F491661
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1207 | 481 | 1203 | 129 |
Family's Representative Sequence
| Representative Sequence | 3300014497|Ga0182008_10034186|Ga0182008_100341862 |
| Length | 156 |
| Sequence | MARHVFLLLEAGANCDSAPLAGEQCRWEIEMDDRAVQLALERHWDASDASDFTVEHEIYREDAVLEYPQSGERIRGRKNIQESRSVQPNKKRFTVRRIIGSGDLWVTEFVLTYDGVPSYAVSIMEFREGLVTNETQYFADRFDPAPSRSHLVERVG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 2 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 3 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 4 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 5 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 6 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 7 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 8 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 9 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 10 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 11 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 12 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 13 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 14 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 15 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 16 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 17 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 18 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 25 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 29 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 40 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 55 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 56 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 61 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 62 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 64 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 66 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 71 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 72 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 74 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 75 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 76 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 78 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 79 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 80 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 81 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 82 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 83 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 84 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 85 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 86 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 87 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 88 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 89 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 90 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 91 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 93 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 94 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 95 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 96 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 97 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 98 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 99 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 100 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 101 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 102 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 103 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 105 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 106 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 107 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 108 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 109 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 110 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 111 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 112 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 113 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 114 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 116 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 117 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 118 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 119 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 120 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 121 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 134 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300012476 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 | Metagenome | Rhizosphere |
| 137 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 147 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 151 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 153 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 154 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 155 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 156 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 157 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 158 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 159 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 162 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 163 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 164 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 165 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 166 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 167 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 168 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 231 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 232 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 233 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 235 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 236 | 3300028036 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 | Metagenome | Rhizosphere |
| 237 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 241 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 242 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 243 | 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 244 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 245 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 246 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 247 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 248 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 249 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 250 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 251 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 252 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 253 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 254 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 255 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 256 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 257 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 258 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 259 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 260 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 261 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 262 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 263 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 264 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 265 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 266 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 267 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 268 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 269 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 270 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 271 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 272 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 273 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 274 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 275 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 276 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 277 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 278 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 279 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 280 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 281 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 282 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 283 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 284 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 285 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 286 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 287 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 288 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 289 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 290 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 291 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 292 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 293 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 294 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 295 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 296 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 297 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 298 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 299 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 300 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 301 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 302 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 303 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 304 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 305 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 306 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 307 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 308 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 309 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 310 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 311 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 312 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 313 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 388 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 389 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 390 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 391 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 392 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 393 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 394 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 395 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 396 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 397 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 398 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 399 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 400 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 401 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 402 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 403 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 404 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 405 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 406 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 407 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 408 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 409 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 410 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 411 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 413 | 3300049672 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought | Metagenome | Rhizosphere |
| 414 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 415 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 416 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 417 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 418 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 419 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 420 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 421 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 422 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 423 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 424 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 425 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 426 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 427 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 428 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 429 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 430 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 431 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 432 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 433 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 435 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 436 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 440 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 441 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 442 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 443 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 444 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 445 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 446 | 3300053097 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere | Metagenome | Endosphere |
| 447 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 448 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 449 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 450 | 3300053106 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere | Metagenome | Endosphere |
| 451 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 452 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 453 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 454 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 455 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 456 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 457 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 458 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 459 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 460 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 461 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 462 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 463 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 464 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 465 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 466 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 467 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 468 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 469 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 470 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 471 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 472 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 473 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 474 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 475 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 476 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 477 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 478 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 479 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 480 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 481 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.5 |
| Metatranscriptomes | 0.33 |
| Isolates | 0.17 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 14.17 |
| Nodule | 1.24 |
| Rhizoplane | 7.62 |
| Rhizosphere | 72.66 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.31 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24746J21847_1012257 | 3300001977 | Bacteria | 1254 |
| 2 | JGI24737J22298_10097201 | 3300001990 | Bacteria | 873 |
| 3 | JGI24743J22301_10018930 | 3300001991 | Bacteria | 1305 |
| 4 | JGI24750J21931_1006628 | 3300002070 | Bacteria | 1445 |
| 5 | JGI24748J21848_1002927 | 3300002074 | Bacteria | 1945 |
| 6 | JGI24738J21930_10014138 | 3300002075 | Bacteria | 1716 |
| 7 | JGI24744J21845_10004502 | 3300002077 | Bacteria | 2879 |
| 8 | JGI24742J22300_10003801 | 3300002244 | Bacteria | 2453 |
| 9 | JGI24742J22300_10050271 | 3300002244 | Bacteria | 754 |
| 10 | JGI25406J46586_10000141 | 3300003203 | Bacteria | 31326 |
| 11 | JGI25165J46597_1000079 | 3300003214 | Bacteria | 179163 |
| 12 | JGI25153J46596_10000083 | 3300003215 | Bacteria | 112056 |
| 13 | JGI25153J46596_10001465 | 3300003215 | Bacteria | 14081 |
| 14 | JGI25153J46596_10026936 | 3300003215 | Bacteria | 2024 |
| 15 | JGI25153J46596_10096827 | 3300003215 | Bacteria | 701 |
| 16 | rootL2_10033170 | 3300003322 | Bacteria | 1217 |
| 17 | rootL2_10033171 | 3300003322 | Bacteria | 1025 |
| 18 | rootL2_10340203 | 3300003322 | Bacteria | 1269 |
| 19 | JGI25404J52841_10022631 | 3300003659 | Bacteria | 1358 |
| 20 | JGI25404J52841_10114191 | 3300003659 | Bacteria | 568 |
| 21 | Ga0055529_1003576 | 3300003763 | Bacteria | 2542 |
| 22 | Ga0055531_10008570 | 3300003794 | Bacteria | 5367 |
| 23 | Ga0070658_10998829 | 3300005327 | Bacteria | 728 |
| 24 | Ga0070676_10038116 | 3300005328 | Bacteria | 2775 |
| 25 | Ga0070676_10441965 | 3300005328 | Bacteria | 913 |
| 26 | Ga0070683_100043821 | 3300005329 | Bacteria | 4124 |
| 27 | Ga0070683_100058699 | 3300005329 | Bacteria | 3574 |
| 28 | Ga0070683_100369195 | 3300005329 | Bacteria | 1367 |
| 29 | Ga0070683_100481303 | 3300005329 | Bacteria | 1185 |
| 30 | Ga0070690_100033424 | 3300005330 | Bacteria | 3219 |
| 31 | Ga0070690_100227885 | 3300005330 | Bacteria | 1309 |
| 32 | Ga0070670_100034140 | 3300005331 | Bacteria | 4379 |
| 33 | Ga0070670_100222100 | 3300005331 | Bacteria | 1644 |
| 34 | Ga0070677_10126034 | 3300005333 | Bacteria | 1163 |
| 35 | Ga0068869_100103670 | 3300005334 | Bacteria | 2155 |
| 36 | Ga0068869_100820464 | 3300005334 | Bacteria | 800 |
| 37 | Ga0070666_10021441 | 3300005335 | Bacteria | 4188 |
| 38 | Ga0070666_10237036 | 3300005335 | Bacteria | 1289 |
| 39 | Ga0070680_100186297 | 3300005336 | Bacteria | 1748 |
| 40 | Ga0070682_100432072 | 3300005337 | Bacteria | 1004 |
| 41 | Ga0068868_100032452 | 3300005338 | Bacteria | 4017 |
| 42 | Ga0068868_100076529 | 3300005338 | Bacteria | 2675 |
| 43 | Ga0068868_100190280 | 3300005338 | Bacteria | 1706 |
| 44 | Ga0070689_100261093 | 3300005340 | Bacteria | 1432 |
| 45 | Ga0070689_101386274 | 3300005340 | Bacteria | 635 |
| 46 | Ga0070691_10211391 | 3300005341 | Bacteria | 1023 |
| 47 | Ga0070687_100324798 | 3300005343 | Bacteria | 984 |
| 48 | Ga0070661_100115681 | 3300005344 | Bacteria | 2006 |
| 49 | Ga0070661_100149347 | 3300005344 | Bacteria | 1766 |
| 50 | Ga0070668_100051916 | 3300005347 | Bacteria | 3160 |
| 51 | Ga0070668_100338781 | 3300005347 | Bacteria | 1270 |
| 52 | Ga0070668_100749340 | 3300005347 | Bacteria | 864 |
| 53 | Ga0070668_101286140 | 3300005347 | Bacteria | 664 |
| 54 | Ga0070669_100427826 | 3300005353 | Bacteria | 1088 |
| 55 | Ga0070675_100292425 | 3300005354 | Bacteria | 1434 |
| 56 | Ga0070671_100068026 | 3300005355 | Bacteria | 2970 |
| 57 | Ga0070671_100157423 | 3300005355 | Bacteria | 1919 |
| 58 | Ga0070671_100193026 | 3300005355 | Bacteria | 1726 |
| 59 | Ga0070671_101110758 | 3300005355 | Bacteria | 694 |
| 60 | Ga0070674_100103785 | 3300005356 | Bacteria | 2076 |
| 61 | Ga0070674_100165038 | 3300005356 | Bacteria | 1684 |
| 62 | Ga0070674_100400327 | 3300005356 | Bacteria | 1122 |
| 63 | Ga0070673_100206555 | 3300005364 | Bacteria | 1694 |
| 64 | Ga0070673_100338577 | 3300005364 | Bacteria | 1332 |
| 65 | Ga0070688_100011699 | 3300005365 | Bacteria | 4888 |
| 66 | Ga0070659_100018907 | 3300005366 | Bacteria | 5205 |
| 67 | Ga0070659_100258131 | 3300005366 | Bacteria | 1446 |
| 68 | Ga0070659_100637824 | 3300005366 | Bacteria | 918 |
| 69 | Ga0070659_102168327 | 3300005366 | Bacteria | 500 |
| 70 | Ga0070667_100126724 | 3300005367 | Bacteria | 2225 |
| 71 | Ga0070667_100128355 | 3300005367 | Bacteria | 2211 |
| 72 | Ga0070703_10049713 | 3300005406 | Bacteria | 1336 |
| 73 | Ga0070709_10034131 | 3300005434 | Bacteria | 3083 |
| 74 | Ga0070709_10063854 | 3300005434 | Bacteria | 2353 |
| 75 | Ga0070709_10092025 | 3300005434 | Bacteria | 2002 |
| 76 | Ga0070714_100023528 | 3300005435 | Bacteria | 5064 |
| 77 | Ga0070714_100419139 | 3300005435 | Bacteria | 1268 |
| 78 | Ga0070714_100475385 | 3300005435 | Bacteria | 1189 |
| 79 | Ga0070714_100622306 | 3300005435 | Bacteria | 1038 |
| 80 | Ga0070714_100745294 | 3300005435 | Bacteria | 947 |
| 81 | Ga0070714_100910647 | 3300005435 | Bacteria | 854 |
| 82 | Ga0070713_100082405 | 3300005436 | Bacteria | 2747 |
| 83 | Ga0070713_100103250 | 3300005436 | Bacteria | 2473 |
| 84 | Ga0070713_100126649 | 3300005436 | Bacteria | 2247 |
| 85 | Ga0070713_100202463 | 3300005436 | Bacteria | 1793 |
| 86 | Ga0070713_100333438 | 3300005436 | Bacteria | 1404 |
| 87 | Ga0070710_10061973 | 3300005437 | Bacteria | 2132 |
| 88 | Ga0070710_10555368 | 3300005437 | Bacteria | 793 |
| 89 | Ga0070711_100013376 | 3300005439 | Bacteria | 5154 |
| 90 | Ga0070711_100623599 | 3300005439 | Bacteria | 902 |
| 91 | Ga0070705_100135126 | 3300005440 | Bacteria | 1614 |
| 92 | Ga0070700_100096999 | 3300005441 | Bacteria | 1935 |
| 93 | Ga0070700_100369672 | 3300005441 | Bacteria | 1069 |
| 94 | Ga0070694_100309001 | 3300005444 | Bacteria | 1214 |
| 95 | Ga0070663_100013068 | 3300005455 | Bacteria | 5275 |
| 96 | Ga0070663_100153170 | 3300005455 | Bacteria | 1769 |
| 97 | Ga0070663_100232418 | 3300005455 | Bacteria | 1452 |
| 98 | Ga0070663_100582960 | 3300005455 | Bacteria | 938 |
| 99 | Ga0070678_100015000 | 3300005456 | Bacteria | 4907 |
| 100 | Ga0070678_100597917 | 3300005456 | Bacteria | 984 |
| 101 | Ga0070678_101355815 | 3300005456 | Bacteria | 663 |
| 102 | Ga0070662_100010380 | 3300005457 | Bacteria | 6107 |
| 103 | Ga0070662_100102222 | 3300005457 | Bacteria | 2171 |
| 104 | Ga0070662_100225935 | 3300005457 | Bacteria | 1496 |
| 105 | Ga0070662_100553911 | 3300005457 | Bacteria | 964 |
| 106 | Ga0070681_10036625 | 3300005458 | Bacteria | 4926 |
| 107 | Ga0070681_10092772 | 3300005458 | Bacteria | 2968 |
| 108 | Ga0070681_10356089 | 3300005458 | Bacteria | 1374 |
| 109 | Ga0068867_101307242 | 3300005459 | Bacteria | 670 |
| 110 | Ga0070685_10005252 | 3300005466 | Bacteria | 6570 |
| 111 | Ga0070706_100510191 | 3300005467 | Bacteria | 1118 |
| 112 | Ga0070706_101865801 | 3300005467 | Bacteria | 546 |
| 113 | Ga0070698_100263292 | 3300005471 | Bacteria | 1656 |
| 114 | Ga0070698_100556222 | 3300005471 | Bacteria | 1087 |
| 115 | Ga0070698_101345321 | 3300005471 | Bacteria | 665 |
| 116 | Ga0070699_100168274 | 3300005518 | Bacteria | 1942 |
| 117 | Ga0070679_100207552 | 3300005530 | Bacteria | 1923 |
| 118 | Ga0070679_100570664 | 3300005530 | Bacteria | 1075 |
| 119 | Ga0070679_100924664 | 3300005530 | Bacteria | 816 |
| 120 | Ga0070684_100169809 | 3300005535 | Bacteria | 1981 |
| 121 | Ga0070697_100165328 | 3300005536 | Bacteria | 1871 |
| 122 | Ga0068853_100007218 | 3300005539 | Bacteria | 8900 |
| 123 | Ga0068853_100013283 | 3300005539 | Bacteria | 6724 |
| 124 | Ga0068853_100035353 | 3300005539 | Bacteria | 4244 |
| 125 | Ga0068853_100267736 | 3300005539 | Bacteria | 1573 |
| 126 | Ga0068853_100343778 | 3300005539 | Bacteria | 1387 |
| 127 | Ga0068853_100856995 | 3300005539 | Bacteria | 872 |
| 128 | Ga0068853_101423548 | 3300005539 | Bacteria | 671 |
| 129 | Ga0068853_101688986 | 3300005539 | Bacteria | 614 |
| 130 | Ga0070672_100001580 | 3300005543 | Bacteria | 14111 |
| 131 | Ga0070672_100231700 | 3300005543 | Bacteria | 1552 |
| 132 | Ga0070686_100015908 | 3300005544 | Bacteria | 4368 |
| 133 | Ga0070695_100711901 | 3300005545 | Bacteria | 798 |
| 134 | Ga0070696_100062520 | 3300005546 | Bacteria | 2606 |
| 135 | Ga0070696_100209183 | 3300005546 | Bacteria | 1460 |
| 136 | Ga0070693_100002880 | 3300005547 | Bacteria | 7934 |
| 137 | Ga0070693_100018934 | 3300005547 | Bacteria | 3603 |
| 138 | Ga0070693_100195011 | 3300005547 | Bacteria | 1312 |
| 139 | Ga0070665_100002371 | 3300005548 | Bacteria | 20814 |
| 140 | Ga0070665_100049057 | 3300005548 | Bacteria | 4237 |
| 141 | Ga0070665_100056376 | 3300005548 | Bacteria | 3939 |
| 142 | Ga0070665_100155645 | 3300005548 | Bacteria | 2288 |
| 143 | Ga0070665_100233455 | 3300005548 | Bacteria | 1840 |
| 144 | Ga0070665_100242469 | 3300005548 | Bacteria | 1803 |
| 145 | Ga0070665_100325675 | 3300005548 | Bacteria | 1541 |
| 146 | Ga0070665_100490466 | 3300005548 | Bacteria | 1239 |
| 147 | Ga0070665_100655738 | 3300005548 | Bacteria | 1063 |
| 148 | Ga0070665_100674530 | 3300005548 | Bacteria | 1047 |
| 149 | Ga0070665_102447995 | 3300005548 | Bacteria | 524 |
| 150 | Ga0070704_100102880 | 3300005549 | Bacteria | 2156 |
| 151 | Ga0068855_100030970 | 3300005563 | Bacteria | 6393 |
| 152 | Ga0068855_100043783 | 3300005563 | Bacteria | 5300 |
| 153 | Ga0068855_100685732 | 3300005563 | Bacteria | 1097 |
| 154 | Ga0068855_101039975 | 3300005563 | Bacteria | 859 |
| 155 | Ga0070664_100227073 | 3300005564 | Bacteria | 1672 |
| 156 | Ga0070664_100267727 | 3300005564 | Bacteria | 1538 |
| 157 | Ga0070664_100671212 | 3300005564 | Bacteria | 964 |
| 158 | Ga0070664_101170780 | 3300005564 | Bacteria | 725 |
| 159 | Ga0068857_100294146 | 3300005577 | Bacteria | 1496 |
| 160 | Ga0068857_100767578 | 3300005577 | Bacteria | 919 |
| 161 | Ga0068857_101267265 | 3300005577 | Bacteria | 715 |
| 162 | Ga0068854_101329044 | 3300005578 | Bacteria | 648 |
| 163 | Ga0068856_101169245 | 3300005614 | Bacteria | 786 |
| 164 | Ga0068856_102124311 | 3300005614 | Bacteria | 571 |
| 165 | Ga0070702_100008859 | 3300005615 | Bacteria | 4895 |
| 166 | Ga0070702_100277779 | 3300005615 | Bacteria | 1148 |
| 167 | Ga0068852_100021320 | 3300005616 | Bacteria | 5171 |
| 168 | Ga0068852_101542836 | 3300005616 | Bacteria | 686 |
| 169 | Ga0068859_100653386 | 3300005617 | Bacteria | 1143 |
| 170 | Ga0068859_102301750 | 3300005617 | Bacteria | 594 |
| 171 | Ga0068864_100050102 | 3300005618 | Bacteria | 3593 |
| 172 | Ga0068864_100405846 | 3300005618 | Bacteria | 1296 |
| 173 | Ga0068864_101871450 | 3300005618 | Bacteria | 606 |
| 174 | Ga0068866_10023225 | 3300005718 | Bacteria | 2881 |
| 175 | Ga0068861_100196403 | 3300005719 | Bacteria | 1690 |
| 176 | Ga0068861_100257786 | 3300005719 | Bacteria | 1491 |
| 177 | Ga0068851_10102114 | 3300005834 | Bacteria | 1523 |
| 178 | Ga0068870_10030330 | 3300005840 | Bacteria | 2732 |
| 179 | Ga0068870_10478712 | 3300005840 | Bacteria | 826 |
| 180 | Ga0068863_100097929 | 3300005841 | Bacteria | 2785 |
| 181 | Ga0068858_100023824 | 3300005842 | Bacteria | 5704 |
| 182 | Ga0068858_100128455 | 3300005842 | Bacteria | 2375 |
| 183 | Ga0068858_100166815 | 3300005842 | Bacteria | 2075 |
| 184 | Ga0068858_100224742 | 3300005842 | Bacteria | 1779 |
| 185 | Ga0068858_100852709 | 3300005842 | Bacteria | 890 |
| 186 | Ga0068860_100001170 | 3300005843 | Bacteria | 28729 |
| 187 | Ga0068860_100125230 | 3300005843 | Bacteria | 2462 |
| 188 | Ga0068860_100132585 | 3300005843 | Bacteria | 2392 |
| 189 | Ga0068860_100152561 | 3300005843 | Bacteria | 2225 |
| 190 | Ga0068860_100172976 | 3300005843 | Bacteria | 2086 |
| 191 | Ga0068860_100860619 | 3300005843 | Bacteria | 921 |
| 192 | Ga0068860_101454885 | 3300005843 | Bacteria | 707 |
| 193 | Ga0068862_100081947 | 3300005844 | Bacteria | 2799 |
| 194 | Ga0081455_10009004 | 3300005937 | Bacteria | 10307 |
| 195 | Ga0081455_10079109 | 3300005937 | Bacteria | 2700 |
| 196 | Ga0081455_10528343 | 3300005937 | Bacteria | 785 |
| 197 | Ga0081540_1005695 | 3300005983 | Bacteria | 9246 |
| 198 | Ga0081540_1011062 | 3300005983 | Bacteria | 6059 |
| 199 | Ga0081540_1021860 | 3300005983 | Bacteria | 3792 |
| 200 | Ga0081540_1036990 | 3300005983 | Bacteria | 2594 |
| 201 | Ga0081540_1207613 | 3300005983 | Bacteria | 707 |
| 202 | Ga0081539_10000008 | 3300005985 | Bacteria | 525071 |
| 203 | Ga0070717_10012822 | 3300006028 | Bacteria | 6399 |
| 204 | Ga0070717_10044494 | 3300006028 | Bacteria | 3625 |
| 205 | Ga0070717_10071458 | 3300006028 | Bacteria | 2895 |
| 206 | Ga0070717_10190210 | 3300006028 | Bacteria | 1793 |
| 207 | Ga0070717_10411620 | 3300006028 | Bacteria | 1215 |
| 208 | Ga0070717_10914881 | 3300006028 | Bacteria | 799 |
| 209 | Ga0070717_11180492 | 3300006028 | Bacteria | 697 |
| 210 | Ga0075365_10030954 | 3300006038 | Bacteria | 3431 |
| 211 | Ga0075365_10031232 | 3300006038 | Bacteria | 3416 |
| 212 | Ga0075365_10031422 | 3300006038 | Bacteria | 3406 |
| 213 | Ga0075365_10031723 | 3300006038 | Bacteria | 3391 |
| 214 | Ga0075365_10188458 | 3300006038 | Bacteria | 1443 |
| 215 | Ga0075365_10551704 | 3300006038 | Bacteria | 815 |
| 216 | Ga0075368_10021264 | 3300006042 | Bacteria | 2463 |
| 217 | Ga0075368_10355637 | 3300006042 | Bacteria | 638 |
| 218 | Ga0075363_100197415 | 3300006048 | Bacteria | 1149 |
| 219 | Ga0075363_100223520 | 3300006048 | Bacteria | 1079 |
| 220 | Ga0075363_100293967 | 3300006048 | Bacteria | 942 |
| 221 | Ga0075364_10135749 | 3300006051 | Bacteria | 1652 |
| 222 | Ga0075364_10180179 | 3300006051 | Bacteria | 1429 |
| 223 | Ga0075364_10374629 | 3300006051 | Bacteria | 971 |
| 224 | Ga0075364_11017455 | 3300006051 | Bacteria | 563 |
| 225 | Ga0070715_10149386 | 3300006163 | Bacteria | 1143 |
| 226 | Ga0070716_100560142 | 3300006173 | Bacteria | 854 |
| 227 | Ga0070716_100714808 | 3300006173 | Bacteria | 767 |
| 228 | Ga0070712_100197388 | 3300006175 | Bacteria | 1578 |
| 229 | Ga0070712_100255778 | 3300006175 | Bacteria | 1401 |
| 230 | Ga0070712_100705437 | 3300006175 | Bacteria | 860 |
| 231 | Ga0070712_100800477 | 3300006175 | Bacteria | 809 |
| 232 | Ga0070712_101045216 | 3300006175 | Bacteria | 708 |
| 233 | Ga0070712_101486738 | 3300006175 | Bacteria | 592 |
| 234 | Ga0075362_10021853 | 3300006177 | Bacteria | 2691 |
| 235 | Ga0075362_10091762 | 3300006177 | Bacteria | 1410 |
| 236 | Ga0075367_10044838 | 3300006178 | Bacteria | 2594 |
| 237 | Ga0075367_10138219 | 3300006178 | Bacteria | 1508 |
| 238 | Ga0075367_10305473 | 3300006178 | Bacteria | 1002 |
| 239 | Ga0075369_10038126 | 3300006186 | Bacteria | 2050 |
| 240 | Ga0075369_10196175 | 3300006186 | Bacteria | 931 |
| 241 | Ga0075369_10247548 | 3300006186 | Bacteria | 827 |
| 242 | Ga0075369_10592383 | 3300006186 | Bacteria | 531 |
| 243 | Ga0075366_10020582 | 3300006195 | Bacteria | 3830 |
| 244 | Ga0075366_10326100 | 3300006195 | Bacteria | 941 |
| 245 | Ga0075366_10428845 | 3300006195 | Bacteria | 815 |
| 246 | Ga0097621_100000035 | 3300006237 | Bacteria | 68179 |
| 247 | Ga0097621_100041237 | 3300006237 | Bacteria | 3715 |
| 248 | Ga0097621_100086763 | 3300006237 | Bacteria | 2612 |
| 249 | Ga0075370_10020680 | 3300006353 | Bacteria | 3600 |
| 250 | Ga0075370_10092306 | 3300006353 | Bacteria | 1747 |
| 251 | Ga0075370_10328369 | 3300006353 | Bacteria | 912 |
| 252 | Ga0075370_10568578 | 3300006353 | Bacteria | 686 |
| 253 | Ga0068871_100000287 | 3300006358 | Bacteria | 35135 |
| 254 | Ga0068871_100039246 | 3300006358 | Bacteria | 3787 |
| 255 | Ga0068871_100184888 | 3300006358 | Bacteria | 1792 |
| 256 | Ga0068871_100253556 | 3300006358 | Bacteria | 1533 |
| 257 | Ga0068871_100376370 | 3300006358 | Bacteria | 1261 |
| 258 | Ga0075428_100018258 | 3300006844 | Bacteria | 7752 |
| 259 | Ga0075428_100261173 | 3300006844 | Bacteria | 1864 |
| 260 | Ga0075428_100262480 | 3300006844 | Bacteria | 1859 |
| 261 | Ga0075430_100148246 | 3300006846 | Bacteria | 1954 |
| 262 | Ga0075431_100250536 | 3300006847 | Bacteria | 1799 |
| 263 | Ga0075433_10911523 | 3300006852 | Bacteria | 767 |
| 264 | Ga0075433_10997282 | 3300006852 | Bacteria | 730 |
| 265 | Ga0075434_100151718 | 3300006871 | Bacteria | 2337 |
| 266 | Ga0075434_100902373 | 3300006871 | Bacteria | 898 |
| 267 | Ga0075429_101095470 | 3300006880 | Bacteria | 696 |
| 268 | Ga0068865_100397117 | 3300006881 | Bacteria | 1128 |
| 269 | Ga0068865_100493023 | 3300006881 | Bacteria | 1020 |
| 270 | Ga0075436_100058654 | 3300006914 | Bacteria | 2659 |
| 271 | Ga0097620_100653378 | 3300006931 | Bacteria | 1143 |
| 272 | Ga0097620_102302830 | 3300006931 | Bacteria | 594 |
| 273 | Ga0099825_1019193 | 3300006941 | Bacteria | 5138 |
| 274 | Ga0099825_1022726 | 3300006941 | Bacteria | 3987 |
| 275 | Ga0099824_1028856 | 3300006942 | Bacteria | 2448 |
| 276 | Ga0099824_1056536 | 3300006942 | Bacteria | 666 |
| 277 | Ga0099823_1000042 | 3300006944 | Bacteria | 60927 |
| 278 | Ga0099823_1068153 | 3300006944 | Bacteria | 1648 |
| 279 | Ga0075435_100399102 | 3300007076 | Bacteria | 1183 |
| 280 | Ga0099794_10044503 | 3300007265 | Bacteria | 2122 |
| 281 | Ga0099795_10084919 | 3300007788 | Bacteria | 1217 |
| 282 | Ga0099795_10135349 | 3300007788 | Bacteria | 998 |
| 283 | Ga0105240_10003004 | 3300009093 | Bacteria | 26546 |
| 284 | Ga0105240_10167862 | 3300009093 | Bacteria | 2602 |
| 285 | Ga0105240_10177698 | 3300009093 | Bacteria | 2515 |
| 286 | Ga0105240_10186744 | 3300009093 | Bacteria | 2441 |
| 287 | Ga0105240_11583468 | 3300009093 | Bacteria | 686 |
| 288 | Ga0105240_12388768 | 3300009093 | Bacteria | 547 |
| 289 | Ga0111539_10279104 | 3300009094 | Bacteria | 1944 |
| 290 | Ga0111539_10660878 | 3300009094 | Bacteria | 1217 |
| 291 | Ga0111539_13112131 | 3300009094 | Bacteria | 535 |
| 292 | Ga0105245_10023627 | 3300009098 | Bacteria | 5397 |
| 293 | Ga0105245_10177430 | 3300009098 | Bacteria | 2033 |
| 294 | Ga0105245_10436964 | 3300009098 | Bacteria | 1315 |
| 295 | Ga0105245_11803904 | 3300009098 | Bacteria | 664 |
| 296 | Ga0105245_11948922 | 3300009098 | Bacteria | 641 |
| 297 | Ga0105247_10008014 | 3300009101 | Bacteria | 6456 |
| 298 | Ga0105247_10047677 | 3300009101 | Bacteria | 2631 |
| 299 | Ga0114129_10018100 | 3300009147 | Bacteria | 10036 |
| 300 | Ga0114129_10179083 | 3300009147 | Bacteria | 2886 |
| 301 | Ga0114129_10197396 | 3300009147 | Bacteria | 2728 |
| 302 | Ga0114129_11143862 | 3300009147 | Bacteria | 972 |
| 303 | Ga0114129_12426892 | 3300009147 | Bacteria | 628 |
| 304 | Ga0105243_10059744 | 3300009148 | Bacteria | 3044 |
| 305 | Ga0105241_10031877 | 3300009174 | Bacteria | 3947 |
| 306 | Ga0105242_10071280 | 3300009176 | Bacteria | 2883 |
| 307 | Ga0105242_10094307 | 3300009176 | Bacteria | 2524 |
| 308 | Ga0105242_10375559 | 3300009176 | Bacteria | 1320 |
| 309 | Ga0105248_10026597 | 3300009177 | Bacteria | 6435 |
| 310 | Ga0105248_10248346 | 3300009177 | Bacteria | 2003 |
| 311 | Ga0105248_10983788 | 3300009177 | Bacteria | 953 |
| 312 | Ga0105248_12120140 | 3300009177 | Bacteria | 639 |
| 313 | Ga0105237_10014439 | 3300009545 | Bacteria | 8260 |
| 314 | Ga0105237_10033837 | 3300009545 | Bacteria | 5178 |
| 315 | Ga0105237_10097347 | 3300009545 | Bacteria | 2932 |
| 316 | Ga0105237_10169585 | 3300009545 | Unclassified | 2182 |
| 317 | Ga0105237_10179726 | 3300009545 | Bacteria | 2116 |
| 318 | Ga0105237_10309840 | 3300009545 | Bacteria | 1582 |
| 319 | Ga0105237_10508770 | 3300009545 | Unclassified | 1211 |
| 320 | Ga0105237_10541218 | 3300009545 | Bacteria | 1171 |
| 321 | Ga0105237_10901705 | 3300009545 | Bacteria | 891 |
| 322 | Ga0105237_11157061 | 3300009545 | Bacteria | 780 |
| 323 | Ga0105237_11333455 | 3300009545 | Bacteria | 724 |
| 324 | Ga0105238_12128875 | 3300009551 | Bacteria | 595 |
| 325 | Ga0105238_12443781 | 3300009551 | Bacteria | 558 |
| 326 | Ga0105249_10026912 | 3300009553 | Bacteria | 5186 |
| 327 | Ga0105249_11377713 | 3300009553 | Bacteria | 777 |
| 328 | Ga0105249_12092050 | 3300009553 | Bacteria | 639 |
| 329 | Ga0099796_10104805 | 3300010159 | Bacteria | 1069 |
| 330 | Ga0099796_10286391 | 3300010159 | Bacteria | 694 |
| 331 | Ga0105239_10013998 | 3300010375 | Bacteria | 8908 |
| 332 | Ga0105239_10047667 | 3300010375 | Bacteria | 4696 |
| 333 | Ga0105239_10098444 | 3300010375 | Bacteria | 3233 |
| 334 | Ga0105239_10544404 | 3300010375 | Bacteria | 1322 |
| 335 | Ga0105239_10932655 | 3300010375 | Bacteria | 997 |
| 336 | Ga0105239_10997278 | 3300010375 | Bacteria | 963 |
| 337 | Ga0105239_11603006 | 3300010375 | Bacteria | 753 |
| 338 | Ga0105239_11762106 | 3300010375 | Bacteria | 717 |
| 339 | Ga0105239_13429890 | 3300010375 | Bacteria | 515 |
| 340 | Ga0105246_10027513 | 3300011119 | Bacteria | 3727 |
| 341 | Ga0105246_10076924 | 3300011119 | Bacteria | 2366 |
| 342 | Ga0105246_10286955 | 3300011119 | Bacteria | 1323 |
| 343 | Ga0105246_10764021 | 3300011119 | Bacteria | 854 |
| 344 | Ga0105246_11186088 | 3300011119 | Bacteria | 702 |
| 345 | Ga0157344_1015975 | 3300012476 | Bacteria | 602 |
| 346 | Ga0157373_11100196 | 3300013100 | Bacteria | 596 |
| 347 | Ga0157369_10137911 | 3300013105 | Bacteria | 2582 |
| 348 | Ga0157369_12184098 | 3300013105 | Bacteria | 561 |
| 349 | Ga0157374_11012590 | 3300013296 | Bacteria | 850 |
| 350 | Ga0157374_11144746 | 3300013296 | Bacteria | 799 |
| 351 | Ga0157374_12637919 | 3300013296 | Bacteria | 530 |
| 352 | Ga0157378_10007983 | 3300013297 | Bacteria | 9240 |
| 353 | Ga0157378_10011018 | 3300013297 | Bacteria | 7913 |
| 354 | Ga0157378_10106621 | 3300013297 | Bacteria | 2563 |
| 355 | Ga0157378_10217973 | 3300013297 | Bacteria | 1813 |
| 356 | Ga0157378_10932975 | 3300013297 | Bacteria | 900 |
| 357 | Ga0157378_11831175 | 3300013297 | Bacteria | 655 |
| 358 | Ga0163162_10033875 | 3300013306 | Bacteria | 5078 |
| 359 | Ga0163162_10086509 | 3300013306 | Bacteria | 3212 |
| 360 | Ga0163162_10128117 | 3300013306 | Bacteria | 2646 |
| 361 | Ga0163162_10161483 | 3300013306 | Bacteria | 2363 |
| 362 | Ga0163162_10244208 | 3300013306 | Bacteria | 1927 |
| 363 | Ga0163162_10446526 | 3300013306 | Bacteria | 1425 |
| 364 | Ga0163162_10576312 | 3300013306 | Bacteria | 1253 |
| 365 | Ga0163162_10991381 | 3300013306 | Bacteria | 950 |
| 366 | Ga0163162_12789136 | 3300013306 | Bacteria | 562 |
| 367 | Ga0157372_10024301 | 3300013307 | Bacteria | 6580 |
| 368 | Ga0157372_10484461 | 3300013307 | Bacteria | 1442 |
| 369 | Ga0157375_10007093 | 3300013308 | Bacteria | 9786 |
| 370 | Ga0157375_10070810 | 3300013308 | Bacteria | 3499 |
| 371 | Ga0157375_11591755 | 3300013308 | Bacteria | 772 |
| 372 | Ga0157375_11844468 | 3300013308 | Bacteria | 717 |
| 373 | Ga0163163_10001366 | 3300014325 | Bacteria | 20573 |
| 374 | Ga0163163_10085274 | 3300014325 | Bacteria | 3166 |
| 375 | Ga0163163_10134185 | 3300014325 | Bacteria | 2516 |
| 376 | Ga0163163_10901598 | 3300014325 | Bacteria | 947 |
| 377 | Ga0163163_11785563 | 3300014325 | Bacteria | 675 |
| 378 | Ga0163163_11863406 | 3300014325 | Bacteria | 661 |
| 379 | Ga0163163_12453279 | 3300014325 | Bacteria | 580 |
| 380 | Ga0157380_10009161 | 3300014326 | Bacteria | 7082 |
| 381 | Ga0157380_10143228 | 3300014326 | Bacteria | 2056 |
| 382 | Ga0157380_11812180 | 3300014326 | Bacteria | 670 |
| 383 | Ga0182008_10034186 | 3300014497 | Bacteria | 2549 |
| 384 | Ga0157377_10037517 | 3300014745 | Bacteria | 2670 |
| 385 | Ga0157377_10351192 | 3300014745 | Bacteria | 989 |
| 386 | Ga0157377_10777228 | 3300014745 | Bacteria | 704 |
| 387 | Ga0157379_10031905 | 3300014968 | Bacteria | 4694 |
| 388 | Ga0157379_10086190 | 3300014968 | Bacteria | 2816 |
| 389 | Ga0157379_10147368 | 3300014968 | Bacteria | 2123 |
| 390 | Ga0157379_10192874 | 3300014968 | Bacteria | 1841 |
| 391 | Ga0157379_10199130 | 3300014968 | Bacteria | 1811 |
| 392 | Ga0157379_10697743 | 3300014968 | Bacteria | 952 |
| 393 | Ga0157376_10074553 | 3300014969 | Bacteria | 2893 |
| 394 | Ga0157376_10109163 | 3300014969 | Bacteria | 2432 |
| 395 | Ga0157376_10877705 | 3300014969 | Bacteria | 914 |
| 396 | Ga0157376_11764805 | 3300014969 | Bacteria | 655 |
| 397 | Ga0182007_10046526 | 3300015262 | Bacteria | 1436 |
| 398 | Ga0163161_10044525 | 3300017792 | Bacteria | 3197 |
| 399 | Ga0163161_11323444 | 3300017792 | Bacteria | 627 |
| 400 | Ga0163161_11374184 | 3300017792 | Bacteria | 616 |
| 401 | Ga0163161_11619543 | 3300017792 | Bacteria | 571 |
| 402 | Ga0213873_10127364 | 3300021358 | Bacteria | 752 |
| 403 | Ga0213873_10142240 | 3300021358 | Bacteria | 717 |
| 404 | Ga0213872_10024600 | 3300021361 | Bacteria | 2771 |
| 405 | Ga0213872_10042073 | 3300021361 | Bacteria | 2084 |
| 406 | Ga0213872_10059182 | 3300021361 | Bacteria | 1734 |
| 407 | Ga0213874_10269325 | 3300021377 | Bacteria | 633 |
| 408 | Ga0213876_10048895 | 3300021384 | Bacteria | 2234 |
| 409 | Ga0213871_10004609 | 3300021441 | Bacteria | 2772 |
| 410 | Ga0213871_10118950 | 3300021441 | Bacteria | 786 |
| 411 | Ga0213871_10203808 | 3300021441 | Bacteria | 618 |
| 412 | Ga0224712_10107837 | 3300022467 | Bacteria | 1191 |
| 413 | Ga0207425_1041828 | 3300025245 | Bacteria | 869 |
| 414 | Ga0209677_100507 | 3300025253 | Bacteria | 21817 |
| 415 | Ga0209148_1000212 | 3300025254 | Bacteria | 101454 |
| 416 | Ga0209233_1028384 | 3300025261 | Bacteria | 1342 |
| 417 | Ga0209455_1000346 | 3300025272 | Bacteria | 43799 |
| 418 | Ga0209564_1024238 | 3300025295 | Bacteria | 2078 |
| 419 | Ga0209758_1000023 | 3300025297 | Bacteria | 612453 |
| 420 | Ga0209758_1000024 | 3300025297 | Bacteria | 591966 |
| 421 | Ga0209758_1000088 | 3300025297 | Bacteria | 251547 |
| 422 | Ga0209758_1002631 | 3300025297 | Bacteria | 17834 |
| 423 | Ga0209758_1004362 | 3300025297 | Bacteria | 11837 |
| 424 | Ga0209758_1024738 | 3300025297 | Bacteria | 2664 |
| 425 | Ga0209758_1034578 | 3300025297 | Bacteria | 2007 |
| 426 | Ga0209758_1067827 | 3300025297 | Bacteria | 1139 |
| 427 | Ga0209050_1001041 | 3300025298 | Bacteria | 34372 |
| 428 | Ga0207426_1147331 | 3300025302 | Bacteria | 552 |
| 429 | Ga0209257_1004708 | 3300025304 | Bacteria | 10234 |
| 430 | Ga0209257_1032451 | 3300025304 | Bacteria | 1656 |
| 431 | Ga0207653_10075677 | 3300025885 | Bacteria | 1157 |
| 432 | Ga0207653_10168951 | 3300025885 | Bacteria | 813 |
| 433 | Ga0207682_10062432 | 3300025893 | Bacteria | 1562 |
| 434 | Ga0207692_10078251 | 3300025898 | Bacteria | 1761 |
| 435 | Ga0207692_10130725 | 3300025898 | Bacteria | 1417 |
| 436 | Ga0207692_10295050 | 3300025898 | Bacteria | 985 |
| 437 | Ga0207692_10483293 | 3300025898 | Bacteria | 784 |
| 438 | Ga0207642_10012459 | 3300025899 | Bacteria | 3070 |
| 439 | Ga0207710_10009583 | 3300025900 | Bacteria | 4074 |
| 440 | Ga0207710_10030393 | 3300025900 | Bacteria | 2356 |
| 441 | Ga0207688_10006010 | 3300025901 | Bacteria | 6607 |
| 442 | Ga0207688_10072928 | 3300025901 | Bacteria | 1951 |
| 443 | Ga0207647_10021697 | 3300025904 | Bacteria | 4282 |
| 444 | Ga0207647_10085968 | 3300025904 | Bacteria | 1880 |
| 445 | Ga0207647_10144726 | 3300025904 | Bacteria | 1392 |
| 446 | Ga0207685_10081867 | 3300025905 | Bacteria | 1338 |
| 447 | Ga0207699_10071844 | 3300025906 | Bacteria | 2118 |
| 448 | Ga0207699_10277842 | 3300025906 | Bacteria | 1163 |
| 449 | Ga0207699_10292559 | 3300025906 | Bacteria | 1135 |
| 450 | Ga0207643_10021169 | 3300025908 | Bacteria | 3571 |
| 451 | Ga0207643_10353632 | 3300025908 | Bacteria | 923 |
| 452 | Ga0207705_10405777 | 3300025909 | Bacteria | 1054 |
| 453 | Ga0207654_10100295 | 3300025911 | Bacteria | 1783 |
| 454 | Ga0207707_10007211 | 3300025912 | Bacteria | 9678 |
| 455 | Ga0207707_10090754 | 3300025912 | Bacteria | 2670 |
| 456 | Ga0207707_10528609 | 3300025912 | Bacteria | 1004 |
| 457 | Ga0207695_10006643 | 3300025913 | Bacteria | 14926 |
| 458 | Ga0207695_10091125 | 3300025913 | Bacteria | 3063 |
| 459 | Ga0207695_10095017 | 3300025913 | Bacteria | 2986 |
| 460 | Ga0207695_10272858 | 3300025913 | Bacteria | 1586 |
| 461 | Ga0207695_10678900 | 3300025913 | Bacteria | 911 |
| 462 | Ga0207695_11399725 | 3300025913 | Bacteria | 580 |
| 463 | Ga0207671_10076274 | 3300025914 | Bacteria | 2508 |
| 464 | Ga0207671_10076601 | 3300025914 | Bacteria | 2503 |
| 465 | Ga0207671_10236225 | 3300025914 | Bacteria | 1435 |
| 466 | Ga0207671_10388131 | 3300025914 | Bacteria | 1110 |
| 467 | Ga0207671_10566443 | 3300025914 | Bacteria | 906 |
| 468 | Ga0207671_10838877 | 3300025914 | Bacteria | 728 |
| 469 | Ga0207693_10012845 | 3300025915 | Bacteria | 6756 |
| 470 | Ga0207693_10076719 | 3300025915 | Bacteria | 2617 |
| 471 | Ga0207693_10379114 | 3300025915 | Bacteria | 1106 |
| 472 | Ga0207693_10412228 | 3300025915 | Bacteria | 1056 |
| 473 | Ga0207693_10574305 | 3300025915 | Bacteria | 879 |
| 474 | Ga0207693_10675093 | 3300025915 | Bacteria | 801 |
| 475 | Ga0207693_11199143 | 3300025915 | Bacteria | 572 |
| 476 | Ga0207663_10174673 | 3300025916 | Bacteria | 1529 |
| 477 | Ga0207663_10216629 | 3300025916 | Bacteria | 1391 |
| 478 | Ga0207663_10480239 | 3300025916 | Bacteria | 963 |
| 479 | Ga0207660_10739834 | 3300025917 | Bacteria | 802 |
| 480 | Ga0207662_10167134 | 3300025918 | Bacteria | 1409 |
| 481 | Ga0207657_10100812 | 3300025919 | Bacteria | 2397 |
| 482 | Ga0207657_10252533 | 3300025919 | Bacteria | 1405 |
| 483 | Ga0207649_10097014 | 3300025920 | Bacteria | 1943 |
| 484 | Ga0207649_10211551 | 3300025920 | Bacteria | 1376 |
| 485 | Ga0207649_10315616 | 3300025920 | Bacteria | 1147 |
| 486 | Ga0207649_10349031 | 3300025920 | Bacteria | 1095 |
| 487 | Ga0207652_10053798 | 3300025921 | Bacteria | 3458 |
| 488 | Ga0207652_10100168 | 3300025921 | Bacteria | 2558 |
| 489 | Ga0207652_10407937 | 3300025921 | Bacteria | 1226 |
| 490 | Ga0207652_11140228 | 3300025921 | Bacteria | 681 |
| 491 | Ga0207646_10956437 | 3300025922 | Unclassified | 758 |
| 492 | Ga0207681_10230161 | 3300025923 | Bacteria | 1438 |
| 493 | Ga0207681_10732291 | 3300025923 | Bacteria | 823 |
| 494 | Ga0207694_10234203 | 3300025924 | Bacteria | 1500 |
| 495 | Ga0207650_10010331 | 3300025925 | Bacteria | 6401 |
| 496 | Ga0207650_10413512 | 3300025925 | Bacteria | 1118 |
| 497 | Ga0207659_10158051 | 3300025926 | Bacteria | 1777 |
| 498 | Ga0207659_11891521 | 3300025926 | Bacteria | 506 |
| 499 | Ga0207687_10024453 | 3300025927 | Bacteria | 4036 |
| 500 | Ga0207700_10021355 | 3300025928 | Bacteria | 4419 |
| 501 | Ga0207700_10073919 | 3300025928 | Bacteria | 2634 |
| 502 | Ga0207700_10075840 | 3300025928 | Bacteria | 2607 |
| 503 | Ga0207700_10091261 | 3300025928 | Bacteria | 2406 |
| 504 | Ga0207700_10301408 | 3300025928 | Bacteria | 1384 |
| 505 | Ga0207700_10579259 | 3300025928 | Bacteria | 998 |
| 506 | Ga0207700_11070598 | 3300025928 | Bacteria | 721 |
| 507 | Ga0207664_10023209 | 3300025929 | Bacteria | 4645 |
| 508 | Ga0207664_10078282 | 3300025929 | Bacteria | 2681 |
| 509 | Ga0207664_11249774 | 3300025929 | Bacteria | 661 |
| 510 | Ga0207644_10070892 | 3300025931 | Bacteria | 2548 |
| 511 | Ga0207644_10160494 | 3300025931 | Bacteria | 1747 |
| 512 | Ga0207644_10177591 | 3300025931 | Bacteria | 1667 |
| 513 | Ga0207644_10474873 | 3300025931 | Bacteria | 1029 |
| 514 | Ga0207644_10996155 | 3300025931 | Bacteria | 703 |
| 515 | Ga0207690_10064302 | 3300025932 | Bacteria | 2505 |
| 516 | Ga0207690_11250754 | 3300025932 | Bacteria | 620 |
| 517 | Ga0207706_10004538 | 3300025933 | Bacteria | 13031 |
| 518 | Ga0207706_10022493 | 3300025933 | Bacteria | 5658 |
| 519 | Ga0207706_10048734 | 3300025933 | Bacteria | 3746 |
| 520 | Ga0207706_10550051 | 3300025933 | Bacteria | 994 |
| 521 | Ga0207686_10012066 | 3300025934 | Bacteria | 4747 |
| 522 | Ga0207686_10156230 | 3300025934 | Bacteria | 1594 |
| 523 | Ga0207686_10221104 | 3300025934 | Bacteria | 1368 |
| 524 | Ga0207686_10433306 | 3300025934 | Bacteria | 1008 |
| 525 | Ga0207670_10117508 | 3300025936 | Bacteria | 1927 |
| 526 | Ga0207670_11619697 | 3300025936 | Bacteria | 551 |
| 527 | Ga0207669_10000778 | 3300025937 | Bacteria | 13668 |
| 528 | Ga0207669_10002431 | 3300025937 | Bacteria | 7939 |
| 529 | Ga0207669_10263959 | 3300025937 | Bacteria | 1289 |
| 530 | Ga0207669_11171849 | 3300025937 | Bacteria | 650 |
| 531 | Ga0207704_10032314 | 3300025938 | Bacteria | 2960 |
| 532 | Ga0207704_10111523 | 3300025938 | Bacteria | 1850 |
| 533 | Ga0207704_11127000 | 3300025938 | Bacteria | 667 |
| 534 | Ga0207665_10061239 | 3300025939 | Bacteria | 2550 |
| 535 | Ga0207665_10619454 | 3300025939 | Bacteria | 846 |
| 536 | Ga0207665_10846094 | 3300025939 | Bacteria | 724 |
| 537 | Ga0207665_11465611 | 3300025939 | Bacteria | 543 |
| 538 | Ga0207691_10185746 | 3300025940 | Bacteria | 1815 |
| 539 | Ga0207711_10010855 | 3300025941 | Bacteria | 7570 |
| 540 | Ga0207711_10028877 | 3300025941 | Bacteria | 4672 |
| 541 | Ga0207711_10053294 | 3300025941 | Bacteria | 3469 |
| 542 | Ga0207689_10006931 | 3300025942 | Bacteria | 9966 |
| 543 | Ga0207689_10081554 | 3300025942 | Bacteria | 2659 |
| 544 | Ga0207661_10097234 | 3300025944 | Bacteria | 2465 |
| 545 | Ga0207679_10071976 | 3300025945 | Bacteria | 2610 |
| 546 | Ga0207679_10296096 | 3300025945 | Bacteria | 1393 |
| 547 | Ga0207667_10179957 | 3300025949 | Bacteria | 2171 |
| 548 | Ga0207667_10906422 | 3300025949 | Bacteria | 873 |
| 549 | Ga0207651_10577923 | 3300025960 | Bacteria | 980 |
| 550 | Ga0207651_10924009 | 3300025960 | Bacteria | 778 |
| 551 | Ga0207712_10038736 | 3300025961 | Bacteria | 3261 |
| 552 | Ga0207712_10476651 | 3300025961 | Bacteria | 1063 |
| 553 | Ga0207712_12047407 | 3300025961 | Bacteria | 512 |
| 554 | Ga0207668_10042593 | 3300025972 | Bacteria | 3075 |
| 555 | Ga0207668_10048038 | 3300025972 | Bacteria | 2926 |
| 556 | Ga0207668_10102188 | 3300025972 | Bacteria | 2132 |
| 557 | Ga0207668_10340803 | 3300025972 | Bacteria | 1250 |
| 558 | Ga0207668_10485949 | 3300025972 | Bacteria | 1060 |
| 559 | Ga0207668_10792164 | 3300025972 | Bacteria | 838 |
| 560 | Ga0207668_11051069 | 3300025972 | Bacteria | 729 |
| 561 | Ga0207640_10138593 | 3300025981 | Bacteria | 1770 |
| 562 | Ga0207640_10603315 | 3300025981 | Bacteria | 930 |
| 563 | Ga0207658_10066476 | 3300025986 | Bacteria | 2712 |
| 564 | Ga0207658_11895337 | 3300025986 | Bacteria | 543 |
| 565 | Ga0207677_10005949 | 3300026023 | Bacteria | 6641 |
| 566 | Ga0207677_10059799 | 3300026023 | Bacteria | 2630 |
| 567 | Ga0207677_10106102 | 3300026023 | Bacteria | 2080 |
| 568 | Ga0207677_11863667 | 3300026023 | Bacteria | 559 |
| 569 | Ga0207703_10104853 | 3300026035 | Bacteria | 2402 |
| 570 | Ga0207703_10185478 | 3300026035 | Bacteria | 1838 |
| 571 | Ga0207703_10203088 | 3300026035 | Bacteria | 1762 |
| 572 | Ga0207703_10654354 | 3300026035 | Bacteria | 997 |
| 573 | Ga0207703_12382147 | 3300026035 | Bacteria | 505 |
| 574 | Ga0207639_10003894 | 3300026041 | Bacteria | 10063 |
| 575 | Ga0207639_10072338 | 3300026041 | Bacteria | 2699 |
| 576 | Ga0207639_10099123 | 3300026041 | Bacteria | 2350 |
| 577 | Ga0207639_10121329 | 3300026041 | Bacteria | 2148 |
| 578 | Ga0207639_10168708 | 3300026041 | Bacteria | 1851 |
| 579 | Ga0207639_10206696 | 3300026041 | Bacteria | 1687 |
| 580 | Ga0207639_11328620 | 3300026041 | Bacteria | 675 |
| 581 | Ga0207678_10007720 | 3300026067 | Bacteria | 9502 |
| 582 | Ga0207678_10014332 | 3300026067 | Bacteria | 6970 |
| 583 | Ga0207678_10083544 | 3300026067 | Bacteria | 2731 |
| 584 | Ga0207678_10097072 | 3300026067 | Bacteria | 2518 |
| 585 | Ga0207678_10356616 | 3300026067 | Bacteria | 1262 |
| 586 | Ga0207678_10358063 | 3300026067 | Bacteria | 1259 |
| 587 | Ga0207708_10500408 | 3300026075 | Bacteria | 1018 |
| 588 | Ga0207708_10630723 | 3300026075 | Bacteria | 911 |
| 589 | Ga0207708_11329141 | 3300026075 | Bacteria | 630 |
| 590 | Ga0207702_10101401 | 3300026078 | Bacteria | 2542 |
| 591 | Ga0207702_10171000 | 3300026078 | Bacteria | 1992 |
| 592 | Ga0207641_10091482 | 3300026088 | Bacteria | 2662 |
| 593 | Ga0207648_10198595 | 3300026089 | Bacteria | 1779 |
| 594 | Ga0207648_11044087 | 3300026089 | Bacteria | 766 |
| 595 | Ga0207648_11895837 | 3300026089 | Bacteria | 558 |
| 596 | Ga0207676_10016623 | 3300026095 | Bacteria | 5328 |
| 597 | Ga0207676_10251174 | 3300026095 | Bacteria | 1592 |
| 598 | Ga0207676_11089961 | 3300026095 | Bacteria | 789 |
| 599 | Ga0207674_10630287 | 3300026116 | Bacteria | 1035 |
| 600 | Ga0207674_11446027 | 3300026116 | Bacteria | 657 |
| 601 | Ga0207675_100163040 | 3300026118 | Bacteria | 2127 |
| 602 | Ga0207675_100202011 | 3300026118 | Bacteria | 1909 |
| 603 | Ga0207675_100643578 | 3300026118 | Bacteria | 1066 |
| 604 | Ga0207675_102483021 | 3300026118 | Bacteria | 529 |
| 605 | Ga0207683_10060851 | 3300026121 | Bacteria | 3320 |
| 606 | Ga0207683_10084312 | 3300026121 | Bacteria | 2824 |
| 607 | Ga0207683_10309922 | 3300026121 | Bacteria | 1445 |
| 608 | Ga0207683_11238186 | 3300026121 | Bacteria | 691 |
| 609 | Ga0207698_10183264 | 3300026142 | Bacteria | 1857 |
| 610 | Ga0207698_12658993 | 3300026142 | Bacteria | 509 |
| 611 | Ga0209389_1000135 | 3300027296 | Bacteria | 64901 |
| 612 | Ga0209389_1051273 | 3300027296 | Bacteria | 2844 |
| 613 | Ga0209389_1078013 | 3300027296 | Bacteria | 1656 |
| 614 | Ga0209489_100653 | 3300027361 | Bacteria | 67569 |
| 615 | Ga0209489_117682 | 3300027361 | Bacteria | 3128 |
| 616 | Ga0209489_121234 | 3300027361 | Bacteria | 1656 |
| 617 | Ga0209700_100076 | 3300027363 | Bacteria | 138075 |
| 618 | Ga0209700_100417 | 3300027363 | Bacteria | 77663 |
| 619 | Ga0209588_1020041 | 3300027671 | Bacteria | 2092 |
| 620 | Ga0209588_1280291 | 3300027671 | Bacteria | 504 |
| 621 | Ga0209813_10153406 | 3300027866 | Bacteria | 827 |
| 622 | Ga0209813_10177054 | 3300027866 | Bacteria | 778 |
| 623 | Ga0207428_10828678 | 3300027907 | Bacteria | 656 |
| 624 | Ga0207428_11055287 | 3300027907 | Unclassified | 569 |
| 625 | Ga0265355_1012723 | 3300028036 | Bacteria | 699 |
| 626 | Ga0268266_10000538 | 3300028379 | Bacteria | 52841 |
| 627 | Ga0268266_10002070 | 3300028379 | Bacteria | 22214 |
| 628 | Ga0268266_10021937 | 3300028379 | Bacteria | 5442 |
| 629 | Ga0268266_10061049 | 3300028379 | Bacteria | 3250 |
| 630 | Ga0268266_10082502 | 3300028379 | Bacteria | 2805 |
| 631 | Ga0268266_10130867 | 3300028379 | Bacteria | 2244 |
| 632 | Ga0268266_10131700 | 3300028379 | Bacteria | 2237 |
| 633 | Ga0268266_10151354 | 3300028379 | Bacteria | 2091 |
| 634 | Ga0268266_10202605 | 3300028379 | Bacteria | 1816 |
| 635 | Ga0268266_11262825 | 3300028379 | Bacteria | 714 |
| 636 | Ga0268265_10010542 | 3300028380 | Bacteria | 6240 |
| 637 | Ga0268265_10403542 | 3300028380 | Bacteria | 1264 |
| 638 | Ga0268265_10474498 | 3300028380 | Bacteria | 1173 |
| 639 | Ga0268265_12445490 | 3300028380 | Bacteria | 528 |
| 640 | Ga0268264_10000187 | 3300028381 | Bacteria | 129270 |
| 641 | Ga0268264_10981947 | 3300028381 | Bacteria | 850 |
| 642 | Ga0268264_11729961 | 3300028381 | Bacteria | 636 |
| 643 | Ga0307517_10041514 | 3300028786 | Bacteria | 4966 |
| 644 | Ga0307511_10000148 | 3300030521 | Bacteria | 66671 |
| 645 | Ga0307511_10172502 | 3300030521 | Bacteria | 1185 |
| 646 | Ga0265762_1032188 | 3300030760 | Bacteria | 1000 |
| 647 | Ga0265763_1019543 | 3300030763 | Bacteria | 703 |
| 648 | Ga0265760_10015070 | 3300031090 | Bacteria | 2215 |
| 649 | Ga0265330_10048809 | 3300031235 | Bacteria | 1861 |
| 650 | Ga0265330_10064136 | 3300031235 | Bacteria | 1596 |
| 651 | Ga0265332_10041215 | 3300031238 | Bacteria | 1998 |
| 652 | Ga0265332_10313682 | 3300031238 | Bacteria | 647 |
| 653 | Ga0265325_10066370 | 3300031241 | Bacteria | 1819 |
| 654 | Ga0265329_10300479 | 3300031242 | Bacteria | 542 |
| 655 | Ga0265340_10013605 | 3300031247 | Bacteria | 4271 |
| 656 | Ga0265339_10001462 | 3300031249 | Bacteria | 17474 |
| 657 | Ga0265339_10012845 | 3300031249 | Bacteria | 5092 |
| 658 | Ga0265339_10320392 | 3300031249 | Bacteria | 736 |
| 659 | Ga0265331_10002616 | 3300031250 | Bacteria | 12083 |
| 660 | Ga0265331_10074139 | 3300031250 | Bacteria | 1589 |
| 661 | Ga0265327_10075135 | 3300031251 | Bacteria | 1681 |
| 662 | Ga0265327_10290248 | 3300031251 | Bacteria | 722 |
| 663 | Ga0265316_10214893 | 3300031344 | Bacteria | 1421 |
| 664 | Ga0307513_10004256 | 3300031456 | Bacteria | 19152 |
| 665 | Ga0307513_10048552 | 3300031456 | Bacteria | 4606 |
| 666 | Ga0307513_11049351 | 3300031456 | Bacteria | 526 |
| 667 | Ga0307509_10302605 | 3300031507 | Bacteria | 1346 |
| 668 | Ga0307509_10458295 | 3300031507 | Bacteria | 967 |
| 669 | Ga0265313_10000583 | 3300031595 | Bacteria | 38024 |
| 670 | Ga0265313_10144237 | 3300031595 | Bacteria | 1022 |
| 671 | Ga0307508_10015508 | 3300031616 | Bacteria | 6942 |
| 672 | Ga0307508_10086902 | 3300031616 | Bacteria | 2710 |
| 673 | Ga0307508_10314881 | 3300031616 | Bacteria | 1157 |
| 674 | Ga0265314_10014316 | 3300031711 | Bacteria | 6357 |
| 675 | Ga0265342_10013591 | 3300031712 | Bacteria | 5451 |
| 676 | Ga0265342_10078644 | 3300031712 | Bacteria | 1908 |
| 677 | Ga0265342_10165583 | 3300031712 | Bacteria | 1220 |
| 678 | Ga0307516_10001085 | 3300031730 | Bacteria | 37853 |
| 679 | Ga0307516_10003990 | 3300031730 | Bacteria | 18533 |
| 680 | Ga0307516_10054944 | 3300031730 | Bacteria | 3889 |
| 681 | Ga0307516_10171992 | 3300031730 | Bacteria | 1906 |
| 682 | Ga0307516_10181888 | 3300031730 | Bacteria | 1835 |
| 683 | Ga0307516_10861546 | 3300031730 | Bacteria | 570 |
| 684 | Ga0307407_10415830 | 3300031903 | Bacteria | 968 |
| 685 | Ga0307412_10691291 | 3300031911 | Bacteria | 874 |
| 686 | Ga0307416_101108203 | 3300032002 | Bacteria | 896 |
| 687 | Ga0307414_10193425 | 3300032004 | Bacteria | 1648 |
| 688 | Ga0307507_10236781 | 3300033179 | Bacteria | 1201 |
| 689 | Ga0307507_10488078 | 3300033179 | Bacteria | 668 |
| 690 | Ga0373930_0027140 | 3300034816 | Bacteria | 1159 |
| 691 | Ga0373959_0075434 | 3300034820 | Bacteria | 769 |
| 692 | Ga0373926_0067511 | 3300035083 | Bacteria | 1310 |
| 693 | Ga0373928_0013984 | 3300035084 | Bacteria | 1617 |
| 694 | Ga0373929_0102134 | 3300035085 | Bacteria | 724 |
| 695 | Ga0373934_0023429 | 3300035086 | Bacteria | 2386 |
| 696 | Ga0373934_0084325 | 3300035086 | Bacteria | 1278 |
| 697 | Ga0373934_0094483 | 3300035086 | Bacteria | 1207 |
| 698 | Ga0373949_0048655 | 3300035090 | Bacteria | 1063 |
| 699 | Ga0373949_0114430 | 3300035090 | Bacteria | 752 |
| 700 | Ga0373952_0022340 | 3300035092 | Bacteria | 1343 |
| 701 | Ga0373923_0016552 | 3300035111 | Bacteria | 2804 |
| 702 | Ga0373923_0051414 | 3300035111 | Bacteria | 1729 |
| 703 | Ga0373923_0601041 | 3300035111 | Bacteria | 542 |
| 704 | Ga0373936_0036045 | 3300035113 | Bacteria | 1971 |
| 705 | Ga0373936_0101381 | 3300035113 | Bacteria | 1215 |
| 706 | Ga0373936_0155166 | 3300035113 | Bacteria | 994 |
| 707 | Ga0373939_0162064 | 3300035114 | Bacteria | 822 |
| 708 | Ga0373941_0097064 | 3300035115 | Bacteria | 1020 |
| 709 | Ga0373945_0022253 | 3300035116 | Bacteria | 2182 |
| 710 | Ga0373945_0241110 | 3300035116 | Bacteria | 761 |
| 711 | Ga0373953_0068663 | 3300035117 | Bacteria | 1459 |
| 712 | Ga0373954_0014990 | 3300035118 | Bacteria | 3461 |
| 713 | Ga0373954_0050959 | 3300035118 | Bacteria | 1943 |
| 714 | Ga0373954_0144140 | 3300035118 | Bacteria | 1163 |
| 715 | Ga0373956_0050116 | 3300035119 | Bacteria | 1874 |
| 716 | Ga0373956_0438577 | 3300035119 | Bacteria | 623 |
| 717 | Ga0373957_0509234 | 3300035120 | Bacteria | 524 |
| 718 | Ga0373960_0002828 | 3300035121 | Bacteria | 3931 |
| 719 | Ga0373943_0035781 | 3300035170 | Bacteria | 2375 |
| 720 | Ga0373943_0057704 | 3300035170 | Bacteria | 1930 |
| 721 | Ga0373943_0125930 | 3300035170 | Bacteria | 1366 |
| 722 | Ga0373955_0096174 | 3300035172 | Bacteria | 1694 |
| 723 | Ga0373955_0123715 | 3300035172 | Bacteria | 1505 |
| 724 | Ga0373955_0679386 | 3300035172 | Bacteria | 632 |
| 725 | Ga0373961_0065203 | 3300035241 | Archaea | 1115 |
| 726 | Ga0373961_0279954 | 3300035241 | Bacteria | 612 |
| 727 | Ga0373931_0005645 | 3300035691 | Bacteria | 5806 |
| 728 | Ga0373931_0283098 | 3300035691 | Bacteria | 1019 |
| 729 | Ga0373935_0003759 | 3300035692 | Bacteria | 8861 |
| 730 | Ga0373935_0013872 | 3300035692 | Bacteria | 4865 |
| 731 | Ga0373935_0048611 | 3300035692 | Bacteria | 2686 |
| 732 | Ga0373935_0308826 | 3300035692 | Bacteria | 1119 |
| 733 | Ga0373927_0004169 | 3300035695 | Bacteria | 10157 |
| 734 | Ga0373927_0021420 | 3300035695 | Bacteria | 4237 |
| 735 | Ga0373927_0023687 | 3300035695 | Bacteria | 4019 |
| 736 | Ga0373927_0028041 | 3300035695 | Bacteria | 3674 |
| 737 | Ga0373927_0073001 | 3300035695 | Bacteria | 2222 |
| 738 | Ga0373927_0707519 | 3300035695 | Bacteria | 665 |
| 739 | Ga0373933_0082380 | 3300035724 | Bacteria | 1974 |
| 740 | Ga0373933_0114248 | 3300035724 | Bacteria | 1686 |
| 741 | Ga0373933_1106047 | 3300035724 | Bacteria | 522 |
| 742 | Ga0373947_0011282 | 3300035725 | Bacteria | 5128 |
| 743 | Ga0373947_0025373 | 3300035725 | Bacteria | 3457 |
| 744 | Ga0373947_0054937 | 3300035725 | Bacteria | 2404 |
| 745 | Ga0373947_0182802 | 3300035725 | Bacteria | 1365 |
| 746 | Ga0373937_0003392 | 3300036401 | Bacteria | 13371 |
| 747 | Ga0373937_0132886 | 3300036401 | Bacteria | 2325 |
| 748 | Ga0373937_0138148 | 3300036401 | Bacteria | 2279 |
| 749 | Ga0373937_0654672 | 3300036401 | Bacteria | 996 |
| 750 | Ga0373937_1164521 | 3300036401 | Bacteria | 719 |
| 751 | Ga0373925_0008051 | 3300037068 | Bacteria | 7678 |
| 752 | Ga0373925_0012799 | 3300037068 | Bacteria | 6077 |
| 753 | Ga0373925_0053000 | 3300037068 | Bacteria | 3031 |
| 754 | Ga0373925_0121764 | 3300037068 | Bacteria | 2026 |
| 755 | Ga0373925_0203417 | 3300037068 | Bacteria | 1575 |
| 756 | Ga0373925_1047653 | 3300037068 | Bacteria | 671 |
| 757 | Ga0373925_1735717 | 3300037068 | Bacteria | 509 |
| 758 | Ga0395900_0411688 | 3300037418 | Bacteria | 1314 |
| 759 | Ga0395900_0520808 | 3300037418 | Bacteria | 1137 |
| 760 | Ga0395898_0050867 | 3300037466 | Bacteria | 4054 |
| 761 | Ga0395898_0308766 | 3300037466 | Bacteria | 1509 |
| 762 | Ga0395905_0170178 | 3300037471 | Bacteria | 2046 |
| 763 | Ga0395905_1214853 | 3300037471 | Bacteria | 657 |
| 764 | Ga0436364_0139836 | 3300037853 | Bacteria | 601 |
| 765 | Ga0436364_0421552 | 3300037853 | Bacteria | 1576 |
| 766 | Ga0395901_0150479 | 3300038443 | Bacteria | 2446 |
| 767 | Ga0436365_0495621 | 3300039437 | Bacteria | 2787 |
| 768 | Ga0436365_0642772 | 3300039437 | Unclassified | 644 |
| 769 | Ga0436365_0661874 | 3300039437 | Bacteria | 3222 |
| 770 | Ga0436360_0224587 | 3300039438 | Bacteria | 1500 |
| 771 | Ga0436360_0258132 | 3300039438 | Bacteria | 748 |
| 772 | Ga0436360_0296010 | 3300039438 | Bacteria | 1207 |
| 773 | Ga0436360_0345518 | 3300039438 | Bacteria | 3003 |
| 774 | Ga0436360_0381778 | 3300039438 | Bacteria | 711 |
| 775 | Ga0436360_0530926 | 3300039438 | Bacteria | 7406 |
| 776 | Ga0436360_0569747 | 3300039438 | Bacteria | 531 |
| 777 | Ga0436360_0585422 | 3300039438 | Bacteria | 6564 |
| 778 | Ga0436360_0598280 | 3300039438 | Bacteria | 862 |
| 779 | Ga0436361_0087582 | 3300039447 | Bacteria | 505 |
| 780 | Ga0436361_0296689 | 3300039447 | Bacteria | 10444 |
| 781 | Ga0436361_0342673 | 3300039447 | Bacteria | 1970 |
| 782 | Ga0436361_0580570 | 3300039447 | Bacteria | 11824 |
| 783 | Ga0436361_0604625 | 3300039447 | Bacteria | 771 |
| 784 | Ga0436361_0668430 | 3300039447 | Bacteria | 2229 |
| 785 | Ga0436361_0804396 | 3300039447 | Bacteria | 977 |
| 786 | Ga0436361_0847865 | 3300039447 | Bacteria | 1854 |
| 787 | Ga0436361_1108985 | 3300039447 | Bacteria | 898 |
| 788 | Ga0436363_0079128 | 3300039450 | Bacteria | 797 |
| 789 | Ga0436363_0219861 | 3300039450 | Bacteria | 7550 |
| 790 | Ga0436363_0637369 | 3300039450 | Bacteria | 707 |
| 791 | Ga0436363_1408653 | 3300039450 | Bacteria | 632 |
| 792 | Ga0436362_0005086 | 3300039453 | Bacteria | 2253 |
| 793 | Ga0436362_0066045 | 3300039453 | Bacteria | 774 |
| 794 | Ga0436362_0319983 | 3300039453 | Bacteria | 1880 |
| 795 | Ga0436362_0362728 | 3300039453 | Bacteria | 1535 |
| 796 | Ga0436362_1207223 | 3300039453 | Bacteria | 809 |
| 797 | Ga0451800_0847615 | 3300041459 | Bacteria | 683 |
| 798 | Ga0439459_0046344 | 3300042438 | Bacteria | 941 |
| 799 | Ga0466966_0601925 | 3300044684 | Bacteria | 662 |
| 800 | Ga0466961_0755586 | 3300044693 | Bacteria | 581 |
| 801 | Ga0466964_0108800 | 3300044706 | Bacteria | 1233 |
| 802 | Ga0466968_0048494 | 3300044735 | Unclassified | 1808 |
| 803 | Ga0466957_0321017 | 3300044842 | Bacteria | 1045 |
| 804 | Ga0466957_0455272 | 3300044842 | Bacteria | 882 |
| 805 | Ga0466957_1194667 | 3300044842 | Bacteria | 550 |
| 806 | Ga0466959_0376170 | 3300045049 | Bacteria | 967 |
| 807 | Ga0466958_0586812 | 3300045836 | Bacteria | 725 |
| 808 | Ga0495617_132591 | 3300046452 | Bacteria | 798 |
| 809 | Ga0495617_134570 | 3300046452 | Bacteria | 791 |
| 810 | Ga0495592_0083966 | 3300046454 | Bacteria | 2299 |
| 811 | Ga0495603_0002503 | 3300046455 | Bacteria | 10810 |
| 812 | Ga0495603_0006600 | 3300046455 | Bacteria | 6959 |
| 813 | Ga0495603_0016575 | 3300046455 | Bacteria | 4458 |
| 814 | Ga0495591_138148 | 3300046458 | Bacteria | 589 |
| 815 | Ga0495629_0030209 | 3300046459 | Bacteria | 3842 |
| 816 | Ga0495629_0566673 | 3300046459 | Bacteria | 761 |
| 817 | Ga0495638_0005411 | 3300046460 | Bacteria | 9504 |
| 818 | Ga0495638_0225485 | 3300046460 | Bacteria | 1045 |
| 819 | Ga0495641_0088339 | 3300046461 | Bacteria | 1386 |
| 820 | Ga0495653_0452446 | 3300046463 | Bacteria | 807 |
| 821 | Ga0495650_0000355 | 3300046471 | Bacteria | 81062 |
| 822 | Ga0495580_0164063 | 3300046472 | Bacteria | 1537 |
| 823 | Ga0495580_0206930 | 3300046472 | Bacteria | 1351 |
| 824 | Ga0495580_0391058 | 3300046472 | Bacteria | 938 |
| 825 | Ga0495580_0740428 | 3300046472 | Bacteria | 641 |
| 826 | Ga0495580_0805929 | 3300046472 | Bacteria | 608 |
| 827 | Ga0495582_0011384 | 3300046473 | Bacteria | 4901 |
| 828 | Ga0495582_0013127 | 3300046473 | Bacteria | 4560 |
| 829 | Ga0495582_0022894 | 3300046473 | Bacteria | 3417 |
| 830 | Ga0495605_0003508 | 3300046474 | Bacteria | 9324 |
| 831 | Ga0495605_0091313 | 3300046474 | Bacteria | 1411 |
| 832 | Ga0495605_0232081 | 3300046474 | Bacteria | 795 |
| 833 | Ga0495639_0009847 | 3300046475 | Bacteria | 4103 |
| 834 | Ga0495639_0103042 | 3300046475 | Bacteria | 1349 |
| 835 | Ga0495639_0400008 | 3300046475 | Bacteria | 694 |
| 836 | Ga0495662_0008018 | 3300046476 | Bacteria | 5202 |
| 837 | Ga0495662_0055060 | 3300046476 | Bacteria | 1922 |
| 838 | Ga0495662_0102251 | 3300046476 | Bacteria | 1402 |
| 839 | Ga0495662_0273019 | 3300046476 | Bacteria | 832 |
| 840 | Ga0495664_0094616 | 3300046477 | Bacteria | 1798 |
| 841 | Ga0495664_0789859 | 3300046477 | Bacteria | 558 |
| 842 | Ga0495584_0247677 | 3300046491 | Bacteria | 906 |
| 843 | Ga0495584_0258110 | 3300046491 | Bacteria | 886 |
| 844 | Ga0495585_0024474 | 3300046492 | Bacteria | 3462 |
| 845 | Ga0495585_0077455 | 3300046492 | Bacteria | 1805 |
| 846 | Ga0495585_0094753 | 3300046492 | Bacteria | 1604 |
| 847 | Ga0495585_0321274 | 3300046492 | Bacteria | 757 |
| 848 | Ga0495594_0036513 | 3300046499 | Bacteria | 2679 |
| 849 | Ga0495594_0556421 | 3300046499 | Bacteria | 651 |
| 850 | Ga0495607_0043454 | 3300046501 | Bacteria | 2657 |
| 851 | Ga0495607_0204590 | 3300046501 | Bacteria | 975 |
| 852 | Ga0495607_0256155 | 3300046501 | Bacteria | 840 |
| 853 | Ga0495583_0000860 | 3300046506 | Bacteria | 36891 |
| 854 | Ga0495583_0012351 | 3300046506 | Bacteria | 4840 |
| 855 | Ga0495606_0002012 | 3300046507 | Bacteria | 24965 |
| 856 | Ga0495606_0425315 | 3300046507 | Bacteria | 686 |
| 857 | Ga0495608_0323159 | 3300046511 | Bacteria | 953 |
| 858 | Ga0495608_0499362 | 3300046511 | Bacteria | 737 |
| 859 | Ga0495610_0000046 | 3300046512 | Bacteria | 153789 |
| 860 | Ga0495610_0088455 | 3300046512 | Bacteria | 1408 |
| 861 | Ga0495610_0359152 | 3300046512 | Bacteria | 547 |
| 862 | Ga0495616_0014970 | 3300046513 | Bacteria | 4325 |
| 863 | Ga0495616_0034251 | 3300046513 | Bacteria | 2639 |
| 864 | Ga0495616_0160155 | 3300046513 | Bacteria | 1013 |
| 865 | Ga0495620_0211516 | 3300046515 | Bacteria | 744 |
| 866 | Ga0495630_0172677 | 3300046517 | Bacteria | 1647 |
| 867 | Ga0495630_0568131 | 3300046517 | Bacteria | 870 |
| 868 | Ga0495631_0002810 | 3300046518 | Bacteria | 9667 |
| 869 | Ga0495631_0368748 | 3300046518 | Bacteria | 611 |
| 870 | Ga0495632_0031510 | 3300046519 | Bacteria | 2740 |
| 871 | Ga0495632_0241145 | 3300046519 | Bacteria | 813 |
| 872 | Ga0495632_0247859 | 3300046519 | Bacteria | 799 |
| 873 | Ga0495637_0070700 | 3300046520 | Bacteria | 1409 |
| 874 | Ga0495643_0180282 | 3300046522 | Bacteria | 1027 |
| 875 | Ga0495648_0227930 | 3300046524 | Bacteria | 914 |
| 876 | Ga0495642_0511153 | 3300046528 | Bacteria | 532 |
| 877 | Ga0495652_0100143 | 3300046529 | Bacteria | 2352 |
| 878 | Ga0495652_0154461 | 3300046529 | Bacteria | 1789 |
| 879 | Ga0495654_0118121 | 3300046530 | Bacteria | 1203 |
| 880 | Ga0495586_0504586 | 3300046535 | Bacteria | 698 |
| 881 | Ga0495586_0601618 | 3300046535 | Bacteria | 635 |
| 882 | Ga0495587_0750518 | 3300046536 | Bacteria | 534 |
| 883 | Ga0495598_0007742 | 3300046537 | Bacteria | 2477 |
| 884 | Ga0495609_0184806 | 3300046538 | Bacteria | 876 |
| 885 | Ga0495609_0434599 | 3300046538 | Bacteria | 523 |
| 886 | Ga0495645_0257498 | 3300046543 | Bacteria | 1157 |
| 887 | Ga0495645_0402597 | 3300046543 | Bacteria | 872 |
| 888 | Ga0495622_0008204 | 3300046557 | Bacteria | 4839 |
| 889 | Ga0495622_0064073 | 3300046557 | Bacteria | 1700 |
| 890 | Ga0495622_0206981 | 3300046557 | Bacteria | 873 |
| 891 | Ga0495667_0514958 | 3300046559 | Bacteria | 749 |
| 892 | Ga0495667_0678854 | 3300046559 | Bacteria | 639 |
| 893 | Ga0495656_0017995 | 3300046615 | Bacteria | 2706 |
| 894 | Ga0495656_0273938 | 3300046615 | Bacteria | 858 |
| 895 | Ga0495656_0641431 | 3300046615 | Bacteria | 570 |
| 896 | Ga0495668_0002555 | 3300046616 | Bacteria | 14799 |
| 897 | Ga0495668_0107162 | 3300046616 | Bacteria | 1528 |
| 898 | Ga0495634_0003625 | 3300046642 | Bacteria | 12337 |
| 899 | Ga0495611_0015617 | 3300046648 | Bacteria | 3246 |
| 900 | Ga0495625_0002001 | 3300046660 | Bacteria | 22996 |
| 901 | Ga0495625_0003868 | 3300046660 | Bacteria | 14469 |
| 902 | Ga0495625_0010556 | 3300046660 | Bacteria | 7628 |
| 903 | Ga0495625_0412012 | 3300046660 | Bacteria | 842 |
| 904 | Ga0495635_0027099 | 3300046663 | Bacteria | 3987 |
| 905 | Ga0495635_0327627 | 3300046663 | Bacteria | 1024 |
| 906 | Ga0495659_0047279 | 3300046664 | Bacteria | 1556 |
| 907 | Ga0495659_0093881 | 3300046664 | Bacteria | 1155 |
| 908 | Ga0495659_0305178 | 3300046664 | Bacteria | 673 |
| 909 | Ga0495661_0052708 | 3300046665 | Bacteria | 2450 |
| 910 | Ga0495661_0202973 | 3300046665 | Bacteria | 1037 |
| 911 | Ga0495661_0556709 | 3300046665 | Bacteria | 542 |
| 912 | Ga0495588_0362994 | 3300046674 | Bacteria | 761 |
| 913 | Ga0495599_0051525 | 3300046678 | Bacteria | 2579 |
| 914 | Ga0495647_0005408 | 3300046681 | Bacteria | 4183 |
| 915 | Ga0495658_0013061 | 3300046683 | Bacteria | 4222 |
| 916 | Ga0495658_0250534 | 3300046683 | Bacteria | 1114 |
| 917 | Ga0495658_0611472 | 3300046683 | Bacteria | 698 |
| 918 | Ga0495669_0419224 | 3300046684 | Bacteria | 649 |
| 919 | Ga0495669_0572051 | 3300046684 | Bacteria | 550 |
| 920 | Ga0495613_0128811 | 3300046689 | Bacteria | 1813 |
| 921 | Ga0495613_0243020 | 3300046689 | Bacteria | 1258 |
| 922 | Ga0495613_0340974 | 3300046689 | Bacteria | 1031 |
| 923 | Ga0495624_0075431 | 3300046690 | Bacteria | 2094 |
| 924 | Ga0495624_0546806 | 3300046690 | Bacteria | 691 |
| 925 | Ga0495670_0065896 | 3300046691 | Bacteria | 1826 |
| 926 | Ga0495670_0137564 | 3300046691 | Bacteria | 1276 |
| 927 | Ga0495671_0327303 | 3300046692 | Bacteria | 736 |
| 928 | Ga0495649_0209571 | 3300046694 | Bacteria | 1010 |
| 929 | Ga0495649_0487914 | 3300046694 | Bacteria | 613 |
| 930 | Ga0495600_0080018 | 3300046809 | Bacteria | 2133 |
| 931 | Ga0495600_0359981 | 3300046809 | Bacteria | 910 |
| 932 | Ga0495660_0219558 | 3300046810 | Bacteria | 897 |
| 933 | Ga0495581_0029494 | 3300047315 | Bacteria | 3179 |
| 934 | Ga0495581_0051590 | 3300047315 | Bacteria | 2375 |
| 935 | Ga0495581_0078265 | 3300047315 | Bacteria | 1914 |
| 936 | Ga0495581_0167543 | 3300047315 | Bacteria | 1285 |
| 937 | Ga0495636_0330677 | 3300047318 | Bacteria | 717 |
| 938 | Ga0495674_0003237 | 3300047319 | Bacteria | 15811 |
| 939 | Ga0495674_0192876 | 3300047319 | Bacteria | 1692 |
| 940 | Ga0495674_0308030 | 3300047319 | Bacteria | 1293 |
| 941 | Ga0495672_0022103 | 3300047320 | Bacteria | 4139 |
| 942 | Ga0495672_0175037 | 3300047320 | Bacteria | 1091 |
| 943 | Ga0495676_0006508 | 3300047321 | Bacteria | 10767 |
| 944 | Ga0495676_0058942 | 3300047321 | Bacteria | 3018 |
| 945 | Ga0495680_0049034 | 3300047322 | Bacteria | 3312 |
| 946 | Ga0495680_0171650 | 3300047322 | Bacteria | 1570 |
| 947 | Ga0495680_0691698 | 3300047322 | Bacteria | 674 |
| 948 | Ga0495687_094340 | 3300047443 | Bacteria | 1138 |
| 949 | Ga0495677_0200923 | 3300047445 | Bacteria | 775 |
| 950 | Ga0495679_055317 | 3300047446 | Bacteria | 1179 |
| 951 | Ga0495686_0000800 | 3300047472 | Bacteria | 40813 |
| 952 | Ga0495686_0065896 | 3300047472 | Bacteria | 2239 |
| 953 | Ga0495686_0078676 | 3300047472 | Bacteria | 2018 |
| 954 | Ga0495593_0049789 | 3300047673 | Bacteria | 2222 |
| 955 | Ga0495593_0055097 | 3300047673 | Bacteria | 2094 |
| 956 | Ga0495593_0240265 | 3300047673 | Bacteria | 907 |
| 957 | Ga0495614_0293972 | 3300048089 | Bacteria | 750 |
| 958 | Ga0495626_0175218 | 3300048091 | Bacteria | 892 |
| 959 | Ga0496100_0024512 | 3300048903 | Bacteria | 3680 |
| 960 | Ga0496100_0073200 | 3300048903 | Bacteria | 2292 |
| 961 | Ga0496100_0815559 | 3300048903 | Bacteria | 731 |
| 962 | Ga0496101_0004545 | 3300048904 | Bacteria | 8759 |
| 963 | Ga0496101_0052927 | 3300048904 | Bacteria | 2928 |
| 964 | Ga0496101_0246999 | 3300048904 | Bacteria | 1390 |
| 965 | Ga0496101_0275889 | 3300048904 | Bacteria | 1313 |
| 966 | Ga0496102_0091640 | 3300048905 | Bacteria | 2813 |
| 967 | Ga0496102_0199742 | 3300048905 | Bacteria | 1885 |
| 968 | Ga0496102_0244942 | 3300048905 | Bacteria | 1690 |
| 969 | Ga0496102_0308541 | 3300048905 | Bacteria | 1491 |
| 970 | Ga0496102_0853793 | 3300048905 | Bacteria | 832 |
| 971 | Ga0496102_1129669 | 3300048905 | Bacteria | 703 |
| 972 | Ga0496103_0021461 | 3300048906 | Bacteria | 3885 |
| 973 | Ga0496103_0386729 | 3300048906 | Bacteria | 899 |
| 974 | Ga0496104_0001506 | 3300048907 | Bacteria | 20100 |
| 975 | Ga0496104_0003793 | 3300048907 | Bacteria | 13077 |
| 976 | Ga0496104_0009149 | 3300048907 | Bacteria | 8807 |
| 977 | Ga0496104_0082253 | 3300048907 | Bacteria | 3070 |
| 978 | Ga0496104_0123885 | 3300048907 | Bacteria | 2481 |
| 979 | Ga0496104_0124102 | 3300048907 | Bacteria | 2479 |
| 980 | Ga0496104_0472172 | 3300048907 | Bacteria | 1166 |
| 981 | Ga0496104_0724024 | 3300048907 | Bacteria | 902 |
| 982 | Ga0496104_1162056 | 3300048907 | Bacteria | 675 |
| 983 | Ga0496105_0000442 | 3300048908 | Bacteria | 27287 |
| 984 | Ga0496105_0000721 | 3300048908 | Bacteria | 22383 |
| 985 | Ga0496105_0013118 | 3300048908 | Bacteria | 6572 |
| 986 | Ga0496105_0132827 | 3300048908 | Bacteria | 2051 |
| 987 | Ga0496105_0313314 | 3300048908 | Bacteria | 1259 |
| 988 | Ga0496105_0358109 | 3300048908 | Bacteria | 1164 |
| 989 | Ga0496105_0510513 | 3300048908 | Bacteria | 942 |
| 990 | Ga0496106_0004293 | 3300048909 | Bacteria | 10594 |
| 991 | Ga0496106_0049748 | 3300048909 | Bacteria | 3158 |
| 992 | Ga0496106_0063696 | 3300048909 | Bacteria | 2803 |
| 993 | Ga0496106_0106603 | 3300048909 | Bacteria | 2178 |
| 994 | Ga0496106_0153455 | 3300048909 | Bacteria | 1817 |
| 995 | Ga0496106_0239048 | 3300048909 | Bacteria | 1451 |
| 996 | Ga0496106_1029765 | 3300048909 | Bacteria | 647 |
| 997 | Ga0496106_1262223 | 3300048909 | Bacteria | 574 |
| 998 | Ga0496106_1351669 | 3300048909 | Bacteria | 552 |
| 999 | Ga0496107_0014835 | 3300048910 | Bacteria | 5455 |
| 1000 | Ga0496107_0043968 | 3300048910 | Bacteria | 3210 |
| 1001 | Ga0496107_0239301 | 3300048910 | Bacteria | 1351 |
| 1002 | Ga0496107_0261289 | 3300048910 | Bacteria | 1288 |
| 1003 | Ga0496107_0569503 | 3300048910 | Bacteria | 838 |
| 1004 | Ga0496108_0006478 | 3300048911 | Bacteria | 9495 |
| 1005 | Ga0496108_0008634 | 3300048911 | Bacteria | 8267 |
| 1006 | Ga0496108_0015824 | 3300048911 | Bacteria | 6148 |
| 1007 | Ga0496108_0070354 | 3300048911 | Bacteria | 2953 |
| 1008 | Ga0496108_0212779 | 3300048911 | Bacteria | 1678 |
| 1009 | Ga0496109_0000392 | 3300048912 | Bacteria | 39781 |
| 1010 | Ga0496109_0001446 | 3300048912 | Bacteria | 19677 |
| 1011 | Ga0496109_0080259 | 3300048912 | Bacteria | 3005 |
| 1012 | Ga0496109_0313767 | 3300048912 | Bacteria | 1479 |
| 1013 | Ga0496109_0397832 | 3300048912 | Bacteria | 1301 |
| 1014 | Ga0496110_0006715 | 3300048913 | Bacteria | 9147 |
| 1015 | Ga0496110_0012186 | 3300048913 | Bacteria | 7062 |
| 1016 | Ga0496110_0093217 | 3300048913 | Bacteria | 2696 |
| 1017 | Ga0496110_0103519 | 3300048913 | Bacteria | 2553 |
| 1018 | Ga0496110_0116199 | 3300048913 | Bacteria | 2408 |
| 1019 | Ga0496110_0710232 | 3300048913 | Bacteria | 907 |
| 1020 | Ga0496110_0909370 | 3300048913 | Bacteria | 786 |
| 1021 | Ga0496110_1479031 | 3300048913 | Bacteria | 589 |
| 1022 | Ga0496110_1517044 | 3300048913 | Bacteria | 580 |
| 1023 | Ga0496111_0002114 | 3300048914 | Bacteria | 11862 |
| 1024 | Ga0496111_0003367 | 3300048914 | Bacteria | 9881 |
| 1025 | Ga0496111_0009885 | 3300048914 | Bacteria | 6375 |
| 1026 | Ga0496111_0018577 | 3300048914 | Bacteria | 4817 |
| 1027 | Ga0496111_0646893 | 3300048914 | Bacteria | 771 |
| 1028 | Ga0496112_0001759 | 3300048915 | Bacteria | 16972 |
| 1029 | Ga0496112_0007831 | 3300048915 | Bacteria | 9509 |
| 1030 | Ga0496112_0070610 | 3300048915 | Bacteria | 3451 |
| 1031 | Ga0496112_0189687 | 3300048915 | Bacteria | 2018 |
| 1032 | Ga0496112_0271088 | 3300048915 | Bacteria | 1646 |
| 1033 | Ga0496112_0382439 | 3300048915 | Bacteria | 1348 |
| 1034 | Ga0496112_0946614 | 3300048915 | Bacteria | 782 |
| 1035 | Ga0496113_0000243 | 3300048916 | Bacteria | 25711 |
| 1036 | Ga0496113_0002540 | 3300048916 | Bacteria | 10641 |
| 1037 | Ga0496113_0068120 | 3300048916 | Bacteria | 2700 |
| 1038 | Ga0496113_0256440 | 3300048916 | Bacteria | 1397 |
| 1039 | Ga0496113_0325105 | 3300048916 | Bacteria | 1233 |
| 1040 | Ga0496114_0001511 | 3300048917 | Bacteria | 17672 |
| 1041 | Ga0496114_0065533 | 3300048917 | Bacteria | 3043 |
| 1042 | Ga0496114_0122384 | 3300048917 | Bacteria | 2239 |
| 1043 | Ga0496114_0317220 | 3300048917 | Bacteria | 1377 |
| 1044 | Ga0496115_0002949 | 3300048918 | Bacteria | 12258 |
| 1045 | Ga0496115_0021101 | 3300048918 | Bacteria | 5027 |
| 1046 | Ga0496115_0027487 | 3300048918 | Bacteria | 4450 |
| 1047 | Ga0496115_0037022 | 3300048918 | Bacteria | 3865 |
| 1048 | Ga0496115_0135661 | 3300048918 | Bacteria | 2029 |
| 1049 | Ga0496115_0538292 | 3300048918 | Bacteria | 935 |
| 1050 | Ga0496118_0271514 | 3300048921 | Bacteria | 950 |
| 1051 | Ga0496119_0052413 | 3300048922 | Bacteria | 2499 |
| 1052 | Ga0496119_0372718 | 3300048922 | Bacteria | 686 |
| 1053 | Ga0496120_0009305 | 3300048923 | Bacteria | 6987 |
| 1054 | Ga0496121_0035770 | 3300048924 | Bacteria | 4442 |
| 1055 | Ga0496121_0204092 | 3300048924 | Bacteria | 1406 |
| 1056 | Ga0496121_0231125 | 3300048924 | Bacteria | 1295 |
| 1057 | Ga0496121_0241249 | 3300048924 | Bacteria | 1259 |
| 1058 | Ga0496122_0035348 | 3300048925 | Bacteria | 4067 |
| 1059 | Ga0496122_0150687 | 3300048925 | Bacteria | 1436 |
| 1060 | Ga0496123_0194984 | 3300048926 | Bacteria | 1044 |
| 1061 | Ga0496125_0018828 | 3300048928 | Bacteria | 6539 |
| 1062 | Ga0496125_0055809 | 3300048928 | Bacteria | 3214 |
| 1063 | Ga0496125_0217409 | 3300048928 | Bacteria | 1235 |
| 1064 | Ga0496126_0095968 | 3300048929 | Bacteria | 2600 |
| 1065 | Ga0496126_0311405 | 3300048929 | Bacteria | 1296 |
| 1066 | Ga0496126_0406157 | 3300048929 | Bacteria | 1104 |
| 1067 | Ga0496126_0929826 | 3300048929 | Bacteria | 657 |
| 1068 | Ga0495678_063215 | 3300049459 | Bacteria | 1383 |
| 1069 | Ga0501069_0365292 | 3300049585 | Bacteria | 852 |
| 1070 | Ga0501239_044813 | 3300049672 | Bacteria | 623 |
| 1071 | Ga0501081_1282330 | 3300049743 | Bacteria | 555 |
| 1072 | Ga0501212_039679 | 3300049851 | Bacteria | 776 |
| 1073 | nmdc:mga03683_126565_c1 | 3300050489 | Bacteria | 823 |
| 1074 | nmdc:mga03683_15367_c1 | 3300050489 | Bacteria | 2856 |
| 1075 | nmdc:mga03683_395739_c1 | 3300050489 | Bacteria | 659 |
| 1076 | nmdc:mga03683_584935_c1 | 3300050489 | Bacteria | 545 |
| 1077 | nmdc:mga03n38_147669_c1 | 3300050490 | Bacteria | 1180 |
| 1078 | nmdc:mga03n38_1541_c1 | 3300050490 | Bacteria | 6679 |
| 1079 | nmdc:mga03n38_174930_c1 | 3300050490 | Bacteria | 1096 |
| 1080 | nmdc:mga03n38_246069_c1 | 3300050490 | Bacteria | 943 |
| 1081 | nmdc:mga03n38_431591_c1 | 3300050490 | Bacteria | 730 |
| 1082 | nmdc:mga00v17_35686_c1 | 3300050491 | Bacteria | 2961 |
| 1083 | nmdc:mga00v17_399663_c1 | 3300050491 | Bacteria | 893 |
| 1084 | nmdc:mga0yw44_131781_c1 | 3300050492 | Bacteria | 1619 |
| 1085 | nmdc:mga0yw44_18644_c1 | 3300050492 | Bacteria | 3807 |
| 1086 | nmdc:mga0yw44_32635_c1 | 3300050492 | Bacteria | 3036 |
| 1087 | nmdc:mga0yw44_42352_c1 | 3300050492 | Bacteria | 2715 |
| 1088 | nmdc:mga0yw44_45115_c1 | 3300050492 | Bacteria | 2641 |
| 1089 | nmdc:mga0yw44_819073_c1 | 3300050492 | Bacteria | 632 |
| 1090 | nmdc:mga0yw44_933868_c1 | 3300050492 | Bacteria | 588 |
| 1091 | nmdc:mga0k408_109126_c1 | 3300050493 | Bacteria | 1635 |
| 1092 | nmdc:mga0k408_343868_c1 | 3300050493 | Bacteria | 889 |
| 1093 | nmdc:mga0k408_684241_c1 | 3300050493 | Bacteria | 602 |
| 1094 | nmdc:mga0k408_72131_c1 | 3300050493 | Bacteria | 2016 |
| 1095 | nmdc:mga0k408_779109_c1 | 3300050493 | Bacteria | 558 |
| 1096 | nmdc:mga06z11_163186_c1 | 3300050494 | Bacteria | 1275 |
| 1097 | nmdc:mga06z11_3997_c1 | 3300050494 | Bacteria | 5756 |
| 1098 | nmdc:mga06z11_59237_c1 | 3300050494 | Bacteria | 1990 |
| 1099 | nmdc:mga06z11_81847_c1 | 3300050494 | Bacteria | 1734 |
| 1100 | nmdc:mga04h51_30851_c1 | 3300050495 | Bacteria | 1690 |
| 1101 | nmdc:mga04h51_313695_c1 | 3300050495 | Bacteria | 641 |
| 1102 | nmdc:mga04h51_518564_c1 | 3300050495 | Bacteria | 511 |
| 1103 | nmdc:mga04h51_99658_c1 | 3300050495 | Bacteria | 1057 |
| 1104 | nmdc:mga07m45_155860_c1 | 3300050496 | Bacteria | 1325 |
| 1105 | nmdc:mga07m45_32518_c1 | 3300050496 | Bacteria | 2893 |
| 1106 | nmdc:mga07m45_65227_c1 | 3300050496 | Bacteria | 2067 |
| 1107 | nmdc:mga07m45_9902_c1 | 3300050496 | Bacteria | 4959 |
| 1108 | nmdc:mga05p37_1566364_c1 | 3300050507 | Bacteria | 651 |
| 1109 | nmdc:mga05p37_25457_c1 | 3300050507 | Bacteria | 7196 |
| 1110 | nmdc:mga05p37_639258_c1 | 3300050507 | Bacteria | 1194 |
| 1111 | nmdc:mga09592_242341_c1 | 3300050508 | Bacteria | 1562 |
| 1112 | nmdc:mga0qj67_273638_c1 | 3300050509 | Bacteria | 1369 |
| 1113 | nmdc:mga06r32_131586_c1 | 3300050510 | Bacteria | 2474 |
| 1114 | nmdc:mga08y16_46383_c1 | 3300050511 | Bacteria | 4549 |
| 1115 | nmdc:mga0n895_189567_c1 | 3300050512 | Bacteria | 2087 |
| 1116 | nmdc:mga0n895_407568_c1 | 3300050512 | Bacteria | 1375 |
| 1117 | nmdc:mga0rr50_321511_c1 | 3300050513 | Bacteria | 1297 |
| 1118 | nmdc:mga08x19_367095_c1 | 3300050514 | Bacteria | 1007 |
| 1119 | nmdc:mga08x19_928918_c1 | 3300050514 | Bacteria | 618 |
| 1120 | nmdc:mga0sz30_25501_c1 | 3300050516 | Bacteria | 2417 |
| 1121 | nmdc:mga0sz30_312452_c1 | 3300050516 | Bacteria | 701 |
| 1122 | nmdc:mga0sz30_733_c1 | 3300050516 | Bacteria | 11987 |
| 1123 | Ga0495601_0019698 | 3300053077 | Bacteria | 4118 |
| 1124 | Ga0500610_0012561 | 3300053079 | Bacteria | 3906 |
| 1125 | Ga0500610_0244192 | 3300053079 | Bacteria | 833 |
| 1126 | Ga0500635_0447727 | 3300053080 | Bacteria | 511 |
| 1127 | Ga0495655_0228027 | 3300053083 | Bacteria | 619 |
| 1128 | Ga0495595_0742319 | 3300053084 | Bacteria | 504 |
| 1129 | Ga0495619_0004858 | 3300053085 | Bacteria | 8529 |
| 1130 | Ga0495619_0069411 | 3300053085 | Bacteria | 2355 |
| 1131 | Ga0495619_0244597 | 3300053085 | Bacteria | 1243 |
| 1132 | Ga0495619_0503272 | 3300053085 | Bacteria | 833 |
| 1133 | Ga0500578_0120669 | 3300053086 | Bacteria | 1648 |
| 1134 | Ga0500646_0048118 | 3300053090 | Bacteria | 1222 |
| 1135 | Ga0500647_0083802 | 3300053091 | Bacteria | 1529 |
| 1136 | Ga0500583_0003828 | 3300053092 | Bacteria | 4811 |
| 1137 | Ga0500583_0041923 | 3300053092 | Bacteria | 2082 |
| 1138 | Ga0500651_0034151 | 3300053093 | Bacteria | 3207 |
| 1139 | Ga0500651_0037407 | 3300053093 | Bacteria | 3059 |
| 1140 | Ga0500566_0003029 | 3300053094 | Bacteria | 10051 |
| 1141 | Ga0500566_0003135 | 3300053094 | Bacteria | 9876 |
| 1142 | Ga0500641_0018361 | 3300053096 | Bacteria | 2630 |
| 1143 | Ga0500641_0151233 | 3300053096 | Bacteria | 1002 |
| 1144 | Ga0500648_126568 | 3300053097 | Bacteria | 1392 |
| 1145 | Ga0500650_0108864 | 3300053098 | Bacteria | 1294 |
| 1146 | Ga0500554_091662 | 3300053102 | Bacteria | 1010 |
| 1147 | Ga0500557_085519 | 3300053105 | Bacteria | 1043 |
| 1148 | Ga0500558_160209 | 3300053106 | Bacteria | 826 |
| 1149 | Ga0500569_128241 | 3300053109 | Bacteria | 848 |
| 1150 | Ga0500572_000747 | 3300053111 | Bacteria | 10459 |
| 1151 | Ga0500594_0000512 | 3300053118 | Bacteria | 8398 |
| 1152 | Ga0500595_000363 | 3300053119 | Bacteria | 29233 |
| 1153 | Ga0500595_003507 | 3300053119 | Bacteria | 7301 |
| 1154 | Ga0500595_003671 | 3300053119 | Bacteria | 7097 |
| 1155 | Ga0500595_006423 | 3300053119 | Bacteria | 4987 |
| 1156 | Ga0500595_013300 | 3300053119 | Bacteria | 3155 |
| 1157 | Ga0500595_078174 | 3300053119 | Bacteria | 972 |
| 1158 | Ga0500608_016509 | 3300053122 | Bacteria | 3337 |
| 1159 | Ga0500608_202165 | 3300053122 | Bacteria | 820 |
| 1160 | Ga0500618_000305 | 3300053125 | Bacteria | 36613 |
| 1161 | Ga0500642_0046365 | 3300053130 | Bacteria | 1900 |
| 1162 | Ga0500642_0051142 | 3300053130 | Bacteria | 1825 |
| 1163 | Ga0500658_0007684 | 3300053134 | Bacteria | 3981 |
| 1164 | Ga0500658_0025292 | 3300053134 | Bacteria | 2281 |
| 1165 | Ga0500658_0147560 | 3300053134 | Bacteria | 1059 |
| 1166 | Ga0500559_0118613 | 3300053136 | Bacteria | 1229 |
| 1167 | Ga0500559_0288282 | 3300053136 | Bacteria | 771 |
| 1168 | Ga0500559_0334112 | 3300053136 | Bacteria | 710 |
| 1169 | Ga0500559_0340923 | 3300053136 | Unclassified | 702 |
| 1170 | Ga0500564_169848 | 3300053138 | Bacteria | 917 |
| 1171 | Ga0500573_0112042 | 3300053140 | Bacteria | 1525 |
| 1172 | Ga0500577_0066143 | 3300053142 | Bacteria | 1405 |
| 1173 | Ga0500577_0158353 | 3300053142 | Bacteria | 963 |
| 1174 | Ga0500586_001048 | 3300053145 | Bacteria | 5708 |
| 1175 | Ga0500590_137221 | 3300053148 | Bacteria | 1123 |
| 1176 | Ga0500603_000740 | 3300053150 | Bacteria | 7963 |
| 1177 | Ga0500604_0113185 | 3300053151 | Bacteria | 902 |
| 1178 | Ga0500604_0193389 | 3300053151 | Bacteria | 699 |
| 1179 | Ga0500616_0003127 | 3300053153 | Bacteria | 12941 |
| 1180 | Ga0500616_0009374 | 3300053153 | Bacteria | 5961 |
| 1181 | Ga0500616_0049753 | 3300053153 | Bacteria | 2216 |
| 1182 | Ga0500619_130648 | 3300053154 | Bacteria | 856 |
| 1183 | Ga0500630_002258 | 3300053159 | Bacteria | 9301 |
| 1184 | Ga0500634_0106664 | 3300053161 | Bacteria | 1391 |
| 1185 | Ga0500638_002245 | 3300053162 | Bacteria | 6617 |
| 1186 | Ga0500639_000035 | 3300053163 | Bacteria | 66883 |
| 1187 | Ga0500636_0000273 | 3300053177 | Bacteria | 28617 |
| 1188 | Ga0500636_0032576 | 3300053177 | Bacteria | 3084 |
| 1189 | Ga0500636_0050413 | 3300053177 | Bacteria | 2448 |
| 1190 | Ga0500637_0000391 | 3300053178 | Bacteria | 16695 |
| 1191 | Ga0500637_0135353 | 3300053178 | Bacteria | 1427 |
| 1192 | Ga0500637_0195046 | 3300053178 | Bacteria | 1155 |
| 1193 | Ga0500625_000140 | 3300053729 | Bacteria | 14802 |
| 1194 | Ga0500645_001069 | 3300053730 | Bacteria | 15155 |
| 1195 | Ga0500645_013746 | 3300053730 | Bacteria | 2592 |
| 1196 | Ga0500645_069265 | 3300053730 | Bacteria | 1014 |
| 1197 | Ga0500609_039661 | 3300053731 | Bacteria | 651 |
| 1198 | Ga0500596_000035 | 3300053735 | Bacteria | 18519 |
| 1199 | Ga0500596_000586 | 3300053735 | Bacteria | 6975 |
| 1200 | Ga0500601_002331 | 3300053737 | Bacteria | 2042 |
| 1201 | Ga0500661_001163 | 3300055283 | Bacteria | 4921 |
| 1202 | Ga0500661_008429 | 3300055283 | Bacteria | 1897 |
| 1203 | Ga0501082_0177318 | 3300060353 | Bacteria | 1853 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009147 | Ga0114129_12426892 | Ga0114129_124268921 | 120 |
| 2 | 3300009545 | Ga0105237_10901705 | Ga0105237_109017051 | 123 |
| 3 | 3300046515 | Ga0495620_0211516 | Ga0495620_0211516_261_683 | 123 |
| 4 | 3300005435 | Ga0070714_100745294 | Ga0070714_1007452941 | 124 |
| 5 | 3300003203 | JGI25406J46586_10000141 | JGI25406J46586_1000014113 | 125 |
| 6 | 3300003214 | JGI25165J46597_1000079 | JGI25165J46597_10000792 | 125 |
| 7 | 3300003322 | rootL2_10033170 | rootL2_100331701 | 125 |
| 8 | 3300005577 | Ga0068857_101267265 | Ga0068857_1012672652 | 125 |
| 9 | 3300005618 | Ga0068864_101871450 | Ga0068864_1018714501 | 125 |
| 10 | 3300005985 | Ga0081539_10000008 | Ga0081539_10000008476 | 125 |
| 11 | 3300010375 | Ga0105239_11762106 | Ga0105239_117621062 | 125 |
| 12 | 3300013105 | Ga0157369_12184098 | Ga0157369_121840982 | 125 |
| 13 | 3300014745 | Ga0157377_10351192 | Ga0157377_103511921 | 125 |
| 14 | 3300014969 | Ga0157376_11764805 | Ga0157376_117648052 | 125 |
| 15 | 3300031251 | Ga0265327_10290248 | Ga0265327_102902482 | 125 |
| 16 | 3300002244 | JGI24742J22300_10050271 | JGI24742J22300_100502711 | 126 |
| 17 | 3300003215 | JGI25153J46596_10000083 | JGI25153J46596_1000008369 | 126 |
| 18 | 3300003215 | JGI25153J46596_10000083 | JGI25153J46596_1000008372 | 126 |
| 19 | 3300003215 | JGI25153J46596_10001465 | JGI25153J46596_100014658 | 126 |
| 20 | 3300003215 | JGI25153J46596_10096827 | JGI25153J46596_100968271 | 126 |
| 21 | 3300003322 | rootL2_10033171 | rootL2_100331711 | 126 |
| 22 | 3300003322 | rootL2_10340203 | rootL2_103402032 | 126 |
| 23 | 3300003763 | Ga0055529_1003576 | Ga0055529_10035762 | 126 |
| 24 | 3300003794 | Ga0055531_10008570 | Ga0055531_100085705 | 126 |
| 25 | 3300005329 | Ga0070683_100369195 | Ga0070683_1003691953 | 126 |
| 26 | 3300005329 | Ga0070683_100481303 | Ga0070683_1004813032 | 126 |
| 27 | 3300005330 | Ga0070690_100227885 | Ga0070690_1002278852 | 126 |
| 28 | 3300005333 | Ga0070677_10126034 | Ga0070677_101260342 | 126 |
| 29 | 3300005335 | Ga0070666_10021441 | Ga0070666_100214413 | 126 |
| 30 | 3300005338 | Ga0068868_100076529 | Ga0068868_1000765293 | 126 |
| 31 | 3300005344 | Ga0070661_100115681 | Ga0070661_1001156814 | 126 |
| 32 | 3300005347 | Ga0070668_100338781 | Ga0070668_1003387811 | 126 |
| 33 | 3300005354 | Ga0070675_100292425 | Ga0070675_1002924252 | 126 |
| 34 | 3300005355 | Ga0070671_100068026 | Ga0070671_1000680264 | 126 |
| 35 | 3300005355 | Ga0070671_100193026 | Ga0070671_1001930261 | 126 |
| 36 | 3300005355 | Ga0070671_101110758 | Ga0070671_1011107581 | 126 |
| 37 | 3300005356 | Ga0070674_100103785 | Ga0070674_1001037852 | 126 |
| 38 | 3300005364 | Ga0070673_100206555 | Ga0070673_1002065553 | 126 |
| 39 | 3300005366 | Ga0070659_102168327 | Ga0070659_1021683271 | 126 |
| 40 | 3300005367 | Ga0070667_100126724 | Ga0070667_1001267243 | 126 |
| 41 | 3300005434 | Ga0070709_10063854 | Ga0070709_100638543 | 126 |
| 42 | 3300005434 | Ga0070709_10092025 | Ga0070709_100920253 | 126 |
| 43 | 3300005435 | Ga0070714_100475385 | Ga0070714_1004753852 | 126 |
| 44 | 3300005435 | Ga0070714_100622306 | Ga0070714_1006223062 | 126 |
| 45 | 3300005435 | Ga0070714_100910647 | Ga0070714_1009106472 | 126 |
| 46 | 3300005436 | Ga0070713_100126649 | Ga0070713_1001266492 | 126 |
| 47 | 3300005436 | Ga0070713_100202463 | Ga0070713_1002024632 | 126 |
| 48 | 3300005437 | Ga0070710_10555368 | Ga0070710_105553682 | 126 |
| 49 | 3300005439 | Ga0070711_100623599 | Ga0070711_1006235992 | 126 |
| 50 | 3300005455 | Ga0070663_100153170 | Ga0070663_1001531702 | 126 |
| 51 | 3300005457 | Ga0070662_100102222 | Ga0070662_1001022223 | 126 |
| 52 | 3300005458 | Ga0070681_10036625 | Ga0070681_100366256 | 126 |
| 53 | 3300005458 | Ga0070681_10356089 | Ga0070681_103560891 | 126 |
| 54 | 3300005467 | Ga0070706_100510191 | Ga0070706_1005101912 | 126 |
| 55 | 3300005471 | Ga0070698_100556222 | Ga0070698_1005562221 | 126 |
| 56 | 3300005530 | Ga0070679_100207552 | Ga0070679_1002075523 | 126 |
| 57 | 3300005530 | Ga0070679_100570664 | Ga0070679_1005706642 | 126 |
| 58 | 3300005530 | Ga0070679_100924664 | Ga0070679_1009246642 | 126 |
| 59 | 3300005535 | Ga0070684_100169809 | Ga0070684_1001698092 | 126 |
| 60 | 3300005536 | Ga0070697_100165328 | Ga0070697_1001653283 | 126 |
| 61 | 3300005539 | Ga0068853_100013283 | Ga0068853_1000132834 | 126 |
| 62 | 3300005539 | Ga0068853_100856995 | Ga0068853_1008569951 | 126 |
| 63 | 3300005539 | Ga0068853_101423548 | Ga0068853_1014235482 | 126 |
| 64 | 3300005539 | Ga0068853_101688986 | Ga0068853_1016889861 | 126 |
| 65 | 3300005547 | Ga0070693_100195011 | Ga0070693_1001950111 | 126 |
| 66 | 3300005548 | Ga0070665_100056376 | Ga0070665_1000563762 | 126 |
| 67 | 3300005548 | Ga0070665_100155645 | Ga0070665_1001556453 | 126 |
| 68 | 3300005548 | Ga0070665_100242469 | Ga0070665_1002424694 | 126 |
| 69 | 3300005548 | Ga0070665_100655738 | Ga0070665_1006557381 | 126 |
| 70 | 3300005548 | Ga0070665_102447995 | Ga0070665_1024479951 | 126 |
| 71 | 3300005563 | Ga0068855_100043783 | Ga0068855_1000437834 | 126 |
| 72 | 3300005563 | Ga0068855_100685732 | Ga0068855_1006857323 | 126 |
| 73 | 3300005564 | Ga0070664_100227073 | Ga0070664_1002270733 | 126 |
| 74 | 3300005564 | Ga0070664_100671212 | Ga0070664_1006712122 | 126 |
| 75 | 3300005564 | Ga0070664_101170780 | Ga0070664_1011707802 | 126 |
| 76 | 3300005577 | Ga0068857_100294146 | Ga0068857_1002941462 | 126 |
| 77 | 3300005577 | Ga0068857_100767578 | Ga0068857_1007675782 | 126 |
| 78 | 3300005578 | Ga0068854_101329044 | Ga0068854_1013290442 | 126 |
| 79 | 3300005614 | Ga0068856_101169245 | Ga0068856_1011692452 | 126 |
| 80 | 3300005842 | Ga0068858_100224742 | Ga0068858_1002247422 | 126 |
| 81 | 3300005937 | Ga0081455_10079109 | Ga0081455_100791092 | 126 |
| 82 | 3300005937 | Ga0081455_10528343 | Ga0081455_105283431 | 126 |
| 83 | 3300006028 | Ga0070717_10012822 | Ga0070717_100128225 | 126 |
| 84 | 3300006028 | Ga0070717_10071458 | Ga0070717_100714583 | 126 |
| 85 | 3300006028 | Ga0070717_10411620 | Ga0070717_104116202 | 126 |
| 86 | 3300006038 | Ga0075365_10188458 | Ga0075365_101884582 | 126 |
| 87 | 3300006038 | Ga0075365_10551704 | Ga0075365_105517042 | 126 |
| 88 | 3300006051 | Ga0075364_10180179 | Ga0075364_101801792 | 126 |
| 89 | 3300006163 | Ga0070715_10149386 | Ga0070715_101493861 | 126 |
| 90 | 3300006173 | Ga0070716_100714808 | Ga0070716_1007148081 | 126 |
| 91 | 3300006175 | Ga0070712_100255778 | Ga0070712_1002557782 | 126 |
| 92 | 3300006175 | Ga0070712_100705437 | Ga0070712_1007054372 | 126 |
| 93 | 3300006175 | Ga0070712_100800477 | Ga0070712_1008004772 | 126 |
| 94 | 3300006175 | Ga0070712_101045216 | Ga0070712_1010452161 | 126 |
| 95 | 3300006177 | Ga0075362_10021853 | Ga0075362_100218532 | 126 |
| 96 | 3300006186 | Ga0075369_10247548 | Ga0075369_102475481 | 126 |
| 97 | 3300006195 | Ga0075366_10020582 | Ga0075366_100205822 | 126 |
| 98 | 3300006195 | Ga0075366_10326100 | Ga0075366_103261001 | 126 |
| 99 | 3300006237 | Ga0097621_100000035 | Ga0097621_10000003564 | 126 |
| 100 | 3300006237 | Ga0097621_100041237 | Ga0097621_1000412377 | 126 |
| 101 | 3300006358 | Ga0068871_100000287 | Ga0068871_10000028719 | 126 |
| 102 | 3300006358 | Ga0068871_100376370 | Ga0068871_1003763702 | 126 |
| 103 | 3300006844 | Ga0075428_100018258 | Ga0075428_1000182589 | 126 |
| 104 | 3300006914 | Ga0075436_100058654 | Ga0075436_1000586542 | 126 |
| 105 | 3300006941 | Ga0099825_1022726 | Ga0099825_10227262 | 126 |
| 106 | 3300006942 | Ga0099824_1056536 | Ga0099824_10565361 | 126 |
| 107 | 3300006944 | Ga0099823_1068153 | Ga0099823_10681532 | 126 |
| 108 | 3300007076 | Ga0075435_100399102 | Ga0075435_1003991022 | 126 |
| 109 | 3300007788 | Ga0099795_10084919 | Ga0099795_100849193 | 126 |
| 110 | 3300007788 | Ga0099795_10135349 | Ga0099795_101353492 | 126 |
| 111 | 3300009093 | Ga0105240_10003004 | Ga0105240_1000300420 | 126 |
| 112 | 3300009093 | Ga0105240_10167862 | Ga0105240_101678623 | 126 |
| 113 | 3300009093 | Ga0105240_10186744 | Ga0105240_101867441 | 126 |
| 114 | 3300009094 | Ga0111539_10279104 | Ga0111539_102791042 | 126 |
| 115 | 3300009098 | Ga0105245_10436964 | Ga0105245_104369642 | 126 |
| 116 | 3300009101 | Ga0105247_10047677 | Ga0105247_100476774 | 126 |
| 117 | 3300009147 | Ga0114129_10197396 | Ga0114129_101973964 | 126 |
| 118 | 3300009545 | Ga0105237_10033837 | Ga0105237_100338376 | 126 |
| 119 | 3300009545 | Ga0105237_10169585 | Ga0105237_101695852 | 126 |
| 120 | 3300009545 | Ga0105237_10508770 | Ga0105237_105087702 | 126 |
| 121 | 3300009545 | Ga0105237_10541218 | Ga0105237_105412182 | 126 |
| 122 | 3300009551 | Ga0105238_12128875 | Ga0105238_121288751 | 126 |
| 123 | 3300009551 | Ga0105238_12443781 | Ga0105238_124437811 | 126 |
| 124 | 3300010159 | Ga0099796_10286391 | Ga0099796_102863912 | 126 |
| 125 | 3300010375 | Ga0105239_10544404 | Ga0105239_105444042 | 126 |
| 126 | 3300010375 | Ga0105239_10932655 | Ga0105239_109326551 | 126 |
| 127 | 3300010375 | Ga0105239_10997278 | Ga0105239_109972781 | 126 |
| 128 | 3300010375 | Ga0105239_11603006 | Ga0105239_116030062 | 126 |
| 129 | 3300011119 | Ga0105246_10286955 | Ga0105246_102869552 | 126 |
| 130 | 3300012476 | Ga0157344_1015975 | Ga0157344_10159751 | 126 |
| 131 | 3300013100 | Ga0157373_11100196 | Ga0157373_111001962 | 126 |
| 132 | 3300013105 | Ga0157369_10137911 | Ga0157369_101379113 | 126 |
| 133 | 3300013296 | Ga0157374_12637919 | Ga0157374_126379191 | 126 |
| 134 | 3300013297 | Ga0157378_10011018 | Ga0157378_100110184 | 126 |
| 135 | 3300013306 | Ga0163162_10033875 | Ga0163162_100338757 | 126 |
| 136 | 3300013306 | Ga0163162_10576312 | Ga0163162_105763122 | 126 |
| 137 | 3300013306 | Ga0163162_12789136 | Ga0163162_127891361 | 126 |
| 138 | 3300013307 | Ga0157372_10024301 | Ga0157372_100243012 | 126 |
| 139 | 3300014325 | Ga0163163_10085274 | Ga0163163_100852743 | 126 |
| 140 | 3300014325 | Ga0163163_11863406 | Ga0163163_118634062 | 126 |
| 141 | 3300014325 | Ga0163163_12453279 | Ga0163163_124532792 | 126 |
| 142 | 3300014497 | Ga0182008_10034186 | Ga0182008_100341862 | 126 |
| 143 | 3300014745 | Ga0157377_10777228 | Ga0157377_107772281 | 126 |
| 144 | 3300014968 | Ga0157379_10192874 | Ga0157379_101928741 | 126 |
| 145 | 3300014969 | Ga0157376_10877705 | Ga0157376_108777052 | 126 |
| 146 | 3300015262 | Ga0182007_10046526 | Ga0182007_100465262 | 126 |
| 147 | 3300017792 | Ga0163161_11374184 | Ga0163161_113741841 | 126 |
| 148 | 3300017792 | Ga0163161_11619543 | Ga0163161_116195431 | 126 |
| 149 | 3300021358 | Ga0213873_10127364 | Ga0213873_101273641 | 126 |
| 150 | 3300021358 | Ga0213873_10142240 | Ga0213873_101422401 | 126 |
| 151 | 3300021361 | Ga0213872_10042073 | Ga0213872_100420731 | 126 |
| 152 | 3300021361 | Ga0213872_10059182 | Ga0213872_100591822 | 126 |
| 153 | 3300021384 | Ga0213876_10048895 | Ga0213876_100488952 | 126 |
| 154 | 3300021441 | Ga0213871_10004609 | Ga0213871_100046093 | 126 |
| 155 | 3300021441 | Ga0213871_10118950 | Ga0213871_101189501 | 126 |
| 156 | 3300025245 | Ga0207425_1041828 | Ga0207425_10418281 | 126 |
| 157 | 3300025254 | Ga0209148_1000212 | Ga0209148_100021299 | 126 |
| 158 | 3300025261 | Ga0209233_1028384 | Ga0209233_10283841 | 126 |
| 159 | 3300025272 | Ga0209455_1000346 | Ga0209455_100034644 | 126 |
| 160 | 3300025295 | Ga0209564_1024238 | Ga0209564_10242382 | 126 |
| 161 | 3300025297 | Ga0209758_1000023 | Ga0209758_1000023560 | 126 |
| 162 | 3300025297 | Ga0209758_1000023 | Ga0209758_1000023562 | 126 |
| 163 | 3300025297 | Ga0209758_1000024 | Ga0209758_1000024142 | 126 |
| 164 | 3300025297 | Ga0209758_1002631 | Ga0209758_100263116 | 126 |
| 165 | 3300025297 | Ga0209758_1024738 | Ga0209758_10247382 | 126 |
| 166 | 3300025302 | Ga0207426_1147331 | Ga0207426_11473311 | 126 |
| 167 | 3300025304 | Ga0209257_1004708 | Ga0209257_10047085 | 126 |
| 168 | 3300025304 | Ga0209257_1032451 | Ga0209257_10324512 | 126 |
| 169 | 3300025893 | Ga0207682_10062432 | Ga0207682_100624322 | 126 |
| 170 | 3300025898 | Ga0207692_10295050 | Ga0207692_102950502 | 126 |
| 171 | 3300025898 | Ga0207692_10483293 | Ga0207692_104832931 | 126 |
| 172 | 3300025900 | Ga0207710_10030393 | Ga0207710_100303932 | 126 |
| 173 | 3300025904 | Ga0207647_10144726 | Ga0207647_101447262 | 126 |
| 174 | 3300025905 | Ga0207685_10081867 | Ga0207685_100818672 | 126 |
| 175 | 3300025906 | Ga0207699_10292559 | Ga0207699_102925592 | 126 |
| 176 | 3300025909 | Ga0207705_10405777 | Ga0207705_104057773 | 126 |
| 177 | 3300025911 | Ga0207654_10100295 | Ga0207654_101002953 | 126 |
| 178 | 3300025912 | Ga0207707_10007211 | Ga0207707_100072117 | 126 |
| 179 | 3300025912 | Ga0207707_10528609 | Ga0207707_105286092 | 126 |
| 180 | 3300025913 | Ga0207695_10006643 | Ga0207695_100066433 | 126 |
| 181 | 3300025913 | Ga0207695_10095017 | Ga0207695_100950172 | 126 |
| 182 | 3300025914 | Ga0207671_10076601 | Ga0207671_100766011 | 126 |
| 183 | 3300025914 | Ga0207671_10236225 | Ga0207671_102362252 | 126 |
| 184 | 3300025914 | Ga0207671_10566443 | Ga0207671_105664431 | 126 |
| 185 | 3300025915 | Ga0207693_10379114 | Ga0207693_103791143 | 126 |
| 186 | 3300025915 | Ga0207693_10412228 | Ga0207693_104122282 | 126 |
| 187 | 3300025915 | Ga0207693_10574305 | Ga0207693_105743052 | 126 |
| 188 | 3300025915 | Ga0207693_10675093 | Ga0207693_106750932 | 126 |
| 189 | 3300025915 | Ga0207693_11199143 | Ga0207693_111991431 | 126 |
| 190 | 3300025916 | Ga0207663_10216629 | Ga0207663_102166292 | 126 |
| 191 | 3300025919 | Ga0207657_10252533 | Ga0207657_102525332 | 126 |
| 192 | 3300025920 | Ga0207649_10211551 | Ga0207649_102115512 | 126 |
| 193 | 3300025920 | Ga0207649_10349031 | Ga0207649_103490312 | 126 |
| 194 | 3300025921 | Ga0207652_10100168 | Ga0207652_101001682 | 126 |
| 195 | 3300025921 | Ga0207652_10407937 | Ga0207652_104079371 | 126 |
| 196 | 3300025921 | Ga0207652_11140228 | Ga0207652_111402281 | 126 |
| 197 | 3300025924 | Ga0207694_10234203 | Ga0207694_102342033 | 126 |
| 198 | 3300025926 | Ga0207659_10158051 | Ga0207659_101580512 | 126 |
| 199 | 3300025928 | Ga0207700_10073919 | Ga0207700_100739191 | 126 |
| 200 | 3300025928 | Ga0207700_10075840 | Ga0207700_100758402 | 126 |
| 201 | 3300025928 | Ga0207700_10091261 | Ga0207700_100912613 | 126 |
| 202 | 3300025928 | Ga0207700_10579259 | Ga0207700_105792592 | 126 |
| 203 | 3300025929 | Ga0207664_10078282 | Ga0207664_100782822 | 126 |
| 204 | 3300025929 | Ga0207664_11249774 | Ga0207664_112497741 | 126 |
| 205 | 3300025931 | Ga0207644_10160494 | Ga0207644_101604941 | 126 |
| 206 | 3300025931 | Ga0207644_10474873 | Ga0207644_104748731 | 126 |
| 207 | 3300025932 | Ga0207690_11250754 | Ga0207690_112507542 | 126 |
| 208 | 3300025933 | Ga0207706_10022493 | Ga0207706_100224934 | 126 |
| 209 | 3300025933 | Ga0207706_10550051 | Ga0207706_105500512 | 126 |
| 210 | 3300025934 | Ga0207686_10433306 | Ga0207686_104333062 | 126 |
| 211 | 3300025936 | Ga0207670_11619697 | Ga0207670_116196971 | 126 |
| 212 | 3300025937 | Ga0207669_10000778 | Ga0207669_100007788 | 126 |
| 213 | 3300025939 | Ga0207665_10619454 | Ga0207665_106194542 | 126 |
| 214 | 3300025939 | Ga0207665_11465611 | Ga0207665_114656111 | 126 |
| 215 | 3300025941 | Ga0207711_10053294 | Ga0207711_100532944 | 126 |
| 216 | 3300025945 | Ga0207679_10071976 | Ga0207679_100719762 | 126 |
| 217 | 3300025945 | Ga0207679_10296096 | Ga0207679_102960962 | 126 |
| 218 | 3300025960 | Ga0207651_10577923 | Ga0207651_105779232 | 126 |
| 219 | 3300025960 | Ga0207651_10924009 | Ga0207651_109240091 | 126 |
| 220 | 3300025961 | Ga0207712_10476651 | Ga0207712_104766512 | 126 |
| 221 | 3300025972 | Ga0207668_10340803 | Ga0207668_103408032 | 126 |
| 222 | 3300025972 | Ga0207668_11051069 | Ga0207668_110510691 | 126 |
| 223 | 3300025981 | Ga0207640_10603315 | Ga0207640_106033152 | 126 |
| 224 | 3300026023 | Ga0207677_10059799 | Ga0207677_100597993 | 126 |
| 225 | 3300026023 | Ga0207677_11863667 | Ga0207677_118636671 | 126 |
| 226 | 3300026035 | Ga0207703_12382147 | Ga0207703_123821471 | 126 |
| 227 | 3300026041 | Ga0207639_10003894 | Ga0207639_100038943 | 126 |
| 228 | 3300026041 | Ga0207639_10099123 | Ga0207639_100991233 | 126 |
| 229 | 3300026041 | Ga0207639_11328620 | Ga0207639_113286202 | 126 |
| 230 | 3300026067 | Ga0207678_10007720 | Ga0207678_100077209 | 126 |
| 231 | 3300026067 | Ga0207678_10097072 | Ga0207678_100970721 | 126 |
| 232 | 3300026067 | Ga0207678_10356616 | Ga0207678_103566161 | 126 |
| 233 | 3300026067 | Ga0207678_10358063 | Ga0207678_103580632 | 126 |
| 234 | 3300026075 | Ga0207708_10500408 | Ga0207708_105004081 | 126 |
| 235 | 3300026075 | Ga0207708_10630723 | Ga0207708_106307232 | 126 |
| 236 | 3300026078 | Ga0207702_10101401 | Ga0207702_101014012 | 126 |
| 237 | 3300026078 | Ga0207702_10171000 | Ga0207702_101710002 | 126 |
| 238 | 3300026089 | Ga0207648_11044087 | Ga0207648_110440872 | 126 |
| 239 | 3300026095 | Ga0207676_10251174 | Ga0207676_102511743 | 126 |
| 240 | 3300026116 | Ga0207674_10630287 | Ga0207674_106302871 | 126 |
| 241 | 3300026116 | Ga0207674_11446027 | Ga0207674_114460272 | 126 |
| 242 | 3300026121 | Ga0207683_10309922 | Ga0207683_103099222 | 126 |
| 243 | 3300027296 | Ga0209389_1051273 | Ga0209389_10512732 | 126 |
| 244 | 3300027296 | Ga0209389_1078013 | Ga0209389_10780132 | 126 |
| 245 | 3300027361 | Ga0209489_117682 | Ga0209489_1176823 | 126 |
| 246 | 3300027361 | Ga0209489_121234 | Ga0209489_1212342 | 126 |
| 247 | 3300027363 | Ga0209700_100076 | Ga0209700_100076132 | 126 |
| 248 | 3300027671 | Ga0209588_1280291 | Ga0209588_12802911 | 126 |
| 249 | 3300027866 | Ga0209813_10153406 | Ga0209813_101534062 | 126 |
| 250 | 3300027907 | Ga0207428_11055287 | Ga0207428_110552871 | 126 |
| 251 | 3300028036 | Ga0265355_1012723 | Ga0265355_10127231 | 126 |
| 252 | 3300028379 | Ga0268266_10002070 | Ga0268266_100020707 | 126 |
| 253 | 3300028379 | Ga0268266_10082502 | Ga0268266_100825023 | 126 |
| 254 | 3300028379 | Ga0268266_10130867 | Ga0268266_101308672 | 126 |
| 255 | 3300028379 | Ga0268266_10131700 | Ga0268266_101317004 | 126 |
| 256 | 3300028379 | Ga0268266_11262825 | Ga0268266_112628251 | 126 |
| 257 | 3300028786 | Ga0307517_10041514 | Ga0307517_100415145 | 126 |
| 258 | 3300030521 | Ga0307511_10000148 | Ga0307511_1000014811 | 126 |
| 259 | 3300030521 | Ga0307511_10172502 | Ga0307511_101725022 | 126 |
| 260 | 3300030763 | Ga0265763_1019543 | Ga0265763_10195432 | 126 |
| 261 | 3300031235 | Ga0265330_10064136 | Ga0265330_100641361 | 126 |
| 262 | 3300031238 | Ga0265332_10041215 | Ga0265332_100412152 | 126 |
| 263 | 3300031238 | Ga0265332_10313682 | Ga0265332_103136822 | 126 |
| 264 | 3300031241 | Ga0265325_10066370 | Ga0265325_100663702 | 126 |
| 265 | 3300031242 | Ga0265329_10300479 | Ga0265329_103004791 | 126 |
| 266 | 3300031247 | Ga0265340_10013605 | Ga0265340_100136052 | 126 |
| 267 | 3300031249 | Ga0265339_10001462 | Ga0265339_100014624 | 126 |
| 268 | 3300031249 | Ga0265339_10012845 | Ga0265339_100128453 | 126 |
| 269 | 3300031250 | Ga0265331_10002616 | Ga0265331_1000261611 | 126 |
| 270 | 3300031250 | Ga0265331_10074139 | Ga0265331_100741392 | 126 |
| 271 | 3300031251 | Ga0265327_10075135 | Ga0265327_100751352 | 126 |
| 272 | 3300031344 | Ga0265316_10214893 | Ga0265316_102148931 | 126 |
| 273 | 3300031456 | Ga0307513_10004256 | Ga0307513_1000425616 | 126 |
| 274 | 3300031456 | Ga0307513_10048552 | Ga0307513_100485522 | 126 |
| 275 | 3300031507 | Ga0307509_10458295 | Ga0307509_104582951 | 126 |
| 276 | 3300031595 | Ga0265313_10000583 | Ga0265313_1000058324 | 126 |
| 277 | 3300031616 | Ga0307508_10086902 | Ga0307508_100869021 | 126 |
| 278 | 3300031711 | Ga0265314_10014316 | Ga0265314_100143166 | 126 |
| 279 | 3300031712 | Ga0265342_10078644 | Ga0265342_100786442 | 126 |
| 280 | 3300031712 | Ga0265342_10165583 | Ga0265342_101655832 | 126 |
| 281 | 3300031730 | Ga0307516_10054944 | Ga0307516_100549442 | 126 |
| 282 | 3300031730 | Ga0307516_10171992 | Ga0307516_101719923 | 126 |
| 283 | 3300033179 | Ga0307507_10236781 | Ga0307507_102367812 | 126 |
| 284 | 3300033179 | Ga0307507_10488078 | Ga0307507_104880782 | 126 |
| 285 | 3300035083 | Ga0373926_0067511 | Ga0373926_0067511_900_1280 | 126 |
| 286 | 3300035085 | Ga0373929_0102134 | Ga0373929_0102134_11_391 | 126 |
| 287 | 3300035086 | Ga0373934_0023429 | Ga0373934_0023429_631_1044 | 126 |
| 288 | 3300035086 | Ga0373934_0084325 | Ga0373934_0084325_146_532 | 126 |
| 289 | 3300035090 | Ga0373949_0048655 | Ga0373949_0048655_431_811 | 126 |
| 290 | 3300035090 | Ga0373949_0114430 | Ga0373949_0114430_38_418 | 126 |
| 291 | 3300035111 | Ga0373923_0051414 | Ga0373923_0051414_798_1211 | 126 |
| 292 | 3300035111 | Ga0373923_0601041 | Ga0373923_0601041_131_511 | 126 |
| 293 | 3300035113 | Ga0373936_0036045 | Ga0373936_0036045_661_1041 | 126 |
| 294 | 3300035113 | Ga0373936_0101381 | Ga0373936_0101381_606_986 | 126 |
| 295 | 3300035114 | Ga0373939_0162064 | Ga0373939_0162064_37_435 | 126 |
| 296 | 3300035115 | Ga0373941_0097064 | Ga0373941_0097064_65_463 | 126 |
| 297 | 3300035117 | Ga0373953_0068663 | Ga0373953_0068663_428_841 | 126 |
| 298 | 3300035118 | Ga0373954_0014990 | Ga0373954_0014990_1840_2253 | 126 |
| 299 | 3300035118 | Ga0373954_0144140 | Ga0373954_0144140_590_976 | 126 |
| 300 | 3300035119 | Ga0373956_0050116 | Ga0373956_0050116_259_645 | 126 |
| 301 | 3300035170 | Ga0373943_0125930 | Ga0373943_0125930_920_1300 | 126 |
| 302 | 3300035172 | Ga0373955_0096174 | Ga0373955_0096174_668_1081 | 126 |
| 303 | 3300035172 | Ga0373955_0123715 | Ga0373955_0123715_542_922 | 126 |
| 304 | 3300035241 | Ga0373961_0065203 | Ga0373961_0065203_467_853 | 126 |
| 305 | 3300035691 | Ga0373931_0283098 | Ga0373931_0283098_625_1005 | 126 |
| 306 | 3300035692 | Ga0373935_0013872 | Ga0373935_0013872_3013_3393 | 126 |
| 307 | 3300035692 | Ga0373935_0048611 | Ga0373935_0048611_1986_2372 | 126 |
| 308 | 3300035695 | Ga0373927_0021420 | Ga0373927_0021420_292_672 | 126 |
| 309 | 3300035695 | Ga0373927_0023687 | Ga0373927_0023687_3288_3674 | 126 |
| 310 | 3300035695 | Ga0373927_0073001 | Ga0373927_0073001_1691_2071 | 126 |
| 311 | 3300035724 | Ga0373933_0082380 | Ga0373933_0082380_666_1079 | 126 |
| 312 | 3300035724 | Ga0373933_1106047 | Ga0373933_1106047_18_398 | 126 |
| 313 | 3300035725 | Ga0373947_0025373 | Ga0373947_0025373_1358_1738 | 126 |
| 314 | 3300035725 | Ga0373947_0182802 | Ga0373947_0182802_941_1321 | 126 |
| 315 | 3300036401 | Ga0373937_0003392 | Ga0373937_0003392_11388_11801 | 126 |
| 316 | 3300036401 | Ga0373937_0132886 | Ga0373937_0132886_1887_2267 | 126 |
| 317 | 3300036401 | Ga0373937_0138148 | Ga0373937_0138148_859_1245 | 126 |
| 318 | 3300037068 | Ga0373925_0012799 | Ga0373925_0012799_784_1164 | 126 |
| 319 | 3300037068 | Ga0373925_0203417 | Ga0373925_0203417_1054_1434 | 126 |
| 320 | 3300037068 | Ga0373925_1047653 | Ga0373925_1047653_272_652 | 126 |
| 321 | 3300037068 | Ga0373925_1735717 | Ga0373925_1735717_62_448 | 126 |
| 322 | 3300037418 | Ga0395900_0411688 | Ga0395900_0411688_498_878 | 126 |
| 323 | 3300037418 | Ga0395900_0520808 | Ga0395900_0520808_555_935 | 126 |
| 324 | 3300037466 | Ga0395898_0050867 | Ga0395898_0050867_450_830 | 126 |
| 325 | 3300037471 | Ga0395905_1214853 | Ga0395905_1214853_143_523 | 126 |
| 326 | 3300037853 | Ga0436364_0421552 | Ga0436364_0421552_937_1317 | 126 |
| 327 | 3300038443 | Ga0395901_0150479 | Ga0395901_0150479_1958_2338 | 126 |
| 328 | 3300039437 | Ga0436365_0495621 | Ga0436365_0495621_973_1353 | 126 |
| 329 | 3300039437 | Ga0436365_0661874 | Ga0436365_0661874_1447_1827 | 126 |
| 330 | 3300039438 | Ga0436360_0224587 | Ga0436360_0224587_278_658 | 126 |
| 331 | 3300039438 | Ga0436360_0258132 | Ga0436360_0258132_158_538 | 126 |
| 332 | 3300039438 | Ga0436360_0296010 | Ga0436360_0296010_244_624 | 126 |
| 333 | 3300039438 | Ga0436360_0345518 | Ga0436360_0345518_2066_2446 | 126 |
| 334 | 3300039438 | Ga0436360_0381778 | Ga0436360_0381778_91_471 | 126 |
| 335 | 3300039438 | Ga0436360_0585422 | Ga0436360_0585422_4240_4620 | 126 |
| 336 | 3300039438 | Ga0436360_0598280 | Ga0436360_0598280_190_570 | 126 |
| 337 | 3300039447 | Ga0436361_0087582 | Ga0436361_0087582_96_476 | 126 |
| 338 | 3300039447 | Ga0436361_0296689 | Ga0436361_0296689_9043_9423 | 126 |
| 339 | 3300039447 | Ga0436361_0342673 | Ga0436361_0342673_436_816 | 126 |
| 340 | 3300039447 | Ga0436361_0604625 | Ga0436361_0604625_281_661 | 126 |
| 341 | 3300039447 | Ga0436361_0668430 | Ga0436361_0668430_1683_2075 | 126 |
| 342 | 3300039447 | Ga0436361_0804396 | Ga0436361_0804396_329_709 | 126 |
| 343 | 3300039447 | Ga0436361_0847865 | Ga0436361_0847865_1134_1514 | 126 |
| 344 | 3300039447 | Ga0436361_1108985 | Ga0436361_1108985_29_409 | 126 |
| 345 | 3300039450 | Ga0436363_0219861 | Ga0436363_0219861_1107_1490 | 126 |
| 346 | 3300039450 | Ga0436363_0637369 | Ga0436363_0637369_200_580 | 126 |
| 347 | 3300039450 | Ga0436363_1408653 | Ga0436363_1408653_96_476 | 126 |
| 348 | 3300039453 | Ga0436362_0005086 | Ga0436362_0005086_1828_2208 | 126 |
| 349 | 3300039453 | Ga0436362_0319983 | Ga0436362_0319983_292_705 | 126 |
| 350 | 3300039453 | Ga0436362_0362728 | Ga0436362_0362728_657_1049 | 126 |
| 351 | 3300039453 | Ga0436362_1207223 | Ga0436362_1207223_120_509 | 126 |
| 352 | 3300041459 | Ga0451800_0847615 | Ga0451800_0847615_100_480 | 126 |
| 353 | 3300044684 | Ga0466966_0601925 | Ga0466966_0601925_101_487 | 126 |
| 354 | 3300044693 | Ga0466961_0755586 | Ga0466961_0755586_50_430 | 126 |
| 355 | 3300044706 | Ga0466964_0108800 | Ga0466964_0108800_707_1087 | 126 |
| 356 | 3300044842 | Ga0466957_0321017 | Ga0466957_0321017_139_528 | 126 |
| 357 | 3300044842 | Ga0466957_0455272 | Ga0466957_0455272_383_763 | 126 |
| 358 | 3300045049 | Ga0466959_0376170 | Ga0466959_0376170_43_423 | 126 |
| 359 | 3300046454 | Ga0495592_0083966 | Ga0495592_0083966_1903_2283 | 126 |
| 360 | 3300046455 | Ga0495603_0002503 | Ga0495603_0002503_5852_6232 | 126 |
| 361 | 3300046455 | Ga0495603_0006600 | Ga0495603_0006600_1264_1644 | 126 |
| 362 | 3300046458 | Ga0495591_138148 | Ga0495591_138148_53_433 | 126 |
| 363 | 3300046459 | Ga0495629_0030209 | Ga0495629_0030209_1269_1649 | 126 |
| 364 | 3300046460 | Ga0495638_0005411 | Ga0495638_0005411_3030_3410 | 126 |
| 365 | 3300046460 | Ga0495638_0225485 | Ga0495638_0225485_390_770 | 126 |
| 366 | 3300046471 | Ga0495650_0000355 | Ga0495650_0000355_16010_16390 | 126 |
| 367 | 3300046472 | Ga0495580_0740428 | Ga0495580_0740428_68_448 | 126 |
| 368 | 3300046472 | Ga0495580_0805929 | Ga0495580_0805929_183_563 | 126 |
| 369 | 3300046473 | Ga0495582_0011384 | Ga0495582_0011384_1414_1794 | 126 |
| 370 | 3300046474 | Ga0495605_0091313 | Ga0495605_0091313_912_1292 | 126 |
| 371 | 3300046475 | Ga0495639_0009847 | Ga0495639_0009847_1287_1667 | 126 |
| 372 | 3300046476 | Ga0495662_0008018 | Ga0495662_0008018_1883_2263 | 126 |
| 373 | 3300046477 | Ga0495664_0094616 | Ga0495664_0094616_695_1075 | 126 |
| 374 | 3300046477 | Ga0495664_0789859 | Ga0495664_0789859_35_421 | 126 |
| 375 | 3300046491 | Ga0495584_0247677 | Ga0495584_0247677_204_584 | 126 |
| 376 | 3300046491 | Ga0495584_0258110 | Ga0495584_0258110_206_586 | 126 |
| 377 | 3300046492 | Ga0495585_0024474 | Ga0495585_0024474_647_1027 | 126 |
| 378 | 3300046492 | Ga0495585_0077455 | Ga0495585_0077455_1250_1630 | 126 |
| 379 | 3300046499 | Ga0495594_0036513 | Ga0495594_0036513_742_1122 | 126 |
| 380 | 3300046499 | Ga0495594_0556421 | Ga0495594_0556421_201_581 | 126 |
| 381 | 3300046501 | Ga0495607_0256155 | Ga0495607_0256155_443_823 | 126 |
| 382 | 3300046506 | Ga0495583_0000860 | Ga0495583_0000860_14004_14384 | 126 |
| 383 | 3300046507 | Ga0495606_0002012 | Ga0495606_0002012_12714_13094 | 126 |
| 384 | 3300046507 | Ga0495606_0425315 | Ga0495606_0425315_67_447 | 126 |
| 385 | 3300046511 | Ga0495608_0323159 | Ga0495608_0323159_319_732 | 126 |
| 386 | 3300046512 | Ga0495610_0000046 | Ga0495610_0000046_75775_76155 | 126 |
| 387 | 3300046512 | Ga0495610_0088455 | Ga0495610_0088455_530_910 | 126 |
| 388 | 3300046513 | Ga0495616_0034251 | Ga0495616_0034251_2145_2525 | 126 |
| 389 | 3300046517 | Ga0495630_0568131 | Ga0495630_0568131_231_611 | 126 |
| 390 | 3300046518 | Ga0495631_0368748 | Ga0495631_0368748_151_531 | 126 |
| 391 | 3300046519 | Ga0495632_0241145 | Ga0495632_0241145_71_451 | 126 |
| 392 | 3300046522 | Ga0495643_0180282 | Ga0495643_0180282_400_780 | 126 |
| 393 | 3300046524 | Ga0495648_0227930 | Ga0495648_0227930_62_442 | 126 |
| 394 | 3300046528 | Ga0495642_0511153 | Ga0495642_0511153_118_498 | 126 |
| 395 | 3300046535 | Ga0495586_0504586 | Ga0495586_0504586_281_661 | 126 |
| 396 | 3300046536 | Ga0495587_0750518 | Ga0495587_0750518_25_405 | 126 |
| 397 | 3300046538 | Ga0495609_0434599 | Ga0495609_0434599_61_441 | 126 |
| 398 | 3300046543 | Ga0495645_0402597 | Ga0495645_0402597_180_560 | 126 |
| 399 | 3300046557 | Ga0495622_0008204 | Ga0495622_0008204_2454_2834 | 126 |
| 400 | 3300046557 | Ga0495622_0064073 | Ga0495622_0064073_794_1174 | 126 |
| 401 | 3300046557 | Ga0495622_0206981 | Ga0495622_0206981_148_528 | 126 |
| 402 | 3300046559 | Ga0495667_0514958 | Ga0495667_0514958_127_513 | 126 |
| 403 | 3300046615 | Ga0495656_0273938 | Ga0495656_0273938_330_710 | 126 |
| 404 | 3300046615 | Ga0495656_0641431 | Ga0495656_0641431_167_553 | 126 |
| 405 | 3300046642 | Ga0495634_0003625 | Ga0495634_0003625_10174_10554 | 126 |
| 406 | 3300046648 | Ga0495611_0015617 | Ga0495611_0015617_2382_2762 | 126 |
| 407 | 3300046660 | Ga0495625_0002001 | Ga0495625_0002001_8451_8831 | 126 |
| 408 | 3300046660 | Ga0495625_0003868 | Ga0495625_0003868_6794_7174 | 126 |
| 409 | 3300046660 | Ga0495625_0412012 | Ga0495625_0412012_280_660 | 126 |
| 410 | 3300046663 | Ga0495635_0027099 | Ga0495635_0027099_1198_1578 | 126 |
| 411 | 3300046664 | Ga0495659_0047279 | Ga0495659_0047279_487_867 | 126 |
| 412 | 3300046664 | Ga0495659_0305178 | Ga0495659_0305178_88_474 | 126 |
| 413 | 3300046665 | Ga0495661_0052708 | Ga0495661_0052708_1302_1682 | 126 |
| 414 | 3300046665 | Ga0495661_0202973 | Ga0495661_0202973_38_418 | 126 |
| 415 | 3300046674 | Ga0495588_0362994 | Ga0495588_0362994_350_730 | 126 |
| 416 | 3300046678 | Ga0495599_0051525 | Ga0495599_0051525_789_1169 | 126 |
| 417 | 3300046683 | Ga0495658_0013061 | Ga0495658_0013061_2017_2397 | 126 |
| 418 | 3300046683 | Ga0495658_0611472 | Ga0495658_0611472_17_403 | 126 |
| 419 | 3300046684 | Ga0495669_0419224 | Ga0495669_0419224_234_614 | 126 |
| 420 | 3300046684 | Ga0495669_0572051 | Ga0495669_0572051_59_439 | 126 |
| 421 | 3300046689 | Ga0495613_0128811 | Ga0495613_0128811_519_899 | 126 |
| 422 | 3300046690 | Ga0495624_0546806 | Ga0495624_0546806_29_409 | 126 |
| 423 | 3300046691 | Ga0495670_0137564 | Ga0495670_0137564_163_543 | 126 |
| 424 | 3300046692 | Ga0495671_0327303 | Ga0495671_0327303_261_641 | 126 |
| 425 | 3300046694 | Ga0495649_0487914 | Ga0495649_0487914_156_536 | 126 |
| 426 | 3300046809 | Ga0495600_0080018 | Ga0495600_0080018_375_755 | 126 |
| 427 | 3300046810 | Ga0495660_0219558 | Ga0495660_0219558_11_391 | 126 |
| 428 | 3300047315 | Ga0495581_0029494 | Ga0495581_0029494_201_581 | 126 |
| 429 | 3300047315 | Ga0495581_0078265 | Ga0495581_0078265_1145_1525 | 126 |
| 430 | 3300047315 | Ga0495581_0167543 | Ga0495581_0167543_648_1028 | 126 |
| 431 | 3300047318 | Ga0495636_0330677 | Ga0495636_0330677_61_441 | 126 |
| 432 | 3300047319 | Ga0495674_0003237 | Ga0495674_0003237_14801_15181 | 126 |
| 433 | 3300047319 | Ga0495674_0308030 | Ga0495674_0308030_385_765 | 126 |
| 434 | 3300047320 | Ga0495672_0022103 | Ga0495672_0022103_3530_3910 | 126 |
| 435 | 3300047320 | Ga0495672_0175037 | Ga0495672_0175037_620_1042 | 126 |
| 436 | 3300047321 | Ga0495676_0058942 | Ga0495676_0058942_1636_2016 | 126 |
| 437 | 3300047322 | Ga0495680_0049034 | Ga0495680_0049034_887_1267 | 126 |
| 438 | 3300047322 | Ga0495680_0171650 | Ga0495680_0171650_562_975 | 126 |
| 439 | 3300047322 | Ga0495680_0691698 | Ga0495680_0691698_60_446 | 126 |
| 440 | 3300047443 | Ga0495687_094340 | Ga0495687_094340_397_777 | 126 |
| 441 | 3300047446 | Ga0495679_055317 | Ga0495679_055317_364_744 | 126 |
| 442 | 3300047472 | Ga0495686_0065896 | Ga0495686_0065896_16_396 | 126 |
| 443 | 3300047472 | Ga0495686_0078676 | Ga0495686_0078676_579_959 | 126 |
| 444 | 3300047673 | Ga0495593_0049789 | Ga0495593_0049789_1167_1547 | 126 |
| 445 | 3300048089 | Ga0495614_0293972 | Ga0495614_0293972_118_498 | 126 |
| 446 | 3300048905 | Ga0496102_0199742 | Ga0496102_0199742_533_913 | 126 |
| 447 | 3300048906 | Ga0496103_0386729 | Ga0496103_0386729_280_660 | 126 |
| 448 | 3300048907 | Ga0496104_0009149 | Ga0496104_0009149_3707_4087 | 126 |
| 449 | 3300048907 | Ga0496104_0472172 | Ga0496104_0472172_281_697 | 126 |
| 450 | 3300048907 | Ga0496104_0724024 | Ga0496104_0724024_409_789 | 126 |
| 451 | 3300048907 | Ga0496104_1162056 | Ga0496104_1162056_129_557 | 126 |
| 452 | 3300048908 | Ga0496105_0313314 | Ga0496105_0313314_555_935 | 126 |
| 453 | 3300048908 | Ga0496105_0358109 | Ga0496105_0358109_82_498 | 126 |
| 454 | 3300048908 | Ga0496105_0510513 | Ga0496105_0510513_145_525 | 126 |
| 455 | 3300048909 | Ga0496106_0239048 | Ga0496106_0239048_318_698 | 126 |
| 456 | 3300048909 | Ga0496106_1029765 | Ga0496106_1029765_170_550 | 126 |
| 457 | 3300048909 | Ga0496106_1351669 | Ga0496106_1351669_17_397 | 126 |
| 458 | 3300048910 | Ga0496107_0239301 | Ga0496107_0239301_564_980 | 126 |
| 459 | 3300048913 | Ga0496110_0710232 | Ga0496110_0710232_200_580 | 126 |
| 460 | 3300048913 | Ga0496110_1517044 | Ga0496110_1517044_136_552 | 126 |
| 461 | 3300048915 | Ga0496112_0189687 | Ga0496112_0189687_1401_1781 | 126 |
| 462 | 3300048915 | Ga0496112_0271088 | Ga0496112_0271088_423_821 | 126 |
| 463 | 3300048917 | Ga0496114_0122384 | Ga0496114_0122384_356_736 | 126 |
| 464 | 3300048918 | Ga0496115_0037022 | Ga0496115_0037022_161_589 | 126 |
| 465 | 3300048918 | Ga0496115_0135661 | Ga0496115_0135661_847_1227 | 126 |
| 466 | 3300048922 | Ga0496119_0052413 | Ga0496119_0052413_1304_1684 | 126 |
| 467 | 3300048922 | Ga0496119_0372718 | Ga0496119_0372718_91_471 | 126 |
| 468 | 3300048923 | Ga0496120_0009305 | Ga0496120_0009305_4570_4950 | 126 |
| 469 | 3300048924 | Ga0496121_0035770 | Ga0496121_0035770_1306_1692 | 126 |
| 470 | 3300048925 | Ga0496122_0035348 | Ga0496122_0035348_3489_3869 | 126 |
| 471 | 3300048926 | Ga0496123_0194984 | Ga0496123_0194984_457_837 | 126 |
| 472 | 3300048929 | Ga0496126_0095968 | Ga0496126_0095968_1405_1791 | 126 |
| 473 | 3300049743 | Ga0501081_1282330 | Ga0501081_1282330_126_506 | 126 |
| 474 | 3300050489 | nmdc:mga03683_126565_c1 | nmdc:mga03683_126565_c1_394_774 | 126 |
| 475 | 3300050489 | nmdc:mga03683_15367_c1 | nmdc:mga03683_15367_c1_1107_1487 | 126 |
| 476 | 3300050489 | nmdc:mga03683_584935_c1 | nmdc:mga03683_584935_c1_124_504 | 126 |
| 477 | 3300050490 | nmdc:mga03n38_1541_c1 | nmdc:mga03n38_1541_c1_2778_3158 | 126 |
| 478 | 3300050492 | nmdc:mga0yw44_42352_c1 | nmdc:mga0yw44_42352_c1_521_901 | 126 |
| 479 | 3300050492 | nmdc:mga0yw44_819073_c1 | nmdc:mga0yw44_819073_c1_30_410 | 126 |
| 480 | 3300050493 | nmdc:mga0k408_343868_c1 | nmdc:mga0k408_343868_c1_391_771 | 126 |
| 481 | 3300050493 | nmdc:mga0k408_779109_c1 | nmdc:mga0k408_779109_c1_137_535 | 126 |
| 482 | 3300050494 | nmdc:mga06z11_3997_c1 | nmdc:mga06z11_3997_c1_4146_4526 | 126 |
| 483 | 3300050494 | nmdc:mga06z11_81847_c1 | nmdc:mga06z11_81847_c1_555_935 | 126 |
| 484 | 3300050495 | nmdc:mga04h51_30851_c1 | nmdc:mga04h51_30851_c1_599_979 | 126 |
| 485 | 3300050496 | nmdc:mga07m45_155860_c1 | nmdc:mga07m45_155860_c1_109_489 | 126 |
| 486 | 3300050496 | nmdc:mga07m45_32518_c1 | nmdc:mga07m45_32518_c1_1558_1938 | 126 |
| 487 | 3300050511 | nmdc:mga08y16_46383_c1 | nmdc:mga08y16_46383_c1_1153_1533 | 126 |
| 488 | 3300050514 | nmdc:mga08x19_367095_c1 | nmdc:mga08x19_367095_c1_257_655 | 126 |
| 489 | 3300050516 | nmdc:mga0sz30_733_c1 | nmdc:mga0sz30_733_c1_194_574 | 126 |
| 490 | 3300053077 | Ga0495601_0019698 | Ga0495601_0019698_27_407 | 126 |
| 491 | 3300053079 | Ga0500610_0244192 | Ga0500610_0244192_427_807 | 126 |
| 492 | 3300053080 | Ga0500635_0447727 | Ga0500635_0447727_117_497 | 126 |
| 493 | 3300053084 | Ga0495595_0742319 | Ga0495595_0742319_93_473 | 126 |
| 494 | 3300053085 | Ga0495619_0069411 | Ga0495619_0069411_542_955 | 126 |
| 495 | 3300053086 | Ga0500578_0120669 | Ga0500578_0120669_246_626 | 126 |
| 496 | 3300053090 | Ga0500646_0048118 | Ga0500646_0048118_18_398 | 126 |
| 497 | 3300053091 | Ga0500647_0083802 | Ga0500647_0083802_688_1068 | 126 |
| 498 | 3300053092 | Ga0500583_0041923 | Ga0500583_0041923_398_778 | 126 |
| 499 | 3300053093 | Ga0500651_0034151 | Ga0500651_0034151_2325_2705 | 126 |
| 500 | 3300053096 | Ga0500641_0018361 | Ga0500641_0018361_1993_2373 | 126 |
| 501 | 3300053097 | Ga0500648_126568 | Ga0500648_126568_993_1379 | 126 |
| 502 | 3300053098 | Ga0500650_0108864 | Ga0500650_0108864_482_862 | 126 |
| 503 | 3300053106 | Ga0500558_160209 | Ga0500558_160209_350_736 | 126 |
| 504 | 3300053119 | Ga0500595_006423 | Ga0500595_006423_2627_3007 | 126 |
| 505 | 3300053119 | Ga0500595_013300 | Ga0500595_013300_1844_2224 | 126 |
| 506 | 3300053125 | Ga0500618_000305 | Ga0500618_000305_25503_25883 | 126 |
| 507 | 3300053130 | Ga0500642_0046365 | Ga0500642_0046365_1242_1622 | 126 |
| 508 | 3300053134 | Ga0500658_0007684 | Ga0500658_0007684_1521_1901 | 126 |
| 509 | 3300053134 | Ga0500658_0025292 | Ga0500658_0025292_510_890 | 126 |
| 510 | 3300053136 | Ga0500559_0288282 | Ga0500559_0288282_51_437 | 126 |
| 511 | 3300053136 | Ga0500559_0334112 | Ga0500559_0334112_232_618 | 126 |
| 512 | 3300053138 | Ga0500564_169848 | Ga0500564_169848_431_811 | 126 |
| 513 | 3300053140 | Ga0500573_0112042 | Ga0500573_0112042_691_1077 | 126 |
| 514 | 3300053145 | Ga0500586_001048 | Ga0500586_001048_896_1276 | 126 |
| 515 | 3300053148 | Ga0500590_137221 | Ga0500590_137221_339_725 | 126 |
| 516 | 3300053151 | Ga0500604_0113185 | Ga0500604_0113185_166_546 | 126 |
| 517 | 3300053153 | Ga0500616_0003127 | Ga0500616_0003127_8633_9013 | 126 |
| 518 | 3300053153 | Ga0500616_0049753 | Ga0500616_0049753_1560_1940 | 126 |
| 519 | 3300053154 | Ga0500619_130648 | Ga0500619_130648_238_624 | 126 |
| 520 | 3300053161 | Ga0500634_0106664 | Ga0500634_0106664_589_969 | 126 |
| 521 | 3300053177 | Ga0500636_0000273 | Ga0500636_0000273_6002_6382 | 126 |
| 522 | 3300053177 | Ga0500636_0032576 | Ga0500636_0032576_1944_2330 | 126 |
| 523 | 3300053177 | Ga0500636_0050413 | Ga0500636_0050413_1044_1430 | 126 |
| 524 | 3300053178 | Ga0500637_0195046 | Ga0500637_0195046_737_1123 | 126 |
| 525 | 3300053729 | Ga0500625_000140 | Ga0500625_000140_10703_11083 | 126 |
| 526 | 3300053730 | Ga0500645_001069 | Ga0500645_001069_8183_8563 | 126 |
| 527 | 3300053730 | Ga0500645_013746 | Ga0500645_013746_1710_2090 | 126 |
| 528 | 3300053730 | Ga0500645_069265 | Ga0500645_069265_268_648 | 126 |
| 529 | 3300053735 | Ga0500596_000035 | Ga0500596_000035_3881_4261 | 126 |
| 530 | 3300053735 | Ga0500596_000586 | Ga0500596_000586_1771_2157 | 126 |
| 531 | 3300055283 | Ga0500661_008429 | Ga0500661_008429_883_1263 | 126 |
| 532 | iso_pu_bacteria | 2888419890 | 2888424985 | 126 |
| 533 | iso_pu_bacteria | 2922361189 | 2922362761 | 126 |
| 534 | 3300001990 | JGI24737J22298_10097201 | JGI24737J22298_100972011 | 127 |
| 535 | 3300003659 | JGI25404J52841_10022631 | JGI25404J52841_100226311 | 127 |
| 536 | 3300005327 | Ga0070658_10998829 | Ga0070658_109988291 | 127 |
| 537 | 3300005328 | Ga0070676_10038116 | Ga0070676_100381161 | 127 |
| 538 | 3300005328 | Ga0070676_10441965 | Ga0070676_104419651 | 127 |
| 539 | 3300005331 | Ga0070670_100222100 | Ga0070670_1002221001 | 127 |
| 540 | 3300005338 | Ga0068868_100190280 | Ga0068868_1001902802 | 127 |
| 541 | 3300005344 | Ga0070661_100149347 | Ga0070661_1001493472 | 127 |
| 542 | 3300005347 | Ga0070668_100051916 | Ga0070668_1000519163 | 127 |
| 543 | 3300005355 | Ga0070671_100157423 | Ga0070671_1001574231 | 127 |
| 544 | 3300005366 | Ga0070659_100637824 | Ga0070659_1006378241 | 127 |
| 545 | 3300005406 | Ga0070703_10049713 | Ga0070703_100497132 | 127 |
| 546 | 3300005435 | Ga0070714_100023528 | Ga0070714_1000235282 | 127 |
| 547 | 3300005436 | Ga0070713_100103250 | Ga0070713_1001032502 | 127 |
| 548 | 3300005436 | Ga0070713_100333438 | Ga0070713_1003334382 | 127 |
| 549 | 3300005441 | Ga0070700_100369672 | Ga0070700_1003696722 | 127 |
| 550 | 3300005444 | Ga0070694_100309001 | Ga0070694_1003090012 | 127 |
| 551 | 3300005455 | Ga0070663_100232418 | Ga0070663_1002324182 | 127 |
| 552 | 3300005456 | Ga0070678_100015000 | Ga0070678_1000150002 | 127 |
| 553 | 3300005457 | Ga0070662_100225935 | Ga0070662_1002259352 | 127 |
| 554 | 3300005471 | Ga0070698_100263292 | Ga0070698_1002632922 | 127 |
| 555 | 3300005539 | Ga0068853_100267736 | Ga0068853_1002677362 | 127 |
| 556 | 3300005563 | Ga0068855_100030970 | Ga0068855_1000309703 | 127 |
| 557 | 3300005614 | Ga0068856_102124311 | Ga0068856_1021243111 | 127 |
| 558 | 3300005615 | Ga0070702_100277779 | Ga0070702_1002777792 | 127 |
| 559 | 3300005617 | Ga0068859_100653386 | Ga0068859_1006533862 | 127 |
| 560 | 3300005618 | Ga0068864_100405846 | Ga0068864_1004058462 | 127 |
| 561 | 3300005719 | Ga0068861_100257786 | Ga0068861_1002577862 | 127 |
| 562 | 3300005840 | Ga0068870_10478712 | Ga0068870_104787121 | 127 |
| 563 | 3300005842 | Ga0068858_100166815 | Ga0068858_1001668152 | 127 |
| 564 | 3300005842 | Ga0068858_100852709 | Ga0068858_1008527092 | 127 |
| 565 | 3300005843 | Ga0068860_100172976 | Ga0068860_1001729762 | 127 |
| 566 | 3300005983 | Ga0081540_1021860 | Ga0081540_10218605 | 127 |
| 567 | 3300005983 | Ga0081540_1036990 | Ga0081540_10369902 | 127 |
| 568 | 3300006028 | Ga0070717_10044494 | Ga0070717_100444943 | 127 |
| 569 | 3300006028 | Ga0070717_10190210 | Ga0070717_101902102 | 127 |
| 570 | 3300006042 | Ga0075368_10021264 | Ga0075368_100212642 | 127 |
| 571 | 3300006048 | Ga0075363_100293967 | Ga0075363_1002939671 | 127 |
| 572 | 3300006051 | Ga0075364_10135749 | Ga0075364_101357492 | 127 |
| 573 | 3300006173 | Ga0070716_100560142 | Ga0070716_1005601422 | 127 |
| 574 | 3300006186 | Ga0075369_10038126 | Ga0075369_100381261 | 127 |
| 575 | 3300006186 | Ga0075369_10592383 | Ga0075369_105923831 | 127 |
| 576 | 3300006237 | Ga0097621_100086763 | Ga0097621_1000867632 | 127 |
| 577 | 3300006353 | Ga0075370_10092306 | Ga0075370_100923061 | 127 |
| 578 | 3300006358 | Ga0068871_100039246 | Ga0068871_1000392464 | 127 |
| 579 | 3300006844 | Ga0075428_100261173 | Ga0075428_1002611733 | 127 |
| 580 | 3300006852 | Ga0075433_10911523 | Ga0075433_109115232 | 127 |
| 581 | 3300006881 | Ga0068865_100397117 | Ga0068865_1003971171 | 127 |
| 582 | 3300006931 | Ga0097620_100653378 | Ga0097620_1006533782 | 127 |
| 583 | 3300007265 | Ga0099794_10044503 | Ga0099794_100445032 | 127 |
| 584 | 3300009176 | Ga0105242_10071280 | Ga0105242_100712802 | 127 |
| 585 | 3300009176 | Ga0105242_10375559 | Ga0105242_103755592 | 127 |
| 586 | 3300009177 | Ga0105248_10248346 | Ga0105248_102483462 | 127 |
| 587 | 3300009545 | Ga0105237_10097347 | Ga0105237_100973472 | 127 |
| 588 | 3300010159 | Ga0099796_10104805 | Ga0099796_101048051 | 127 |
| 589 | 3300011119 | Ga0105246_10076924 | Ga0105246_100769242 | 127 |
| 590 | 3300013296 | Ga0157374_11012590 | Ga0157374_110125902 | 127 |
| 591 | 3300013306 | Ga0163162_10128117 | Ga0163162_101281172 | 127 |
| 592 | 3300013306 | Ga0163162_10446526 | Ga0163162_104465262 | 127 |
| 593 | 3300013308 | Ga0157375_11591755 | Ga0157375_115917551 | 127 |
| 594 | 3300014325 | Ga0163163_10134185 | Ga0163163_101341853 | 127 |
| 595 | 3300014326 | Ga0157380_11812180 | Ga0157380_118121802 | 127 |
| 596 | 3300014968 | Ga0157379_10147368 | Ga0157379_101473682 | 127 |
| 597 | 3300014969 | Ga0157376_10109163 | Ga0157376_101091632 | 127 |
| 598 | 3300025297 | Ga0209758_1004362 | Ga0209758_10043629 | 127 |
| 599 | 3300025885 | Ga0207653_10168951 | Ga0207653_101689511 | 127 |
| 600 | 3300025901 | Ga0207688_10072928 | Ga0207688_100729281 | 127 |
| 601 | 3300025906 | Ga0207699_10277842 | Ga0207699_102778421 | 127 |
| 602 | 3300025908 | Ga0207643_10353632 | Ga0207643_103536322 | 127 |
| 603 | 3300025914 | Ga0207671_10388131 | Ga0207671_103881312 | 127 |
| 604 | 3300025920 | Ga0207649_10315616 | Ga0207649_103156162 | 127 |
| 605 | 3300025922 | Ga0207646_10956437 | Ga0207646_109564371 | 127 |
| 606 | 3300025925 | Ga0207650_10413512 | Ga0207650_104135122 | 127 |
| 607 | 3300025927 | Ga0207687_10024453 | Ga0207687_100244532 | 127 |
| 608 | 3300025928 | Ga0207700_10021355 | Ga0207700_100213554 | 127 |
| 609 | 3300025929 | Ga0207664_10023209 | Ga0207664_100232093 | 127 |
| 610 | 3300025931 | Ga0207644_10996155 | Ga0207644_109961551 | 127 |
| 611 | 3300025934 | Ga0207686_10221104 | Ga0207686_102211042 | 127 |
| 612 | 3300025938 | Ga0207704_10111523 | Ga0207704_101115232 | 127 |
| 613 | 3300025942 | Ga0207689_10081554 | Ga0207689_100815543 | 127 |
| 614 | 3300025949 | Ga0207667_10179957 | Ga0207667_101799571 | 127 |
| 615 | 3300025972 | Ga0207668_10102188 | Ga0207668_101021883 | 127 |
| 616 | 3300026023 | Ga0207677_10005949 | Ga0207677_100059493 | 127 |
| 617 | 3300026035 | Ga0207703_10185478 | Ga0207703_101854782 | 127 |
| 618 | 3300026041 | Ga0207639_10168708 | Ga0207639_101687083 | 127 |
| 619 | 3300026067 | Ga0207678_10083544 | Ga0207678_100835443 | 127 |
| 620 | 3300026095 | Ga0207676_11089961 | Ga0207676_110899612 | 127 |
| 621 | 3300026118 | Ga0207675_100202011 | Ga0207675_1002020112 | 127 |
| 622 | 3300026121 | Ga0207683_10084312 | Ga0207683_100843122 | 127 |
| 623 | 3300026142 | Ga0207698_12658993 | Ga0207698_126589931 | 127 |
| 624 | 3300027671 | Ga0209588_1020041 | Ga0209588_10200412 | 127 |
| 625 | 3300028379 | Ga0268266_10061049 | Ga0268266_100610493 | 127 |
| 626 | 3300031616 | Ga0307508_10314881 | Ga0307508_103148812 | 127 |
| 627 | 3300031730 | Ga0307516_10181888 | Ga0307516_101818884 | 127 |
| 628 | 3300037853 | Ga0436364_0139836 | Ga0436364_0139836_182_565 | 127 |
| 629 | 3300039437 | Ga0436365_0642772 | Ga0436365_0642772_182_565 | 127 |
| 630 | 3300039438 | Ga0436360_0569747 | Ga0436360_0569747_42_428 | 127 |
| 631 | 3300039453 | Ga0436362_0066045 | Ga0436362_0066045_223_624 | 127 |
| 632 | 3300046463 | Ga0495653_0452446 | Ga0495653_0452446_152_553 | 127 |
| 633 | 3300046476 | Ga0495662_0102251 | Ga0495662_0102251_759_1160 | 127 |
| 634 | 3300046535 | Ga0495586_0601618 | Ga0495586_0601618_212_613 | 127 |
| 635 | 3300046559 | Ga0495667_0678854 | Ga0495667_0678854_40_441 | 127 |
| 636 | 3300048905 | Ga0496102_0308541 | Ga0496102_0308541_764_1147 | 127 |
| 637 | 3300048909 | Ga0496106_0106603 | Ga0496106_0106603_1248_1631 | 127 |
| 638 | 3300048910 | Ga0496107_0569503 | Ga0496107_0569503_372_755 | 127 |
| 639 | 3300048911 | Ga0496108_0070354 | Ga0496108_0070354_762_1145 | 127 |
| 640 | 3300048913 | Ga0496110_1479031 | Ga0496110_1479031_147_530 | 127 |
| 641 | 3300048915 | Ga0496112_0382439 | Ga0496112_0382439_14_397 | 127 |
| 642 | 3300048916 | Ga0496113_0325105 | Ga0496113_0325105_267_650 | 127 |
| 643 | 3300048918 | Ga0496115_0538292 | Ga0496115_0538292_103_486 | 127 |
| 644 | 3300048921 | Ga0496118_0271514 | Ga0496118_0271514_204_587 | 127 |
| 645 | 3300048928 | Ga0496125_0217409 | Ga0496125_0217409_487_870 | 127 |
| 646 | 3300049585 | Ga0501069_0365292 | Ga0501069_0365292_145_528 | 127 |
| 647 | 3300050490 | nmdc:mga03n38_147669_c1 | nmdc:mga03n38_147669_c1_713_1096 | 127 |
| 648 | 3300050490 | nmdc:mga03n38_431591_c1 | nmdc:mga03n38_431591_c1_188_571 | 127 |
| 649 | 3300050491 | nmdc:mga00v17_35686_c1 | nmdc:mga00v17_35686_c1_1673_2056 | 127 |
| 650 | 3300050493 | nmdc:mga0k408_684241_c1 | nmdc:mga0k408_684241_c1_114_497 | 127 |
| 651 | 3300050493 | nmdc:mga0k408_72131_c1 | nmdc:mga0k408_72131_c1_51_434 | 127 |
| 652 | 3300050495 | nmdc:mga04h51_313695_c1 | nmdc:mga04h51_313695_c1_183_566 | 127 |
| 653 | 3300050507 | nmdc:mga05p37_1566364_c1 | nmdc:mga05p37_1566364_c1_73_474 | 127 |
| 654 | 3300050512 | nmdc:mga0n895_189567_c1 | nmdc:mga0n895_189567_c1_1086_1469 | 127 |
| 655 | 3300050513 | nmdc:mga0rr50_321511_c1 | nmdc:mga0rr50_321511_c1_309_692 | 127 |
| 656 | 3300050514 | nmdc:mga08x19_928918_c1 | nmdc:mga08x19_928918_c1_104_487 | 127 |
| 657 | 3300050516 | nmdc:mga0sz30_25501_c1 | nmdc:mga0sz30_25501_c1_1381_1764 | 127 |
| 658 | 3300053083 | Ga0495655_0228027 | Ga0495655_0228027_197_580 | 127 |
| 659 | 3300003659 | JGI25404J52841_10114191 | JGI25404J52841_101141911 | 128 |
| 660 | 3300005329 | Ga0070683_100058699 | Ga0070683_1000586993 | 128 |
| 661 | 3300005458 | Ga0070681_10092772 | Ga0070681_100927723 | 128 |
| 662 | 3300005539 | Ga0068853_100343778 | Ga0068853_1003437782 | 128 |
| 663 | 3300005617 | Ga0068859_102301750 | Ga0068859_1023017501 | 128 |
| 664 | 3300005983 | Ga0081540_1005695 | Ga0081540_100569512 | 128 |
| 665 | 3300005983 | Ga0081540_1011062 | Ga0081540_10110625 | 128 |
| 666 | 3300005983 | Ga0081540_1207613 | Ga0081540_12076131 | 128 |
| 667 | 3300006931 | Ga0097620_102302830 | Ga0097620_1023028301 | 128 |
| 668 | 3300009177 | Ga0105248_12120140 | Ga0105248_121201401 | 128 |
| 669 | 3300009545 | Ga0105237_10179726 | Ga0105237_101797263 | 128 |
| 670 | 3300014325 | Ga0163163_10901598 | Ga0163163_109015982 | 128 |
| 671 | 3300025297 | Ga0209758_1067827 | Ga0209758_10678272 | 128 |
| 672 | 3300025912 | Ga0207707_10090754 | Ga0207707_100907543 | 128 |
| 673 | 3300025913 | Ga0207695_11399725 | Ga0207695_113997251 | 128 |
| 674 | 3300025914 | Ga0207671_10076274 | Ga0207671_100762743 | 128 |
| 675 | 3300026041 | Ga0207639_10072338 | Ga0207639_100723381 | 128 |
| 676 | 3300030760 | Ga0265762_1032188 | Ga0265762_10321882 | 128 |
| 677 | 3300031730 | Ga0307516_10861546 | Ga0307516_108615461 | 128 |
| 678 | 3300044735 | Ga0466968_0048494 | Ga0466968_0048494_999_1397 | 128 |
| 679 | 3300044842 | Ga0466957_1194667 | Ga0466957_1194667_48_434 | 128 |
| 680 | 3300045836 | Ga0466958_0586812 | Ga0466958_0586812_314_700 | 128 |
| 681 | 3300048924 | Ga0496121_0231125 | Ga0496121_0231125_696_1082 | 128 |
| 682 | 3300048929 | Ga0496126_0929826 | Ga0496126_0929826_37_423 | 128 |
| 683 | 3300005548 | Ga0070665_100325675 | Ga0070665_1003256752 | 129 |
| 684 | 3300005548 | Ga0070665_100674530 | Ga0070665_1006745302 | 129 |
| 685 | 3300005563 | Ga0068855_101039975 | Ga0068855_1010399752 | 129 |
| 686 | 3300005937 | Ga0081455_10009004 | Ga0081455_100090044 | 129 |
| 687 | 3300006038 | Ga0075365_10030954 | Ga0075365_100309543 | 129 |
| 688 | 3300006038 | Ga0075365_10031232 | Ga0075365_100312322 | 129 |
| 689 | 3300006048 | Ga0075363_100223520 | Ga0075363_1002235202 | 129 |
| 690 | 3300006051 | Ga0075364_11017455 | Ga0075364_110174551 | 129 |
| 691 | 3300006177 | Ga0075362_10091762 | Ga0075362_100917622 | 129 |
| 692 | 3300006353 | Ga0075370_10568578 | Ga0075370_105685781 | 129 |
| 693 | 3300006844 | Ga0075428_100262480 | Ga0075428_1002624803 | 129 |
| 694 | 3300006846 | Ga0075430_100148246 | Ga0075430_1001482463 | 129 |
| 695 | 3300006847 | Ga0075431_100250536 | Ga0075431_1002505361 | 129 |
| 696 | 3300009093 | Ga0105240_12388768 | Ga0105240_123887681 | 129 |
| 697 | 3300014325 | Ga0163163_11785563 | Ga0163163_117855632 | 129 |
| 698 | 3300014968 | Ga0157379_10199130 | Ga0157379_101991302 | 129 |
| 699 | 3300025972 | Ga0207668_10048038 | Ga0207668_100480381 | 129 |
| 700 | 3300025972 | Ga0207668_10485949 | Ga0207668_104859492 | 129 |
| 701 | 3300025986 | Ga0207658_11895337 | Ga0207658_118953372 | 129 |
| 702 | 3300028380 | Ga0268265_10403542 | Ga0268265_104035422 | 129 |
| 703 | 3300031456 | Ga0307513_11049351 | Ga0307513_110493511 | 129 |
| 704 | 3300046474 | Ga0495605_0232081 | Ga0495605_0232081_233_622 | 129 |
| 705 | 3300046616 | Ga0495668_0107162 | Ga0495668_0107162_563_952 | 129 |
| 706 | 3300046665 | Ga0495661_0556709 | Ga0495661_0556709_98_487 | 129 |
| 707 | 3300050489 | nmdc:mga03683_395739_c1 | nmdc:mga03683_395739_c1_207_596 | 129 |
| 708 | 3300050490 | nmdc:mga03n38_246069_c1 | nmdc:mga03n38_246069_c1_340_747 | 129 |
| 709 | 3300050492 | nmdc:mga0yw44_131781_c1 | nmdc:mga0yw44_131781_c1_958_1365 | 129 |
| 710 | 3300050492 | nmdc:mga0yw44_18644_c1 | nmdc:mga0yw44_18644_c1_1741_2130 | 129 |
| 711 | 3300050492 | nmdc:mga0yw44_933868_c1 | nmdc:mga0yw44_933868_c1_149_538 | 129 |
| 712 | 3300050496 | nmdc:mga07m45_65227_c1 | nmdc:mga07m45_65227_c1_1002_1409 | 129 |
| 713 | 3300050509 | nmdc:mga0qj67_273638_c1 | nmdc:mga0qj67_273638_c1_138_527 | 129 |
| 714 | 3300053092 | Ga0500583_0003828 | Ga0500583_0003828_2202_2591 | 129 |
| 715 | 3300053094 | Ga0500566_0003135 | Ga0500566_0003135_2095_2484 | 129 |
| 716 | 3300053102 | Ga0500554_091662 | Ga0500554_091662_270_659 | 129 |
| 717 | 3300053119 | Ga0500595_000363 | Ga0500595_000363_13323_13712 | 129 |
| 718 | 3300053122 | Ga0500608_202165 | Ga0500608_202165_47_436 | 129 |
| 719 | 3300053162 | Ga0500638_002245 | Ga0500638_002245_1281_1670 | 129 |
| 720 | 3300053178 | Ga0500637_0000391 | Ga0500637_0000391_8602_8991 | 129 |
| 721 | 3300055283 | Ga0500661_001163 | Ga0500661_001163_1911_2300 | 129 |
| 722 | 3300005341 | Ga0070691_10211391 | Ga0070691_102113911 | 130 |
| 723 | 3300005456 | Ga0070678_101355815 | Ga0070678_1013558151 | 130 |
| 724 | 3300005518 | Ga0070699_100168274 | Ga0070699_1001682742 | 130 |
| 725 | 3300005547 | Ga0070693_100018934 | Ga0070693_1000189342 | 130 |
| 726 | 3300005548 | Ga0070665_100002371 | Ga0070665_10000237110 | 130 |
| 727 | 3300005548 | Ga0070665_100233455 | Ga0070665_1002334552 | 130 |
| 728 | 3300005548 | Ga0070665_100490466 | Ga0070665_1004904663 | 130 |
| 729 | 3300006028 | Ga0070717_11180492 | Ga0070717_111804922 | 130 |
| 730 | 3300006038 | Ga0075365_10031723 | Ga0075365_100317231 | 130 |
| 731 | 3300006042 | Ga0075368_10355637 | Ga0075368_103556372 | 130 |
| 732 | 3300006048 | Ga0075363_100197415 | Ga0075363_1001974152 | 130 |
| 733 | 3300006051 | Ga0075364_10374629 | Ga0075364_103746292 | 130 |
| 734 | 3300006178 | Ga0075367_10044838 | Ga0075367_100448383 | 130 |
| 735 | 3300006178 | Ga0075367_10138219 | Ga0075367_101382192 | 130 |
| 736 | 3300006195 | Ga0075366_10428845 | Ga0075366_104288452 | 130 |
| 737 | 3300006353 | Ga0075370_10020680 | Ga0075370_100206805 | 130 |
| 738 | 3300006353 | Ga0075370_10328369 | Ga0075370_103283692 | 130 |
| 739 | 3300009093 | Ga0105240_10177698 | Ga0105240_101776982 | 130 |
| 740 | 3300009177 | Ga0105248_10983788 | Ga0105248_109837882 | 130 |
| 741 | 3300009545 | Ga0105237_10014439 | Ga0105237_100144394 | 130 |
| 742 | 3300009553 | Ga0105249_11377713 | Ga0105249_113777131 | 130 |
| 743 | 3300010375 | Ga0105239_10047667 | Ga0105239_100476672 | 130 |
| 744 | 3300011119 | Ga0105246_10764021 | Ga0105246_107640211 | 130 |
| 745 | 3300013306 | Ga0163162_10086509 | Ga0163162_100865093 | 130 |
| 746 | 3300013308 | Ga0157375_11844468 | Ga0157375_118444681 | 130 |
| 747 | 3300017792 | Ga0163161_11323444 | Ga0163161_113234441 | 130 |
| 748 | 3300021361 | Ga0213872_10024600 | Ga0213872_100246003 | 130 |
| 749 | 3300021377 | Ga0213874_10269325 | Ga0213874_102693251 | 130 |
| 750 | 3300021441 | Ga0213871_10203808 | Ga0213871_102038081 | 130 |
| 751 | 3300025253 | Ga0209677_100507 | Ga0209677_1005076 | 130 |
| 752 | 3300025885 | Ga0207653_10075677 | Ga0207653_100756772 | 130 |
| 753 | 3300025913 | Ga0207695_10272858 | Ga0207695_102728582 | 130 |
| 754 | 3300025913 | Ga0207695_10678900 | Ga0207695_106789002 | 130 |
| 755 | 3300025914 | Ga0207671_10838877 | Ga0207671_108388772 | 130 |
| 756 | 3300025921 | Ga0207652_10053798 | Ga0207652_100537982 | 130 |
| 757 | 3300025934 | Ga0207686_10156230 | Ga0207686_101562302 | 130 |
| 758 | 3300025939 | Ga0207665_10846094 | Ga0207665_108460942 | 130 |
| 759 | 3300025941 | Ga0207711_10010855 | Ga0207711_100108553 | 130 |
| 760 | 3300025949 | Ga0207667_10906422 | Ga0207667_109064222 | 130 |
| 761 | 3300025961 | Ga0207712_12047407 | Ga0207712_120474071 | 130 |
| 762 | 3300026118 | Ga0207675_102483021 | Ga0207675_1024830211 | 130 |
| 763 | 3300026121 | Ga0207683_11238186 | Ga0207683_112381862 | 130 |
| 764 | 3300027866 | Ga0209813_10177054 | Ga0209813_101770541 | 130 |
| 765 | 3300028379 | Ga0268266_10000538 | Ga0268266_1000053853 | 130 |
| 766 | 3300028379 | Ga0268266_10021937 | Ga0268266_100219376 | 130 |
| 767 | 3300028379 | Ga0268266_10202605 | Ga0268266_102026051 | 130 |
| 768 | 3300031090 | Ga0265760_10015070 | Ga0265760_100150702 | 130 |
| 769 | 3300031249 | Ga0265339_10320392 | Ga0265339_103203921 | 130 |
| 770 | 3300031595 | Ga0265313_10144237 | Ga0265313_101442371 | 130 |
| 771 | 3300031616 | Ga0307508_10015508 | Ga0307508_100155085 | 130 |
| 772 | 3300031730 | Ga0307516_10003990 | Ga0307516_100039903 | 130 |
| 773 | 3300034816 | Ga0373930_0027140 | Ga0373930_0027140_733_1125 | 130 |
| 774 | 3300034820 | Ga0373959_0075434 | Ga0373959_0075434_129_521 | 130 |
| 775 | 3300035084 | Ga0373928_0013984 | Ga0373928_0013984_372_764 | 130 |
| 776 | 3300035086 | Ga0373934_0094483 | Ga0373934_0094483_187_579 | 130 |
| 777 | 3300035092 | Ga0373952_0022340 | Ga0373952_0022340_375_767 | 130 |
| 778 | 3300035111 | Ga0373923_0016552 | Ga0373923_0016552_360_752 | 130 |
| 779 | 3300035113 | Ga0373936_0155166 | Ga0373936_0155166_425_817 | 130 |
| 780 | 3300035116 | Ga0373945_0022253 | Ga0373945_0022253_183_575 | 130 |
| 781 | 3300035118 | Ga0373954_0050959 | Ga0373954_0050959_886_1278 | 130 |
| 782 | 3300035119 | Ga0373956_0438577 | Ga0373956_0438577_195_587 | 130 |
| 783 | 3300035120 | Ga0373957_0509234 | Ga0373957_0509234_32_424 | 130 |
| 784 | 3300035121 | Ga0373960_0002828 | Ga0373960_0002828_2497_2889 | 130 |
| 785 | 3300035170 | Ga0373943_0057704 | Ga0373943_0057704_463_855 | 130 |
| 786 | 3300035241 | Ga0373961_0279954 | Ga0373961_0279954_122_514 | 130 |
| 787 | 3300035691 | Ga0373931_0005645 | Ga0373931_0005645_569_961 | 130 |
| 788 | 3300035692 | Ga0373935_0308826 | Ga0373935_0308826_384_776 | 130 |
| 789 | 3300035695 | Ga0373927_0707519 | Ga0373927_0707519_105_497 | 130 |
| 790 | 3300035724 | Ga0373933_0114248 | Ga0373933_0114248_1098_1490 | 130 |
| 791 | 3300036401 | Ga0373937_1164521 | Ga0373937_1164521_280_672 | 130 |
| 792 | 3300037068 | Ga0373925_0121764 | Ga0373925_0121764_1497_1889 | 130 |
| 793 | 3300039438 | Ga0436360_0530926 | Ga0436360_0530926_6284_6676 | 130 |
| 794 | 3300039447 | Ga0436361_0580570 | Ga0436361_0580570_6482_6874 | 130 |
| 795 | 3300039450 | Ga0436363_0079128 | Ga0436363_0079128_300_692 | 130 |
| 796 | 3300042438 | Ga0439459_0046344 | Ga0439459_0046344_140_532 | 130 |
| 797 | 3300046472 | Ga0495580_0391058 | Ga0495580_0391058_49_441 | 130 |
| 798 | 3300046473 | Ga0495582_0022894 | Ga0495582_0022894_1185_1577 | 130 |
| 799 | 3300046475 | Ga0495639_0400008 | Ga0495639_0400008_244_636 | 130 |
| 800 | 3300046476 | Ga0495662_0273019 | Ga0495662_0273019_417_809 | 130 |
| 801 | 3300046517 | Ga0495630_0172677 | Ga0495630_0172677_739_1131 | 130 |
| 802 | 3300046529 | Ga0495652_0100143 | Ga0495652_0100143_1557_1949 | 130 |
| 803 | 3300046529 | Ga0495652_0154461 | Ga0495652_0154461_612_1004 | 130 |
| 804 | 3300046543 | Ga0495645_0257498 | Ga0495645_0257498_482_874 | 130 |
| 805 | 3300046663 | Ga0495635_0327627 | Ga0495635_0327627_154_546 | 130 |
| 806 | 3300047315 | Ga0495581_0051590 | Ga0495581_0051590_387_779 | 130 |
| 807 | 3300047319 | Ga0495674_0192876 | Ga0495674_0192876_734_1126 | 130 |
| 808 | 3300047673 | Ga0495593_0240265 | Ga0495593_0240265_168_560 | 130 |
| 809 | 3300048903 | Ga0496100_0073200 | Ga0496100_0073200_1251_1643 | 130 |
| 810 | 3300048903 | Ga0496100_0815559 | Ga0496100_0815559_191_583 | 130 |
| 811 | 3300048904 | Ga0496101_0052927 | Ga0496101_0052927_1229_1621 | 130 |
| 812 | 3300048905 | Ga0496102_0853793 | Ga0496102_0853793_372_764 | 130 |
| 813 | 3300048907 | Ga0496104_0123885 | Ga0496104_0123885_1143_1535 | 130 |
| 814 | 3300048908 | Ga0496105_0132827 | Ga0496105_0132827_36_428 | 130 |
| 815 | 3300048909 | Ga0496106_0153455 | Ga0496106_0153455_217_609 | 130 |
| 816 | 3300048909 | Ga0496106_1262223 | Ga0496106_1262223_28_420 | 130 |
| 817 | 3300048910 | Ga0496107_0043968 | Ga0496107_0043968_2358_2750 | 130 |
| 818 | 3300048911 | Ga0496108_0212779 | Ga0496108_0212779_749_1141 | 130 |
| 819 | 3300048912 | Ga0496109_0397832 | Ga0496109_0397832_650_1042 | 130 |
| 820 | 3300048913 | Ga0496110_0103519 | Ga0496110_0103519_1861_2253 | 130 |
| 821 | 3300048914 | Ga0496111_0646893 | Ga0496111_0646893_41_433 | 130 |
| 822 | 3300048916 | Ga0496113_0256440 | Ga0496113_0256440_184_576 | 130 |
| 823 | 3300048917 | Ga0496114_0065533 | Ga0496114_0065533_2348_2740 | 130 |
| 824 | 3300048918 | Ga0496115_0027487 | Ga0496115_0027487_3437_3829 | 130 |
| 825 | 3300048924 | Ga0496121_0241249 | Ga0496121_0241249_277_669 | 130 |
| 826 | 3300048928 | Ga0496125_0055809 | Ga0496125_0055809_21_413 | 130 |
| 827 | 3300048929 | Ga0496126_0406157 | Ga0496126_0406157_145_537 | 130 |
| 828 | 3300050490 | nmdc:mga03n38_174930_c1 | nmdc:mga03n38_174930_c1_292_684 | 130 |
| 829 | 3300050491 | nmdc:mga00v17_399663_c1 | nmdc:mga00v17_399663_c1_62_454 | 130 |
| 830 | 3300050492 | nmdc:mga0yw44_32635_c1 | nmdc:mga0yw44_32635_c1_144_536 | 130 |
| 831 | 3300050494 | nmdc:mga06z11_163186_c1 | nmdc:mga06z11_163186_c1_317_709 | 130 |
| 832 | 3300050494 | nmdc:mga06z11_59237_c1 | nmdc:mga06z11_59237_c1_1209_1601 | 130 |
| 833 | 3300050495 | nmdc:mga04h51_518564_c1 | nmdc:mga04h51_518564_c1_64_456 | 130 |
| 834 | 3300050495 | nmdc:mga04h51_99658_c1 | nmdc:mga04h51_99658_c1_645_1037 | 130 |
| 835 | 3300050496 | nmdc:mga07m45_9902_c1 | nmdc:mga07m45_9902_c1_2590_2982 | 130 |
| 836 | 3300053085 | Ga0495619_0503272 | Ga0495619_0503272_162_554 | 130 |
| 837 | 3300053119 | Ga0500595_003671 | Ga0500595_003671_6188_6580 | 130 |
| 838 | 3300053119 | Ga0500595_078174 | Ga0500595_078174_169_561 | 130 |
| 839 | 3300053136 | Ga0500559_0340923 | Ga0500559_0340923_27_419 | 130 |
| 840 | 3300053153 | Ga0500616_0009374 | Ga0500616_0009374_5506_5898 | 130 |
| 841 | 3300001977 | JGI24746J21847_1012257 | JGI24746J21847_10122572 | 131 |
| 842 | 3300001991 | JGI24743J22301_10018930 | JGI24743J22301_100189302 | 131 |
| 843 | 3300002070 | JGI24750J21931_1006628 | JGI24750J21931_10066283 | 131 |
| 844 | 3300002074 | JGI24748J21848_1002927 | JGI24748J21848_10029272 | 131 |
| 845 | 3300002075 | JGI24738J21930_10014138 | JGI24738J21930_100141381 | 131 |
| 846 | 3300002077 | JGI24744J21845_10004502 | JGI24744J21845_100045024 | 131 |
| 847 | 3300002244 | JGI24742J22300_10003801 | JGI24742J22300_100038014 | 131 |
| 848 | 3300003215 | JGI25153J46596_10026936 | JGI25153J46596_100269362 | 131 |
| 849 | 3300005329 | Ga0070683_100043821 | Ga0070683_1000438214 | 131 |
| 850 | 3300005330 | Ga0070690_100033424 | Ga0070690_1000334243 | 131 |
| 851 | 3300005331 | Ga0070670_100034140 | Ga0070670_1000341405 | 131 |
| 852 | 3300005334 | Ga0068869_100103670 | Ga0068869_1001036703 | 131 |
| 853 | 3300005334 | Ga0068869_100820464 | Ga0068869_1008204641 | 131 |
| 854 | 3300005335 | Ga0070666_10237036 | Ga0070666_102370362 | 131 |
| 855 | 3300005336 | Ga0070680_100186297 | Ga0070680_1001862972 | 131 |
| 856 | 3300005337 | Ga0070682_100432072 | Ga0070682_1004320722 | 131 |
| 857 | 3300005338 | Ga0068868_100032452 | Ga0068868_1000324525 | 131 |
| 858 | 3300005340 | Ga0070689_100261093 | Ga0070689_1002610932 | 131 |
| 859 | 3300005340 | Ga0070689_101386274 | Ga0070689_1013862741 | 131 |
| 860 | 3300005343 | Ga0070687_100324798 | Ga0070687_1003247982 | 131 |
| 861 | 3300005347 | Ga0070668_100749340 | Ga0070668_1007493401 | 131 |
| 862 | 3300005347 | Ga0070668_101286140 | Ga0070668_1012861401 | 131 |
| 863 | 3300005353 | Ga0070669_100427826 | Ga0070669_1004278262 | 131 |
| 864 | 3300005356 | Ga0070674_100165038 | Ga0070674_1001650383 | 131 |
| 865 | 3300005356 | Ga0070674_100400327 | Ga0070674_1004003272 | 131 |
| 866 | 3300005364 | Ga0070673_100338577 | Ga0070673_1003385772 | 131 |
| 867 | 3300005365 | Ga0070688_100011699 | Ga0070688_1000116994 | 131 |
| 868 | 3300005366 | Ga0070659_100018907 | Ga0070659_1000189074 | 131 |
| 869 | 3300005366 | Ga0070659_100258131 | Ga0070659_1002581313 | 131 |
| 870 | 3300005367 | Ga0070667_100128355 | Ga0070667_1001283552 | 131 |
| 871 | 3300005434 | Ga0070709_10034131 | Ga0070709_100341314 | 131 |
| 872 | 3300005435 | Ga0070714_100419139 | Ga0070714_1004191391 | 131 |
| 873 | 3300005436 | Ga0070713_100082405 | Ga0070713_1000824054 | 131 |
| 874 | 3300005437 | Ga0070710_10061973 | Ga0070710_100619732 | 131 |
| 875 | 3300005439 | Ga0070711_100013376 | Ga0070711_1000133762 | 131 |
| 876 | 3300005440 | Ga0070705_100135126 | Ga0070705_1001351261 | 131 |
| 877 | 3300005441 | Ga0070700_100096999 | Ga0070700_1000969992 | 131 |
| 878 | 3300005455 | Ga0070663_100013068 | Ga0070663_1000130686 | 131 |
| 879 | 3300005455 | Ga0070663_100582960 | Ga0070663_1005829602 | 131 |
| 880 | 3300005456 | Ga0070678_100597917 | Ga0070678_1005979171 | 131 |
| 881 | 3300005457 | Ga0070662_100010380 | Ga0070662_1000103805 | 131 |
| 882 | 3300005457 | Ga0070662_100553911 | Ga0070662_1005539112 | 131 |
| 883 | 3300005459 | Ga0068867_101307242 | Ga0068867_1013072421 | 131 |
| 884 | 3300005466 | Ga0070685_10005252 | Ga0070685_100052524 | 131 |
| 885 | 3300005467 | Ga0070706_101865801 | Ga0070706_1018658011 | 131 |
| 886 | 3300005471 | Ga0070698_101345321 | Ga0070698_1013453211 | 131 |
| 887 | 3300005539 | Ga0068853_100007218 | Ga0068853_1000072187 | 131 |
| 888 | 3300005539 | Ga0068853_100035353 | Ga0068853_1000353533 | 131 |
| 889 | 3300005543 | Ga0070672_100001580 | Ga0070672_1000015801 | 131 |
| 890 | 3300005543 | Ga0070672_100231700 | Ga0070672_1002317002 | 131 |
| 891 | 3300005544 | Ga0070686_100015908 | Ga0070686_1000159084 | 131 |
| 892 | 3300005545 | Ga0070695_100711901 | Ga0070695_1007119012 | 131 |
| 893 | 3300005546 | Ga0070696_100062520 | Ga0070696_1000625204 | 131 |
| 894 | 3300005546 | Ga0070696_100209183 | Ga0070696_1002091831 | 131 |
| 895 | 3300005547 | Ga0070693_100002880 | Ga0070693_1000028806 | 131 |
| 896 | 3300005548 | Ga0070665_100049057 | Ga0070665_1000490575 | 131 |
| 897 | 3300005549 | Ga0070704_100102880 | Ga0070704_1001028803 | 131 |
| 898 | 3300005564 | Ga0070664_100267727 | Ga0070664_1002677272 | 131 |
| 899 | 3300005615 | Ga0070702_100008859 | Ga0070702_1000088593 | 131 |
| 900 | 3300005616 | Ga0068852_100021320 | Ga0068852_1000213206 | 131 |
| 901 | 3300005616 | Ga0068852_101542836 | Ga0068852_1015428362 | 131 |
| 902 | 3300005618 | Ga0068864_100050102 | Ga0068864_1000501022 | 131 |
| 903 | 3300005718 | Ga0068866_10023225 | Ga0068866_100232252 | 131 |
| 904 | 3300005719 | Ga0068861_100196403 | Ga0068861_1001964031 | 131 |
| 905 | 3300005834 | Ga0068851_10102114 | Ga0068851_101021144 | 131 |
| 906 | 3300005840 | Ga0068870_10030330 | Ga0068870_100303305 | 131 |
| 907 | 3300005841 | Ga0068863_100097929 | Ga0068863_1000979293 | 131 |
| 908 | 3300005842 | Ga0068858_100023824 | Ga0068858_1000238245 | 131 |
| 909 | 3300005842 | Ga0068858_100128455 | Ga0068858_1001284553 | 131 |
| 910 | 3300005843 | Ga0068860_100001170 | Ga0068860_10000117017 | 131 |
| 911 | 3300005843 | Ga0068860_100125230 | Ga0068860_1001252303 | 131 |
| 912 | 3300005843 | Ga0068860_100132585 | Ga0068860_1001325854 | 131 |
| 913 | 3300005843 | Ga0068860_100152561 | Ga0068860_1001525614 | 131 |
| 914 | 3300005843 | Ga0068860_100860619 | Ga0068860_1008606192 | 131 |
| 915 | 3300005843 | Ga0068860_101454885 | Ga0068860_1014548851 | 131 |
| 916 | 3300005844 | Ga0068862_100081947 | Ga0068862_1000819472 | 131 |
| 917 | 3300006028 | Ga0070717_10914881 | Ga0070717_109148812 | 131 |
| 918 | 3300006038 | Ga0075365_10031422 | Ga0075365_100314222 | 131 |
| 919 | 3300006175 | Ga0070712_100197388 | Ga0070712_1001973883 | 131 |
| 920 | 3300006175 | Ga0070712_101486738 | Ga0070712_1014867381 | 131 |
| 921 | 3300006178 | Ga0075367_10305473 | Ga0075367_103054731 | 131 |
| 922 | 3300006186 | Ga0075369_10196175 | Ga0075369_101961751 | 131 |
| 923 | 3300006358 | Ga0068871_100184888 | Ga0068871_1001848882 | 131 |
| 924 | 3300006358 | Ga0068871_100253556 | Ga0068871_1002535563 | 131 |
| 925 | 3300006852 | Ga0075433_10997282 | Ga0075433_109972822 | 131 |
| 926 | 3300006871 | Ga0075434_100151718 | Ga0075434_1001517183 | 131 |
| 927 | 3300006871 | Ga0075434_100902373 | Ga0075434_1009023732 | 131 |
| 928 | 3300006880 | Ga0075429_101095470 | Ga0075429_1010954701 | 131 |
| 929 | 3300006881 | Ga0068865_100493023 | Ga0068865_1004930232 | 131 |
| 930 | 3300006941 | Ga0099825_1019193 | Ga0099825_10191934 | 131 |
| 931 | 3300006942 | Ga0099824_1028856 | Ga0099824_10288563 | 131 |
| 932 | 3300006944 | Ga0099823_1000042 | Ga0099823_100004223 | 131 |
| 933 | 3300009093 | Ga0105240_11583468 | Ga0105240_115834681 | 131 |
| 934 | 3300009094 | Ga0111539_10660878 | Ga0111539_106608782 | 131 |
| 935 | 3300009094 | Ga0111539_13112131 | Ga0111539_131121311 | 131 |
| 936 | 3300009098 | Ga0105245_10023627 | Ga0105245_100236274 | 131 |
| 937 | 3300009098 | Ga0105245_10177430 | Ga0105245_101774302 | 131 |
| 938 | 3300009098 | Ga0105245_11803904 | Ga0105245_118039042 | 131 |
| 939 | 3300009098 | Ga0105245_11948922 | Ga0105245_119489222 | 131 |
| 940 | 3300009101 | Ga0105247_10008014 | Ga0105247_100080145 | 131 |
| 941 | 3300009147 | Ga0114129_10018100 | Ga0114129_100181004 | 131 |
| 942 | 3300009147 | Ga0114129_10179083 | Ga0114129_101790831 | 131 |
| 943 | 3300009147 | Ga0114129_11143862 | Ga0114129_111438621 | 131 |
| 944 | 3300009148 | Ga0105243_10059744 | Ga0105243_100597441 | 131 |
| 945 | 3300009174 | Ga0105241_10031877 | Ga0105241_100318774 | 131 |
| 946 | 3300009176 | Ga0105242_10094307 | Ga0105242_100943073 | 131 |
| 947 | 3300009177 | Ga0105248_10026597 | Ga0105248_100265974 | 131 |
| 948 | 3300009545 | Ga0105237_10309840 | Ga0105237_103098401 | 131 |
| 949 | 3300009545 | Ga0105237_11157061 | Ga0105237_111570612 | 131 |
| 950 | 3300009545 | Ga0105237_11333455 | Ga0105237_113334552 | 131 |
| 951 | 3300009553 | Ga0105249_10026912 | Ga0105249_100269124 | 131 |
| 952 | 3300009553 | Ga0105249_12092050 | Ga0105249_120920501 | 131 |
| 953 | 3300010375 | Ga0105239_10013998 | Ga0105239_100139988 | 131 |
| 954 | 3300010375 | Ga0105239_10098444 | Ga0105239_100984443 | 131 |
| 955 | 3300010375 | Ga0105239_13429890 | Ga0105239_134298901 | 131 |
| 956 | 3300011119 | Ga0105246_10027513 | Ga0105246_100275132 | 131 |
| 957 | 3300011119 | Ga0105246_11186088 | Ga0105246_111860882 | 131 |
| 958 | 3300013296 | Ga0157374_11144746 | Ga0157374_111447462 | 131 |
| 959 | 3300013297 | Ga0157378_10007983 | Ga0157378_100079835 | 131 |
| 960 | 3300013297 | Ga0157378_10106621 | Ga0157378_101066212 | 131 |
| 961 | 3300013297 | Ga0157378_10217973 | Ga0157378_102179732 | 131 |
| 962 | 3300013297 | Ga0157378_10932975 | Ga0157378_109329751 | 131 |
| 963 | 3300013297 | Ga0157378_11831175 | Ga0157378_118311752 | 131 |
| 964 | 3300013306 | Ga0163162_10161483 | Ga0163162_101614833 | 131 |
| 965 | 3300013306 | Ga0163162_10244208 | Ga0163162_102442083 | 131 |
| 966 | 3300013306 | Ga0163162_10991381 | Ga0163162_109913811 | 131 |
| 967 | 3300013307 | Ga0157372_10484461 | Ga0157372_104844612 | 131 |
| 968 | 3300013308 | Ga0157375_10007093 | Ga0157375_100070932 | 131 |
| 969 | 3300013308 | Ga0157375_10070810 | Ga0157375_100708104 | 131 |
| 970 | 3300014325 | Ga0163163_10001366 | Ga0163163_100013667 | 131 |
| 971 | 3300014326 | Ga0157380_10009161 | Ga0157380_100091615 | 131 |
| 972 | 3300014326 | Ga0157380_10143228 | Ga0157380_101432282 | 131 |
| 973 | 3300014745 | Ga0157377_10037517 | Ga0157377_100375171 | 131 |
| 974 | 3300014968 | Ga0157379_10031905 | Ga0157379_100319054 | 131 |
| 975 | 3300014968 | Ga0157379_10086190 | Ga0157379_100861902 | 131 |
| 976 | 3300014968 | Ga0157379_10697743 | Ga0157379_106977431 | 131 |
| 977 | 3300014969 | Ga0157376_10074553 | Ga0157376_100745534 | 131 |
| 978 | 3300017792 | Ga0163161_10044525 | Ga0163161_100445252 | 131 |
| 979 | 3300022467 | Ga0224712_10107837 | Ga0224712_101078371 | 131 |
| 980 | 3300025297 | Ga0209758_1000088 | Ga0209758_100008881 | 131 |
| 981 | 3300025297 | Ga0209758_1034578 | Ga0209758_10345782 | 131 |
| 982 | 3300025298 | Ga0209050_1001041 | Ga0209050_10010411 | 131 |
| 983 | 3300025898 | Ga0207692_10078251 | Ga0207692_100782514 | 131 |
| 984 | 3300025898 | Ga0207692_10130725 | Ga0207692_101307252 | 131 |
| 985 | 3300025899 | Ga0207642_10012459 | Ga0207642_100124593 | 131 |
| 986 | 3300025900 | Ga0207710_10009583 | Ga0207710_100095833 | 131 |
| 987 | 3300025901 | Ga0207688_10006010 | Ga0207688_100060104 | 131 |
| 988 | 3300025904 | Ga0207647_10021697 | Ga0207647_100216974 | 131 |
| 989 | 3300025904 | Ga0207647_10085968 | Ga0207647_100859683 | 131 |
| 990 | 3300025906 | Ga0207699_10071844 | Ga0207699_100718442 | 131 |
| 991 | 3300025908 | Ga0207643_10021169 | Ga0207643_100211694 | 131 |
| 992 | 3300025913 | Ga0207695_10091125 | Ga0207695_100911252 | 131 |
| 993 | 3300025915 | Ga0207693_10012845 | Ga0207693_100128451 | 131 |
| 994 | 3300025915 | Ga0207693_10076719 | Ga0207693_100767191 | 131 |
| 995 | 3300025916 | Ga0207663_10174673 | Ga0207663_101746732 | 131 |
| 996 | 3300025916 | Ga0207663_10480239 | Ga0207663_104802392 | 131 |
| 997 | 3300025917 | Ga0207660_10739834 | Ga0207660_107398342 | 131 |
| 998 | 3300025918 | Ga0207662_10167134 | Ga0207662_101671343 | 131 |
| 999 | 3300025919 | Ga0207657_10100812 | Ga0207657_101008122 | 131 |
| 1000 | 3300025920 | Ga0207649_10097014 | Ga0207649_100970142 | 131 |
| 1001 | 3300025923 | Ga0207681_10230161 | Ga0207681_102301611 | 131 |
| 1002 | 3300025923 | Ga0207681_10732291 | Ga0207681_107322912 | 131 |
| 1003 | 3300025925 | Ga0207650_10010331 | Ga0207650_100103313 | 131 |
| 1004 | 3300025926 | Ga0207659_11891521 | Ga0207659_118915211 | 131 |
| 1005 | 3300025928 | Ga0207700_10301408 | Ga0207700_103014082 | 131 |
| 1006 | 3300025928 | Ga0207700_11070598 | Ga0207700_110705981 | 131 |
| 1007 | 3300025931 | Ga0207644_10070892 | Ga0207644_100708923 | 131 |
| 1008 | 3300025931 | Ga0207644_10177591 | Ga0207644_101775913 | 131 |
| 1009 | 3300025932 | Ga0207690_10064302 | Ga0207690_100643023 | 131 |
| 1010 | 3300025933 | Ga0207706_10004538 | Ga0207706_100045382 | 131 |
| 1011 | 3300025933 | Ga0207706_10048734 | Ga0207706_100487342 | 131 |
| 1012 | 3300025934 | Ga0207686_10012066 | Ga0207686_100120663 | 131 |
| 1013 | 3300025936 | Ga0207670_10117508 | Ga0207670_101175082 | 131 |
| 1014 | 3300025937 | Ga0207669_10002431 | Ga0207669_100024316 | 131 |
| 1015 | 3300025937 | Ga0207669_10263959 | Ga0207669_102639592 | 131 |
| 1016 | 3300025937 | Ga0207669_11171849 | Ga0207669_111718491 | 131 |
| 1017 | 3300025938 | Ga0207704_10032314 | Ga0207704_100323143 | 131 |
| 1018 | 3300025938 | Ga0207704_11127000 | Ga0207704_111270001 | 131 |
| 1019 | 3300025939 | Ga0207665_10061239 | Ga0207665_100612392 | 131 |
| 1020 | 3300025940 | Ga0207691_10185746 | Ga0207691_101857463 | 131 |
| 1021 | 3300025941 | Ga0207711_10028877 | Ga0207711_100288774 | 131 |
| 1022 | 3300025942 | Ga0207689_10006931 | Ga0207689_100069319 | 131 |
| 1023 | 3300025944 | Ga0207661_10097234 | Ga0207661_100972342 | 131 |
| 1024 | 3300025961 | Ga0207712_10038736 | Ga0207712_100387361 | 131 |
| 1025 | 3300025972 | Ga0207668_10042593 | Ga0207668_100425932 | 131 |
| 1026 | 3300025972 | Ga0207668_10792164 | Ga0207668_107921641 | 131 |
| 1027 | 3300025981 | Ga0207640_10138593 | Ga0207640_101385932 | 131 |
| 1028 | 3300025986 | Ga0207658_10066476 | Ga0207658_100664764 | 131 |
| 1029 | 3300026023 | Ga0207677_10106102 | Ga0207677_101061022 | 131 |
| 1030 | 3300026035 | Ga0207703_10104853 | Ga0207703_101048533 | 131 |
| 1031 | 3300026035 | Ga0207703_10203088 | Ga0207703_102030882 | 131 |
| 1032 | 3300026035 | Ga0207703_10654354 | Ga0207703_106543542 | 131 |
| 1033 | 3300026041 | Ga0207639_10121329 | Ga0207639_101213293 | 131 |
| 1034 | 3300026041 | Ga0207639_10206696 | Ga0207639_102066961 | 131 |
| 1035 | 3300026067 | Ga0207678_10014332 | Ga0207678_100143327 | 131 |
| 1036 | 3300026075 | Ga0207708_11329141 | Ga0207708_113291412 | 131 |
| 1037 | 3300026088 | Ga0207641_10091482 | Ga0207641_100914822 | 131 |
| 1038 | 3300026089 | Ga0207648_10198595 | Ga0207648_101985952 | 131 |
| 1039 | 3300026089 | Ga0207648_11895837 | Ga0207648_118958372 | 131 |
| 1040 | 3300026095 | Ga0207676_10016623 | Ga0207676_100166234 | 131 |
| 1041 | 3300026118 | Ga0207675_100163040 | Ga0207675_1001630403 | 131 |
| 1042 | 3300026118 | Ga0207675_100643578 | Ga0207675_1006435782 | 131 |
| 1043 | 3300026121 | Ga0207683_10060851 | Ga0207683_100608511 | 131 |
| 1044 | 3300026142 | Ga0207698_10183264 | Ga0207698_101832643 | 131 |
| 1045 | 3300027296 | Ga0209389_1000135 | Ga0209389_100013520 | 131 |
| 1046 | 3300027361 | Ga0209489_100653 | Ga0209489_10065322 | 131 |
| 1047 | 3300027363 | Ga0209700_100417 | Ga0209700_10041728 | 131 |
| 1048 | 3300027907 | Ga0207428_10828678 | Ga0207428_108286781 | 131 |
| 1049 | 3300028379 | Ga0268266_10151354 | Ga0268266_101513542 | 131 |
| 1050 | 3300028380 | Ga0268265_10010542 | Ga0268265_100105423 | 131 |
| 1051 | 3300028380 | Ga0268265_10474498 | Ga0268265_104744982 | 131 |
| 1052 | 3300028380 | Ga0268265_12445490 | Ga0268265_124454902 | 131 |
| 1053 | 3300028381 | Ga0268264_10000187 | Ga0268264_1000018785 | 131 |
| 1054 | 3300028381 | Ga0268264_10981947 | Ga0268264_109819471 | 131 |
| 1055 | 3300028381 | Ga0268264_11729961 | Ga0268264_117299611 | 131 |
| 1056 | 3300031235 | Ga0265330_10048809 | Ga0265330_100488091 | 131 |
| 1057 | 3300031507 | Ga0307509_10302605 | Ga0307509_103026052 | 131 |
| 1058 | 3300031712 | Ga0265342_10013591 | Ga0265342_100135913 | 131 |
| 1059 | 3300031730 | Ga0307516_10001085 | Ga0307516_1000108537 | 131 |
| 1060 | 3300031903 | Ga0307407_10415830 | Ga0307407_104158302 | 131 |
| 1061 | 3300031911 | Ga0307412_10691291 | Ga0307412_106912912 | 131 |
| 1062 | 3300032002 | Ga0307416_101108203 | Ga0307416_1011082031 | 131 |
| 1063 | 3300032004 | Ga0307414_10193425 | Ga0307414_101934252 | 131 |
| 1064 | 3300035116 | Ga0373945_0241110 | Ga0373945_0241110_287_685 | 131 |
| 1065 | 3300035170 | Ga0373943_0035781 | Ga0373943_0035781_955_1350 | 131 |
| 1066 | 3300035172 | Ga0373955_0679386 | Ga0373955_0679386_43_444 | 131 |
| 1067 | 3300035692 | Ga0373935_0003759 | Ga0373935_0003759_1202_1597 | 131 |
| 1068 | 3300035695 | Ga0373927_0004169 | Ga0373927_0004169_2455_2850 | 131 |
| 1069 | 3300035695 | Ga0373927_0028041 | Ga0373927_0028041_2151_2546 | 131 |
| 1070 | 3300035725 | Ga0373947_0011282 | Ga0373947_0011282_2455_2850 | 131 |
| 1071 | 3300035725 | Ga0373947_0054937 | Ga0373947_0054937_1797_2192 | 131 |
| 1072 | 3300036401 | Ga0373937_0654672 | Ga0373937_0654672_244_639 | 131 |
| 1073 | 3300037068 | Ga0373925_0008051 | Ga0373925_0008051_1630_2025 | 131 |
| 1074 | 3300037068 | Ga0373925_0053000 | Ga0373925_0053000_1610_2005 | 131 |
| 1075 | 3300037466 | Ga0395898_0308766 | Ga0395898_0308766_932_1330 | 131 |
| 1076 | 3300037471 | Ga0395905_0170178 | Ga0395905_0170178_133_531 | 131 |
| 1077 | 3300046452 | Ga0495617_132591 | Ga0495617_132591_228_623 | 131 |
| 1078 | 3300046452 | Ga0495617_134570 | Ga0495617_134570_364_759 | 131 |
| 1079 | 3300046455 | Ga0495603_0016575 | Ga0495603_0016575_2278_2673 | 131 |
| 1080 | 3300046459 | Ga0495629_0566673 | Ga0495629_0566673_193_588 | 131 |
| 1081 | 3300046461 | Ga0495641_0088339 | Ga0495641_0088339_759_1154 | 131 |
| 1082 | 3300046472 | Ga0495580_0164063 | Ga0495580_0164063_1107_1502 | 131 |
| 1083 | 3300046472 | Ga0495580_0206930 | Ga0495580_0206930_280_675 | 131 |
| 1084 | 3300046473 | Ga0495582_0013127 | Ga0495582_0013127_1206_1601 | 131 |
| 1085 | 3300046474 | Ga0495605_0003508 | Ga0495605_0003508_2812_3207 | 131 |
| 1086 | 3300046475 | Ga0495639_0103042 | Ga0495639_0103042_120_515 | 131 |
| 1087 | 3300046476 | Ga0495662_0055060 | Ga0495662_0055060_1013_1408 | 131 |
| 1088 | 3300046492 | Ga0495585_0094753 | Ga0495585_0094753_117_653 | 131 |
| 1089 | 3300046492 | Ga0495585_0321274 | Ga0495585_0321274_277_672 | 131 |
| 1090 | 3300046501 | Ga0495607_0043454 | Ga0495607_0043454_824_1219 | 131 |
| 1091 | 3300046501 | Ga0495607_0204590 | Ga0495607_0204590_267_662 | 131 |
| 1092 | 3300046506 | Ga0495583_0012351 | Ga0495583_0012351_1738_2133 | 131 |
| 1093 | 3300046511 | Ga0495608_0499362 | Ga0495608_0499362_122_517 | 131 |
| 1094 | 3300046512 | Ga0495610_0359152 | Ga0495610_0359152_20_415 | 131 |
| 1095 | 3300046513 | Ga0495616_0014970 | Ga0495616_0014970_3800_4195 | 131 |
| 1096 | 3300046513 | Ga0495616_0160155 | Ga0495616_0160155_535_930 | 131 |
| 1097 | 3300046518 | Ga0495631_0002810 | Ga0495631_0002810_2992_3387 | 131 |
| 1098 | 3300046519 | Ga0495632_0031510 | Ga0495632_0031510_1624_2019 | 131 |
| 1099 | 3300046519 | Ga0495632_0247859 | Ga0495632_0247859_29_424 | 131 |
| 1100 | 3300046520 | Ga0495637_0070700 | Ga0495637_0070700_105_500 | 131 |
| 1101 | 3300046530 | Ga0495654_0118121 | Ga0495654_0118121_722_1117 | 131 |
| 1102 | 3300046537 | Ga0495598_0007742 | Ga0495598_0007742_194_640 | 131 |
| 1103 | 3300046538 | Ga0495609_0184806 | Ga0495609_0184806_54_449 | 131 |
| 1104 | 3300046615 | Ga0495656_0017995 | Ga0495656_0017995_1406_1801 | 131 |
| 1105 | 3300046616 | Ga0495668_0002555 | Ga0495668_0002555_8483_8878 | 131 |
| 1106 | 3300046660 | Ga0495625_0010556 | Ga0495625_0010556_6240_6635 | 131 |
| 1107 | 3300046664 | Ga0495659_0093881 | Ga0495659_0093881_477_872 | 131 |
| 1108 | 3300046681 | Ga0495647_0005408 | Ga0495647_0005408_3274_3669 | 131 |
| 1109 | 3300046683 | Ga0495658_0250534 | Ga0495658_0250534_11_406 | 131 |
| 1110 | 3300046689 | Ga0495613_0243020 | Ga0495613_0243020_782_1177 | 131 |
| 1111 | 3300046689 | Ga0495613_0340974 | Ga0495613_0340974_228_623 | 131 |
| 1112 | 3300046690 | Ga0495624_0075431 | Ga0495624_0075431_1463_1858 | 131 |
| 1113 | 3300046691 | Ga0495670_0065896 | Ga0495670_0065896_492_887 | 131 |
| 1114 | 3300046694 | Ga0495649_0209571 | Ga0495649_0209571_416_811 | 131 |
| 1115 | 3300046809 | Ga0495600_0359981 | Ga0495600_0359981_261_656 | 131 |
| 1116 | 3300047321 | Ga0495676_0006508 | Ga0495676_0006508_3038_3433 | 131 |
| 1117 | 3300047445 | Ga0495677_0200923 | Ga0495677_0200923_25_420 | 131 |
| 1118 | 3300047472 | Ga0495686_0000800 | Ga0495686_0000800_11513_11908 | 131 |
| 1119 | 3300047673 | Ga0495593_0055097 | Ga0495593_0055097_1129_1524 | 131 |
| 1120 | 3300048091 | Ga0495626_0175218 | Ga0495626_0175218_316_711 | 131 |
| 1121 | 3300048903 | Ga0496100_0024512 | Ga0496100_0024512_2135_2530 | 131 |
| 1122 | 3300048904 | Ga0496101_0004545 | Ga0496101_0004545_1940_2335 | 131 |
| 1123 | 3300048904 | Ga0496101_0246999 | Ga0496101_0246999_425_820 | 131 |
| 1124 | 3300048904 | Ga0496101_0275889 | Ga0496101_0275889_468_863 | 131 |
| 1125 | 3300048905 | Ga0496102_0091640 | Ga0496102_0091640_1366_1761 | 131 |
| 1126 | 3300048905 | Ga0496102_0244942 | Ga0496102_0244942_492_887 | 131 |
| 1127 | 3300048905 | Ga0496102_1129669 | Ga0496102_1129669_89_484 | 131 |
| 1128 | 3300048906 | Ga0496103_0021461 | Ga0496103_0021461_2445_2840 | 131 |
| 1129 | 3300048907 | Ga0496104_0001506 | Ga0496104_0001506_1389_1784 | 131 |
| 1130 | 3300048907 | Ga0496104_0003793 | Ga0496104_0003793_230_625 | 131 |
| 1131 | 3300048907 | Ga0496104_0082253 | Ga0496104_0082253_1177_1572 | 131 |
| 1132 | 3300048907 | Ga0496104_0124102 | Ga0496104_0124102_581_976 | 131 |
| 1133 | 3300048908 | Ga0496105_0000442 | Ga0496105_0000442_23156_23551 | 131 |
| 1134 | 3300048908 | Ga0496105_0000721 | Ga0496105_0000721_4485_4880 | 131 |
| 1135 | 3300048908 | Ga0496105_0013118 | Ga0496105_0013118_1802_2197 | 131 |
| 1136 | 3300048909 | Ga0496106_0004293 | Ga0496106_0004293_2165_2560 | 131 |
| 1137 | 3300048909 | Ga0496106_0049748 | Ga0496106_0049748_2210_2623 | 131 |
| 1138 | 3300048909 | Ga0496106_0063696 | Ga0496106_0063696_1505_1912 | 131 |
| 1139 | 3300048910 | Ga0496107_0014835 | Ga0496107_0014835_3112_3507 | 131 |
| 1140 | 3300048910 | Ga0496107_0261289 | Ga0496107_0261289_397_792 | 131 |
| 1141 | 3300048911 | Ga0496108_0006478 | Ga0496108_0006478_7597_7992 | 131 |
| 1142 | 3300048911 | Ga0496108_0008634 | Ga0496108_0008634_4358_4753 | 131 |
| 1143 | 3300048911 | Ga0496108_0015824 | Ga0496108_0015824_3382_3777 | 131 |
| 1144 | 3300048912 | Ga0496109_0000392 | Ga0496109_0000392_4374_4769 | 131 |
| 1145 | 3300048912 | Ga0496109_0001446 | Ga0496109_0001446_12098_12493 | 131 |
| 1146 | 3300048912 | Ga0496109_0080259 | Ga0496109_0080259_1366_1761 | 131 |
| 1147 | 3300048912 | Ga0496109_0313767 | Ga0496109_0313767_645_1040 | 131 |
| 1148 | 3300048913 | Ga0496110_0006715 | Ga0496110_0006715_7222_7617 | 131 |
| 1149 | 3300048913 | Ga0496110_0012186 | Ga0496110_0012186_1641_2036 | 131 |
| 1150 | 3300048913 | Ga0496110_0093217 | Ga0496110_0093217_1296_1691 | 131 |
| 1151 | 3300048913 | Ga0496110_0116199 | Ga0496110_0116199_366_761 | 131 |
| 1152 | 3300048913 | Ga0496110_0909370 | Ga0496110_0909370_106_501 | 131 |
| 1153 | 3300048914 | Ga0496111_0002114 | Ga0496111_0002114_1849_2244 | 131 |
| 1154 | 3300048914 | Ga0496111_0003367 | Ga0496111_0003367_2722_3117 | 131 |
| 1155 | 3300048914 | Ga0496111_0009885 | Ga0496111_0009885_5624_6019 | 131 |
| 1156 | 3300048914 | Ga0496111_0018577 | Ga0496111_0018577_3329_3724 | 131 |
| 1157 | 3300048915 | Ga0496112_0001759 | Ga0496112_0001759_10476_10871 | 131 |
| 1158 | 3300048915 | Ga0496112_0007831 | Ga0496112_0007831_1518_1913 | 131 |
| 1159 | 3300048915 | Ga0496112_0070610 | Ga0496112_0070610_1331_1726 | 131 |
| 1160 | 3300048915 | Ga0496112_0946614 | Ga0496112_0946614_236_631 | 131 |
| 1161 | 3300048916 | Ga0496113_0000243 | Ga0496113_0000243_3727_4122 | 131 |
| 1162 | 3300048916 | Ga0496113_0002540 | Ga0496113_0002540_9632_10027 | 131 |
| 1163 | 3300048916 | Ga0496113_0068120 | Ga0496113_0068120_1227_1622 | 131 |
| 1164 | 3300048917 | Ga0496114_0001511 | Ga0496114_0001511_12773_13168 | 131 |
| 1165 | 3300048917 | Ga0496114_0317220 | Ga0496114_0317220_836_1285 | 131 |
| 1166 | 3300048918 | Ga0496115_0002949 | Ga0496115_0002949_380_775 | 131 |
| 1167 | 3300048918 | Ga0496115_0021101 | Ga0496115_0021101_2468_2863 | 131 |
| 1168 | 3300048924 | Ga0496121_0204092 | Ga0496121_0204092_332_727 | 131 |
| 1169 | 3300048925 | Ga0496122_0150687 | Ga0496122_0150687_53_451 | 131 |
| 1170 | 3300048928 | Ga0496125_0018828 | Ga0496125_0018828_4631_5026 | 131 |
| 1171 | 3300048929 | Ga0496126_0311405 | Ga0496126_0311405_345_740 | 131 |
| 1172 | 3300049459 | Ga0495678_063215 | Ga0495678_063215_848_1243 | 131 |
| 1173 | 3300049672 | Ga0501239_044813 | Ga0501239_044813_188_583 | 131 |
| 1174 | 3300049851 | Ga0501212_039679 | Ga0501212_039679_341_736 | 131 |
| 1175 | 3300050492 | nmdc:mga0yw44_45115_c1 | nmdc:mga0yw44_45115_c1_644_1039 | 131 |
| 1176 | 3300050493 | nmdc:mga0k408_109126_c1 | nmdc:mga0k408_109126_c1_1077_1472 | 131 |
| 1177 | 3300050507 | nmdc:mga05p37_25457_c1 | nmdc:mga05p37_25457_c1_2477_2872 | 131 |
| 1178 | 3300050507 | nmdc:mga05p37_639258_c1 | nmdc:mga05p37_639258_c1_749_1144 | 131 |
| 1179 | 3300050508 | nmdc:mga09592_242341_c1 | nmdc:mga09592_242341_c1_220_615 | 131 |
| 1180 | 3300050510 | nmdc:mga06r32_131586_c1 | nmdc:mga06r32_131586_c1_1491_1886 | 131 |
| 1181 | 3300050512 | nmdc:mga0n895_407568_c1 | nmdc:mga0n895_407568_c1_228_623 | 131 |
| 1182 | 3300050516 | nmdc:mga0sz30_312452_c1 | nmdc:mga0sz30_312452_c1_140_547 | 131 |
| 1183 | 3300053079 | Ga0500610_0012561 | Ga0500610_0012561_133_528 | 131 |
| 1184 | 3300053085 | Ga0495619_0004858 | Ga0495619_0004858_3369_3764 | 131 |
| 1185 | 3300053085 | Ga0495619_0244597 | Ga0495619_0244597_442_837 | 131 |
| 1186 | 3300053093 | Ga0500651_0037407 | Ga0500651_0037407_1114_1509 | 131 |
| 1187 | 3300053094 | Ga0500566_0003029 | Ga0500566_0003029_5956_6351 | 131 |
| 1188 | 3300053096 | Ga0500641_0151233 | Ga0500641_0151233_485_883 | 131 |
| 1189 | 3300053105 | Ga0500557_085519 | Ga0500557_085519_249_644 | 131 |
| 1190 | 3300053109 | Ga0500569_128241 | Ga0500569_128241_150_545 | 131 |
| 1191 | 3300053111 | Ga0500572_000747 | Ga0500572_000747_1214_1609 | 131 |
| 1192 | 3300053118 | Ga0500594_0000512 | Ga0500594_0000512_4723_5118 | 131 |
| 1193 | 3300053119 | Ga0500595_003507 | Ga0500595_003507_1413_1808 | 131 |
| 1194 | 3300053122 | Ga0500608_016509 | Ga0500608_016509_2485_2880 | 131 |
| 1195 | 3300053130 | Ga0500642_0051142 | Ga0500642_0051142_708_1103 | 131 |
| 1196 | 3300053134 | Ga0500658_0147560 | Ga0500658_0147560_341_739 | 131 |
| 1197 | 3300053136 | Ga0500559_0118613 | Ga0500559_0118613_782_1177 | 131 |
| 1198 | 3300053142 | Ga0500577_0066143 | Ga0500577_0066143_348_794 | 131 |
| 1199 | 3300053142 | Ga0500577_0158353 | Ga0500577_0158353_327_722 | 131 |
| 1200 | 3300053150 | Ga0500603_000740 | Ga0500603_000740_2027_2422 | 131 |
| 1201 | 3300053151 | Ga0500604_0193389 | Ga0500604_0193389_40_447 | 131 |
| 1202 | 3300053159 | Ga0500630_002258 | Ga0500630_002258_3980_4375 | 131 |
| 1203 | 3300053163 | Ga0500639_000035 | Ga0500639_000035_62508_62903 | 131 |
| 1204 | 3300053178 | Ga0500637_0135353 | Ga0500637_0135353_1017_1412 | 131 |
| 1205 | 3300053731 | Ga0500609_039661 | Ga0500609_039661_205_600 | 131 |
| 1206 | 3300053737 | Ga0500601_002331 | Ga0500601_002331_1261_1656 | 131 |
| 1207 | 3300060353 | Ga0501082_0177318 | Ga0501082_0177318_1333_1728 | 131 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3f40-assembly1.cif.gz_A-2 | crystal structure of ntf2-like protein of unknown function (yp_677363.1) from cytophaga hutchinsonii atcc 33406 at 1.27 a resolution | 0.9106 | 6 | 108 |
| 6uae-assembly4.cif.gz_D | ketosteroid isomerase (c. testosteroni) with truncated & designed loop for precise positioning of a catalytic e38 | 0.9007 | 4 | 110 |
| 6uad-assembly1.cif.gz_A | ketosteroid isomerase (c. testosteroni) with truncated & designed loop for precise positioning of a catalytic e38 | 0.8848 | 4 | 110 |
| 5aii-assembly1.cif.gz_H | discovery and characterization of thermophilic limonene-1,2-epoxide hydrolases from hot spring metagenomic libraries. ch55-sample-peg complex | 0.883 | 8 | 108 |
| 3f8h-assembly1.cif.gz_B | crystal structure of a putative polyketide cyclase (tm1040_3560) from silicibacter sp. tm1040 at 2.00 a resolution | 0.8819 | 4 | 108 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3en8A01 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.954 | 3 | 110 | 3.10.450.50 |
| 3en8A01 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.9285 | 3 | 110 | 3.10.450.50 |
| 3f40A00 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.914 | 6 | 108 | 3.10.450.50 |
| 2bngA00 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.8868 | 4 | 108 | 3.10.450.50 |
| 5aiiN00 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.8863 | 8 | 108 | 3.10.450.50 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A838J2U5-F1-model_v4 | Nuclear transport factor 2 family protein | 0.9866 | 1 | 97 |
|
| AF-A0A838J2U5-F1-model_v4 | Nuclear transport factor 2 family protein | 0.9766 | 1 | 97 |
|
| AF-A0A328EGT5-F1-model_v4 | SnoaL-like domain-containing protein | 0.9532 | 61 | 108 |
|
| AF-A0A7Y2IYY7-F1-model_v4 | SnoaL-like domain-containing protein | 0.9359 | 18 | 110 |
|
| AF-A0A6J4VCE0-F1-model_v4 | SnoaL-like domain-containing protein | 0.9357 | 6 | 107 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar