 3300049589 | Ga0501073_0016906 | Ga0501073_0016906_3967_4767 | 266 |
| 1087 | 3300049589 | Ga0501073_0047845 | Ga0501073_0047845_1426_2226 | 266 |
| 1088 | 3300049589 | Ga0501073_0059193 | Ga0501073_0059193_96_896 | 266 |
| 1089 | 3300049589 | Ga0501073_0167408 | Ga0501073_0167408_632_1435 | 266 |
| 1090 | 3300049590 | Ga0501074_0003305 | Ga0501074_0003305_2638_3438 | 266 |
| 1091 | 3300049590 | Ga0501074_0119873 | Ga0501074_0119873_1042_1842 | 266 |
| 1092 | 3300049592 | Ga0501076_0160613 | Ga0501076_0160613_218_1027 | 266 |
| 1093 | 3300049593 | Ga0501077_0118487 | Ga0501077_0118487_261_1061 | 266 |
| 1094 | 3300049593 | Ga0501077_0312791 | Ga0501077_0312791_45_845 | 266 |
| 1095 | 3300049741 | Ga0501079_0012178 | Ga0501079_0012178_934_1743 | 266 |
| 1096 | 3300049742 | Ga0501080_0000112 | Ga0501080_0000112_41845_42645 | 266 |
| 1097 | 3300049742 | Ga0501080_0013759 | Ga0501080_0013759_5850_6650 | 266 |
| 1098 | 3300049742 | Ga0501080_0053206 | Ga0501080_0053206_1574_2374 | 266 |
| 1099 | 3300049742 | Ga0501080_0420448 | Ga0501080_0420448_34_837 | 266 |
| 1100 | 3300049743 | Ga0501081_0022376 | Ga0501081_0022376_1124_1933 | 266 |
| 1101 | 3300049744 | Ga0501083_0001098 | Ga0501083_0001098_4101_4901 | 266 |
| 1102 | 3300049744 | Ga0501083_0011138 | Ga0501083_0011138_2081_2899 | 266 |
| 1103 | 3300049744 | Ga0501083_0051420 | Ga0501083_0051420_1774_2574 | 266 |
| 1104 | 3300049822 | Ga0501035_0001573 | Ga0501035_0001573_19917_20717 | 266 |
| 1105 | 3300049822 | Ga0501035_0012556 | Ga0501035_0012556_2953_3753 | 266 |
| 1106 | 3300049822 | Ga0501035_0047298 | Ga0501035_0047298_1728_2531 | 266 |
| 1107 | 3300049822 | Ga0501035_0125846 | Ga0501035_0125846_1237_2037 | 266 |
| 1108 | 3300049822 | Ga0501035_0222004 | Ga0501035_0222004_385_1188 | 266 |
| 1109 | 3300049823 | Ga0501044_0015838 | Ga0501044_0015838_503_1303 | 266 |
| 1110 | 3300049823 | Ga0501044_0017602 | Ga0501044_0017602_1473_2273 | 266 |
| 1111 | 3300049823 | Ga0501044_0059118 | Ga0501044_0059118_1864_2664 | 266 |
| 1112 | 3300049823 | Ga0501044_0229370 | Ga0501044_0229370_759_1562 | 266 |
| 1113 | 3300049823 | Ga0501044_0291111 | Ga0501044_0291111_299_1099 | 266 |
| 1114 | 3300049824 | Ga0501045_0509016 | Ga0501045_0509016_16_825 | 266 |
| 1115 | 3300050489 | nmdc:mga03683_118853_c1 | nmdc:mga03683_118853_c1_41_868 | 266 |
| 1116 | 3300050490 | nmdc:mga03n38_125692_c1 | nmdc:mga03n38_125692_c1_153_953 | 266 |
| 1117 | 3300050490 | nmdc:mga03n38_92959_c1 | nmdc:mga03n38_92959_c1_456_1259 | 266 |
| 1118 | 3300050494 | nmdc:mga06z11_98530_c1 | nmdc:mga06z11_98530_c1_128_928 | 266 |
| 1119 | 3300050496 | nmdc:mga07m45_53349_c1 | nmdc:mga07m45_53349_c1_1278_2081 | 266 |
| 1120 | 3300050507 | nmdc:mga05p37_313858_c1 | nmdc:mga05p37_313858_c1_561_1361 | 266 |
| 1121 | 3300050507 | nmdc:mga05p37_45_c1 | nmdc:mga05p37_45_c1_76729_77529 | 266 |
| 1122 | 3300050507 | nmdc:mga05p37_9625_c1 | nmdc:mga05p37_9625_c1_4573_5373 | 266 |
| 1123 | 3300050508 | nmdc:mga09592_1055_c1 | nmdc:mga09592_1055_c1_5833_6633 | 266 |
| 1124 | 3300050508 | nmdc:mga09592_16858_c1 | nmdc:mga09592_16858_c1_4047_4907 | 266 |
| 1125 | 3300050509 | nmdc:mga0qj67_201_c1 | nmdc:mga0qj67_201_c1_38269_39069 | 266 |
| 1126 | 3300050509 | nmdc:mga0qj67_21795_c1 | nmdc:mga0qj67_21795_c1_1507_2367 | 266 |
| 1127 | 3300050509 | nmdc:mga0qj67_471394_c1 | nmdc:mga0qj67_471394_c1_160_960 | 266 |
| 1128 | 3300050509 | nmdc:mga0qj67_701_c1 | nmdc:mga0qj67_701_c1_12432_13232 | 266 |
| 1129 | 3300050510 | nmdc:mga06r32_119_c1 | nmdc:mga06r32_119_c1_8080_8940 | 266 |
| 1130 | 3300050510 | nmdc:mga06r32_227_c1 | nmdc:mga06r32_227_c1_11575_12375 | 266 |
| 1131 | 3300050510 | nmdc:mga06r32_538051_c1 | nmdc:mga06r32_538051_c1_155_982 | 266 |
| 1132 | 3300050511 | nmdc:mga08y16_1191_c1 | nmdc:mga08y16_1191_c1_441_1241 | 266 |
| 1133 | 3300050511 | nmdc:mga08y16_1666_c1 | nmdc:mga08y16_1666_c1_2447_3247 | 266 |
| 1134 | 3300050511 | nmdc:mga08y16_359795_c1 | nmdc:mga08y16_359795_c1_468_1268 | 266 |
| 1135 | 3300050511 | nmdc:mga08y16_636_c1 | nmdc:mga08y16_636_c1_4876_5736 | 266 |
| 1136 | 3300050511 | nmdc:mga08y16_87220_c1 | nmdc:mga08y16_87220_c1_1137_1937 | 266 |
| 1137 | 3300050512 | nmdc:mga0n895_147000_c1 | nmdc:mga0n895_147000_c1_214_1014 | 266 |
| 1138 | 3300050512 | nmdc:mga0n895_153246_c1 | nmdc:mga0n895_153246_c1_174_974 | 266 |
| 1139 | 3300050512 | nmdc:mga0n895_4930_c1 | nmdc:mga0n895_4930_c1_8061_8903 | 266 |
| 1140 | 3300050512 | nmdc:mga0n895_50_c1 | nmdc:mga0n895_50_c1_55413_56213 | 266 |
| 1141 | 3300050513 | nmdc:mga0rr50_17122_c1 | nmdc:mga0rr50_17122_c1_3724_4524 | 266 |
| 1142 | 3300050513 | nmdc:mga0rr50_19371_c1 | nmdc:mga0rr50_19371_c1_788_1588 | 266 |
| 1143 | 3300050513 | nmdc:mga0rr50_235652_c1 | nmdc:mga0rr50_235652_c1_463_1263 | 266 |
| 1144 | 3300050513 | nmdc:mga0rr50_398005_c1 | nmdc:mga0rr50_398005_c1_241_1041 | 266 |
| 1145 | 3300050513 | nmdc:mga0rr50_511473_c1 | nmdc:mga0rr50_511473_c1_41_841 | 266 |
| 1146 | 3300050513 | nmdc:mga0rr50_67221_c1 | nmdc:mga0rr50_67221_c1_1290_2090 | 266 |
| 1147 | 3300050514 | nmdc:mga08x19_107491_c1 | nmdc:mga08x19_107491_c1_385_1185 | 266 |
| 1148 | 3300050514 | nmdc:mga08x19_20074_c1 | nmdc:mga08x19_20074_c1_1697_2497 | 266 |
| 1149 | 3300050514 | nmdc:mga08x19_73725_c1 | nmdc:mga08x19_73725_c1_668_1468 | 266 |
| 1150 | 3300050515 | nmdc:mga0a205_173299_c1 | nmdc:mga0a205_173299_c1_44_844 | 266 |
| 1151 | 3300050515 | nmdc:mga0a205_21352_c1 | nmdc:mga0a205_21352_c1_4189_4989 | 266 |
| 1152 | 3300050515 | nmdc:mga0a205_2228_c1 | nmdc:mga0a205_2228_c1_13260_14102 | 266 |
| 1153 | 3300050515 | nmdc:mga0a205_25091_c1 | nmdc:mga0a205_25091_c1_2166_2993 | 266 |
| 1154 | 3300050515 | nmdc:mga0a205_4901_c1 | nmdc:mga0a205_4901_c1_8915_9715 | 266 |
| 1155 | 3300053077 | Ga0495601_0000006 | Ga0495601_0000006_253412_254245 | 266 |
| 1156 | 3300053077 | Ga0495601_0000204 | Ga0495601_0000204_3006_3806 | 266 |
| 1157 | 3300053077 | Ga0495601_0002295 | Ga0495601_0002295_7266_8066 | 266 |
| 1158 | 3300053077 | Ga0495601_0002402 | Ga0495601_0002402_6510_7310 | 266 |
| 1159 | 3300053077 | Ga0495601_0004165 | Ga0495601_0004165_3563_4378 | 266 |
| 1160 | 3300053077 | Ga0495601_0011343 | Ga0495601_0011343_623_1423 | 266 |
| 1161 | 3300053077 | Ga0495601_0056978 | Ga0495601_0056978_572_1390 | 266 |
| 1162 | 3300053077 | Ga0495601_0111497 | Ga0495601_0111497_259_1059 | 266 |
| 1163 | 3300053077 | Ga0495601_0201861 | Ga0495601_0201861_457_1257 | 266 |
| 1164 | 3300053078 | Ga0495612_0000004 | Ga0495612_0000004_60415_61248 | 266 |
| 1165 | 3300053078 | Ga0495612_0000384 | Ga0495612_0000384_13926_14726 | 266 |
| 1166 | 3300053078 | Ga0495612_0011006 | Ga0495612_0011006_305_1105 | 266 |
| 1167 | 3300053078 | Ga0495612_0012068 | Ga0495612_0012068_1442_2242 | 266 |
| 1168 | 3300053078 | Ga0495612_0040105 | Ga0495612_0040105_448_1266 | 266 |
| 1169 | 3300053078 | Ga0495612_0051614 | Ga0495612_0051614_229_1029 | 266 |
| 1170 | 3300053084 | Ga0495595_0000227 | Ga0495595_0000227_20714_21547 | 266 |
| 1171 | 3300053084 | Ga0495595_0000577 | Ga0495595_0000577_1238_2038 | 266 |
| 1172 | 3300053084 | Ga0495595_0000686 | Ga0495595_0000686_1569_2369 | 266 |
| 1173 | 3300053084 | Ga0495595_0001081 | Ga0495595_0001081_6157_6957 | 266 |
| 1174 | 3300053084 | Ga0495595_0002024 | Ga0495595_0002024_3190_3990 | 266 |
| 1175 | 3300053084 | Ga0495595_0023885 | Ga0495595_0023885_537_1337 | 266 |
| 1176 | 3300053084 | Ga0495595_0071131 | Ga0495595_0071131_714_1514 | 266 |
| 1177 | 3300053084 | Ga0495595_0098390 | Ga0495595_0098390_52_852 | 266 |
| 1178 | 3300053084 | Ga0495595_0214467 | Ga0495595_0214467_23_823 | 266 |
| 1179 | 3300053085 | Ga0495619_0000027 | Ga0495619_0000027_44670_45503 | 266 |
| 1180 | 3300053085 | Ga0495619_0000260 | Ga0495619_0000260_21835_22635 | 266 |
| 1181 | 3300053085 | Ga0495619_0000655 | Ga0495619_0000655_9010_9810 | 266 |
| 1182 | 3300053085 | Ga0495619_0015754 | Ga0495619_0015754_2169_2987 | 266 |
| 1183 | 3300053085 | Ga0495619_0017989 | Ga0495619_0017989_2403_3203 | 266 |
| 1184 | 3300053085 | Ga0495619_0024139 | Ga0495619_0024139_2187_2987 | 266 |
| 1185 | 3300053085 | Ga0495619_0061424 | Ga0495619_0061424_1635_2435 | 266 |
| 1186 | 3300053085 | Ga0495619_0072372 | Ga0495619_0072372_411_1211 | 266 |
| 1187 | 3300053087 | Ga0500643_002725 | Ga0500643_002725_513_1313 | 266 |
| 1188 | 3300053088 | Ga0500644_0000577 | Ga0500644_0000577_6867_7667 | 266 |
| 1189 | 3300053093 | Ga0500651_0016523 | Ga0500651_0016523_1168_1968 | 266 |
| 1190 | 3300053094 | Ga0500566_0060690 | Ga0500566_0060690_920_1720 | 266 |
| 1191 | 3300053096 | Ga0500641_0018081 | Ga0500641_0018081_818_1618 | 266 |
| 1192 | 3300053119 | Ga0500595_000144 | Ga0500595_000144_23004_23804 | 266 |
| 1193 | 3300053119 | Ga0500595_082593 | Ga0500595_082593_56_856 | 266 |
| 1194 | 3300053131 | Ga0500652_000016 | Ga0500652_000016_16118_16918 | 266 |
| 1195 | 3300053131 | Ga0500652_066720 | Ga0500652_066720_85_885 | 266 |
| 1196 | 3300053153 | Ga0500616_0000006 | Ga0500616_0000006_413422_414222 | 266 |
| 1197 | 3300053153 | Ga0500616_0011270 | Ga0500616_0011270_2860_3660 | 266 |
| 1198 | 3300053158 | Ga0500627_0124195 | Ga0500627_0124195_271_1074 | 266 |
| 1199 | 3300053177 | Ga0500636_0021600 | Ga0500636_0021600_368_1168 | 266 |
| 1200 | 3300053730 | Ga0500645_001128 | Ga0500645_001128_6830_7630 | 266 |
| 1201 | 3300054114 | Ga0501084_0072817 | Ga0501084_0072817_2041_2859 | 266 |
| 1202 | 3300054114 | Ga0501084_0212725 | Ga0501084_0212725_113_913 | 266 |
| 1203 | 3300060353 | Ga0501082_0021751 | Ga0501082_0021751_2588_3388 | 266 |
| 1204 | 3300060353 | Ga0501082_0147860 | Ga0501082_0147860_1054_1863 | 266 |
| 1205 | 3300060353 | Ga0501082_0239674 | Ga0501082_0239674_515_1315 | 266 |
| 1206 | 3300061719 | Ga0466962_0099785 | Ga0466962_0099785_334_1134 | 266 |
| 1207 | 3300061734 | Ga0530510_0107937 | Ga0530510_0107937_786_1595 | 266 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7dqx-assembly1.cif.gz_B | crystal structure of xanthine dehydrogenase family protein | 0.8555 | 4 | 264 |
| 7dqx-assembly1.cif.gz_E | crystal structure of xanthine dehydrogenase family protein | 0.8453 | 4 | 264 |
| 1ffv-assembly1.cif.gz_F | carbon monoxide dehydrogenase from hydrogenophaga pseudoflava | 0.8397 | 3 | 265 |
| 7dqx-assembly1.cif.gz_B | crystal structure of xanthine dehydrogenase family protein | 0.8375 | 4 | 264 |
| 1ffu-assembly1.cif.gz_F | carbon monoxide dehydrogenase from hydrogenophaga pseudoflava which lacks the mo-pyranopterin moiety of the molybdenum cofactor | 0.8358 | 3 | 265 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1t3qF02 | Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; | 0.936 | 55 | 167 | 3.30.465.10 |
| 1ffvC03 | Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; | 0.9156 | 57 | 166 | 3.30.465.10 |
| af_I6Y7N2_57_165_3.30.465.10 | Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; | 0.9129 | 62 | 166 | 3.30.465.10 |
| af_Q46800_56_173_3.30.465.10 | Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; | 0.8919 | 56 | 166 | 3.30.465.10 |
| 1t3qF02 | Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; | 0.8906 | 55 | 167 | 3.30.465.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A527DEU0-F1-model_v4 | Carbon monoxide dehydrogenase | 0.9798 | 133 | 266 |
|
| AF-A0A1H8YRK0-F1-model_v4 | Carbon-monoxide dehydrogenase medium subunit | 0.9756 | 169 | 264 |
|
| AF-A0A1M7TWS0-F1-model_v4 | Carbon-monoxide dehydrogenase medium subunit | 0.9741 | 148 | 264 |
|
| AF-A0A3S1U3F1-F1-model_v4 | deleted | 0.9739 | 146 | 266 |
|
| AF-A0A2S6TG65-F1-model_v4 | FAD-binding PCMH-type domain-containing protein | 0.9736 | 56 | 262 |
GO:0016491
GO:0071949 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar