F491661

General Info

Members Datasets Scaffolds Average Seq Length
1207 481 1203 129

Family's Representative Sequence

Representative Sequence 3300014497|Ga0182008_10034186|Ga0182008_100341862
Length 156
Sequence MARHVFLLLEAGANCDSAPLAGEQCRWEIEMDDRAVQLALERHWDASDASDFTVEHEIYREDAVLEYPQSGERIRGRKNIQESRSVQPNKKRFTVRRIIGSGDLWVTEFVLTYDGVPSYAVSIMEFREGLVTNETQYFADRFDPAPSRSHLVERVG

Samples

Sample ID Description Type Environment
1 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
2 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
3 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
6 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
7 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
8 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
9 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
10 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
11 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
12 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
13 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
14 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
15 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
16 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
17 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
18 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
19 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
20 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
21 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
24 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
25 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
26 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
27 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
28 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
29 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
30 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
31 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
32 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
33 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
34 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
35 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
36 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
37 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
38 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
39 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
40 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
41 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
42 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
43 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
44 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
45 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
46 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
47 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
48 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
49 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
50 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
51 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
52 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
53 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
54 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
55 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
56 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
57 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
58 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
59 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
60 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
61 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
62 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
63 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
64 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
65 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
66 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
67 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
68 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
69 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
70 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
71 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
72 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
73 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
74 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
75 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
76 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
77 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
78 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
79 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
80 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
81 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
82 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
83 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
84 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
85 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
86 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
87 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
88 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
89 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
90 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
91 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
92 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
93 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
94 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
95 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
96 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
97 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
98 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
99 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
100 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
101 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
102 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
103 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
104 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
105 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
106 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
107 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
108 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
109 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
110 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
111 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
112 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
113 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
114 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
115 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
116 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
117 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
118 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
119 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
120 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
121 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
122 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
123 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
124 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
125 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
126 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
127 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
128 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
129 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
130 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
131 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
132 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
133 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
134 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
135 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
136 3300012476 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 Metagenome Rhizosphere
137 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
138 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
139 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
140 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
141 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
142 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
143 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
144 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
145 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
146 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
147 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
148 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
149 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
150 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
151 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
152 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
153 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
154 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
155 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
156 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
157 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
158 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
159 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
160 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
161 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
162 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
163 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
164 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
165 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
166 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
167 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
168 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
231 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
232 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
233 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
235 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
236 3300028036 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 Metagenome Rhizosphere
237 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
241 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
242 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
243 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
244 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
245 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
246 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
247 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
248 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
249 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
250 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
251 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
252 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
253 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
254 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
255 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
256 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
257 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
258 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
259 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
260 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
261 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
262 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
263 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
264 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
265 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
266 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
267 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
268 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
269 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
270 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
271 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
272 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
273 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
274 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
275 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
276 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
277 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
278 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
279 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
280 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
281 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
282 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
283 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
284 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
285 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
286 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
287 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
288 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
289 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
290 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
291 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
292 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
293 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
294 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
295 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
296 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
297 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
298 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
299 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
300 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
301 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
302 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
303 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
304 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
305 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
306 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
307 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
308 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
309 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
310 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
311 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
312 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
313 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
314 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
315 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
316 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
317 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
318 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
319 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
320 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
321 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
322 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
323 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
324 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
325 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
326 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
327 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
328 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
329 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
330 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
331 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
332 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
333 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
334 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
335 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
336 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
337 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
338 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
339 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
340 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
341 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
342 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
343 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
344 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
345 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
346 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
347 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
348 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
349 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
350 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
351 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
352 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
353 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
354 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
355 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
356 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
357 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
358 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
359 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
360 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
361 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
362 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
363 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
364 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
365 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
366 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
367 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
368 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
369 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
370 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
371 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
372 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
373 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
374 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
375 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
376 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
377 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
378 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
379 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
380 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
381 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
382 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
383 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
384 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
385 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
386 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
387 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
388 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
389 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
390 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
391 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
392 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
393 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
394 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
395 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
396 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
397 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
398 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
399 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
400 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
401 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
402 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
403 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
404 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
405 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
406 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
407 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
408 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
409 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
410 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
411 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
412 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
413 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
414 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
415 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
416 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
417 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
418 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
419 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
420 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
421 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
422 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
423 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
424 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
425 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
426 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
427 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
428 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
429 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
430 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
431 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
432 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
433 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
434 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
435 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
436 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
437 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
438 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
439 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
440 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
441 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
442 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
443 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
444 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
445 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
446 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
447 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
448 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
449 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
450 3300053106 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere Metagenome Endosphere
451 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
452 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
453 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
454 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
455 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
456 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
457 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
458 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
459 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
460 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
461 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
462 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
463 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
464 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
465 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
466 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
467 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
468 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
469 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
470 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
471 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
472 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
473 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
474 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
475 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
476 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
477 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
478 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
479 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
480 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
481 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.5
Metatranscriptomes 0.33
Isolates 0.17

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.17
Nodule 1.24
Rhizoplane 7.62
Rhizosphere 72.66
Stem 0
Stem Tuber 0
Unclassified 4.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1012257 3300001977 Bacteria 1254
2 JGI24737J22298_10097201 3300001990 Bacteria 873
3 JGI24743J22301_10018930 3300001991 Bacteria 1305
4 JGI24750J21931_1006628 3300002070 Bacteria 1445
5 JGI24748J21848_1002927 3300002074 Bacteria 1945
6 JGI24738J21930_10014138 3300002075 Bacteria 1716
7 JGI24744J21845_10004502 3300002077 Bacteria 2879
8 JGI24742J22300_10003801 3300002244 Bacteria 2453
9 JGI24742J22300_10050271 3300002244 Bacteria 754
10 JGI25406J46586_10000141 3300003203 Bacteria 31326
11 JGI25165J46597_1000079 3300003214 Bacteria 179163
12 JGI25153J46596_10000083 3300003215 Bacteria 112056
13 JGI25153J46596_10001465 3300003215 Bacteria 14081
14 JGI25153J46596_10026936 3300003215 Bacteria 2024
15 JGI25153J46596_10096827 3300003215 Bacteria 701
16 rootL2_10033170 3300003322 Bacteria 1217
17 rootL2_10033171 3300003322 Bacteria 1025
18 rootL2_10340203 3300003322 Bacteria 1269
19 JGI25404J52841_10022631 3300003659 Bacteria 1358
20 JGI25404J52841_10114191 3300003659 Bacteria 568
21 Ga0055529_1003576 3300003763 Bacteria 2542
22 Ga0055531_10008570 3300003794 Bacteria 5367
23 Ga0070658_10998829 3300005327 Bacteria 728
24 Ga0070676_10038116 3300005328 Bacteria 2775
25 Ga0070676_10441965 3300005328 Bacteria 913
26 Ga0070683_100043821 3300005329 Bacteria 4124
27 Ga0070683_100058699 3300005329 Bacteria 3574
28 Ga0070683_100369195 3300005329 Bacteria 1367
29 Ga0070683_100481303 3300005329 Bacteria 1185
30 Ga0070690_100033424 3300005330 Bacteria 3219
31 Ga0070690_100227885 3300005330 Bacteria 1309
32 Ga0070670_100034140 3300005331 Bacteria 4379
33 Ga0070670_100222100 3300005331 Bacteria 1644
34 Ga0070677_10126034 3300005333 Bacteria 1163
35 Ga0068869_100103670 3300005334 Bacteria 2155
36 Ga0068869_100820464 3300005334 Bacteria 800
37 Ga0070666_10021441 3300005335 Bacteria 4188
38 Ga0070666_10237036 3300005335 Bacteria 1289
39 Ga0070680_100186297 3300005336 Bacteria 1748
40 Ga0070682_100432072 3300005337 Bacteria 1004
41 Ga0068868_100032452 3300005338 Bacteria 4017
42 Ga0068868_100076529 3300005338 Bacteria 2675
43 Ga0068868_100190280 3300005338 Bacteria 1706
44 Ga0070689_100261093 3300005340 Bacteria 1432
45 Ga0070689_101386274 3300005340 Bacteria 635
46 Ga0070691_10211391 3300005341 Bacteria 1023
47 Ga0070687_100324798 3300005343 Bacteria 984
48 Ga0070661_100115681 3300005344 Bacteria 2006
49 Ga0070661_100149347 3300005344 Bacteria 1766
50 Ga0070668_100051916 3300005347 Bacteria 3160
51 Ga0070668_100338781 3300005347 Bacteria 1270
52 Ga0070668_100749340 3300005347 Bacteria 864
53 Ga0070668_101286140 3300005347 Bacteria 664
54 Ga0070669_100427826 3300005353 Bacteria 1088
55 Ga0070675_100292425 3300005354 Bacteria 1434
56 Ga0070671_100068026 3300005355 Bacteria 2970
57 Ga0070671_100157423 3300005355 Bacteria 1919
58 Ga0070671_100193026 3300005355 Bacteria 1726
59 Ga0070671_101110758 3300005355 Bacteria 694
60 Ga0070674_100103785 3300005356 Bacteria 2076
61 Ga0070674_100165038 3300005356 Bacteria 1684
62 Ga0070674_100400327 3300005356 Bacteria 1122
63 Ga0070673_100206555 3300005364 Bacteria 1694
64 Ga0070673_100338577 3300005364 Bacteria 1332
65 Ga0070688_100011699 3300005365 Bacteria 4888
66 Ga0070659_100018907 3300005366 Bacteria 5205
67 Ga0070659_100258131 3300005366 Bacteria 1446
68 Ga0070659_100637824 3300005366 Bacteria 918
69 Ga0070659_102168327 3300005366 Bacteria 500
70 Ga0070667_100126724 3300005367 Bacteria 2225
71 Ga0070667_100128355 3300005367 Bacteria 2211
72 Ga0070703_10049713 3300005406 Bacteria 1336
73 Ga0070709_10034131 3300005434 Bacteria 3083
74 Ga0070709_10063854 3300005434 Bacteria 2353
75 Ga0070709_10092025 3300005434 Bacteria 2002
76 Ga0070714_100023528 3300005435 Bacteria 5064
77 Ga0070714_100419139 3300005435 Bacteria 1268
78 Ga0070714_100475385 3300005435 Bacteria 1189
79 Ga0070714_100622306 3300005435 Bacteria 1038
80 Ga0070714_100745294 3300005435 Bacteria 947
81 Ga0070714_100910647 3300005435 Bacteria 854
82 Ga0070713_100082405 3300005436 Bacteria 2747
83 Ga0070713_100103250 3300005436 Bacteria 2473
84 Ga0070713_100126649 3300005436 Bacteria 2247
85 Ga0070713_100202463 3300005436 Bacteria 1793
86 Ga0070713_100333438 3300005436 Bacteria 1404
87 Ga0070710_10061973 3300005437 Bacteria 2132
88 Ga0070710_10555368 3300005437 Bacteria 793
89 Ga0070711_100013376 3300005439 Bacteria 5154
90 Ga0070711_100623599 3300005439 Bacteria 902
91 Ga0070705_100135126 3300005440 Bacteria 1614
92 Ga0070700_100096999 3300005441 Bacteria 1935
93 Ga0070700_100369672 3300005441 Bacteria 1069
94 Ga0070694_100309001 3300005444 Bacteria 1214
95 Ga0070663_100013068 3300005455 Bacteria 5275
96 Ga0070663_100153170 3300005455 Bacteria 1769
97 Ga0070663_100232418 3300005455 Bacteria 1452
98 Ga0070663_100582960 3300005455 Bacteria 938
99 Ga0070678_100015000 3300005456 Bacteria 4907
100 Ga0070678_100597917 3300005456 Bacteria 984
101 Ga0070678_101355815 3300005456 Bacteria 663
102 Ga0070662_100010380 3300005457 Bacteria 6107
103 Ga0070662_100102222 3300005457 Bacteria 2171
104 Ga0070662_100225935 3300005457 Bacteria 1496
105 Ga0070662_100553911 3300005457 Bacteria 964
106 Ga0070681_10036625 3300005458 Bacteria 4926
107 Ga0070681_10092772 3300005458 Bacteria 2968
108 Ga0070681_10356089 3300005458 Bacteria 1374
109 Ga0068867_101307242 3300005459 Bacteria 670
110 Ga0070685_10005252 3300005466 Bacteria 6570
111 Ga0070706_100510191 3300005467 Bacteria 1118
112 Ga0070706_101865801 3300005467 Bacteria 546
113 Ga0070698_100263292 3300005471 Bacteria 1656
114 Ga0070698_100556222 3300005471 Bacteria 1087
115 Ga0070698_101345321 3300005471 Bacteria 665
116 Ga0070699_100168274 3300005518 Bacteria 1942
117 Ga0070679_100207552 3300005530 Bacteria 1923
118 Ga0070679_100570664 3300005530 Bacteria 1075
119 Ga0070679_100924664 3300005530 Bacteria 816
120 Ga0070684_100169809 3300005535 Bacteria 1981
121 Ga0070697_100165328 3300005536 Bacteria 1871
122 Ga0068853_100007218 3300005539 Bacteria 8900
123 Ga0068853_100013283 3300005539 Bacteria 6724
124 Ga0068853_100035353 3300005539 Bacteria 4244
125 Ga0068853_100267736 3300005539 Bacteria 1573
126 Ga0068853_100343778 3300005539 Bacteria 1387
127 Ga0068853_100856995 3300005539 Bacteria 872
128 Ga0068853_101423548 3300005539 Bacteria 671
129 Ga0068853_101688986 3300005539 Bacteria 614
130 Ga0070672_100001580 3300005543 Bacteria 14111
131 Ga0070672_100231700 3300005543 Bacteria 1552
132 Ga0070686_100015908 3300005544 Bacteria 4368
133 Ga0070695_100711901 3300005545 Bacteria 798
134 Ga0070696_100062520 3300005546 Bacteria 2606
135 Ga0070696_100209183 3300005546 Bacteria 1460
136 Ga0070693_100002880 3300005547 Bacteria 7934
137 Ga0070693_100018934 3300005547 Bacteria 3603
138 Ga0070693_100195011 3300005547 Bacteria 1312
139 Ga0070665_100002371 3300005548 Bacteria 20814
140 Ga0070665_100049057 3300005548 Bacteria 4237
141 Ga0070665_100056376 3300005548 Bacteria 3939
142 Ga0070665_100155645 3300005548 Bacteria 2288
143 Ga0070665_100233455 3300005548 Bacteria 1840
144 Ga0070665_100242469 3300005548 Bacteria 1803
145 Ga0070665_100325675 3300005548 Bacteria 1541
146 Ga0070665_100490466 3300005548 Bacteria 1239
147 Ga0070665_100655738 3300005548 Bacteria 1063
148 Ga0070665_100674530 3300005548 Bacteria 1047
149 Ga0070665_102447995 3300005548 Bacteria 524
150 Ga0070704_100102880 3300005549 Bacteria 2156
151 Ga0068855_100030970 3300005563 Bacteria 6393
152 Ga0068855_100043783 3300005563 Bacteria 5300
153 Ga0068855_100685732 3300005563 Bacteria 1097
154 Ga0068855_101039975 3300005563 Bacteria 859
155 Ga0070664_100227073 3300005564 Bacteria 1672
156 Ga0070664_100267727 3300005564 Bacteria 1538
157 Ga0070664_100671212 3300005564 Bacteria 964
158 Ga0070664_101170780 3300005564 Bacteria 725
159 Ga0068857_100294146 3300005577 Bacteria 1496
160 Ga0068857_100767578 3300005577 Bacteria 919
161 Ga0068857_101267265 3300005577 Bacteria 715
162 Ga0068854_101329044 3300005578 Bacteria 648
163 Ga0068856_101169245 3300005614 Bacteria 786
164 Ga0068856_102124311 3300005614 Bacteria 571
165 Ga0070702_100008859 3300005615 Bacteria 4895
166 Ga0070702_100277779 3300005615 Bacteria 1148
167 Ga0068852_100021320 3300005616 Bacteria 5171
168 Ga0068852_101542836 3300005616 Bacteria 686
169 Ga0068859_100653386 3300005617 Bacteria 1143
170 Ga0068859_102301750 3300005617 Bacteria 594
171 Ga0068864_100050102 3300005618 Bacteria 3593
172 Ga0068864_100405846 3300005618 Bacteria 1296
173 Ga0068864_101871450 3300005618 Bacteria 606
174 Ga0068866_10023225 3300005718 Bacteria 2881
175 Ga0068861_100196403 3300005719 Bacteria 1690
176 Ga0068861_100257786 3300005719 Bacteria 1491
177 Ga0068851_10102114 3300005834 Bacteria 1523
178 Ga0068870_10030330 3300005840 Bacteria 2732
179 Ga0068870_10478712 3300005840 Bacteria 826
180 Ga0068863_100097929 3300005841 Bacteria 2785
181 Ga0068858_100023824 3300005842 Bacteria 5704
182 Ga0068858_100128455 3300005842 Bacteria 2375
183 Ga0068858_100166815 3300005842 Bacteria 2075
184 Ga0068858_100224742 3300005842 Bacteria 1779
185 Ga0068858_100852709 3300005842 Bacteria 890
186 Ga0068860_100001170 3300005843 Bacteria 28729
187 Ga0068860_100125230 3300005843 Bacteria 2462
188 Ga0068860_100132585 3300005843 Bacteria 2392
189 Ga0068860_100152561 3300005843 Bacteria 2225
190 Ga0068860_100172976 3300005843 Bacteria 2086
191 Ga0068860_100860619 3300005843 Bacteria 921
192 Ga0068860_101454885 3300005843 Bacteria 707
193 Ga0068862_100081947 3300005844 Bacteria 2799
194 Ga0081455_10009004 3300005937 Bacteria 10307
195 Ga0081455_10079109 3300005937 Bacteria 2700
196 Ga0081455_10528343 3300005937 Bacteria 785
197 Ga0081540_1005695 3300005983 Bacteria 9246
198 Ga0081540_1011062 3300005983 Bacteria 6059
199 Ga0081540_1021860 3300005983 Bacteria 3792
200 Ga0081540_1036990 3300005983 Bacteria 2594
201 Ga0081540_1207613 3300005983 Bacteria 707
202 Ga0081539_10000008 3300005985 Bacteria 525071
203 Ga0070717_10012822 3300006028 Bacteria 6399
204 Ga0070717_10044494 3300006028 Bacteria 3625
205 Ga0070717_10071458 3300006028 Bacteria 2895
206 Ga0070717_10190210 3300006028 Bacteria 1793
207 Ga0070717_10411620 3300006028 Bacteria 1215
208 Ga0070717_10914881 3300006028 Bacteria 799
209 Ga0070717_11180492 3300006028 Bacteria 697
210 Ga0075365_10030954 3300006038 Bacteria 3431
211 Ga0075365_10031232 3300006038 Bacteria 3416
212 Ga0075365_10031422 3300006038 Bacteria 3406
213 Ga0075365_10031723 3300006038 Bacteria 3391
214 Ga0075365_10188458 3300006038 Bacteria 1443
215 Ga0075365_10551704 3300006038 Bacteria 815
216 Ga0075368_10021264 3300006042 Bacteria 2463
217 Ga0075368_10355637 3300006042 Bacteria 638
218 Ga0075363_100197415 3300006048 Bacteria 1149
219 Ga0075363_100223520 3300006048 Bacteria 1079
220 Ga0075363_100293967 3300006048 Bacteria 942
221 Ga0075364_10135749 3300006051 Bacteria 1652
222 Ga0075364_10180179 3300006051 Bacteria 1429
223 Ga0075364_10374629 3300006051 Bacteria 971
224 Ga0075364_11017455 3300006051 Bacteria 563
225 Ga0070715_10149386 3300006163 Bacteria 1143
226 Ga0070716_100560142 3300006173 Bacteria 854
227 Ga0070716_100714808 3300006173 Bacteria 767
228 Ga0070712_100197388 3300006175 Bacteria 1578
229 Ga0070712_100255778 3300006175 Bacteria 1401
230 Ga0070712_100705437 3300006175 Bacteria 860
231 Ga0070712_100800477 3300006175 Bacteria 809
232 Ga0070712_101045216 3300006175 Bacteria 708
233 Ga0070712_101486738 3300006175 Bacteria 592
234 Ga0075362_10021853 3300006177 Bacteria 2691
235 Ga0075362_10091762 3300006177 Bacteria 1410
236 Ga0075367_10044838 3300006178 Bacteria 2594
237 Ga0075367_10138219 3300006178 Bacteria 1508
238 Ga0075367_10305473 3300006178 Bacteria 1002
239 Ga0075369_10038126 3300006186 Bacteria 2050
240 Ga0075369_10196175 3300006186 Bacteria 931
241 Ga0075369_10247548 3300006186 Bacteria 827
242 Ga0075369_10592383 3300006186 Bacteria 531
243 Ga0075366_10020582 3300006195 Bacteria 3830
244 Ga0075366_10326100 3300006195 Bacteria 941
245 Ga0075366_10428845 3300006195 Bacteria 815
246 Ga0097621_100000035 3300006237 Bacteria 68179
247 Ga0097621_100041237 3300006237 Bacteria 3715
248 Ga0097621_100086763 3300006237 Bacteria 2612
249 Ga0075370_10020680 3300006353 Bacteria 3600
250 Ga0075370_10092306 3300006353 Bacteria 1747
251 Ga0075370_10328369 3300006353 Bacteria 912
252 Ga0075370_10568578 3300006353 Bacteria 686
253 Ga0068871_100000287 3300006358 Bacteria 35135
254 Ga0068871_100039246 3300006358 Bacteria 3787
255 Ga0068871_100184888 3300006358 Bacteria 1792
256 Ga0068871_100253556 3300006358 Bacteria 1533
257 Ga0068871_100376370 3300006358 Bacteria 1261
258 Ga0075428_100018258 3300006844 Bacteria 7752
259 Ga0075428_100261173 3300006844 Bacteria 1864
260 Ga0075428_100262480 3300006844 Bacteria 1859
261 Ga0075430_100148246 3300006846 Bacteria 1954
262 Ga0075431_100250536 3300006847 Bacteria 1799
263 Ga0075433_10911523 3300006852 Bacteria 767
264 Ga0075433_10997282 3300006852 Bacteria 730
265 Ga0075434_100151718 3300006871 Bacteria 2337
266 Ga0075434_100902373 3300006871 Bacteria 898
267 Ga0075429_101095470 3300006880 Bacteria 696
268 Ga0068865_100397117 3300006881 Bacteria 1128
269 Ga0068865_100493023 3300006881 Bacteria 1020
270 Ga0075436_100058654 3300006914 Bacteria 2659
271 Ga0097620_100653378 3300006931 Bacteria 1143
272 Ga0097620_102302830 3300006931 Bacteria 594
273 Ga0099825_1019193 3300006941 Bacteria 5138
274 Ga0099825_1022726 3300006941 Bacteria 3987
275 Ga0099824_1028856 3300006942 Bacteria 2448
276 Ga0099824_1056536 3300006942 Bacteria 666
277 Ga0099823_1000042 3300006944 Bacteria 60927
278 Ga0099823_1068153 3300006944 Bacteria 1648
279 Ga0075435_100399102 3300007076 Bacteria 1183
280 Ga0099794_10044503 3300007265 Bacteria 2122
281 Ga0099795_10084919 3300007788 Bacteria 1217
282 Ga0099795_10135349 3300007788 Bacteria 998
283 Ga0105240_10003004 3300009093 Bacteria 26546
284 Ga0105240_10167862 3300009093 Bacteria 2602
285 Ga0105240_10177698 3300009093 Bacteria 2515
286 Ga0105240_10186744 3300009093 Bacteria 2441
287 Ga0105240_11583468 3300009093 Bacteria 686
288 Ga0105240_12388768 3300009093 Bacteria 547
289 Ga0111539_10279104 3300009094 Bacteria 1944
290 Ga0111539_10660878 3300009094 Bacteria 1217
291 Ga0111539_13112131 3300009094 Bacteria 535
292 Ga0105245_10023627 3300009098 Bacteria 5397
293 Ga0105245_10177430 3300009098 Bacteria 2033
294 Ga0105245_10436964 3300009098 Bacteria 1315
295 Ga0105245_11803904 3300009098 Bacteria 664
296 Ga0105245_11948922 3300009098 Bacteria 641
297 Ga0105247_10008014 3300009101 Bacteria 6456
298 Ga0105247_10047677 3300009101 Bacteria 2631
299 Ga0114129_10018100 3300009147 Bacteria 10036
300 Ga0114129_10179083 3300009147 Bacteria 2886
301 Ga0114129_10197396 3300009147 Bacteria 2728
302 Ga0114129_11143862 3300009147 Bacteria 972
303 Ga0114129_12426892 3300009147 Bacteria 628
304 Ga0105243_10059744 3300009148 Bacteria 3044
305 Ga0105241_10031877 3300009174 Bacteria 3947
306 Ga0105242_10071280 3300009176 Bacteria 2883
307 Ga0105242_10094307 3300009176 Bacteria 2524
308 Ga0105242_10375559 3300009176 Bacteria 1320
309 Ga0105248_10026597 3300009177 Bacteria 6435
310 Ga0105248_10248346 3300009177 Bacteria 2003
311 Ga0105248_10983788 3300009177 Bacteria 953
312 Ga0105248_12120140 3300009177 Bacteria 639
313 Ga0105237_10014439 3300009545 Bacteria 8260
314 Ga0105237_10033837 3300009545 Bacteria 5178
315 Ga0105237_10097347 3300009545 Bacteria 2932
316 Ga0105237_10169585 3300009545 Unclassified 2182
317 Ga0105237_10179726 3300009545 Bacteria 2116
318 Ga0105237_10309840 3300009545 Bacteria 1582
319 Ga0105237_10508770 3300009545 Unclassified 1211
320 Ga0105237_10541218 3300009545 Bacteria 1171
321 Ga0105237_10901705 3300009545 Bacteria 891
322 Ga0105237_11157061 3300009545 Bacteria 780
323 Ga0105237_11333455 3300009545 Bacteria 724
324 Ga0105238_12128875 3300009551 Bacteria 595
325 Ga0105238_12443781 3300009551 Bacteria 558
326 Ga0105249_10026912 3300009553 Bacteria 5186
327 Ga0105249_11377713 3300009553 Bacteria 777
328 Ga0105249_12092050 3300009553 Bacteria 639
329 Ga0099796_10104805 3300010159 Bacteria 1069
330 Ga0099796_10286391 3300010159 Bacteria 694
331 Ga0105239_10013998 3300010375 Bacteria 8908
332 Ga0105239_10047667 3300010375 Bacteria 4696
333 Ga0105239_10098444 3300010375 Bacteria 3233
334 Ga0105239_10544404 3300010375 Bacteria 1322
335 Ga0105239_10932655 3300010375 Bacteria 997
336 Ga0105239_10997278 3300010375 Bacteria 963
337 Ga0105239_11603006 3300010375 Bacteria 753
338 Ga0105239_11762106 3300010375 Bacteria 717
339 Ga0105239_13429890 3300010375 Bacteria 515
340 Ga0105246_10027513 3300011119 Bacteria 3727
341 Ga0105246_10076924 3300011119 Bacteria 2366
342 Ga0105246_10286955 3300011119 Bacteria 1323
343 Ga0105246_10764021 3300011119 Bacteria 854
344 Ga0105246_11186088 3300011119 Bacteria 702
345 Ga0157344_1015975 3300012476 Bacteria 602
346 Ga0157373_11100196 3300013100 Bacteria 596
347 Ga0157369_10137911 3300013105 Bacteria 2582
348 Ga0157369_12184098 3300013105 Bacteria 561
349 Ga0157374_11012590 3300013296 Bacteria 850
350 Ga0157374_11144746 3300013296 Bacteria 799
351 Ga0157374_12637919 3300013296 Bacteria 530
352 Ga0157378_10007983 3300013297 Bacteria 9240
353 Ga0157378_10011018 3300013297 Bacteria 7913
354 Ga0157378_10106621 3300013297 Bacteria 2563
355 Ga0157378_10217973 3300013297 Bacteria 1813
356 Ga0157378_10932975 3300013297 Bacteria 900
357 Ga0157378_11831175 3300013297 Bacteria 655
358 Ga0163162_10033875 3300013306 Bacteria 5078
359 Ga0163162_10086509 3300013306 Bacteria 3212
360 Ga0163162_10128117 3300013306 Bacteria 2646
361 Ga0163162_10161483 3300013306 Bacteria 2363
362 Ga0163162_10244208 3300013306 Bacteria 1927
363 Ga0163162_10446526 3300013306 Bacteria 1425
364 Ga0163162_10576312 3300013306 Bacteria 1253
365 Ga0163162_10991381 3300013306 Bacteria 950
366 Ga0163162_12789136 3300013306 Bacteria 562
367 Ga0157372_10024301 3300013307 Bacteria 6580
368 Ga0157372_10484461 3300013307 Bacteria 1442
369 Ga0157375_10007093 3300013308 Bacteria 9786
370 Ga0157375_10070810 3300013308 Bacteria 3499
371 Ga0157375_11591755 3300013308 Bacteria 772
372 Ga0157375_11844468 3300013308 Bacteria 717
373 Ga0163163_10001366 3300014325 Bacteria 20573
374 Ga0163163_10085274 3300014325 Bacteria 3166
375 Ga0163163_10134185 3300014325 Bacteria 2516
376 Ga0163163_10901598 3300014325 Bacteria 947
377 Ga0163163_11785563 3300014325 Bacteria 675
378 Ga0163163_11863406 3300014325 Bacteria 661
379 Ga0163163_12453279 3300014325 Bacteria 580
380 Ga0157380_10009161 3300014326 Bacteria 7082
381 Ga0157380_10143228 3300014326 Bacteria 2056
382 Ga0157380_11812180 3300014326 Bacteria 670
383 Ga0182008_10034186 3300014497 Bacteria 2549
384 Ga0157377_10037517 3300014745 Bacteria 2670
385 Ga0157377_10351192 3300014745 Bacteria 989
386 Ga0157377_10777228 3300014745 Bacteria 704
387 Ga0157379_10031905 3300014968 Bacteria 4694
388 Ga0157379_10086190 3300014968 Bacteria 2816
389 Ga0157379_10147368 3300014968 Bacteria 2123
390 Ga0157379_10192874 3300014968 Bacteria 1841
391 Ga0157379_10199130 3300014968 Bacteria 1811
392 Ga0157379_10697743 3300014968 Bacteria 952
393 Ga0157376_10074553 3300014969 Bacteria 2893
394 Ga0157376_10109163 3300014969 Bacteria 2432
395 Ga0157376_10877705 3300014969 Bacteria 914
396 Ga0157376_11764805 3300014969 Bacteria 655
397 Ga0182007_10046526 3300015262 Bacteria 1436
398 Ga0163161_10044525 3300017792 Bacteria 3197
399 Ga0163161_11323444 3300017792 Bacteria 627
400 Ga0163161_11374184 3300017792 Bacteria 616
401 Ga0163161_11619543 3300017792 Bacteria 571
402 Ga0213873_10127364 3300021358 Bacteria 752
403 Ga0213873_10142240 3300021358 Bacteria 717
404 Ga0213872_10024600 3300021361 Bacteria 2771
405 Ga0213872_10042073 3300021361 Bacteria 2084
406 Ga0213872_10059182 3300021361 Bacteria 1734
407 Ga0213874_10269325 3300021377 Bacteria 633
408 Ga0213876_10048895 3300021384 Bacteria 2234
409 Ga0213871_10004609 3300021441 Bacteria 2772
410 Ga0213871_10118950 3300021441 Bacteria 786
411 Ga0213871_10203808 3300021441 Bacteria 618
412 Ga0224712_10107837 3300022467 Bacteria 1191
413 Ga0207425_1041828 3300025245 Bacteria 869
414 Ga0209677_100507 3300025253 Bacteria 21817
415 Ga0209148_1000212 3300025254 Bacteria 101454
416 Ga0209233_1028384 3300025261 Bacteria 1342
417 Ga0209455_1000346 3300025272 Bacteria 43799
418 Ga0209564_1024238 3300025295 Bacteria 2078
419 Ga0209758_1000023 3300025297 Bacteria 612453
420 Ga0209758_1000024 3300025297 Bacteria 591966
421 Ga0209758_1000088 3300025297 Bacteria 251547
422 Ga0209758_1002631 3300025297 Bacteria 17834
423 Ga0209758_1004362 3300025297 Bacteria 11837
424 Ga0209758_1024738 3300025297 Bacteria 2664
425 Ga0209758_1034578 3300025297 Bacteria 2007
426 Ga0209758_1067827 3300025297 Bacteria 1139
427 Ga0209050_1001041 3300025298 Bacteria 34372
428 Ga0207426_1147331 3300025302 Bacteria 552
429 Ga0209257_1004708 3300025304 Bacteria 10234
430 Ga0209257_1032451 3300025304 Bacteria 1656
431 Ga0207653_10075677 3300025885 Bacteria 1157
432 Ga0207653_10168951 3300025885 Bacteria 813
433 Ga0207682_10062432 3300025893 Bacteria 1562
434 Ga0207692_10078251 3300025898 Bacteria 1761
435 Ga0207692_10130725 3300025898 Bacteria 1417
436 Ga0207692_10295050 3300025898 Bacteria 985
437 Ga0207692_10483293 3300025898 Bacteria 784
438 Ga0207642_10012459 3300025899 Bacteria 3070
439 Ga0207710_10009583 3300025900 Bacteria 4074
440 Ga0207710_10030393 3300025900 Bacteria 2356
441 Ga0207688_10006010 3300025901 Bacteria 6607
442 Ga0207688_10072928 3300025901 Bacteria 1951
443 Ga0207647_10021697 3300025904 Bacteria 4282
444 Ga0207647_10085968 3300025904 Bacteria 1880
445 Ga0207647_10144726 3300025904 Bacteria 1392
446 Ga0207685_10081867 3300025905 Bacteria 1338
447 Ga0207699_10071844 3300025906 Bacteria 2118
448 Ga0207699_10277842 3300025906 Bacteria 1163
449 Ga0207699_10292559 3300025906 Bacteria 1135
450 Ga0207643_10021169 3300025908 Bacteria 3571
451 Ga0207643_10353632 3300025908 Bacteria 923
452 Ga0207705_10405777 3300025909 Bacteria 1054
453 Ga0207654_10100295 3300025911 Bacteria 1783
454 Ga0207707_10007211 3300025912 Bacteria 9678
455 Ga0207707_10090754 3300025912 Bacteria 2670
456 Ga0207707_10528609 3300025912 Bacteria 1004
457 Ga0207695_10006643 3300025913 Bacteria 14926
458 Ga0207695_10091125 3300025913 Bacteria 3063
459 Ga0207695_10095017 3300025913 Bacteria 2986
460 Ga0207695_10272858 3300025913 Bacteria 1586
461 Ga0207695_10678900 3300025913 Bacteria 911
462 Ga0207695_11399725 3300025913 Bacteria 580
463 Ga0207671_10076274 3300025914 Bacteria 2508
464 Ga0207671_10076601 3300025914 Bacteria 2503
465 Ga0207671_10236225 3300025914 Bacteria 1435
466 Ga0207671_10388131 3300025914 Bacteria 1110
467 Ga0207671_10566443 3300025914 Bacteria 906
468 Ga0207671_10838877 3300025914 Bacteria 728
469 Ga0207693_10012845 3300025915 Bacteria 6756
470 Ga0207693_10076719 3300025915 Bacteria 2617
471 Ga0207693_10379114 3300025915 Bacteria 1106
472 Ga0207693_10412228 3300025915 Bacteria 1056
473 Ga0207693_10574305 3300025915 Bacteria 879
474 Ga0207693_10675093 3300025915 Bacteria 801
475 Ga0207693_11199143 3300025915 Bacteria 572
476 Ga0207663_10174673 3300025916 Bacteria 1529
477 Ga0207663_10216629 3300025916 Bacteria 1391
478 Ga0207663_10480239 3300025916 Bacteria 963
479 Ga0207660_10739834 3300025917 Bacteria 802
480 Ga0207662_10167134 3300025918 Bacteria 1409
481 Ga0207657_10100812 3300025919 Bacteria 2397
482 Ga0207657_10252533 3300025919 Bacteria 1405
483 Ga0207649_10097014 3300025920 Bacteria 1943
484 Ga0207649_10211551 3300025920 Bacteria 1376
485 Ga0207649_10315616 3300025920 Bacteria 1147
486 Ga0207649_10349031 3300025920 Bacteria 1095
487 Ga0207652_10053798 3300025921 Bacteria 3458
488 Ga0207652_10100168 3300025921 Bacteria 2558
489 Ga0207652_10407937 3300025921 Bacteria 1226
490 Ga0207652_11140228 3300025921 Bacteria 681
491 Ga0207646_10956437 3300025922 Unclassified 758
492 Ga0207681_10230161 3300025923 Bacteria 1438
493 Ga0207681_10732291 3300025923 Bacteria 823
494 Ga0207694_10234203 3300025924 Bacteria 1500
495 Ga0207650_10010331 3300025925 Bacteria 6401
496 Ga0207650_10413512 3300025925 Bacteria 1118
497 Ga0207659_10158051 3300025926 Bacteria 1777
498 Ga0207659_11891521 3300025926 Bacteria 506
499 Ga0207687_10024453 3300025927 Bacteria 4036
500 Ga0207700_10021355 3300025928 Bacteria 4419
501 Ga0207700_10073919 3300025928 Bacteria 2634
502 Ga0207700_10075840 3300025928 Bacteria 2607
503 Ga0207700_10091261 3300025928 Bacteria 2406
504 Ga0207700_10301408 3300025928 Bacteria 1384
505 Ga0207700_10579259 3300025928 Bacteria 998
506 Ga0207700_11070598 3300025928 Bacteria 721
507 Ga0207664_10023209 3300025929 Bacteria 4645
508 Ga0207664_10078282 3300025929 Bacteria 2681
509 Ga0207664_11249774 3300025929 Bacteria 661
510 Ga0207644_10070892 3300025931 Bacteria 2548
511 Ga0207644_10160494 3300025931 Bacteria 1747
512 Ga0207644_10177591 3300025931 Bacteria 1667
513 Ga0207644_10474873 3300025931 Bacteria 1029
514 Ga0207644_10996155 3300025931 Bacteria 703
515 Ga0207690_10064302 3300025932 Bacteria 2505
516 Ga0207690_11250754 3300025932 Bacteria 620
517 Ga0207706_10004538 3300025933 Bacteria 13031
518 Ga0207706_10022493 3300025933 Bacteria 5658
519 Ga0207706_10048734 3300025933 Bacteria 3746
520 Ga0207706_10550051 3300025933 Bacteria 994
521 Ga0207686_10012066 3300025934 Bacteria 4747
522 Ga0207686_10156230 3300025934 Bacteria 1594
523 Ga0207686_10221104 3300025934 Bacteria 1368
524 Ga0207686_10433306 3300025934 Bacteria 1008
525 Ga0207670_10117508 3300025936 Bacteria 1927
526 Ga0207670_11619697 3300025936 Bacteria 551
527 Ga0207669_10000778 3300025937 Bacteria 13668
528 Ga0207669_10002431 3300025937 Bacteria 7939
529 Ga0207669_10263959 3300025937 Bacteria 1289
530 Ga0207669_11171849 3300025937 Bacteria 650
531 Ga0207704_10032314 3300025938 Bacteria 2960
532 Ga0207704_10111523 3300025938 Bacteria 1850
533 Ga0207704_11127000 3300025938 Bacteria 667
534 Ga0207665_10061239 3300025939 Bacteria 2550
535 Ga0207665_10619454 3300025939 Bacteria 846
536 Ga0207665_10846094 3300025939 Bacteria 724
537 Ga0207665_11465611 3300025939 Bacteria 543
538 Ga0207691_10185746 3300025940 Bacteria 1815
539 Ga0207711_10010855 3300025941 Bacteria 7570
540 Ga0207711_10028877 3300025941 Bacteria 4672
541 Ga0207711_10053294 3300025941 Bacteria 3469
542 Ga0207689_10006931 3300025942 Bacteria 9966
543 Ga0207689_10081554 3300025942 Bacteria 2659
544 Ga0207661_10097234 3300025944 Bacteria 2465
545 Ga0207679_10071976 3300025945 Bacteria 2610
546 Ga0207679_10296096 3300025945 Bacteria 1393
547 Ga0207667_10179957 3300025949 Bacteria 2171
548 Ga0207667_10906422 3300025949 Bacteria 873
549 Ga0207651_10577923 3300025960 Bacteria 980
550 Ga0207651_10924009 3300025960 Bacteria 778
551 Ga0207712_10038736 3300025961 Bacteria 3261
552 Ga0207712_10476651 3300025961 Bacteria 1063
553 Ga0207712_12047407 3300025961 Bacteria 512
554 Ga0207668_10042593 3300025972 Bacteria 3075
555 Ga0207668_10048038 3300025972 Bacteria 2926
556 Ga0207668_10102188 3300025972 Bacteria 2132
557 Ga0207668_10340803 3300025972 Bacteria 1250
558 Ga0207668_10485949 3300025972 Bacteria 1060
559 Ga0207668_10792164 3300025972 Bacteria 838
560 Ga0207668_11051069 3300025972 Bacteria 729
561 Ga0207640_10138593 3300025981 Bacteria 1770
562 Ga0207640_10603315 3300025981 Bacteria 930
563 Ga0207658_10066476 3300025986 Bacteria 2712
564 Ga0207658_11895337 3300025986 Bacteria 543
565 Ga0207677_10005949 3300026023 Bacteria 6641
566 Ga0207677_10059799 3300026023 Bacteria 2630
567 Ga0207677_10106102 3300026023 Bacteria 2080
568 Ga0207677_11863667 3300026023 Bacteria 559
569 Ga0207703_10104853 3300026035 Bacteria 2402
570 Ga0207703_10185478 3300026035 Bacteria 1838
571 Ga0207703_10203088 3300026035 Bacteria 1762
572 Ga0207703_10654354 3300026035 Bacteria 997
573 Ga0207703_12382147 3300026035 Bacteria 505
574 Ga0207639_10003894 3300026041 Bacteria 10063
575 Ga0207639_10072338 3300026041 Bacteria 2699
576 Ga0207639_10099123 3300026041 Bacteria 2350
577 Ga0207639_10121329 3300026041 Bacteria 2148
578 Ga0207639_10168708 3300026041 Bacteria 1851
579 Ga0207639_10206696 3300026041 Bacteria 1687
580 Ga0207639_11328620 3300026041 Bacteria 675
581 Ga0207678_10007720 3300026067 Bacteria 9502
582 Ga0207678_10014332 3300026067 Bacteria 6970
583 Ga0207678_10083544 3300026067 Bacteria 2731
584 Ga0207678_10097072 3300026067 Bacteria 2518
585 Ga0207678_10356616 3300026067 Bacteria 1262
586 Ga0207678_10358063 3300026067 Bacteria 1259
587 Ga0207708_10500408 3300026075 Bacteria 1018
588 Ga0207708_10630723 3300026075 Bacteria 911
589 Ga0207708_11329141 3300026075 Bacteria 630
590 Ga0207702_10101401 3300026078 Bacteria 2542
591 Ga0207702_10171000 3300026078 Bacteria 1992
592 Ga0207641_10091482 3300026088 Bacteria 2662
593 Ga0207648_10198595 3300026089 Bacteria 1779
594 Ga0207648_11044087 3300026089 Bacteria 766
595 Ga0207648_11895837 3300026089 Bacteria 558
596 Ga0207676_10016623 3300026095 Bacteria 5328
597 Ga0207676_10251174 3300026095 Bacteria 1592
598 Ga0207676_11089961 3300026095 Bacteria 789
599 Ga0207674_10630287 3300026116 Bacteria 1035
600 Ga0207674_11446027 3300026116 Bacteria 657
601 Ga0207675_100163040 3300026118 Bacteria 2127
602 Ga0207675_100202011 3300026118 Bacteria 1909
603 Ga0207675_100643578 3300026118 Bacteria 1066
604 Ga0207675_102483021 3300026118 Bacteria 529
605 Ga0207683_10060851 3300026121 Bacteria 3320
606 Ga0207683_10084312 3300026121 Bacteria 2824
607 Ga0207683_10309922 3300026121 Bacteria 1445
608 Ga0207683_11238186 3300026121 Bacteria 691
609 Ga0207698_10183264 3300026142 Bacteria 1857
610 Ga0207698_12658993 3300026142 Bacteria 509
611 Ga0209389_1000135 3300027296 Bacteria 64901
612 Ga0209389_1051273 3300027296 Bacteria 2844
613 Ga0209389_1078013 3300027296 Bacteria 1656
614 Ga0209489_100653 3300027361 Bacteria 67569
615 Ga0209489_117682 3300027361 Bacteria 3128
616 Ga0209489_121234 3300027361 Bacteria 1656
617 Ga0209700_100076 3300027363 Bacteria 138075
618 Ga0209700_100417 3300027363 Bacteria 77663
619 Ga0209588_1020041 3300027671 Bacteria 2092
620 Ga0209588_1280291 3300027671 Bacteria 504
621 Ga0209813_10153406 3300027866 Bacteria 827
622 Ga0209813_10177054 3300027866 Bacteria 778
623 Ga0207428_10828678 3300027907 Bacteria 656
624 Ga0207428_11055287 3300027907 Unclassified 569
625 Ga0265355_1012723 3300028036 Bacteria 699
626 Ga0268266_10000538 3300028379 Bacteria 52841
627 Ga0268266_10002070 3300028379 Bacteria 22214
628 Ga0268266_10021937 3300028379 Bacteria 5442
629 Ga0268266_10061049 3300028379 Bacteria 3250
630 Ga0268266_10082502 3300028379 Bacteria 2805
631 Ga0268266_10130867 3300028379 Bacteria 2244
632 Ga0268266_10131700 3300028379 Bacteria 2237
633 Ga0268266_10151354 3300028379 Bacteria 2091
634 Ga0268266_10202605 3300028379 Bacteria 1816
635 Ga0268266_11262825 3300028379 Bacteria 714
636 Ga0268265_10010542 3300028380 Bacteria 6240
637 Ga0268265_10403542 3300028380 Bacteria 1264
638 Ga0268265_10474498 3300028380 Bacteria 1173
639 Ga0268265_12445490 3300028380 Bacteria 528
640 Ga0268264_10000187 3300028381 Bacteria 129270
641 Ga0268264_10981947 3300028381 Bacteria 850
642 Ga0268264_11729961 3300028381 Bacteria 636
643 Ga0307517_10041514 3300028786 Bacteria 4966
644 Ga0307511_10000148 3300030521 Bacteria 66671
645 Ga0307511_10172502 3300030521 Bacteria 1185
646 Ga0265762_1032188 3300030760 Bacteria 1000
647 Ga0265763_1019543 3300030763 Bacteria 703
648 Ga0265760_10015070 3300031090 Bacteria 2215
649 Ga0265330_10048809 3300031235 Bacteria 1861
650 Ga0265330_10064136 3300031235 Bacteria 1596
651 Ga0265332_10041215 3300031238 Bacteria 1998
652 Ga0265332_10313682 3300031238 Bacteria 647
653 Ga0265325_10066370 3300031241 Bacteria 1819
654 Ga0265329_10300479 3300031242 Bacteria 542
655 Ga0265340_10013605 3300031247 Bacteria 4271
656 Ga0265339_10001462 3300031249 Bacteria 17474
657 Ga0265339_10012845 3300031249 Bacteria 5092
658 Ga0265339_10320392 3300031249 Bacteria 736
659 Ga0265331_10002616 3300031250 Bacteria 12083
660 Ga0265331_10074139 3300031250 Bacteria 1589
661 Ga0265327_10075135 3300031251 Bacteria 1681
662 Ga0265327_10290248 3300031251 Bacteria 722
663 Ga0265316_10214893 3300031344 Bacteria 1421
664 Ga0307513_10004256 3300031456 Bacteria 19152
665 Ga0307513_10048552 3300031456 Bacteria 4606
666 Ga0307513_11049351 3300031456 Bacteria 526
667 Ga0307509_10302605 3300031507 Bacteria 1346
668 Ga0307509_10458295 3300031507 Bacteria 967
669 Ga0265313_10000583 3300031595 Bacteria 38024
670 Ga0265313_10144237 3300031595 Bacteria 1022
671 Ga0307508_10015508 3300031616 Bacteria 6942
672 Ga0307508_10086902 3300031616 Bacteria 2710
673 Ga0307508_10314881 3300031616 Bacteria 1157
674 Ga0265314_10014316 3300031711 Bacteria 6357
675 Ga0265342_10013591 3300031712 Bacteria 5451
676 Ga0265342_10078644 3300031712 Bacteria 1908
677 Ga0265342_10165583 3300031712 Bacteria 1220
678 Ga0307516_10001085 3300031730 Bacteria 37853
679 Ga0307516_10003990 3300031730 Bacteria 18533
680 Ga0307516_10054944 3300031730 Bacteria 3889
681 Ga0307516_10171992 3300031730 Bacteria 1906
682 Ga0307516_10181888 3300031730 Bacteria 1835
683 Ga0307516_10861546 3300031730 Bacteria 570
684 Ga0307407_10415830 3300031903 Bacteria 968
685 Ga0307412_10691291 3300031911 Bacteria 874
686 Ga0307416_101108203 3300032002 Bacteria 896
687 Ga0307414_10193425 3300032004 Bacteria 1648
688 Ga0307507_10236781 3300033179 Bacteria 1201
689 Ga0307507_10488078 3300033179 Bacteria 668
690 Ga0373930_0027140 3300034816 Bacteria 1159
691 Ga0373959_0075434 3300034820 Bacteria 769
692 Ga0373926_0067511 3300035083 Bacteria 1310
693 Ga0373928_0013984 3300035084 Bacteria 1617
694 Ga0373929_0102134 3300035085 Bacteria 724
695 Ga0373934_0023429 3300035086 Bacteria 2386
696 Ga0373934_0084325 3300035086 Bacteria 1278
697 Ga0373934_0094483 3300035086 Bacteria 1207
698 Ga0373949_0048655 3300035090 Bacteria 1063
699 Ga0373949_0114430 3300035090 Bacteria 752
700 Ga0373952_0022340 3300035092 Bacteria 1343
701 Ga0373923_0016552 3300035111 Bacteria 2804
702 Ga0373923_0051414 3300035111 Bacteria 1729
703 Ga0373923_0601041 3300035111 Bacteria 542
704 Ga0373936_0036045 3300035113 Bacteria 1971
705 Ga0373936_0101381 3300035113 Bacteria 1215
706 Ga0373936_0155166 3300035113 Bacteria 994
707 Ga0373939_0162064 3300035114 Bacteria 822
708 Ga0373941_0097064 3300035115 Bacteria 1020
709 Ga0373945_0022253 3300035116 Bacteria 2182
710 Ga0373945_0241110 3300035116 Bacteria 761
711 Ga0373953_0068663 3300035117 Bacteria 1459
712 Ga0373954_0014990 3300035118 Bacteria 3461
713 Ga0373954_0050959 3300035118 Bacteria 1943
714 Ga0373954_0144140 3300035118 Bacteria 1163
715 Ga0373956_0050116 3300035119 Bacteria 1874
716 Ga0373956_0438577 3300035119 Bacteria 623
717 Ga0373957_0509234 3300035120 Bacteria 524
718 Ga0373960_0002828 3300035121 Bacteria 3931
719 Ga0373943_0035781 3300035170 Bacteria 2375
720 Ga0373943_0057704 3300035170 Bacteria 1930
721 Ga0373943_0125930 3300035170 Bacteria 1366
722 Ga0373955_0096174 3300035172 Bacteria 1694
723 Ga0373955_0123715 3300035172 Bacteria 1505
724 Ga0373955_0679386 3300035172 Bacteria 632
725 Ga0373961_0065203 3300035241 Archaea 1115
726 Ga0373961_0279954 3300035241 Bacteria 612
727 Ga0373931_0005645 3300035691 Bacteria 5806
728 Ga0373931_0283098 3300035691 Bacteria 1019
729 Ga0373935_0003759 3300035692 Bacteria 8861
730 Ga0373935_0013872 3300035692 Bacteria 4865
731 Ga0373935_0048611 3300035692 Bacteria 2686
732 Ga0373935_0308826 3300035692 Bacteria 1119
733 Ga0373927_0004169 3300035695 Bacteria 10157
734 Ga0373927_0021420 3300035695 Bacteria 4237
735 Ga0373927_0023687 3300035695 Bacteria 4019
736 Ga0373927_0028041 3300035695 Bacteria 3674
737 Ga0373927_0073001 3300035695 Bacteria 2222
738 Ga0373927_0707519 3300035695 Bacteria 665
739 Ga0373933_0082380 3300035724 Bacteria 1974
740 Ga0373933_0114248 3300035724 Bacteria 1686
741 Ga0373933_1106047 3300035724 Bacteria 522
742 Ga0373947_0011282 3300035725 Bacteria 5128
743 Ga0373947_0025373 3300035725 Bacteria 3457
744 Ga0373947_0054937 3300035725 Bacteria 2404
745 Ga0373947_0182802 3300035725 Bacteria 1365
746 Ga0373937_0003392 3300036401 Bacteria 13371
747 Ga0373937_0132886 3300036401 Bacteria 2325
748 Ga0373937_0138148 3300036401 Bacteria 2279
749 Ga0373937_0654672 3300036401 Bacteria 996
750 Ga0373937_1164521 3300036401 Bacteria 719
751 Ga0373925_0008051 3300037068 Bacteria 7678
752 Ga0373925_0012799 3300037068 Bacteria 6077
753 Ga0373925_0053000 3300037068 Bacteria 3031
754 Ga0373925_0121764 3300037068 Bacteria 2026
755 Ga0373925_0203417 3300037068 Bacteria 1575
756 Ga0373925_1047653 3300037068 Bacteria 671
757 Ga0373925_1735717 3300037068 Bacteria 509
758 Ga0395900_0411688 3300037418 Bacteria 1314
759 Ga0395900_0520808 3300037418 Bacteria 1137
760 Ga0395898_0050867 3300037466 Bacteria 4054
761 Ga0395898_0308766 3300037466 Bacteria 1509
762 Ga0395905_0170178 3300037471 Bacteria 2046
763 Ga0395905_1214853 3300037471 Bacteria 657
764 Ga0436364_0139836 3300037853 Bacteria 601
765 Ga0436364_0421552 3300037853 Bacteria 1576
766 Ga0395901_0150479 3300038443 Bacteria 2446
767 Ga0436365_0495621 3300039437 Bacteria 2787
768 Ga0436365_0642772 3300039437 Unclassified 644
769 Ga0436365_0661874 3300039437 Bacteria 3222
770 Ga0436360_0224587 3300039438 Bacteria 1500
771 Ga0436360_0258132 3300039438 Bacteria 748
772 Ga0436360_0296010 3300039438 Bacteria 1207
773 Ga0436360_0345518 3300039438 Bacteria 3003
774 Ga0436360_0381778 3300039438 Bacteria 711
775 Ga0436360_0530926 3300039438 Bacteria 7406
776 Ga0436360_0569747 3300039438 Bacteria 531
777 Ga0436360_0585422 3300039438 Bacteria 6564
778 Ga0436360_0598280 3300039438 Bacteria 862
779 Ga0436361_0087582 3300039447 Bacteria 505
780 Ga0436361_0296689 3300039447 Bacteria 10444
781 Ga0436361_0342673 3300039447 Bacteria 1970
782 Ga0436361_0580570 3300039447 Bacteria 11824
783 Ga0436361_0604625 3300039447 Bacteria 771
784 Ga0436361_0668430 3300039447 Bacteria 2229
785 Ga0436361_0804396 3300039447 Bacteria 977
786 Ga0436361_0847865 3300039447 Bacteria 1854
787 Ga0436361_1108985 3300039447 Bacteria 898
788 Ga0436363_0079128 3300039450 Bacteria 797
789 Ga0436363_0219861 3300039450 Bacteria 7550
790 Ga0436363_0637369 3300039450 Bacteria 707
791 Ga0436363_1408653 3300039450 Bacteria 632
792 Ga0436362_0005086 3300039453 Bacteria 2253
793 Ga0436362_0066045 3300039453 Bacteria 774
794 Ga0436362_0319983 3300039453 Bacteria 1880
795 Ga0436362_0362728 3300039453 Bacteria 1535
796 Ga0436362_1207223 3300039453 Bacteria 809
797 Ga0451800_0847615 3300041459 Bacteria 683
798 Ga0439459_0046344 3300042438 Bacteria 941
799 Ga0466966_0601925 3300044684 Bacteria 662
800 Ga0466961_0755586 3300044693 Bacteria 581
801 Ga0466964_0108800 3300044706 Bacteria 1233
802 Ga0466968_0048494 3300044735 Unclassified 1808
803 Ga0466957_0321017 3300044842 Bacteria 1045
804 Ga0466957_0455272 3300044842 Bacteria 882
805 Ga0466957_1194667 3300044842 Bacteria 550
806 Ga0466959_0376170 3300045049 Bacteria 967
807 Ga0466958_0586812 3300045836 Bacteria 725
808 Ga0495617_132591 3300046452 Bacteria 798
809 Ga0495617_134570 3300046452 Bacteria 791
810 Ga0495592_0083966 3300046454 Bacteria 2299
811 Ga0495603_0002503 3300046455 Bacteria 10810
812 Ga0495603_0006600 3300046455 Bacteria 6959
813 Ga0495603_0016575 3300046455 Bacteria 4458
814 Ga0495591_138148 3300046458 Bacteria 589
815 Ga0495629_0030209 3300046459 Bacteria 3842
816 Ga0495629_0566673 3300046459 Bacteria 761
817 Ga0495638_0005411 3300046460 Bacteria 9504
818 Ga0495638_0225485 3300046460 Bacteria 1045
819 Ga0495641_0088339 3300046461 Bacteria 1386
820 Ga0495653_0452446 3300046463 Bacteria 807
821 Ga0495650_0000355 3300046471 Bacteria 81062
822 Ga0495580_0164063 3300046472 Bacteria 1537
823 Ga0495580_0206930 3300046472 Bacteria 1351
824 Ga0495580_0391058 3300046472 Bacteria 938
825 Ga0495580_0740428 3300046472 Bacteria 641
826 Ga0495580_0805929 3300046472 Bacteria 608
827 Ga0495582_0011384 3300046473 Bacteria 4901
828 Ga0495582_0013127 3300046473 Bacteria 4560
829 Ga0495582_0022894 3300046473 Bacteria 3417
830 Ga0495605_0003508 3300046474 Bacteria 9324
831 Ga0495605_0091313 3300046474 Bacteria 1411
832 Ga0495605_0232081 3300046474 Bacteria 795
833 Ga0495639_0009847 3300046475 Bacteria 4103
834 Ga0495639_0103042 3300046475 Bacteria 1349
835 Ga0495639_0400008 3300046475 Bacteria 694
836 Ga0495662_0008018 3300046476 Bacteria 5202
837 Ga0495662_0055060 3300046476 Bacteria 1922
838 Ga0495662_0102251 3300046476 Bacteria 1402
839 Ga0495662_0273019 3300046476 Bacteria 832
840 Ga0495664_0094616 3300046477 Bacteria 1798
841 Ga0495664_0789859 3300046477 Bacteria 558
842 Ga0495584_0247677 3300046491 Bacteria 906
843 Ga0495584_0258110 3300046491 Bacteria 886
844 Ga0495585_0024474 3300046492 Bacteria 3462
845 Ga0495585_0077455 3300046492 Bacteria 1805
846 Ga0495585_0094753 3300046492 Bacteria 1604
847 Ga0495585_0321274 3300046492 Bacteria 757
848 Ga0495594_0036513 3300046499 Bacteria 2679
849 Ga0495594_0556421 3300046499 Bacteria 651
850 Ga0495607_0043454 3300046501 Bacteria 2657
851 Ga0495607_0204590 3300046501 Bacteria 975
852 Ga0495607_0256155 3300046501 Bacteria 840
853 Ga0495583_0000860 3300046506 Bacteria 36891
854 Ga0495583_0012351 3300046506 Bacteria 4840
855 Ga0495606_0002012 3300046507 Bacteria 24965
856 Ga0495606_0425315 3300046507 Bacteria 686
857 Ga0495608_0323159 3300046511 Bacteria 953
858 Ga0495608_0499362 3300046511 Bacteria 737
859 Ga0495610_0000046 3300046512 Bacteria 153789
860 Ga0495610_0088455 3300046512 Bacteria 1408
861 Ga0495610_0359152 3300046512 Bacteria 547
862 Ga0495616_0014970 3300046513 Bacteria 4325
863 Ga0495616_0034251 3300046513 Bacteria 2639
864 Ga0495616_0160155 3300046513 Bacteria 1013
865 Ga0495620_0211516 3300046515 Bacteria 744
866 Ga0495630_0172677 3300046517 Bacteria 1647
867 Ga0495630_0568131 3300046517 Bacteria 870
868 Ga0495631_0002810 3300046518 Bacteria 9667
869 Ga0495631_0368748 3300046518 Bacteria 611
870 Ga0495632_0031510 3300046519 Bacteria 2740
871 Ga0495632_0241145 3300046519 Bacteria 813
872 Ga0495632_0247859 3300046519 Bacteria 799
873 Ga0495637_0070700 3300046520 Bacteria 1409
874 Ga0495643_0180282 3300046522 Bacteria 1027
875 Ga0495648_0227930 3300046524 Bacteria 914
876 Ga0495642_0511153 3300046528 Bacteria 532
877 Ga0495652_0100143 3300046529 Bacteria 2352
878 Ga0495652_0154461 3300046529 Bacteria 1789
879 Ga0495654_0118121 3300046530 Bacteria 1203
880 Ga0495586_0504586 3300046535 Bacteria 698
881 Ga0495586_0601618 3300046535 Bacteria 635
882 Ga0495587_0750518 3300046536 Bacteria 534
883 Ga0495598_0007742 3300046537 Bacteria 2477
884 Ga0495609_0184806 3300046538 Bacteria 876
885 Ga0495609_0434599 3300046538 Bacteria 523
886 Ga0495645_0257498 3300046543 Bacteria 1157
887 Ga0495645_0402597 3300046543 Bacteria 872
888 Ga0495622_0008204 3300046557 Bacteria 4839
889 Ga0495622_0064073 3300046557 Bacteria 1700
890 Ga0495622_0206981 3300046557 Bacteria 873
891 Ga0495667_0514958 3300046559 Bacteria 749
892 Ga0495667_0678854 3300046559 Bacteria 639
893 Ga0495656_0017995 3300046615 Bacteria 2706
894 Ga0495656_0273938 3300046615 Bacteria 858
895 Ga0495656_0641431 3300046615 Bacteria 570
896 Ga0495668_0002555 3300046616 Bacteria 14799
897 Ga0495668_0107162 3300046616 Bacteria 1528
898 Ga0495634_0003625 3300046642 Bacteria 12337
899 Ga0495611_0015617 3300046648 Bacteria 3246
900 Ga0495625_0002001 3300046660 Bacteria 22996
901 Ga0495625_0003868 3300046660 Bacteria 14469
902 Ga0495625_0010556 3300046660 Bacteria 7628
903 Ga0495625_0412012 3300046660 Bacteria 842
904 Ga0495635_0027099 3300046663 Bacteria 3987
905 Ga0495635_0327627 3300046663 Bacteria 1024
906 Ga0495659_0047279 3300046664 Bacteria 1556
907 Ga0495659_0093881 3300046664 Bacteria 1155
908 Ga0495659_0305178 3300046664 Bacteria 673
909 Ga0495661_0052708 3300046665 Bacteria 2450
910 Ga0495661_0202973 3300046665 Bacteria 1037
911 Ga0495661_0556709 3300046665 Bacteria 542
912 Ga0495588_0362994 3300046674 Bacteria 761
913 Ga0495599_0051525 3300046678 Bacteria 2579
914 Ga0495647_0005408 3300046681 Bacteria 4183
915 Ga0495658_0013061 3300046683 Bacteria 4222
916 Ga0495658_0250534 3300046683 Bacteria 1114
917 Ga0495658_0611472 3300046683 Bacteria 698
918 Ga0495669_0419224 3300046684 Bacteria 649
919 Ga0495669_0572051 3300046684 Bacteria 550
920 Ga0495613_0128811 3300046689 Bacteria 1813
921 Ga0495613_0243020 3300046689 Bacteria 1258
922 Ga0495613_0340974 3300046689 Bacteria 1031
923 Ga0495624_0075431 3300046690 Bacteria 2094
924 Ga0495624_0546806 3300046690 Bacteria 691
925 Ga0495670_0065896 3300046691 Bacteria 1826
926 Ga0495670_0137564 3300046691 Bacteria 1276
927 Ga0495671_0327303 3300046692 Bacteria 736
928 Ga0495649_0209571 3300046694 Bacteria 1010
929 Ga0495649_0487914 3300046694 Bacteria 613
930 Ga0495600_0080018 3300046809 Bacteria 2133
931 Ga0495600_0359981 3300046809 Bacteria 910
932 Ga0495660_0219558 3300046810 Bacteria 897
933 Ga0495581_0029494 3300047315 Bacteria 3179
934 Ga0495581_0051590 3300047315 Bacteria 2375
935 Ga0495581_0078265 3300047315 Bacteria 1914
936 Ga0495581_0167543 3300047315 Bacteria 1285
937 Ga0495636_0330677 3300047318 Bacteria 717
938 Ga0495674_0003237 3300047319 Bacteria 15811
939 Ga0495674_0192876 3300047319 Bacteria 1692
940 Ga0495674_0308030 3300047319 Bacteria 1293
941 Ga0495672_0022103 3300047320 Bacteria 4139
942 Ga0495672_0175037 3300047320 Bacteria 1091
943 Ga0495676_0006508 3300047321 Bacteria 10767
944 Ga0495676_0058942 3300047321 Bacteria 3018
945 Ga0495680_0049034 3300047322 Bacteria 3312
946 Ga0495680_0171650 3300047322 Bacteria 1570
947 Ga0495680_0691698 3300047322 Bacteria 674
948 Ga0495687_094340 3300047443 Bacteria 1138
949 Ga0495677_0200923 3300047445 Bacteria 775
950 Ga0495679_055317 3300047446 Bacteria 1179
951 Ga0495686_0000800 3300047472 Bacteria 40813
952 Ga0495686_0065896 3300047472 Bacteria 2239
953 Ga0495686_0078676 3300047472 Bacteria 2018
954 Ga0495593_0049789 3300047673 Bacteria 2222
955 Ga0495593_0055097 3300047673 Bacteria 2094
956 Ga0495593_0240265 3300047673 Bacteria 907
957 Ga0495614_0293972 3300048089 Bacteria 750
958 Ga0495626_0175218 3300048091 Bacteria 892
959 Ga0496100_0024512 3300048903 Bacteria 3680
960 Ga0496100_0073200 3300048903 Bacteria 2292
961 Ga0496100_0815559 3300048903 Bacteria 731
962 Ga0496101_0004545 3300048904 Bacteria 8759
963 Ga0496101_0052927 3300048904 Bacteria 2928
964 Ga0496101_0246999 3300048904 Bacteria 1390
965 Ga0496101_0275889 3300048904 Bacteria 1313
966 Ga0496102_0091640 3300048905 Bacteria 2813
967 Ga0496102_0199742 3300048905 Bacteria 1885
968 Ga0496102_0244942 3300048905 Bacteria 1690
969 Ga0496102_0308541 3300048905 Bacteria 1491
970 Ga0496102_0853793 3300048905 Bacteria 832
971 Ga0496102_1129669 3300048905 Bacteria 703
972 Ga0496103_0021461 3300048906 Bacteria 3885
973 Ga0496103_0386729 3300048906 Bacteria 899
974 Ga0496104_0001506 3300048907 Bacteria 20100
975 Ga0496104_0003793 3300048907 Bacteria 13077
976 Ga0496104_0009149 3300048907 Bacteria 8807
977 Ga0496104_0082253 3300048907 Bacteria 3070
978 Ga0496104_0123885 3300048907 Bacteria 2481
979 Ga0496104_0124102 3300048907 Bacteria 2479
980 Ga0496104_0472172 3300048907 Bacteria 1166
981 Ga0496104_0724024 3300048907 Bacteria 902
982 Ga0496104_1162056 3300048907 Bacteria 675
983 Ga0496105_0000442 3300048908 Bacteria 27287
984 Ga0496105_0000721 3300048908 Bacteria 22383
985 Ga0496105_0013118 3300048908 Bacteria 6572
986 Ga0496105_0132827 3300048908 Bacteria 2051
987 Ga0496105_0313314 3300048908 Bacteria 1259
988 Ga0496105_0358109 3300048908 Bacteria 1164
989 Ga0496105_0510513 3300048908 Bacteria 942
990 Ga0496106_0004293 3300048909 Bacteria 10594
991 Ga0496106_0049748 3300048909 Bacteria 3158
992 Ga0496106_0063696 3300048909 Bacteria 2803
993 Ga0496106_0106603 3300048909 Bacteria 2178
994 Ga0496106_0153455 3300048909 Bacteria 1817
995 Ga0496106_0239048 3300048909 Bacteria 1451
996 Ga0496106_1029765 3300048909 Bacteria 647
997 Ga0496106_1262223 3300048909 Bacteria 574
998 Ga0496106_1351669 3300048909 Bacteria 552
999 Ga0496107_0014835 3300048910 Bacteria 5455
1000 Ga0496107_0043968 3300048910 Bacteria 3210
1001 Ga0496107_0239301 3300048910 Bacteria 1351
1002 Ga0496107_0261289 3300048910 Bacteria 1288
1003 Ga0496107_0569503 3300048910 Bacteria 838
1004 Ga0496108_0006478 3300048911 Bacteria 9495
1005 Ga0496108_0008634 3300048911 Bacteria 8267
1006 Ga0496108_0015824 3300048911 Bacteria 6148
1007 Ga0496108_0070354 3300048911 Bacteria 2953
1008 Ga0496108_0212779 3300048911 Bacteria 1678
1009 Ga0496109_0000392 3300048912 Bacteria 39781
1010 Ga0496109_0001446 3300048912 Bacteria 19677
1011 Ga0496109_0080259 3300048912 Bacteria 3005
1012 Ga0496109_0313767 3300048912 Bacteria 1479
1013 Ga0496109_0397832 3300048912 Bacteria 1301
1014 Ga0496110_0006715 3300048913 Bacteria 9147
1015 Ga0496110_0012186 3300048913 Bacteria 7062
1016 Ga0496110_0093217 3300048913 Bacteria 2696
1017 Ga0496110_0103519 3300048913 Bacteria 2553
1018 Ga0496110_0116199 3300048913 Bacteria 2408
1019 Ga0496110_0710232 3300048913 Bacteria 907
1020 Ga0496110_0909370 3300048913 Bacteria 786
1021 Ga0496110_1479031 3300048913 Bacteria 589
1022 Ga0496110_1517044 3300048913 Bacteria 580
1023 Ga0496111_0002114 3300048914 Bacteria 11862
1024 Ga0496111_0003367 3300048914 Bacteria 9881
1025 Ga0496111_0009885 3300048914 Bacteria 6375
1026 Ga0496111_0018577 3300048914 Bacteria 4817
1027 Ga0496111_0646893 3300048914 Bacteria 771
1028 Ga0496112_0001759 3300048915 Bacteria 16972
1029 Ga0496112_0007831 3300048915 Bacteria 9509
1030 Ga0496112_0070610 3300048915 Bacteria 3451
1031 Ga0496112_0189687 3300048915 Bacteria 2018
1032 Ga0496112_0271088 3300048915 Bacteria 1646
1033 Ga0496112_0382439 3300048915 Bacteria 1348
1034 Ga0496112_0946614 3300048915 Bacteria 782
1035 Ga0496113_0000243 3300048916 Bacteria 25711
1036 Ga0496113_0002540 3300048916 Bacteria 10641
1037 Ga0496113_0068120 3300048916 Bacteria 2700
1038 Ga0496113_0256440 3300048916 Bacteria 1397
1039 Ga0496113_0325105 3300048916 Bacteria 1233
1040 Ga0496114_0001511 3300048917 Bacteria 17672
1041 Ga0496114_0065533 3300048917 Bacteria 3043
1042 Ga0496114_0122384 3300048917 Bacteria 2239
1043 Ga0496114_0317220 3300048917 Bacteria 1377
1044 Ga0496115_0002949 3300048918 Bacteria 12258
1045 Ga0496115_0021101 3300048918 Bacteria 5027
1046 Ga0496115_0027487 3300048918 Bacteria 4450
1047 Ga0496115_0037022 3300048918 Bacteria 3865
1048 Ga0496115_0135661 3300048918 Bacteria 2029
1049 Ga0496115_0538292 3300048918 Bacteria 935
1050 Ga0496118_0271514 3300048921 Bacteria 950
1051 Ga0496119_0052413 3300048922 Bacteria 2499
1052 Ga0496119_0372718 3300048922 Bacteria 686
1053 Ga0496120_0009305 3300048923 Bacteria 6987
1054 Ga0496121_0035770 3300048924 Bacteria 4442
1055 Ga0496121_0204092 3300048924 Bacteria 1406
1056 Ga0496121_0231125 3300048924 Bacteria 1295
1057 Ga0496121_0241249 3300048924 Bacteria 1259
1058 Ga0496122_0035348 3300048925 Bacteria 4067
1059 Ga0496122_0150687 3300048925 Bacteria 1436
1060 Ga0496123_0194984 3300048926 Bacteria 1044
1061 Ga0496125_0018828 3300048928 Bacteria 6539
1062 Ga0496125_0055809 3300048928 Bacteria 3214
1063 Ga0496125_0217409 3300048928 Bacteria 1235
1064 Ga0496126_0095968 3300048929 Bacteria 2600
1065 Ga0496126_0311405 3300048929 Bacteria 1296
1066 Ga0496126_0406157 3300048929 Bacteria 1104
1067 Ga0496126_0929826 3300048929 Bacteria 657
1068 Ga0495678_063215 3300049459 Bacteria 1383
1069 Ga0501069_0365292 3300049585 Bacteria 852
1070 Ga0501239_044813 3300049672 Bacteria 623
1071 Ga0501081_1282330 3300049743 Bacteria 555
1072 Ga0501212_039679 3300049851 Bacteria 776
1073 nmdc:mga03683_126565_c1 3300050489 Bacteria 823
1074 nmdc:mga03683_15367_c1 3300050489 Bacteria 2856
1075 nmdc:mga03683_395739_c1 3300050489 Bacteria 659
1076 nmdc:mga03683_584935_c1 3300050489 Bacteria 545
1077 nmdc:mga03n38_147669_c1 3300050490 Bacteria 1180
1078 nmdc:mga03n38_1541_c1 3300050490 Bacteria 6679
1079 nmdc:mga03n38_174930_c1 3300050490 Bacteria 1096
1080 nmdc:mga03n38_246069_c1 3300050490 Bacteria 943
1081 nmdc:mga03n38_431591_c1 3300050490 Bacteria 730
1082 nmdc:mga00v17_35686_c1 3300050491 Bacteria 2961
1083 nmdc:mga00v17_399663_c1 3300050491 Bacteria 893
1084 nmdc:mga0yw44_131781_c1 3300050492 Bacteria 1619
1085 nmdc:mga0yw44_18644_c1 3300050492 Bacteria 3807
1086 nmdc:mga0yw44_32635_c1 3300050492 Bacteria 3036
1087 nmdc:mga0yw44_42352_c1 3300050492 Bacteria 2715
1088 nmdc:mga0yw44_45115_c1 3300050492 Bacteria 2641
1089 nmdc:mga0yw44_819073_c1 3300050492 Bacteria 632
1090 nmdc:mga0yw44_933868_c1 3300050492 Bacteria 588
1091 nmdc:mga0k408_109126_c1 3300050493 Bacteria 1635
1092 nmdc:mga0k408_343868_c1 3300050493 Bacteria 889
1093 nmdc:mga0k408_684241_c1 3300050493 Bacteria 602
1094 nmdc:mga0k408_72131_c1 3300050493 Bacteria 2016
1095 nmdc:mga0k408_779109_c1 3300050493 Bacteria 558
1096 nmdc:mga06z11_163186_c1 3300050494 Bacteria 1275
1097 nmdc:mga06z11_3997_c1 3300050494 Bacteria 5756
1098 nmdc:mga06z11_59237_c1 3300050494 Bacteria 1990
1099 nmdc:mga06z11_81847_c1 3300050494 Bacteria 1734
1100 nmdc:mga04h51_30851_c1 3300050495 Bacteria 1690
1101 nmdc:mga04h51_313695_c1 3300050495 Bacteria 641
1102 nmdc:mga04h51_518564_c1 3300050495 Bacteria 511
1103 nmdc:mga04h51_99658_c1 3300050495 Bacteria 1057
1104 nmdc:mga07m45_155860_c1 3300050496 Bacteria 1325
1105 nmdc:mga07m45_32518_c1 3300050496 Bacteria 2893
1106 nmdc:mga07m45_65227_c1 3300050496 Bacteria 2067
1107 nmdc:mga07m45_9902_c1 3300050496 Bacteria 4959
1108 nmdc:mga05p37_1566364_c1 3300050507 Bacteria 651
1109 nmdc:mga05p37_25457_c1 3300050507 Bacteria 7196
1110 nmdc:mga05p37_639258_c1 3300050507 Bacteria 1194
1111 nmdc:mga09592_242341_c1 3300050508 Bacteria 1562
1112 nmdc:mga0qj67_273638_c1 3300050509 Bacteria 1369
1113 nmdc:mga06r32_131586_c1 3300050510 Bacteria 2474
1114 nmdc:mga08y16_46383_c1 3300050511 Bacteria 4549
1115 nmdc:mga0n895_189567_c1 3300050512 Bacteria 2087
1116 nmdc:mga0n895_407568_c1 3300050512 Bacteria 1375
1117 nmdc:mga0rr50_321511_c1 3300050513 Bacteria 1297
1118 nmdc:mga08x19_367095_c1 3300050514 Bacteria 1007
1119 nmdc:mga08x19_928918_c1 3300050514 Bacteria 618
1120 nmdc:mga0sz30_25501_c1 3300050516 Bacteria 2417
1121 nmdc:mga0sz30_312452_c1 3300050516 Bacteria 701
1122 nmdc:mga0sz30_733_c1 3300050516 Bacteria 11987
1123 Ga0495601_0019698 3300053077 Bacteria 4118
1124 Ga0500610_0012561 3300053079 Bacteria 3906
1125 Ga0500610_0244192 3300053079 Bacteria 833
1126 Ga0500635_0447727 3300053080 Bacteria 511
1127 Ga0495655_0228027 3300053083 Bacteria 619
1128 Ga0495595_0742319 3300053084 Bacteria 504
1129 Ga0495619_0004858 3300053085 Bacteria 8529
1130 Ga0495619_0069411 3300053085 Bacteria 2355
1131 Ga0495619_0244597 3300053085 Bacteria 1243
1132 Ga0495619_0503272 3300053085 Bacteria 833
1133 Ga0500578_0120669 3300053086 Bacteria 1648
1134 Ga0500646_0048118 3300053090 Bacteria 1222
1135 Ga0500647_0083802 3300053091 Bacteria 1529
1136 Ga0500583_0003828 3300053092 Bacteria 4811
1137 Ga0500583_0041923 3300053092 Bacteria 2082
1138 Ga0500651_0034151 3300053093 Bacteria 3207
1139 Ga0500651_0037407 3300053093 Bacteria 3059
1140 Ga0500566_0003029 3300053094 Bacteria 10051
1141 Ga0500566_0003135 3300053094 Bacteria 9876
1142 Ga0500641_0018361 3300053096 Bacteria 2630
1143 Ga0500641_0151233 3300053096 Bacteria 1002
1144 Ga0500648_126568 3300053097 Bacteria 1392
1145 Ga0500650_0108864 3300053098 Bacteria 1294
1146 Ga0500554_091662 3300053102 Bacteria 1010
1147 Ga0500557_085519 3300053105 Bacteria 1043
1148 Ga0500558_160209 3300053106 Bacteria 826
1149 Ga0500569_128241 3300053109 Bacteria 848
1150 Ga0500572_000747 3300053111 Bacteria 10459
1151 Ga0500594_0000512 3300053118 Bacteria 8398
1152 Ga0500595_000363 3300053119 Bacteria 29233
1153 Ga0500595_003507 3300053119 Bacteria 7301
1154 Ga0500595_003671 3300053119 Bacteria 7097
1155 Ga0500595_006423 3300053119 Bacteria 4987
1156 Ga0500595_013300 3300053119 Bacteria 3155
1157 Ga0500595_078174 3300053119 Bacteria 972
1158 Ga0500608_016509 3300053122 Bacteria 3337
1159 Ga0500608_202165 3300053122 Bacteria 820
1160 Ga0500618_000305 3300053125 Bacteria 36613
1161 Ga0500642_0046365 3300053130 Bacteria 1900
1162 Ga0500642_0051142 3300053130 Bacteria 1825
1163 Ga0500658_0007684 3300053134 Bacteria 3981
1164 Ga0500658_0025292 3300053134 Bacteria 2281
1165 Ga0500658_0147560 3300053134 Bacteria 1059
1166 Ga0500559_0118613 3300053136 Bacteria 1229
1167 Ga0500559_0288282 3300053136 Bacteria 771
1168 Ga0500559_0334112 3300053136 Bacteria 710
1169 Ga0500559_0340923 3300053136 Unclassified 702
1170 Ga0500564_169848 3300053138 Bacteria 917
1171 Ga0500573_0112042 3300053140 Bacteria 1525
1172 Ga0500577_0066143 3300053142 Bacteria 1405
1173 Ga0500577_0158353 3300053142 Bacteria 963
1174 Ga0500586_001048 3300053145 Bacteria 5708
1175 Ga0500590_137221 3300053148 Bacteria 1123
1176 Ga0500603_000740 3300053150 Bacteria 7963
1177 Ga0500604_0113185 3300053151 Bacteria 902
1178 Ga0500604_0193389 3300053151 Bacteria 699
1179 Ga0500616_0003127 3300053153 Bacteria 12941
1180 Ga0500616_0009374 3300053153 Bacteria 5961
1181 Ga0500616_0049753 3300053153 Bacteria 2216
1182 Ga0500619_130648 3300053154 Bacteria 856
1183 Ga0500630_002258 3300053159 Bacteria 9301
1184 Ga0500634_0106664 3300053161 Bacteria 1391
1185 Ga0500638_002245 3300053162 Bacteria 6617
1186 Ga0500639_000035 3300053163 Bacteria 66883
1187 Ga0500636_0000273 3300053177 Bacteria 28617
1188 Ga0500636_0032576 3300053177 Bacteria 3084
1189 Ga0500636_0050413 3300053177 Bacteria 2448
1190 Ga0500637_0000391 3300053178 Bacteria 16695
1191 Ga0500637_0135353 3300053178 Bacteria 1427
1192 Ga0500637_0195046 3300053178 Bacteria 1155
1193 Ga0500625_000140 3300053729 Bacteria 14802
1194 Ga0500645_001069 3300053730 Bacteria 15155
1195 Ga0500645_013746 3300053730 Bacteria 2592
1196 Ga0500645_069265 3300053730 Bacteria 1014
1197 Ga0500609_039661 3300053731 Bacteria 651
1198 Ga0500596_000035 3300053735 Bacteria 18519
1199 Ga0500596_000586 3300053735 Bacteria 6975
1200 Ga0500601_002331 3300053737 Bacteria 2042
1201 Ga0500661_001163 3300055283 Bacteria 4921
1202 Ga0500661_008429 3300055283 Bacteria 1897
1203 Ga0501082_0177318 3300060353 Bacteria 1853

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009147 Ga0114129_12426892 Ga0114129_124268921 120
2 3300009545 Ga0105237_10901705 Ga0105237_109017051 123
3 3300046515 Ga0495620_0211516 Ga0495620_0211516_261_683 123
4 3300005435 Ga0070714_100745294 Ga0070714_1007452941 124
5 3300003203 JGI25406J46586_10000141 JGI25406J46586_1000014113 125
6 3300003214 JGI25165J46597_1000079 JGI25165J46597_10000792 125
7 3300003322 rootL2_10033170 rootL2_100331701 125
8 3300005577 Ga0068857_101267265 Ga0068857_1012672652 125
9 3300005618 Ga0068864_101871450 Ga0068864_1018714501 125
10 3300005985 Ga0081539_10000008 Ga0081539_10000008476 125
11 3300010375 Ga0105239_11762106 Ga0105239_117621062 125
12 3300013105 Ga0157369_12184098 Ga0157369_121840982 125
13 3300014745 Ga0157377_10351192 Ga0157377_103511921 125
14 3300014969 Ga0157376_11764805 Ga0157376_117648052 125
15 3300031251 Ga0265327_10290248 Ga0265327_102902482 125
16 3300002244 JGI24742J22300_10050271 JGI24742J22300_100502711 126
17 3300003215 JGI25153J46596_10000083 JGI25153J46596_1000008369 126
18 3300003215 JGI25153J46596_10000083 JGI25153J46596_1000008372 126
19 3300003215 JGI25153J46596_10001465 JGI25153J46596_100014658 126
20 3300003215 JGI25153J46596_10096827 JGI25153J46596_100968271 126
21 3300003322 rootL2_10033171 rootL2_100331711 126
22 3300003322 rootL2_10340203 rootL2_103402032 126
23 3300003763 Ga0055529_1003576 Ga0055529_10035762 126
24 3300003794 Ga0055531_10008570 Ga0055531_100085705 126
25 3300005329 Ga0070683_100369195 Ga0070683_1003691953 126
26 3300005329 Ga0070683_100481303 Ga0070683_1004813032 126
27 3300005330 Ga0070690_100227885 Ga0070690_1002278852 126
28 3300005333 Ga0070677_10126034 Ga0070677_101260342 126
29 3300005335 Ga0070666_10021441 Ga0070666_100214413 126
30 3300005338 Ga0068868_100076529 Ga0068868_1000765293 126
31 3300005344 Ga0070661_100115681 Ga0070661_1001156814 126
32 3300005347 Ga0070668_100338781 Ga0070668_1003387811 126
33 3300005354 Ga0070675_100292425 Ga0070675_1002924252 126
34 3300005355 Ga0070671_100068026 Ga0070671_1000680264 126
35 3300005355 Ga0070671_100193026 Ga0070671_1001930261 126
36 3300005355 Ga0070671_101110758 Ga0070671_1011107581 126
37 3300005356 Ga0070674_100103785 Ga0070674_1001037852 126
38 3300005364 Ga0070673_100206555 Ga0070673_1002065553 126
39 3300005366 Ga0070659_102168327 Ga0070659_1021683271 126
40 3300005367 Ga0070667_100126724 Ga0070667_1001267243 126
41 3300005434 Ga0070709_10063854 Ga0070709_100638543 126
42 3300005434 Ga0070709_10092025 Ga0070709_100920253 126
43 3300005435 Ga0070714_100475385 Ga0070714_1004753852 126
44 3300005435 Ga0070714_100622306 Ga0070714_1006223062 126
45 3300005435 Ga0070714_100910647 Ga0070714_1009106472 126
46 3300005436 Ga0070713_100126649 Ga0070713_1001266492 126
47 3300005436 Ga0070713_100202463 Ga0070713_1002024632 126
48 3300005437 Ga0070710_10555368 Ga0070710_105553682 126
49 3300005439 Ga0070711_100623599 Ga0070711_1006235992 126
50 3300005455 Ga0070663_100153170 Ga0070663_1001531702 126
51 3300005457 Ga0070662_100102222 Ga0070662_1001022223 126
52 3300005458 Ga0070681_10036625 Ga0070681_100366256 126
53 3300005458 Ga0070681_10356089 Ga0070681_103560891 126
54 3300005467 Ga0070706_100510191 Ga0070706_1005101912 126
55 3300005471 Ga0070698_100556222 Ga0070698_1005562221 126
56 3300005530 Ga0070679_100207552 Ga0070679_1002075523 126
57 3300005530 Ga0070679_100570664 Ga0070679_1005706642 126
58 3300005530 Ga0070679_100924664 Ga0070679_1009246642 126
59 3300005535 Ga0070684_100169809 Ga0070684_1001698092 126
60 3300005536 Ga0070697_100165328 Ga0070697_1001653283 126
61 3300005539 Ga0068853_100013283 Ga0068853_1000132834 126
62 3300005539 Ga0068853_100856995 Ga0068853_1008569951 126
63 3300005539 Ga0068853_101423548 Ga0068853_1014235482 126
64 3300005539 Ga0068853_101688986 Ga0068853_1016889861 126
65 3300005547 Ga0070693_100195011 Ga0070693_1001950111 126
66 3300005548 Ga0070665_100056376 Ga0070665_1000563762 126
67 3300005548 Ga0070665_100155645 Ga0070665_1001556453 126
68 3300005548 Ga0070665_100242469 Ga0070665_1002424694 126
69 3300005548 Ga0070665_100655738 Ga0070665_1006557381 126
70 3300005548 Ga0070665_102447995 Ga0070665_1024479951 126
71 3300005563 Ga0068855_100043783 Ga0068855_1000437834 126
72 3300005563 Ga0068855_100685732 Ga0068855_1006857323 126
73 3300005564 Ga0070664_100227073 Ga0070664_1002270733 126
74 3300005564 Ga0070664_100671212 Ga0070664_1006712122 126
75 3300005564 Ga0070664_101170780 Ga0070664_1011707802 126
76 3300005577 Ga0068857_100294146 Ga0068857_1002941462 126
77 3300005577 Ga0068857_100767578 Ga0068857_1007675782 126
78 3300005578 Ga0068854_101329044 Ga0068854_1013290442 126
79 3300005614 Ga0068856_101169245 Ga0068856_1011692452 126
80 3300005842 Ga0068858_100224742 Ga0068858_1002247422 126
81 3300005937 Ga0081455_10079109 Ga0081455_100791092 126
82 3300005937 Ga0081455_10528343 Ga0081455_105283431 126
83 3300006028 Ga0070717_10012822 Ga0070717_100128225 126
84 3300006028 Ga0070717_10071458 Ga0070717_100714583 126
85 3300006028 Ga0070717_10411620 Ga0070717_104116202 126
86 3300006038 Ga0075365_10188458 Ga0075365_101884582 126
87 3300006038 Ga0075365_10551704 Ga0075365_105517042 126
88 3300006051 Ga0075364_10180179 Ga0075364_101801792 126
89 3300006163 Ga0070715_10149386 Ga0070715_101493861 126
90 3300006173 Ga0070716_100714808 Ga0070716_1007148081 126
91 3300006175 Ga0070712_100255778 Ga0070712_1002557782 126
92 3300006175 Ga0070712_100705437 Ga0070712_1007054372 126
93 3300006175 Ga0070712_100800477 Ga0070712_1008004772 126
94 3300006175 Ga0070712_101045216 Ga0070712_1010452161 126
95 3300006177 Ga0075362_10021853 Ga0075362_100218532 126
96 3300006186 Ga0075369_10247548 Ga0075369_102475481 126
97 3300006195 Ga0075366_10020582 Ga0075366_100205822 126
98 3300006195 Ga0075366_10326100 Ga0075366_103261001 126
99 3300006237 Ga0097621_100000035 Ga0097621_10000003564 126
100 3300006237 Ga0097621_100041237 Ga0097621_1000412377 126
101 3300006358 Ga0068871_100000287 Ga0068871_10000028719 126
102 3300006358 Ga0068871_100376370 Ga0068871_1003763702 126
103 3300006844 Ga0075428_100018258 Ga0075428_1000182589 126
104 3300006914 Ga0075436_100058654 Ga0075436_1000586542 126
105 3300006941 Ga0099825_1022726 Ga0099825_10227262 126
106 3300006942 Ga0099824_1056536 Ga0099824_10565361 126
107 3300006944 Ga0099823_1068153 Ga0099823_10681532 126
108 3300007076 Ga0075435_100399102 Ga0075435_1003991022 126
109 3300007788 Ga0099795_10084919 Ga0099795_100849193 126
110 3300007788 Ga0099795_10135349 Ga0099795_101353492 126
111 3300009093 Ga0105240_10003004 Ga0105240_1000300420 126
112 3300009093 Ga0105240_10167862 Ga0105240_101678623 126
113 3300009093 Ga0105240_10186744 Ga0105240_101867441 126
114 3300009094 Ga0111539_10279104 Ga0111539_102791042 126
115 3300009098 Ga0105245_10436964 Ga0105245_104369642 126
116 3300009101 Ga0105247_10047677 Ga0105247_100476774 126
117 3300009147 Ga0114129_10197396 Ga0114129_101973964 126
118 3300009545 Ga0105237_10033837 Ga0105237_100338376 126
119 3300009545 Ga0105237_10169585 Ga0105237_101695852 126
120 3300009545 Ga0105237_10508770 Ga0105237_105087702 126
121 3300009545 Ga0105237_10541218 Ga0105237_105412182 126
122 3300009551 Ga0105238_12128875 Ga0105238_121288751 126
123 3300009551 Ga0105238_12443781 Ga0105238_124437811 126
124 3300010159 Ga0099796_10286391 Ga0099796_102863912 126
125 3300010375 Ga0105239_10544404 Ga0105239_105444042 126
126 3300010375 Ga0105239_10932655 Ga0105239_109326551 126
127 3300010375 Ga0105239_10997278 Ga0105239_109972781 126
128 3300010375 Ga0105239_11603006 Ga0105239_116030062 126
129 3300011119 Ga0105246_10286955 Ga0105246_102869552 126
130 3300012476 Ga0157344_1015975 Ga0157344_10159751 126
131 3300013100 Ga0157373_11100196 Ga0157373_111001962 126
132 3300013105 Ga0157369_10137911 Ga0157369_101379113 126
133 3300013296 Ga0157374_12637919 Ga0157374_126379191 126
134 3300013297 Ga0157378_10011018 Ga0157378_100110184 126
135 3300013306 Ga0163162_10033875 Ga0163162_100338757 126
136 3300013306 Ga0163162_10576312 Ga0163162_105763122 126
137 3300013306 Ga0163162_12789136 Ga0163162_127891361 126
138 3300013307 Ga0157372_10024301 Ga0157372_100243012 126
139 3300014325 Ga0163163_10085274 Ga0163163_100852743 126
140 3300014325 Ga0163163_11863406 Ga0163163_118634062 126
141 3300014325 Ga0163163_12453279 Ga0163163_124532792 126
142 3300014497 Ga0182008_10034186 Ga0182008_100341862 126
143 3300014745 Ga0157377_10777228 Ga0157377_107772281 126
144 3300014968 Ga0157379_10192874 Ga0157379_101928741 126
145 3300014969 Ga0157376_10877705 Ga0157376_108777052 126
146 3300015262 Ga0182007_10046526 Ga0182007_100465262 126
147 3300017792 Ga0163161_11374184 Ga0163161_113741841 126
148 3300017792 Ga0163161_11619543 Ga0163161_116195431 126
149 3300021358 Ga0213873_10127364 Ga0213873_101273641 126
150 3300021358 Ga0213873_10142240 Ga0213873_101422401 126
151 3300021361 Ga0213872_10042073 Ga0213872_100420731 126
152 3300021361 Ga0213872_10059182 Ga0213872_100591822 126
153 3300021384 Ga0213876_10048895 Ga0213876_100488952 126
154 3300021441 Ga0213871_10004609 Ga0213871_100046093 126
155 3300021441 Ga0213871_10118950 Ga0213871_101189501 126
156 3300025245 Ga0207425_1041828 Ga0207425_10418281 126
157 3300025254 Ga0209148_1000212 Ga0209148_100021299 126
158 3300025261 Ga0209233_1028384 Ga0209233_10283841 126
159 3300025272 Ga0209455_1000346 Ga0209455_100034644 126
160 3300025295 Ga0209564_1024238 Ga0209564_10242382 126
161 3300025297 Ga0209758_1000023 Ga0209758_1000023560 126
162 3300025297 Ga0209758_1000023 Ga0209758_1000023562 126
163 3300025297 Ga0209758_1000024 Ga0209758_1000024142 126
164 3300025297 Ga0209758_1002631 Ga0209758_100263116 126
165 3300025297 Ga0209758_1024738 Ga0209758_10247382 126
166 3300025302 Ga0207426_1147331 Ga0207426_11473311 126
167 3300025304 Ga0209257_1004708 Ga0209257_10047085 126
168 3300025304 Ga0209257_1032451 Ga0209257_10324512 126
169 3300025893 Ga0207682_10062432 Ga0207682_100624322 126
170 3300025898 Ga0207692_10295050 Ga0207692_102950502 126
171 3300025898 Ga0207692_10483293 Ga0207692_104832931 126
172 3300025900 Ga0207710_10030393 Ga0207710_100303932 126
173 3300025904 Ga0207647_10144726 Ga0207647_101447262 126
174 3300025905 Ga0207685_10081867 Ga0207685_100818672 126
175 3300025906 Ga0207699_10292559 Ga0207699_102925592 126
176 3300025909 Ga0207705_10405777 Ga0207705_104057773 126
177 3300025911 Ga0207654_10100295 Ga0207654_101002953 126
178 3300025912 Ga0207707_10007211 Ga0207707_100072117 126
179 3300025912 Ga0207707_10528609 Ga0207707_105286092 126
180 3300025913 Ga0207695_10006643 Ga0207695_100066433 126
181 3300025913 Ga0207695_10095017 Ga0207695_100950172 126
182 3300025914 Ga0207671_10076601 Ga0207671_100766011 126
183 3300025914 Ga0207671_10236225 Ga0207671_102362252 126
184 3300025914 Ga0207671_10566443 Ga0207671_105664431 126
185 3300025915 Ga0207693_10379114 Ga0207693_103791143 126
186 3300025915 Ga0207693_10412228 Ga0207693_104122282 126
187 3300025915 Ga0207693_10574305 Ga0207693_105743052 126
188 3300025915 Ga0207693_10675093 Ga0207693_106750932 126
189 3300025915 Ga0207693_11199143 Ga0207693_111991431 126
190 3300025916 Ga0207663_10216629 Ga0207663_102166292 126
191 3300025919 Ga0207657_10252533 Ga0207657_102525332 126
192 3300025920 Ga0207649_10211551 Ga0207649_102115512 126
193 3300025920 Ga0207649_10349031 Ga0207649_103490312 126
194 3300025921 Ga0207652_10100168 Ga0207652_101001682 126
195 3300025921 Ga0207652_10407937 Ga0207652_104079371 126
196 3300025921 Ga0207652_11140228 Ga0207652_111402281 126
197 3300025924 Ga0207694_10234203 Ga0207694_102342033 126
198 3300025926 Ga0207659_10158051 Ga0207659_101580512 126
199 3300025928 Ga0207700_10073919 Ga0207700_100739191 126
200 3300025928 Ga0207700_10075840 Ga0207700_100758402 126
201 3300025928 Ga0207700_10091261 Ga0207700_100912613 126
202 3300025928 Ga0207700_10579259 Ga0207700_105792592 126
203 3300025929 Ga0207664_10078282 Ga0207664_100782822 126
204 3300025929 Ga0207664_11249774 Ga0207664_112497741 126
205 3300025931 Ga0207644_10160494 Ga0207644_101604941 126
206 3300025931 Ga0207644_10474873 Ga0207644_104748731 126
207 3300025932 Ga0207690_11250754 Ga0207690_112507542 126
208 3300025933 Ga0207706_10022493 Ga0207706_100224934 126
209 3300025933 Ga0207706_10550051 Ga0207706_105500512 126
210 3300025934 Ga0207686_10433306 Ga0207686_104333062 126
211 3300025936 Ga0207670_11619697 Ga0207670_116196971 126
212 3300025937 Ga0207669_10000778 Ga0207669_100007788 126
213 3300025939 Ga0207665_10619454 Ga0207665_106194542 126
214 3300025939 Ga0207665_11465611 Ga0207665_114656111 126
215 3300025941 Ga0207711_10053294 Ga0207711_100532944 126
216 3300025945 Ga0207679_10071976 Ga0207679_100719762 126
217 3300025945 Ga0207679_10296096 Ga0207679_102960962 126
218 3300025960 Ga0207651_10577923 Ga0207651_105779232 126
219 3300025960 Ga0207651_10924009 Ga0207651_109240091 126
220 3300025961 Ga0207712_10476651 Ga0207712_104766512 126
221 3300025972 Ga0207668_10340803 Ga0207668_103408032 126
222 3300025972 Ga0207668_11051069 Ga0207668_110510691 126
223 3300025981 Ga0207640_10603315 Ga0207640_106033152 126
224 3300026023 Ga0207677_10059799 Ga0207677_100597993 126
225 3300026023 Ga0207677_11863667 Ga0207677_118636671 126
226 3300026035 Ga0207703_12382147 Ga0207703_123821471 126
227 3300026041 Ga0207639_10003894 Ga0207639_100038943 126
228 3300026041 Ga0207639_10099123 Ga0207639_100991233 126
229 3300026041 Ga0207639_11328620 Ga0207639_113286202 126
230 3300026067 Ga0207678_10007720 Ga0207678_100077209 126
231 3300026067 Ga0207678_10097072 Ga0207678_100970721 126
232 3300026067 Ga0207678_10356616 Ga0207678_103566161 126
233 3300026067 Ga0207678_10358063 Ga0207678_103580632 126
234 3300026075 Ga0207708_10500408 Ga0207708_105004081 126
235 3300026075 Ga0207708_10630723 Ga0207708_106307232 126
236 3300026078 Ga0207702_10101401 Ga0207702_101014012 126
237 3300026078 Ga0207702_10171000 Ga0207702_101710002 126
238 3300026089 Ga0207648_11044087 Ga0207648_110440872 126
239 3300026095 Ga0207676_10251174 Ga0207676_102511743 126
240 3300026116 Ga0207674_10630287 Ga0207674_106302871 126
241 3300026116 Ga0207674_11446027 Ga0207674_114460272 126
242 3300026121 Ga0207683_10309922 Ga0207683_103099222 126
243 3300027296 Ga0209389_1051273 Ga0209389_10512732 126
244 3300027296 Ga0209389_1078013 Ga0209389_10780132 126
245 3300027361 Ga0209489_117682 Ga0209489_1176823 126
246 3300027361 Ga0209489_121234 Ga0209489_1212342 126
247 3300027363 Ga0209700_100076 Ga0209700_100076132 126
248 3300027671 Ga0209588_1280291 Ga0209588_12802911 126
249 3300027866 Ga0209813_10153406 Ga0209813_101534062 126
250 3300027907 Ga0207428_11055287 Ga0207428_110552871 126
251 3300028036 Ga0265355_1012723 Ga0265355_10127231 126
252 3300028379 Ga0268266_10002070 Ga0268266_100020707 126
253 3300028379 Ga0268266_10082502 Ga0268266_100825023 126
254 3300028379 Ga0268266_10130867 Ga0268266_101308672 126
255 3300028379 Ga0268266_10131700 Ga0268266_101317004 126
256 3300028379 Ga0268266_11262825 Ga0268266_112628251 126
257 3300028786 Ga0307517_10041514 Ga0307517_100415145 126
258 3300030521 Ga0307511_10000148 Ga0307511_1000014811 126
259 3300030521 Ga0307511_10172502 Ga0307511_101725022 126
260 3300030763 Ga0265763_1019543 Ga0265763_10195432 126
261 3300031235 Ga0265330_10064136 Ga0265330_100641361 126
262 3300031238 Ga0265332_10041215 Ga0265332_100412152 126
263 3300031238 Ga0265332_10313682 Ga0265332_103136822 126
264 3300031241 Ga0265325_10066370 Ga0265325_100663702 126
265 3300031242 Ga0265329_10300479 Ga0265329_103004791 126
266 3300031247 Ga0265340_10013605 Ga0265340_100136052 126
267 3300031249 Ga0265339_10001462 Ga0265339_100014624 126
268 3300031249 Ga0265339_10012845 Ga0265339_100128453 126
269 3300031250 Ga0265331_10002616 Ga0265331_1000261611 126
270 3300031250 Ga0265331_10074139 Ga0265331_100741392 126
271 3300031251 Ga0265327_10075135 Ga0265327_100751352 126
272 3300031344 Ga0265316_10214893 Ga0265316_102148931 126
273 3300031456 Ga0307513_10004256 Ga0307513_1000425616 126
274 3300031456 Ga0307513_10048552 Ga0307513_100485522 126
275 3300031507 Ga0307509_10458295 Ga0307509_104582951 126
276 3300031595 Ga0265313_10000583 Ga0265313_1000058324 126
277 3300031616 Ga0307508_10086902 Ga0307508_100869021 126
278 3300031711 Ga0265314_10014316 Ga0265314_100143166 126
279 3300031712 Ga0265342_10078644 Ga0265342_100786442 126
280 3300031712 Ga0265342_10165583 Ga0265342_101655832 126
281 3300031730 Ga0307516_10054944 Ga0307516_100549442 126
282 3300031730 Ga0307516_10171992 Ga0307516_101719923 126
283 3300033179 Ga0307507_10236781 Ga0307507_102367812 126
284 3300033179 Ga0307507_10488078 Ga0307507_104880782 126
285 3300035083 Ga0373926_0067511 Ga0373926_0067511_900_1280 126
286 3300035085 Ga0373929_0102134 Ga0373929_0102134_11_391 126
287 3300035086 Ga0373934_0023429 Ga0373934_0023429_631_1044 126
288 3300035086 Ga0373934_0084325 Ga0373934_0084325_146_532 126
289 3300035090 Ga0373949_0048655 Ga0373949_0048655_431_811 126
290 3300035090 Ga0373949_0114430 Ga0373949_0114430_38_418 126
291 3300035111 Ga0373923_0051414 Ga0373923_0051414_798_1211 126
292 3300035111 Ga0373923_0601041 Ga0373923_0601041_131_511 126
293 3300035113 Ga0373936_0036045 Ga0373936_0036045_661_1041 126
294 3300035113 Ga0373936_0101381 Ga0373936_0101381_606_986 126
295 3300035114 Ga0373939_0162064 Ga0373939_0162064_37_435 126
296 3300035115 Ga0373941_0097064 Ga0373941_0097064_65_463 126
297 3300035117 Ga0373953_0068663 Ga0373953_0068663_428_841 126
298 3300035118 Ga0373954_0014990 Ga0373954_0014990_1840_2253 126
299 3300035118 Ga0373954_0144140 Ga0373954_0144140_590_976 126
300 3300035119 Ga0373956_0050116 Ga0373956_0050116_259_645 126
301 3300035170 Ga0373943_0125930 Ga0373943_0125930_920_1300 126
302 3300035172 Ga0373955_0096174 Ga0373955_0096174_668_1081 126
303 3300035172 Ga0373955_0123715 Ga0373955_0123715_542_922 126
304 3300035241 Ga0373961_0065203 Ga0373961_0065203_467_853 126
305 3300035691 Ga0373931_0283098 Ga0373931_0283098_625_1005 126
306 3300035692 Ga0373935_0013872 Ga0373935_0013872_3013_3393 126
307 3300035692 Ga0373935_0048611 Ga0373935_0048611_1986_2372 126
308 3300035695 Ga0373927_0021420 Ga0373927_0021420_292_672 126
309 3300035695 Ga0373927_0023687 Ga0373927_0023687_3288_3674 126
310 3300035695 Ga0373927_0073001 Ga0373927_0073001_1691_2071 126
311 3300035724 Ga0373933_0082380 Ga0373933_0082380_666_1079 126
312 3300035724 Ga0373933_1106047 Ga0373933_1106047_18_398 126
313 3300035725 Ga0373947_0025373 Ga0373947_0025373_1358_1738 126
314 3300035725 Ga0373947_0182802 Ga0373947_0182802_941_1321 126
315 3300036401 Ga0373937_0003392 Ga0373937_0003392_11388_11801 126
316 3300036401 Ga0373937_0132886 Ga0373937_0132886_1887_2267 126
317 3300036401 Ga0373937_0138148 Ga0373937_0138148_859_1245 126
318 3300037068 Ga0373925_0012799 Ga0373925_0012799_784_1164 126
319 3300037068 Ga0373925_0203417 Ga0373925_0203417_1054_1434 126
320 3300037068 Ga0373925_1047653 Ga0373925_1047653_272_652 126
321 3300037068 Ga0373925_1735717 Ga0373925_1735717_62_448 126
322 3300037418 Ga0395900_0411688 Ga0395900_0411688_498_878 126
323 3300037418 Ga0395900_0520808 Ga0395900_0520808_555_935 126
324 3300037466 Ga0395898_0050867 Ga0395898_0050867_450_830 126
325 3300037471 Ga0395905_1214853 Ga0395905_1214853_143_523 126
326 3300037853 Ga0436364_0421552 Ga0436364_0421552_937_1317 126
327 3300038443 Ga0395901_0150479 Ga0395901_0150479_1958_2338 126
328 3300039437 Ga0436365_0495621 Ga0436365_0495621_973_1353 126
329 3300039437 Ga0436365_0661874 Ga0436365_0661874_1447_1827 126
330 3300039438 Ga0436360_0224587 Ga0436360_0224587_278_658 126
331 3300039438 Ga0436360_0258132 Ga0436360_0258132_158_538 126
332 3300039438 Ga0436360_0296010 Ga0436360_0296010_244_624 126
333 3300039438 Ga0436360_0345518 Ga0436360_0345518_2066_2446 126
334 3300039438 Ga0436360_0381778 Ga0436360_0381778_91_471 126
335 3300039438 Ga0436360_0585422 Ga0436360_0585422_4240_4620 126
336 3300039438 Ga0436360_0598280 Ga0436360_0598280_190_570 126
337 3300039447 Ga0436361_0087582 Ga0436361_0087582_96_476 126
338 3300039447 Ga0436361_0296689 Ga0436361_0296689_9043_9423 126
339 3300039447 Ga0436361_0342673 Ga0436361_0342673_436_816 126
340 3300039447 Ga0436361_0604625 Ga0436361_0604625_281_661 126
341 3300039447 Ga0436361_0668430 Ga0436361_0668430_1683_2075 126
342 3300039447 Ga0436361_0804396 Ga0436361_0804396_329_709 126
343 3300039447 Ga0436361_0847865 Ga0436361_0847865_1134_1514 126
344 3300039447 Ga0436361_1108985 Ga0436361_1108985_29_409 126
345 3300039450 Ga0436363_0219861 Ga0436363_0219861_1107_1490 126
346 3300039450 Ga0436363_0637369 Ga0436363_0637369_200_580 126
347 3300039450 Ga0436363_1408653 Ga0436363_1408653_96_476 126
348 3300039453 Ga0436362_0005086 Ga0436362_0005086_1828_2208 126
349 3300039453 Ga0436362_0319983 Ga0436362_0319983_292_705 126
350 3300039453 Ga0436362_0362728 Ga0436362_0362728_657_1049 126
351 3300039453 Ga0436362_1207223 Ga0436362_1207223_120_509 126
352 3300041459 Ga0451800_0847615 Ga0451800_0847615_100_480 126
353 3300044684 Ga0466966_0601925 Ga0466966_0601925_101_487 126
354 3300044693 Ga0466961_0755586 Ga0466961_0755586_50_430 126
355 3300044706 Ga0466964_0108800 Ga0466964_0108800_707_1087 126
356 3300044842 Ga0466957_0321017 Ga0466957_0321017_139_528 126
357 3300044842 Ga0466957_0455272 Ga0466957_0455272_383_763 126
358 3300045049 Ga0466959_0376170 Ga0466959_0376170_43_423 126
359 3300046454 Ga0495592_0083966 Ga0495592_0083966_1903_2283 126
360 3300046455 Ga0495603_0002503 Ga0495603_0002503_5852_6232 126
361 3300046455 Ga0495603_0006600 Ga0495603_0006600_1264_1644 126
362 3300046458 Ga0495591_138148 Ga0495591_138148_53_433 126
363 3300046459 Ga0495629_0030209 Ga0495629_0030209_1269_1649 126
364 3300046460 Ga0495638_0005411 Ga0495638_0005411_3030_3410 126
365 3300046460 Ga0495638_0225485 Ga0495638_0225485_390_770 126
366 3300046471 Ga0495650_0000355 Ga0495650_0000355_16010_16390 126
367 3300046472 Ga0495580_0740428 Ga0495580_0740428_68_448 126
368 3300046472 Ga0495580_0805929 Ga0495580_0805929_183_563 126
369 3300046473 Ga0495582_0011384 Ga0495582_0011384_1414_1794 126
370 3300046474 Ga0495605_0091313 Ga0495605_0091313_912_1292 126
371 3300046475 Ga0495639_0009847 Ga0495639_0009847_1287_1667 126
372 3300046476 Ga0495662_0008018 Ga0495662_0008018_1883_2263 126
373 3300046477 Ga0495664_0094616 Ga0495664_0094616_695_1075 126
374 3300046477 Ga0495664_0789859 Ga0495664_0789859_35_421 126
375 3300046491 Ga0495584_0247677 Ga0495584_0247677_204_584 126
376 3300046491 Ga0495584_0258110 Ga0495584_0258110_206_586 126
377 3300046492 Ga0495585_0024474 Ga0495585_0024474_647_1027 126
378 3300046492 Ga0495585_0077455 Ga0495585_0077455_1250_1630 126
379 3300046499 Ga0495594_0036513 Ga0495594_0036513_742_1122 126
380 3300046499 Ga0495594_0556421 Ga0495594_0556421_201_581 126
381 3300046501 Ga0495607_0256155 Ga0495607_0256155_443_823 126
382 3300046506 Ga0495583_0000860 Ga0495583_0000860_14004_14384 126
383 3300046507 Ga0495606_0002012 Ga0495606_0002012_12714_13094 126
384 3300046507 Ga0495606_0425315 Ga0495606_0425315_67_447 126
385 3300046511 Ga0495608_0323159 Ga0495608_0323159_319_732 126
386 3300046512 Ga0495610_0000046 Ga0495610_0000046_75775_76155 126
387 3300046512 Ga0495610_0088455 Ga0495610_0088455_530_910 126
388 3300046513 Ga0495616_0034251 Ga0495616_0034251_2145_2525 126
389 3300046517 Ga0495630_0568131 Ga0495630_0568131_231_611 126
390 3300046518 Ga0495631_0368748 Ga0495631_0368748_151_531 126
391 3300046519 Ga0495632_0241145 Ga0495632_0241145_71_451 126
392 3300046522 Ga0495643_0180282 Ga0495643_0180282_400_780 126
393 3300046524 Ga0495648_0227930 Ga0495648_0227930_62_442 126
394 3300046528 Ga0495642_0511153 Ga0495642_0511153_118_498 126
395 3300046535 Ga0495586_0504586 Ga0495586_0504586_281_661 126
396 3300046536 Ga0495587_0750518 Ga0495587_0750518_25_405 126
397 3300046538 Ga0495609_0434599 Ga0495609_0434599_61_441 126
398 3300046543 Ga0495645_0402597 Ga0495645_0402597_180_560 126
399 3300046557 Ga0495622_0008204 Ga0495622_0008204_2454_2834 126
400 3300046557 Ga0495622_0064073 Ga0495622_0064073_794_1174 126
401 3300046557 Ga0495622_0206981 Ga0495622_0206981_148_528 126
402 3300046559 Ga0495667_0514958 Ga0495667_0514958_127_513 126
403 3300046615 Ga0495656_0273938 Ga0495656_0273938_330_710 126
404 3300046615 Ga0495656_0641431 Ga0495656_0641431_167_553 126
405 3300046642 Ga0495634_0003625 Ga0495634_0003625_10174_10554 126
406 3300046648 Ga0495611_0015617 Ga0495611_0015617_2382_2762 126
407 3300046660 Ga0495625_0002001 Ga0495625_0002001_8451_8831 126
408 3300046660 Ga0495625_0003868 Ga0495625_0003868_6794_7174 126
409 3300046660 Ga0495625_0412012 Ga0495625_0412012_280_660 126
410 3300046663 Ga0495635_0027099 Ga0495635_0027099_1198_1578 126
411 3300046664 Ga0495659_0047279 Ga0495659_0047279_487_867 126
412 3300046664 Ga0495659_0305178 Ga0495659_0305178_88_474 126
413 3300046665 Ga0495661_0052708 Ga0495661_0052708_1302_1682 126
414 3300046665 Ga0495661_0202973 Ga0495661_0202973_38_418 126
415 3300046674 Ga0495588_0362994 Ga0495588_0362994_350_730 126
416 3300046678 Ga0495599_0051525 Ga0495599_0051525_789_1169 126
417 3300046683 Ga0495658_0013061 Ga0495658_0013061_2017_2397 126
418 3300046683 Ga0495658_0611472 Ga0495658_0611472_17_403 126
419 3300046684 Ga0495669_0419224 Ga0495669_0419224_234_614 126
420 3300046684 Ga0495669_0572051 Ga0495669_0572051_59_439 126
421 3300046689 Ga0495613_0128811 Ga0495613_0128811_519_899 126
422 3300046690 Ga0495624_0546806 Ga0495624_0546806_29_409 126
423 3300046691 Ga0495670_0137564 Ga0495670_0137564_163_543 126
424 3300046692 Ga0495671_0327303 Ga0495671_0327303_261_641 126
425 3300046694 Ga0495649_0487914 Ga0495649_0487914_156_536 126
426 3300046809 Ga0495600_0080018 Ga0495600_0080018_375_755 126
427 3300046810 Ga0495660_0219558 Ga0495660_0219558_11_391 126
428 3300047315 Ga0495581_0029494 Ga0495581_0029494_201_581 126
429 3300047315 Ga0495581_0078265 Ga0495581_0078265_1145_1525 126
430 3300047315 Ga0495581_0167543 Ga0495581_0167543_648_1028 126
431 3300047318 Ga0495636_0330677 Ga0495636_0330677_61_441 126
432 3300047319 Ga0495674_0003237 Ga0495674_0003237_14801_15181 126
433 3300047319 Ga0495674_0308030 Ga0495674_0308030_385_765 126
434 3300047320 Ga0495672_0022103 Ga0495672_0022103_3530_3910 126
435 3300047320 Ga0495672_0175037 Ga0495672_0175037_620_1042 126
436 3300047321 Ga0495676_0058942 Ga0495676_0058942_1636_2016 126
437 3300047322 Ga0495680_0049034 Ga0495680_0049034_887_1267 126
438 3300047322 Ga0495680_0171650 Ga0495680_0171650_562_975 126
439 3300047322 Ga0495680_0691698 Ga0495680_0691698_60_446 126
440 3300047443 Ga0495687_094340 Ga0495687_094340_397_777 126
441 3300047446 Ga0495679_055317 Ga0495679_055317_364_744 126
442 3300047472 Ga0495686_0065896 Ga0495686_0065896_16_396 126
443 3300047472 Ga0495686_0078676 Ga0495686_0078676_579_959 126
444 3300047673 Ga0495593_0049789 Ga0495593_0049789_1167_1547 126
445 3300048089 Ga0495614_0293972 Ga0495614_0293972_118_498 126
446 3300048905 Ga0496102_0199742 Ga0496102_0199742_533_913 126
447 3300048906 Ga0496103_0386729 Ga0496103_0386729_280_660 126
448 3300048907 Ga0496104_0009149 Ga0496104_0009149_3707_4087 126
449 3300048907 Ga0496104_0472172 Ga0496104_0472172_281_697 126
450 3300048907 Ga0496104_0724024 Ga0496104_0724024_409_789 126
451 3300048907 Ga0496104_1162056 Ga0496104_1162056_129_557 126
452 3300048908 Ga0496105_0313314 Ga0496105_0313314_555_935 126
453 3300048908 Ga0496105_0358109 Ga0496105_0358109_82_498 126
454 3300048908 Ga0496105_0510513 Ga0496105_0510513_145_525 126
455 3300048909 Ga0496106_0239048 Ga0496106_0239048_318_698 126
456 3300048909 Ga0496106_1029765 Ga0496106_1029765_170_550 126
457 3300048909 Ga0496106_1351669 Ga0496106_1351669_17_397 126
458 3300048910 Ga0496107_0239301 Ga0496107_0239301_564_980 126
459 3300048913 Ga0496110_0710232 Ga0496110_0710232_200_580 126
460 3300048913 Ga0496110_1517044 Ga0496110_1517044_136_552 126
461 3300048915 Ga0496112_0189687 Ga0496112_0189687_1401_1781 126
462 3300048915 Ga0496112_0271088 Ga0496112_0271088_423_821 126
463 3300048917 Ga0496114_0122384 Ga0496114_0122384_356_736 126
464 3300048918 Ga0496115_0037022 Ga0496115_0037022_161_589 126
465 3300048918 Ga0496115_0135661 Ga0496115_0135661_847_1227 126
466 3300048922 Ga0496119_0052413 Ga0496119_0052413_1304_1684 126
467 3300048922 Ga0496119_0372718 Ga0496119_0372718_91_471 126
468 3300048923 Ga0496120_0009305 Ga0496120_0009305_4570_4950 126
469 3300048924 Ga0496121_0035770 Ga0496121_0035770_1306_1692 126
470 3300048925 Ga0496122_0035348 Ga0496122_0035348_3489_3869 126
471 3300048926 Ga0496123_0194984 Ga0496123_0194984_457_837 126
472 3300048929 Ga0496126_0095968 Ga0496126_0095968_1405_1791 126
473 3300049743 Ga0501081_1282330 Ga0501081_1282330_126_506 126
474 3300050489 nmdc:mga03683_126565_c1 nmdc:mga03683_126565_c1_394_774 126
475 3300050489 nmdc:mga03683_15367_c1 nmdc:mga03683_15367_c1_1107_1487 126
476 3300050489 nmdc:mga03683_584935_c1 nmdc:mga03683_584935_c1_124_504 126
477 3300050490 nmdc:mga03n38_1541_c1 nmdc:mga03n38_1541_c1_2778_3158 126
478 3300050492 nmdc:mga0yw44_42352_c1 nmdc:mga0yw44_42352_c1_521_901 126
479 3300050492 nmdc:mga0yw44_819073_c1 nmdc:mga0yw44_819073_c1_30_410 126
480 3300050493 nmdc:mga0k408_343868_c1 nmdc:mga0k408_343868_c1_391_771 126
481 3300050493 nmdc:mga0k408_779109_c1 nmdc:mga0k408_779109_c1_137_535 126
482 3300050494 nmdc:mga06z11_3997_c1 nmdc:mga06z11_3997_c1_4146_4526 126
483 3300050494 nmdc:mga06z11_81847_c1 nmdc:mga06z11_81847_c1_555_935 126
484 3300050495 nmdc:mga04h51_30851_c1 nmdc:mga04h51_30851_c1_599_979 126
485 3300050496 nmdc:mga07m45_155860_c1 nmdc:mga07m45_155860_c1_109_489 126
486 3300050496 nmdc:mga07m45_32518_c1 nmdc:mga07m45_32518_c1_1558_1938 126
487 3300050511 nmdc:mga08y16_46383_c1 nmdc:mga08y16_46383_c1_1153_1533 126
488 3300050514 nmdc:mga08x19_367095_c1 nmdc:mga08x19_367095_c1_257_655 126
489 3300050516 nmdc:mga0sz30_733_c1 nmdc:mga0sz30_733_c1_194_574 126
490 3300053077 Ga0495601_0019698 Ga0495601_0019698_27_407 126
491 3300053079 Ga0500610_0244192 Ga0500610_0244192_427_807 126
492 3300053080 Ga0500635_0447727 Ga0500635_0447727_117_497 126
493 3300053084 Ga0495595_0742319 Ga0495595_0742319_93_473 126
494 3300053085 Ga0495619_0069411 Ga0495619_0069411_542_955 126
495 3300053086 Ga0500578_0120669 Ga0500578_0120669_246_626 126
496 3300053090 Ga0500646_0048118 Ga0500646_0048118_18_398 126
497 3300053091 Ga0500647_0083802 Ga0500647_0083802_688_1068 126
498 3300053092 Ga0500583_0041923 Ga0500583_0041923_398_778 126
499 3300053093 Ga0500651_0034151 Ga0500651_0034151_2325_2705 126
500 3300053096 Ga0500641_0018361 Ga0500641_0018361_1993_2373 126
501 3300053097 Ga0500648_126568 Ga0500648_126568_993_1379 126
502 3300053098 Ga0500650_0108864 Ga0500650_0108864_482_862 126
503 3300053106 Ga0500558_160209 Ga0500558_160209_350_736 126
504 3300053119 Ga0500595_006423 Ga0500595_006423_2627_3007 126
505 3300053119 Ga0500595_013300 Ga0500595_013300_1844_2224 126
506 3300053125 Ga0500618_000305 Ga0500618_000305_25503_25883 126
507 3300053130 Ga0500642_0046365 Ga0500642_0046365_1242_1622 126
508 3300053134 Ga0500658_0007684 Ga0500658_0007684_1521_1901 126
509 3300053134 Ga0500658_0025292 Ga0500658_0025292_510_890 126
510 3300053136 Ga0500559_0288282 Ga0500559_0288282_51_437 126
511 3300053136 Ga0500559_0334112 Ga0500559_0334112_232_618 126
512 3300053138 Ga0500564_169848 Ga0500564_169848_431_811 126
513 3300053140 Ga0500573_0112042 Ga0500573_0112042_691_1077 126
514 3300053145 Ga0500586_001048 Ga0500586_001048_896_1276 126
515 3300053148 Ga0500590_137221 Ga0500590_137221_339_725 126
516 3300053151 Ga0500604_0113185 Ga0500604_0113185_166_546 126
517 3300053153 Ga0500616_0003127 Ga0500616_0003127_8633_9013 126
518 3300053153 Ga0500616_0049753 Ga0500616_0049753_1560_1940 126
519 3300053154 Ga0500619_130648 Ga0500619_130648_238_624 126
520 3300053161 Ga0500634_0106664 Ga0500634_0106664_589_969 126
521 3300053177 Ga0500636_0000273 Ga0500636_0000273_6002_6382 126
522 3300053177 Ga0500636_0032576 Ga0500636_0032576_1944_2330 126
523 3300053177 Ga0500636_0050413 Ga0500636_0050413_1044_1430 126
524 3300053178 Ga0500637_0195046 Ga0500637_0195046_737_1123 126
525 3300053729 Ga0500625_000140 Ga0500625_000140_10703_11083 126
526 3300053730 Ga0500645_001069 Ga0500645_001069_8183_8563 126
527 3300053730 Ga0500645_013746 Ga0500645_013746_1710_2090 126
528 3300053730 Ga0500645_069265 Ga0500645_069265_268_648 126
529 3300053735 Ga0500596_000035 Ga0500596_000035_3881_4261 126
530 3300053735 Ga0500596_000586 Ga0500596_000586_1771_2157 126
531 3300055283 Ga0500661_008429 Ga0500661_008429_883_1263 126
532 iso_pu_bacteria 2888419890 2888424985 126
533 iso_pu_bacteria 2922361189 2922362761 126
534 3300001990 JGI24737J22298_10097201 JGI24737J22298_100972011 127
535 3300003659 JGI25404J52841_10022631 JGI25404J52841_100226311 127
536 3300005327 Ga0070658_10998829 Ga0070658_109988291 127
537 3300005328 Ga0070676_10038116 Ga0070676_100381161 127
538 3300005328 Ga0070676_10441965 Ga0070676_104419651 127
539 3300005331 Ga0070670_100222100 Ga0070670_1002221001 127
540 3300005338 Ga0068868_100190280 Ga0068868_1001902802 127
541 3300005344 Ga0070661_100149347 Ga0070661_1001493472 127
542 3300005347 Ga0070668_100051916 Ga0070668_1000519163 127
543 3300005355 Ga0070671_100157423 Ga0070671_1001574231 127
544 3300005366 Ga0070659_100637824 Ga0070659_1006378241 127
545 3300005406 Ga0070703_10049713 Ga0070703_100497132 127
546 3300005435 Ga0070714_100023528 Ga0070714_1000235282 127
547 3300005436 Ga0070713_100103250 Ga0070713_1001032502 127
548 3300005436 Ga0070713_100333438 Ga0070713_1003334382 127
549 3300005441 Ga0070700_100369672 Ga0070700_1003696722 127
550 3300005444 Ga0070694_100309001 Ga0070694_1003090012 127
551 3300005455 Ga0070663_100232418 Ga0070663_1002324182 127
552 3300005456 Ga0070678_100015000 Ga0070678_1000150002 127
553 3300005457 Ga0070662_100225935 Ga0070662_1002259352 127
554 3300005471 Ga0070698_100263292 Ga0070698_1002632922 127
555 3300005539 Ga0068853_100267736 Ga0068853_1002677362 127
556 3300005563 Ga0068855_100030970 Ga0068855_1000309703 127
557 3300005614 Ga0068856_102124311 Ga0068856_1021243111 127
558 3300005615 Ga0070702_100277779 Ga0070702_1002777792 127
559 3300005617 Ga0068859_100653386 Ga0068859_1006533862 127
560 3300005618 Ga0068864_100405846 Ga0068864_1004058462 127
561 3300005719 Ga0068861_100257786 Ga0068861_1002577862 127
562 3300005840 Ga0068870_10478712 Ga0068870_104787121 127
563 3300005842 Ga0068858_100166815 Ga0068858_1001668152 127
564 3300005842 Ga0068858_100852709 Ga0068858_1008527092 127
565 3300005843 Ga0068860_100172976 Ga0068860_1001729762 127
566 3300005983 Ga0081540_1021860 Ga0081540_10218605 127
567 3300005983 Ga0081540_1036990 Ga0081540_10369902 127
568 3300006028 Ga0070717_10044494 Ga0070717_100444943 127
569 3300006028 Ga0070717_10190210 Ga0070717_101902102 127
570 3300006042 Ga0075368_10021264 Ga0075368_100212642 127
571 3300006048 Ga0075363_100293967 Ga0075363_1002939671 127
572 3300006051 Ga0075364_10135749 Ga0075364_101357492 127
573 3300006173 Ga0070716_100560142 Ga0070716_1005601422 127
574 3300006186 Ga0075369_10038126 Ga0075369_100381261 127
575 3300006186 Ga0075369_10592383 Ga0075369_105923831 127
576 3300006237 Ga0097621_100086763 Ga0097621_1000867632 127
577 3300006353 Ga0075370_10092306 Ga0075370_100923061 127
578 3300006358 Ga0068871_100039246 Ga0068871_1000392464 127
579 3300006844 Ga0075428_100261173 Ga0075428_1002611733 127
580 3300006852 Ga0075433_10911523 Ga0075433_109115232 127
581 3300006881 Ga0068865_100397117 Ga0068865_1003971171 127
582 3300006931 Ga0097620_100653378 Ga0097620_1006533782 127
583 3300007265 Ga0099794_10044503 Ga0099794_100445032 127
584 3300009176 Ga0105242_10071280 Ga0105242_100712802 127
585 3300009176 Ga0105242_10375559 Ga0105242_103755592 127
586 3300009177 Ga0105248_10248346 Ga0105248_102483462 127
587 3300009545 Ga0105237_10097347 Ga0105237_100973472 127
588 3300010159 Ga0099796_10104805 Ga0099796_101048051 127
589 3300011119 Ga0105246_10076924 Ga0105246_100769242 127
590 3300013296 Ga0157374_11012590 Ga0157374_110125902 127
591 3300013306 Ga0163162_10128117 Ga0163162_101281172 127
592 3300013306 Ga0163162_10446526 Ga0163162_104465262 127
593 3300013308 Ga0157375_11591755 Ga0157375_115917551 127
594 3300014325 Ga0163163_10134185 Ga0163163_101341853 127
595 3300014326 Ga0157380_11812180 Ga0157380_118121802 127
596 3300014968 Ga0157379_10147368 Ga0157379_101473682 127
597 3300014969 Ga0157376_10109163 Ga0157376_101091632 127
598 3300025297 Ga0209758_1004362 Ga0209758_10043629 127
599 3300025885 Ga0207653_10168951 Ga0207653_101689511 127
600 3300025901 Ga0207688_10072928 Ga0207688_100729281 127
601 3300025906 Ga0207699_10277842 Ga0207699_102778421 127
602 3300025908 Ga0207643_10353632 Ga0207643_103536322 127
603 3300025914 Ga0207671_10388131 Ga0207671_103881312 127
604 3300025920 Ga0207649_10315616 Ga0207649_103156162 127
605 3300025922 Ga0207646_10956437 Ga0207646_109564371 127
606 3300025925 Ga0207650_10413512 Ga0207650_104135122 127
607 3300025927 Ga0207687_10024453 Ga0207687_100244532 127
608 3300025928 Ga0207700_10021355 Ga0207700_100213554 127
609 3300025929 Ga0207664_10023209 Ga0207664_100232093 127
610 3300025931 Ga0207644_10996155 Ga0207644_109961551 127
611 3300025934 Ga0207686_10221104 Ga0207686_102211042 127
612 3300025938 Ga0207704_10111523 Ga0207704_101115232 127
613 3300025942 Ga0207689_10081554 Ga0207689_100815543 127
614 3300025949 Ga0207667_10179957 Ga0207667_101799571 127
615 3300025972 Ga0207668_10102188 Ga0207668_101021883 127
616 3300026023 Ga0207677_10005949 Ga0207677_100059493 127
617 3300026035 Ga0207703_10185478 Ga0207703_101854782 127
618 3300026041 Ga0207639_10168708 Ga0207639_101687083 127
619 3300026067 Ga0207678_10083544 Ga0207678_100835443 127
620 3300026095 Ga0207676_11089961 Ga0207676_110899612 127
621 3300026118 Ga0207675_100202011 Ga0207675_1002020112 127
622 3300026121 Ga0207683_10084312 Ga0207683_100843122 127
623 3300026142 Ga0207698_12658993 Ga0207698_126589931 127
624 3300027671 Ga0209588_1020041 Ga0209588_10200412 127
625 3300028379 Ga0268266_10061049 Ga0268266_100610493 127
626 3300031616 Ga0307508_10314881 Ga0307508_103148812 127
627 3300031730 Ga0307516_10181888 Ga0307516_101818884 127
628 3300037853 Ga0436364_0139836 Ga0436364_0139836_182_565 127
629 3300039437 Ga0436365_0642772 Ga0436365_0642772_182_565 127
630 3300039438 Ga0436360_0569747 Ga0436360_0569747_42_428 127
631 3300039453 Ga0436362_0066045 Ga0436362_0066045_223_624 127
632 3300046463 Ga0495653_0452446 Ga0495653_0452446_152_553 127
633 3300046476 Ga0495662_0102251 Ga0495662_0102251_759_1160 127
634 3300046535 Ga0495586_0601618 Ga0495586_0601618_212_613 127
635 3300046559 Ga0495667_0678854 Ga0495667_0678854_40_441 127
636 3300048905 Ga0496102_0308541 Ga0496102_0308541_764_1147 127
637 3300048909 Ga0496106_0106603 Ga0496106_0106603_1248_1631 127
638 3300048910 Ga0496107_0569503 Ga0496107_0569503_372_755 127
639 3300048911 Ga0496108_0070354 Ga0496108_0070354_762_1145 127
640 3300048913 Ga0496110_1479031 Ga0496110_1479031_147_530 127
641 3300048915 Ga0496112_0382439 Ga0496112_0382439_14_397 127
642 3300048916 Ga0496113_0325105 Ga0496113_0325105_267_650 127
643 3300048918 Ga0496115_0538292 Ga0496115_0538292_103_486 127
644 3300048921 Ga0496118_0271514 Ga0496118_0271514_204_587 127
645 3300048928 Ga0496125_0217409 Ga0496125_0217409_487_870 127
646 3300049585 Ga0501069_0365292 Ga0501069_0365292_145_528 127
647 3300050490 nmdc:mga03n38_147669_c1 nmdc:mga03n38_147669_c1_713_1096 127
648 3300050490 nmdc:mga03n38_431591_c1 nmdc:mga03n38_431591_c1_188_571 127
649 3300050491 nmdc:mga00v17_35686_c1 nmdc:mga00v17_35686_c1_1673_2056 127
650 3300050493 nmdc:mga0k408_684241_c1 nmdc:mga0k408_684241_c1_114_497 127
651 3300050493 nmdc:mga0k408_72131_c1 nmdc:mga0k408_72131_c1_51_434 127
652 3300050495 nmdc:mga04h51_313695_c1 nmdc:mga04h51_313695_c1_183_566 127
653 3300050507 nmdc:mga05p37_1566364_c1 nmdc:mga05p37_1566364_c1_73_474 127
654 3300050512 nmdc:mga0n895_189567_c1 nmdc:mga0n895_189567_c1_1086_1469 127
655 3300050513 nmdc:mga0rr50_321511_c1 nmdc:mga0rr50_321511_c1_309_692 127
656 3300050514 nmdc:mga08x19_928918_c1 nmdc:mga08x19_928918_c1_104_487 127
657 3300050516 nmdc:mga0sz30_25501_c1 nmdc:mga0sz30_25501_c1_1381_1764 127
658 3300053083 Ga0495655_0228027 Ga0495655_0228027_197_580 127
659 3300003659 JGI25404J52841_10114191 JGI25404J52841_101141911 128
660 3300005329 Ga0070683_100058699 Ga0070683_1000586993 128
661 3300005458 Ga0070681_10092772 Ga0070681_100927723 128
662 3300005539 Ga0068853_100343778 Ga0068853_1003437782 128
663 3300005617 Ga0068859_102301750 Ga0068859_1023017501 128
664 3300005983 Ga0081540_1005695 Ga0081540_100569512 128
665 3300005983 Ga0081540_1011062 Ga0081540_10110625 128
666 3300005983 Ga0081540_1207613 Ga0081540_12076131 128
667 3300006931 Ga0097620_102302830 Ga0097620_1023028301 128
668 3300009177 Ga0105248_12120140 Ga0105248_121201401 128
669 3300009545 Ga0105237_10179726 Ga0105237_101797263 128
670 3300014325 Ga0163163_10901598 Ga0163163_109015982 128
671 3300025297 Ga0209758_1067827 Ga0209758_10678272 128
672 3300025912 Ga0207707_10090754 Ga0207707_100907543 128
673 3300025913 Ga0207695_11399725 Ga0207695_113997251 128
674 3300025914 Ga0207671_10076274 Ga0207671_100762743 128
675 3300026041 Ga0207639_10072338 Ga0207639_100723381 128
676 3300030760 Ga0265762_1032188 Ga0265762_10321882 128
677 3300031730 Ga0307516_10861546 Ga0307516_108615461 128
678 3300044735 Ga0466968_0048494 Ga0466968_0048494_999_1397 128
679 3300044842 Ga0466957_1194667 Ga0466957_1194667_48_434 128
680 3300045836 Ga0466958_0586812 Ga0466958_0586812_314_700 128
681 3300048924 Ga0496121_0231125 Ga0496121_0231125_696_1082 128
682 3300048929 Ga0496126_0929826 Ga0496126_0929826_37_423 128
683 3300005548 Ga0070665_100325675 Ga0070665_1003256752 129
684 3300005548 Ga0070665_100674530 Ga0070665_1006745302 129
685 3300005563 Ga0068855_101039975 Ga0068855_1010399752 129
686 3300005937 Ga0081455_10009004 Ga0081455_100090044 129
687 3300006038 Ga0075365_10030954 Ga0075365_100309543 129
688 3300006038 Ga0075365_10031232 Ga0075365_100312322 129
689 3300006048 Ga0075363_100223520 Ga0075363_1002235202 129
690 3300006051 Ga0075364_11017455 Ga0075364_110174551 129
691 3300006177 Ga0075362_10091762 Ga0075362_100917622 129
692 3300006353 Ga0075370_10568578 Ga0075370_105685781 129
693 3300006844 Ga0075428_100262480 Ga0075428_1002624803 129
694 3300006846 Ga0075430_100148246 Ga0075430_1001482463 129
695 3300006847 Ga0075431_100250536 Ga0075431_1002505361 129
696 3300009093 Ga0105240_12388768 Ga0105240_123887681 129
697 3300014325 Ga0163163_11785563 Ga0163163_117855632 129
698 3300014968 Ga0157379_10199130 Ga0157379_101991302 129
699 3300025972 Ga0207668_10048038 Ga0207668_100480381 129
700 3300025972 Ga0207668_10485949 Ga0207668_104859492 129
701 3300025986 Ga0207658_11895337 Ga0207658_118953372 129
702 3300028380 Ga0268265_10403542 Ga0268265_104035422 129
703 3300031456 Ga0307513_11049351 Ga0307513_110493511 129
704 3300046474 Ga0495605_0232081 Ga0495605_0232081_233_622 129
705 3300046616 Ga0495668_0107162 Ga0495668_0107162_563_952 129
706 3300046665 Ga0495661_0556709 Ga0495661_0556709_98_487 129
707 3300050489 nmdc:mga03683_395739_c1 nmdc:mga03683_395739_c1_207_596 129
708 3300050490 nmdc:mga03n38_246069_c1 nmdc:mga03n38_246069_c1_340_747 129
709 3300050492 nmdc:mga0yw44_131781_c1 nmdc:mga0yw44_131781_c1_958_1365 129
710 3300050492 nmdc:mga0yw44_18644_c1 nmdc:mga0yw44_18644_c1_1741_2130 129
711 3300050492 nmdc:mga0yw44_933868_c1 nmdc:mga0yw44_933868_c1_149_538 129
712 3300050496 nmdc:mga07m45_65227_c1 nmdc:mga07m45_65227_c1_1002_1409 129
713 3300050509 nmdc:mga0qj67_273638_c1 nmdc:mga0qj67_273638_c1_138_527 129
714 3300053092 Ga0500583_0003828 Ga0500583_0003828_2202_2591 129
715 3300053094 Ga0500566_0003135 Ga0500566_0003135_2095_2484 129
716 3300053102 Ga0500554_091662 Ga0500554_091662_270_659 129
717 3300053119 Ga0500595_000363 Ga0500595_000363_13323_13712 129
718 3300053122 Ga0500608_202165 Ga0500608_202165_47_436 129
719 3300053162 Ga0500638_002245 Ga0500638_002245_1281_1670 129
720 3300053178 Ga0500637_0000391 Ga0500637_0000391_8602_8991 129
721 3300055283 Ga0500661_001163 Ga0500661_001163_1911_2300 129
722 3300005341 Ga0070691_10211391 Ga0070691_102113911 130
723 3300005456 Ga0070678_101355815 Ga0070678_1013558151 130
724 3300005518 Ga0070699_100168274 Ga0070699_1001682742 130
725 3300005547 Ga0070693_100018934 Ga0070693_1000189342 130
726 3300005548 Ga0070665_100002371 Ga0070665_10000237110 130
727 3300005548 Ga0070665_100233455 Ga0070665_1002334552 130
728 3300005548 Ga0070665_100490466 Ga0070665_1004904663 130
729 3300006028 Ga0070717_11180492 Ga0070717_111804922 130
730 3300006038 Ga0075365_10031723 Ga0075365_100317231 130
731 3300006042 Ga0075368_10355637 Ga0075368_103556372 130
732 3300006048 Ga0075363_100197415 Ga0075363_1001974152 130
733 3300006051 Ga0075364_10374629 Ga0075364_103746292 130
734 3300006178 Ga0075367_10044838 Ga0075367_100448383 130
735 3300006178 Ga0075367_10138219 Ga0075367_101382192 130
736 3300006195 Ga0075366_10428845 Ga0075366_104288452 130
737 3300006353 Ga0075370_10020680 Ga0075370_100206805 130
738 3300006353 Ga0075370_10328369 Ga0075370_103283692 130
739 3300009093 Ga0105240_10177698 Ga0105240_101776982 130
740 3300009177 Ga0105248_10983788 Ga0105248_109837882 130
741 3300009545 Ga0105237_10014439 Ga0105237_100144394 130
742 3300009553 Ga0105249_11377713 Ga0105249_113777131 130
743 3300010375 Ga0105239_10047667 Ga0105239_100476672 130
744 3300011119 Ga0105246_10764021 Ga0105246_107640211 130
745 3300013306 Ga0163162_10086509 Ga0163162_100865093 130
746 3300013308 Ga0157375_11844468 Ga0157375_118444681 130
747 3300017792 Ga0163161_11323444 Ga0163161_113234441 130
748 3300021361 Ga0213872_10024600 Ga0213872_100246003 130
749 3300021377 Ga0213874_10269325 Ga0213874_102693251 130
750 3300021441 Ga0213871_10203808 Ga0213871_102038081 130
751 3300025253 Ga0209677_100507 Ga0209677_1005076 130
752 3300025885 Ga0207653_10075677 Ga0207653_100756772 130
753 3300025913 Ga0207695_10272858 Ga0207695_102728582 130
754 3300025913 Ga0207695_10678900 Ga0207695_106789002 130
755 3300025914 Ga0207671_10838877 Ga0207671_108388772 130
756 3300025921 Ga0207652_10053798 Ga0207652_100537982 130
757 3300025934 Ga0207686_10156230 Ga0207686_101562302 130
758 3300025939 Ga0207665_10846094 Ga0207665_108460942 130
759 3300025941 Ga0207711_10010855 Ga0207711_100108553 130
760 3300025949 Ga0207667_10906422 Ga0207667_109064222 130
761 3300025961 Ga0207712_12047407 Ga0207712_120474071 130
762 3300026118 Ga0207675_102483021 Ga0207675_1024830211 130
763 3300026121 Ga0207683_11238186 Ga0207683_112381862 130
764 3300027866 Ga0209813_10177054 Ga0209813_101770541 130
765 3300028379 Ga0268266_10000538 Ga0268266_1000053853 130
766 3300028379 Ga0268266_10021937 Ga0268266_100219376 130
767 3300028379 Ga0268266_10202605 Ga0268266_102026051 130
768 3300031090 Ga0265760_10015070 Ga0265760_100150702 130
769 3300031249 Ga0265339_10320392 Ga0265339_103203921 130
770 3300031595 Ga0265313_10144237 Ga0265313_101442371 130
771 3300031616 Ga0307508_10015508 Ga0307508_100155085 130
772 3300031730 Ga0307516_10003990 Ga0307516_100039903 130
773 3300034816 Ga0373930_0027140 Ga0373930_0027140_733_1125 130
774 3300034820 Ga0373959_0075434 Ga0373959_0075434_129_521 130
775 3300035084 Ga0373928_0013984 Ga0373928_0013984_372_764 130
776 3300035086 Ga0373934_0094483 Ga0373934_0094483_187_579 130
777 3300035092 Ga0373952_0022340 Ga0373952_0022340_375_767 130
778 3300035111 Ga0373923_0016552 Ga0373923_0016552_360_752 130
779 3300035113 Ga0373936_0155166 Ga0373936_0155166_425_817 130
780 3300035116 Ga0373945_0022253 Ga0373945_0022253_183_575 130
781 3300035118 Ga0373954_0050959 Ga0373954_0050959_886_1278 130
782 3300035119 Ga0373956_0438577 Ga0373956_0438577_195_587 130
783 3300035120 Ga0373957_0509234 Ga0373957_0509234_32_424 130
784 3300035121 Ga0373960_0002828 Ga0373960_0002828_2497_2889 130
785 3300035170 Ga0373943_0057704 Ga0373943_0057704_463_855 130
786 3300035241 Ga0373961_0279954 Ga0373961_0279954_122_514 130
787 3300035691 Ga0373931_0005645 Ga0373931_0005645_569_961 130
788 3300035692 Ga0373935_0308826 Ga0373935_0308826_384_776 130
789 3300035695 Ga0373927_0707519 Ga0373927_0707519_105_497 130
790 3300035724 Ga0373933_0114248 Ga0373933_0114248_1098_1490 130
791 3300036401 Ga0373937_1164521 Ga0373937_1164521_280_672 130
792 3300037068 Ga0373925_0121764 Ga0373925_0121764_1497_1889 130
793 3300039438 Ga0436360_0530926 Ga0436360_0530926_6284_6676 130
794 3300039447 Ga0436361_0580570 Ga0436361_0580570_6482_6874 130
795 3300039450 Ga0436363_0079128 Ga0436363_0079128_300_692 130
796 3300042438 Ga0439459_0046344 Ga0439459_0046344_140_532 130
797 3300046472 Ga0495580_0391058 Ga0495580_0391058_49_441 130
798 3300046473 Ga0495582_0022894 Ga0495582_0022894_1185_1577 130
799 3300046475 Ga0495639_0400008 Ga0495639_0400008_244_636 130
800 3300046476 Ga0495662_0273019 Ga0495662_0273019_417_809 130
801 3300046517 Ga0495630_0172677 Ga0495630_0172677_739_1131 130
802 3300046529 Ga0495652_0100143 Ga0495652_0100143_1557_1949 130
803 3300046529 Ga0495652_0154461 Ga0495652_0154461_612_1004 130
804 3300046543 Ga0495645_0257498 Ga0495645_0257498_482_874 130
805 3300046663 Ga0495635_0327627 Ga0495635_0327627_154_546 130
806 3300047315 Ga0495581_0051590 Ga0495581_0051590_387_779 130
807 3300047319 Ga0495674_0192876 Ga0495674_0192876_734_1126 130
808 3300047673 Ga0495593_0240265 Ga0495593_0240265_168_560 130
809 3300048903 Ga0496100_0073200 Ga0496100_0073200_1251_1643 130
810 3300048903 Ga0496100_0815559 Ga0496100_0815559_191_583 130
811 3300048904 Ga0496101_0052927 Ga0496101_0052927_1229_1621 130
812 3300048905 Ga0496102_0853793 Ga0496102_0853793_372_764 130
813 3300048907 Ga0496104_0123885 Ga0496104_0123885_1143_1535 130
814 3300048908 Ga0496105_0132827 Ga0496105_0132827_36_428 130
815 3300048909 Ga0496106_0153455 Ga0496106_0153455_217_609 130
816 3300048909 Ga0496106_1262223 Ga0496106_1262223_28_420 130
817 3300048910 Ga0496107_0043968 Ga0496107_0043968_2358_2750 130
818 3300048911 Ga0496108_0212779 Ga0496108_0212779_749_1141 130
819 3300048912 Ga0496109_0397832 Ga0496109_0397832_650_1042 130
820 3300048913 Ga0496110_0103519 Ga0496110_0103519_1861_2253 130
821 3300048914 Ga0496111_0646893 Ga0496111_0646893_41_433 130
822 3300048916 Ga0496113_0256440 Ga0496113_0256440_184_576 130
823 3300048917 Ga0496114_0065533 Ga0496114_0065533_2348_2740 130
824 3300048918 Ga0496115_0027487 Ga0496115_0027487_3437_3829 130
825 3300048924 Ga0496121_0241249 Ga0496121_0241249_277_669 130
826 3300048928 Ga0496125_0055809 Ga0496125_0055809_21_413 130
827 3300048929 Ga0496126_0406157 Ga0496126_0406157_145_537 130
828 3300050490 nmdc:mga03n38_174930_c1 nmdc:mga03n38_174930_c1_292_684 130
829 3300050491 nmdc:mga00v17_399663_c1 nmdc:mga00v17_399663_c1_62_454 130
830 3300050492 nmdc:mga0yw44_32635_c1 nmdc:mga0yw44_32635_c1_144_536 130
831 3300050494 nmdc:mga06z11_163186_c1 nmdc:mga06z11_163186_c1_317_709 130
832 3300050494 nmdc:mga06z11_59237_c1 nmdc:mga06z11_59237_c1_1209_1601 130
833 3300050495 nmdc:mga04h51_518564_c1 nmdc:mga04h51_518564_c1_64_456 130
834 3300050495 nmdc:mga04h51_99658_c1 nmdc:mga04h51_99658_c1_645_1037 130
835 3300050496 nmdc:mga07m45_9902_c1 nmdc:mga07m45_9902_c1_2590_2982 130
836 3300053085 Ga0495619_0503272 Ga0495619_0503272_162_554 130
837 3300053119 Ga0500595_003671 Ga0500595_003671_6188_6580 130
838 3300053119 Ga0500595_078174 Ga0500595_078174_169_561 130
839 3300053136 Ga0500559_0340923 Ga0500559_0340923_27_419 130
840 3300053153 Ga0500616_0009374 Ga0500616_0009374_5506_5898 130
841 3300001977 JGI24746J21847_1012257 JGI24746J21847_10122572 131
842 3300001991 JGI24743J22301_10018930 JGI24743J22301_100189302 131
843 3300002070 JGI24750J21931_1006628 JGI24750J21931_10066283 131
844 3300002074 JGI24748J21848_1002927 JGI24748J21848_10029272 131
845 3300002075 JGI24738J21930_10014138 JGI24738J21930_100141381 131
846 3300002077 JGI24744J21845_10004502 JGI24744J21845_100045024 131
847 3300002244 JGI24742J22300_10003801 JGI24742J22300_100038014 131
848 3300003215 JGI25153J46596_10026936 JGI25153J46596_100269362 131
849 3300005329 Ga0070683_100043821 Ga0070683_1000438214 131
850 3300005330 Ga0070690_100033424 Ga0070690_1000334243 131
851 3300005331 Ga0070670_100034140 Ga0070670_1000341405 131
852 3300005334 Ga0068869_100103670 Ga0068869_1001036703 131
853 3300005334 Ga0068869_100820464 Ga0068869_1008204641 131
854 3300005335 Ga0070666_10237036 Ga0070666_102370362 131
855 3300005336 Ga0070680_100186297 Ga0070680_1001862972 131
856 3300005337 Ga0070682_100432072 Ga0070682_1004320722 131
857 3300005338 Ga0068868_100032452 Ga0068868_1000324525 131
858 3300005340 Ga0070689_100261093 Ga0070689_1002610932 131
859 3300005340 Ga0070689_101386274 Ga0070689_1013862741 131
860 3300005343 Ga0070687_100324798 Ga0070687_1003247982 131
861 3300005347 Ga0070668_100749340 Ga0070668_1007493401 131
862 3300005347 Ga0070668_101286140 Ga0070668_1012861401 131
863 3300005353 Ga0070669_100427826 Ga0070669_1004278262 131
864 3300005356 Ga0070674_100165038 Ga0070674_1001650383 131
865 3300005356 Ga0070674_100400327 Ga0070674_1004003272 131
866 3300005364 Ga0070673_100338577 Ga0070673_1003385772 131
867 3300005365 Ga0070688_100011699 Ga0070688_1000116994 131
868 3300005366 Ga0070659_100018907 Ga0070659_1000189074 131
869 3300005366 Ga0070659_100258131 Ga0070659_1002581313 131
870 3300005367 Ga0070667_100128355 Ga0070667_1001283552 131
871 3300005434 Ga0070709_10034131 Ga0070709_100341314 131
872 3300005435 Ga0070714_100419139 Ga0070714_1004191391 131
873 3300005436 Ga0070713_100082405 Ga0070713_1000824054 131
874 3300005437 Ga0070710_10061973 Ga0070710_100619732 131
875 3300005439 Ga0070711_100013376 Ga0070711_1000133762 131
876 3300005440 Ga0070705_100135126 Ga0070705_1001351261 131
877 3300005441 Ga0070700_100096999 Ga0070700_1000969992 131
878 3300005455 Ga0070663_100013068 Ga0070663_1000130686 131
879 3300005455 Ga0070663_100582960 Ga0070663_1005829602 131
880 3300005456 Ga0070678_100597917 Ga0070678_1005979171 131
881 3300005457 Ga0070662_100010380 Ga0070662_1000103805 131
882 3300005457 Ga0070662_100553911 Ga0070662_1005539112 131
883 3300005459 Ga0068867_101307242 Ga0068867_1013072421 131
884 3300005466 Ga0070685_10005252 Ga0070685_100052524 131
885 3300005467 Ga0070706_101865801 Ga0070706_1018658011 131
886 3300005471 Ga0070698_101345321 Ga0070698_1013453211 131
887 3300005539 Ga0068853_100007218 Ga0068853_1000072187 131
888 3300005539 Ga0068853_100035353 Ga0068853_1000353533 131
889 3300005543 Ga0070672_100001580 Ga0070672_1000015801 131
890 3300005543 Ga0070672_100231700 Ga0070672_1002317002 131
891 3300005544 Ga0070686_100015908 Ga0070686_1000159084 131
892 3300005545 Ga0070695_100711901 Ga0070695_1007119012 131
893 3300005546 Ga0070696_100062520 Ga0070696_1000625204 131
894 3300005546 Ga0070696_100209183 Ga0070696_1002091831 131
895 3300005547 Ga0070693_100002880 Ga0070693_1000028806 131
896 3300005548 Ga0070665_100049057 Ga0070665_1000490575 131
897 3300005549 Ga0070704_100102880 Ga0070704_1001028803 131
898 3300005564 Ga0070664_100267727 Ga0070664_1002677272 131
899 3300005615 Ga0070702_100008859 Ga0070702_1000088593 131
900 3300005616 Ga0068852_100021320 Ga0068852_1000213206 131
901 3300005616 Ga0068852_101542836 Ga0068852_1015428362 131
902 3300005618 Ga0068864_100050102 Ga0068864_1000501022 131
903 3300005718 Ga0068866_10023225 Ga0068866_100232252 131
904 3300005719 Ga0068861_100196403 Ga0068861_1001964031 131
905 3300005834 Ga0068851_10102114 Ga0068851_101021144 131
906 3300005840 Ga0068870_10030330 Ga0068870_100303305 131
907 3300005841 Ga0068863_100097929 Ga0068863_1000979293 131
908 3300005842 Ga0068858_100023824 Ga0068858_1000238245 131
909 3300005842 Ga0068858_100128455 Ga0068858_1001284553 131
910 3300005843 Ga0068860_100001170 Ga0068860_10000117017 131
911 3300005843 Ga0068860_100125230 Ga0068860_1001252303 131
912 3300005843 Ga0068860_100132585 Ga0068860_1001325854 131
913 3300005843 Ga0068860_100152561 Ga0068860_1001525614 131
914 3300005843 Ga0068860_100860619 Ga0068860_1008606192 131
915 3300005843 Ga0068860_101454885 Ga0068860_1014548851 131
916 3300005844 Ga0068862_100081947 Ga0068862_1000819472 131
917 3300006028 Ga0070717_10914881 Ga0070717_109148812 131
918 3300006038 Ga0075365_10031422 Ga0075365_100314222 131
919 3300006175 Ga0070712_100197388 Ga0070712_1001973883 131
920 3300006175 Ga0070712_101486738 Ga0070712_1014867381 131
921 3300006178 Ga0075367_10305473 Ga0075367_103054731 131
922 3300006186 Ga0075369_10196175 Ga0075369_101961751 131
923 3300006358 Ga0068871_100184888 Ga0068871_1001848882 131
924 3300006358 Ga0068871_100253556 Ga0068871_1002535563 131
925 3300006852 Ga0075433_10997282 Ga0075433_109972822 131
926 3300006871 Ga0075434_100151718 Ga0075434_1001517183 131
927 3300006871 Ga0075434_100902373 Ga0075434_1009023732 131
928 3300006880 Ga0075429_101095470 Ga0075429_1010954701 131
929 3300006881 Ga0068865_100493023 Ga0068865_1004930232 131
930 3300006941 Ga0099825_1019193 Ga0099825_10191934 131
931 3300006942 Ga0099824_1028856 Ga0099824_10288563 131
932 3300006944 Ga0099823_1000042 Ga0099823_100004223 131
933 3300009093 Ga0105240_11583468 Ga0105240_115834681 131
934 3300009094 Ga0111539_10660878 Ga0111539_106608782 131
935 3300009094 Ga0111539_13112131 Ga0111539_131121311 131
936 3300009098 Ga0105245_10023627 Ga0105245_100236274 131
937 3300009098 Ga0105245_10177430 Ga0105245_101774302 131
938 3300009098 Ga0105245_11803904 Ga0105245_118039042 131
939 3300009098 Ga0105245_11948922 Ga0105245_119489222 131
940 3300009101 Ga0105247_10008014 Ga0105247_100080145 131
941 3300009147 Ga0114129_10018100 Ga0114129_100181004 131
942 3300009147 Ga0114129_10179083 Ga0114129_101790831 131
943 3300009147 Ga0114129_11143862 Ga0114129_111438621 131
944 3300009148 Ga0105243_10059744 Ga0105243_100597441 131
945 3300009174 Ga0105241_10031877 Ga0105241_100318774 131
946 3300009176 Ga0105242_10094307 Ga0105242_100943073 131
947 3300009177 Ga0105248_10026597 Ga0105248_100265974 131
948 3300009545 Ga0105237_10309840 Ga0105237_103098401 131
949 3300009545 Ga0105237_11157061 Ga0105237_111570612 131
950 3300009545 Ga0105237_11333455 Ga0105237_113334552 131
951 3300009553 Ga0105249_10026912 Ga0105249_100269124 131
952 3300009553 Ga0105249_12092050 Ga0105249_120920501 131
953 3300010375 Ga0105239_10013998 Ga0105239_100139988 131
954 3300010375 Ga0105239_10098444 Ga0105239_100984443 131
955 3300010375 Ga0105239_13429890 Ga0105239_134298901 131
956 3300011119 Ga0105246_10027513 Ga0105246_100275132 131
957 3300011119 Ga0105246_11186088 Ga0105246_111860882 131
958 3300013296 Ga0157374_11144746 Ga0157374_111447462 131
959 3300013297 Ga0157378_10007983 Ga0157378_100079835 131
960 3300013297 Ga0157378_10106621 Ga0157378_101066212 131
961 3300013297 Ga0157378_10217973 Ga0157378_102179732 131
962 3300013297 Ga0157378_10932975 Ga0157378_109329751 131
963 3300013297 Ga0157378_11831175 Ga0157378_118311752 131
964 3300013306 Ga0163162_10161483 Ga0163162_101614833 131
965 3300013306 Ga0163162_10244208 Ga0163162_102442083 131
966 3300013306 Ga0163162_10991381 Ga0163162_109913811 131
967 3300013307 Ga0157372_10484461 Ga0157372_104844612 131
968 3300013308 Ga0157375_10007093 Ga0157375_100070932 131
969 3300013308 Ga0157375_10070810 Ga0157375_100708104 131
970 3300014325 Ga0163163_10001366 Ga0163163_100013667 131
971 3300014326 Ga0157380_10009161 Ga0157380_100091615 131
972 3300014326 Ga0157380_10143228 Ga0157380_101432282 131
973 3300014745 Ga0157377_10037517 Ga0157377_100375171 131
974 3300014968 Ga0157379_10031905 Ga0157379_100319054 131
975 3300014968 Ga0157379_10086190 Ga0157379_100861902 131
976 3300014968 Ga0157379_10697743 Ga0157379_106977431 131
977 3300014969 Ga0157376_10074553 Ga0157376_100745534 131
978 3300017792 Ga0163161_10044525 Ga0163161_100445252 131
979 3300022467 Ga0224712_10107837 Ga0224712_101078371 131
980 3300025297 Ga0209758_1000088 Ga0209758_100008881 131
981 3300025297 Ga0209758_1034578 Ga0209758_10345782 131
982 3300025298 Ga0209050_1001041 Ga0209050_10010411 131
983 3300025898 Ga0207692_10078251 Ga0207692_100782514 131
984 3300025898 Ga0207692_10130725 Ga0207692_101307252 131
985 3300025899 Ga0207642_10012459 Ga0207642_100124593 131
986 3300025900 Ga0207710_10009583 Ga0207710_100095833 131
987 3300025901 Ga0207688_10006010 Ga0207688_100060104 131
988 3300025904 Ga0207647_10021697 Ga0207647_100216974 131
989 3300025904 Ga0207647_10085968 Ga0207647_100859683 131
990 3300025906 Ga0207699_10071844 Ga0207699_100718442 131
991 3300025908 Ga0207643_10021169 Ga0207643_100211694 131
992 3300025913 Ga0207695_10091125 Ga0207695_100911252 131
993 3300025915 Ga0207693_10012845 Ga0207693_100128451 131
994 3300025915 Ga0207693_10076719 Ga0207693_100767191 131
995 3300025916 Ga0207663_10174673 Ga0207663_101746732 131
996 3300025916 Ga0207663_10480239 Ga0207663_104802392 131
997 3300025917 Ga0207660_10739834 Ga0207660_107398342 131
998 3300025918 Ga0207662_10167134 Ga0207662_101671343 131
999 3300025919 Ga0207657_10100812 Ga0207657_101008122 131
1000 3300025920 Ga0207649_10097014 Ga0207649_100970142 131
1001 3300025923 Ga0207681_10230161 Ga0207681_102301611 131
1002 3300025923 Ga0207681_10732291 Ga0207681_107322912 131
1003 3300025925 Ga0207650_10010331 Ga0207650_100103313 131
1004 3300025926 Ga0207659_11891521 Ga0207659_118915211 131
1005 3300025928 Ga0207700_10301408 Ga0207700_103014082 131
1006 3300025928 Ga0207700_11070598 Ga0207700_110705981 131
1007 3300025931 Ga0207644_10070892 Ga0207644_100708923 131
1008 3300025931 Ga0207644_10177591 Ga0207644_101775913 131
1009 3300025932 Ga0207690_10064302 Ga0207690_100643023 131
1010 3300025933 Ga0207706_10004538 Ga0207706_100045382 131
1011 3300025933 Ga0207706_10048734 Ga0207706_100487342 131
1012 3300025934 Ga0207686_10012066 Ga0207686_100120663 131
1013 3300025936 Ga0207670_10117508 Ga0207670_101175082 131
1014 3300025937 Ga0207669_10002431 Ga0207669_100024316 131
1015 3300025937 Ga0207669_10263959 Ga0207669_102639592 131
1016 3300025937 Ga0207669_11171849 Ga0207669_111718491 131
1017 3300025938 Ga0207704_10032314 Ga0207704_100323143 131
1018 3300025938 Ga0207704_11127000 Ga0207704_111270001 131
1019 3300025939 Ga0207665_10061239 Ga0207665_100612392 131
1020 3300025940 Ga0207691_10185746 Ga0207691_101857463 131
1021 3300025941 Ga0207711_10028877 Ga0207711_100288774 131
1022 3300025942 Ga0207689_10006931 Ga0207689_100069319 131
1023 3300025944 Ga0207661_10097234 Ga0207661_100972342 131
1024 3300025961 Ga0207712_10038736 Ga0207712_100387361 131
1025 3300025972 Ga0207668_10042593 Ga0207668_100425932 131
1026 3300025972 Ga0207668_10792164 Ga0207668_107921641 131
1027 3300025981 Ga0207640_10138593 Ga0207640_101385932 131
1028 3300025986 Ga0207658_10066476 Ga0207658_100664764 131
1029 3300026023 Ga0207677_10106102 Ga0207677_101061022 131
1030 3300026035 Ga0207703_10104853 Ga0207703_101048533 131
1031 3300026035 Ga0207703_10203088 Ga0207703_102030882 131
1032 3300026035 Ga0207703_10654354 Ga0207703_106543542 131
1033 3300026041 Ga0207639_10121329 Ga0207639_101213293 131
1034 3300026041 Ga0207639_10206696 Ga0207639_102066961 131
1035 3300026067 Ga0207678_10014332 Ga0207678_100143327 131
1036 3300026075 Ga0207708_11329141 Ga0207708_113291412 131
1037 3300026088 Ga0207641_10091482 Ga0207641_100914822 131
1038 3300026089 Ga0207648_10198595 Ga0207648_101985952 131
1039 3300026089 Ga0207648_11895837 Ga0207648_118958372 131
1040 3300026095 Ga0207676_10016623 Ga0207676_100166234 131
1041 3300026118 Ga0207675_100163040 Ga0207675_1001630403 131
1042 3300026118 Ga0207675_100643578 Ga0207675_1006435782 131
1043 3300026121 Ga0207683_10060851 Ga0207683_100608511 131
1044 3300026142 Ga0207698_10183264 Ga0207698_101832643 131
1045 3300027296 Ga0209389_1000135 Ga0209389_100013520 131
1046 3300027361 Ga0209489_100653 Ga0209489_10065322 131
1047 3300027363 Ga0209700_100417 Ga0209700_10041728 131
1048 3300027907 Ga0207428_10828678 Ga0207428_108286781 131
1049 3300028379 Ga0268266_10151354 Ga0268266_101513542 131
1050 3300028380 Ga0268265_10010542 Ga0268265_100105423 131
1051 3300028380 Ga0268265_10474498 Ga0268265_104744982 131
1052 3300028380 Ga0268265_12445490 Ga0268265_124454902 131
1053 3300028381 Ga0268264_10000187 Ga0268264_1000018785 131
1054 3300028381 Ga0268264_10981947 Ga0268264_109819471 131
1055 3300028381 Ga0268264_11729961 Ga0268264_117299611 131
1056 3300031235 Ga0265330_10048809 Ga0265330_100488091 131
1057 3300031507 Ga0307509_10302605 Ga0307509_103026052 131
1058 3300031712 Ga0265342_10013591 Ga0265342_100135913 131
1059 3300031730 Ga0307516_10001085 Ga0307516_1000108537 131
1060 3300031903 Ga0307407_10415830 Ga0307407_104158302 131
1061 3300031911 Ga0307412_10691291 Ga0307412_106912912 131
1062 3300032002 Ga0307416_101108203 Ga0307416_1011082031 131
1063 3300032004 Ga0307414_10193425 Ga0307414_101934252 131
1064 3300035116 Ga0373945_0241110 Ga0373945_0241110_287_685 131
1065 3300035170 Ga0373943_0035781 Ga0373943_0035781_955_1350 131
1066 3300035172 Ga0373955_0679386 Ga0373955_0679386_43_444 131
1067 3300035692 Ga0373935_0003759 Ga0373935_0003759_1202_1597 131
1068 3300035695 Ga0373927_0004169 Ga0373927_0004169_2455_2850 131
1069 3300035695 Ga0373927_0028041 Ga0373927_0028041_2151_2546 131
1070 3300035725 Ga0373947_0011282 Ga0373947_0011282_2455_2850 131
1071 3300035725 Ga0373947_0054937 Ga0373947_0054937_1797_2192 131
1072 3300036401 Ga0373937_0654672 Ga0373937_0654672_244_639 131
1073 3300037068 Ga0373925_0008051 Ga0373925_0008051_1630_2025 131
1074 3300037068 Ga0373925_0053000 Ga0373925_0053000_1610_2005 131
1075 3300037466 Ga0395898_0308766 Ga0395898_0308766_932_1330 131
1076 3300037471 Ga0395905_0170178 Ga0395905_0170178_133_531 131
1077 3300046452 Ga0495617_132591 Ga0495617_132591_228_623 131
1078 3300046452 Ga0495617_134570 Ga0495617_134570_364_759 131
1079 3300046455 Ga0495603_0016575 Ga0495603_0016575_2278_2673 131
1080 3300046459 Ga0495629_0566673 Ga0495629_0566673_193_588 131
1081 3300046461 Ga0495641_0088339 Ga0495641_0088339_759_1154 131
1082 3300046472 Ga0495580_0164063 Ga0495580_0164063_1107_1502 131
1083 3300046472 Ga0495580_0206930 Ga0495580_0206930_280_675 131
1084 3300046473 Ga0495582_0013127 Ga0495582_0013127_1206_1601 131
1085 3300046474 Ga0495605_0003508 Ga0495605_0003508_2812_3207 131
1086 3300046475 Ga0495639_0103042 Ga0495639_0103042_120_515 131
1087 3300046476 Ga0495662_0055060 Ga0495662_0055060_1013_1408 131
1088 3300046492 Ga0495585_0094753 Ga0495585_0094753_117_653 131
1089 3300046492 Ga0495585_0321274 Ga0495585_0321274_277_672 131
1090 3300046501 Ga0495607_0043454 Ga0495607_0043454_824_1219 131
1091 3300046501 Ga0495607_0204590 Ga0495607_0204590_267_662 131
1092 3300046506 Ga0495583_0012351 Ga0495583_0012351_1738_2133 131
1093 3300046511 Ga0495608_0499362 Ga0495608_0499362_122_517 131
1094 3300046512 Ga0495610_0359152 Ga0495610_0359152_20_415 131
1095 3300046513 Ga0495616_0014970 Ga0495616_0014970_3800_4195 131
1096 3300046513 Ga0495616_0160155 Ga0495616_0160155_535_930 131
1097 3300046518 Ga0495631_0002810 Ga0495631_0002810_2992_3387 131
1098 3300046519 Ga0495632_0031510 Ga0495632_0031510_1624_2019 131
1099 3300046519 Ga0495632_0247859 Ga0495632_0247859_29_424 131
1100 3300046520 Ga0495637_0070700 Ga0495637_0070700_105_500 131
1101 3300046530 Ga0495654_0118121 Ga0495654_0118121_722_1117 131
1102 3300046537 Ga0495598_0007742 Ga0495598_0007742_194_640 131
1103 3300046538 Ga0495609_0184806 Ga0495609_0184806_54_449 131
1104 3300046615 Ga0495656_0017995 Ga0495656_0017995_1406_1801 131
1105 3300046616 Ga0495668_0002555 Ga0495668_0002555_8483_8878 131
1106 3300046660 Ga0495625_0010556 Ga0495625_0010556_6240_6635 131
1107 3300046664 Ga0495659_0093881 Ga0495659_0093881_477_872 131
1108 3300046681 Ga0495647_0005408 Ga0495647_0005408_3274_3669 131
1109 3300046683 Ga0495658_0250534 Ga0495658_0250534_11_406 131
1110 3300046689 Ga0495613_0243020 Ga0495613_0243020_782_1177 131
1111 3300046689 Ga0495613_0340974 Ga0495613_0340974_228_623 131
1112 3300046690 Ga0495624_0075431 Ga0495624_0075431_1463_1858 131
1113 3300046691 Ga0495670_0065896 Ga0495670_0065896_492_887 131
1114 3300046694 Ga0495649_0209571 Ga0495649_0209571_416_811 131
1115 3300046809 Ga0495600_0359981 Ga0495600_0359981_261_656 131
1116 3300047321 Ga0495676_0006508 Ga0495676_0006508_3038_3433 131
1117 3300047445 Ga0495677_0200923 Ga0495677_0200923_25_420 131
1118 3300047472 Ga0495686_0000800 Ga0495686_0000800_11513_11908 131
1119 3300047673 Ga0495593_0055097 Ga0495593_0055097_1129_1524 131
1120 3300048091 Ga0495626_0175218 Ga0495626_0175218_316_711 131
1121 3300048903 Ga0496100_0024512 Ga0496100_0024512_2135_2530 131
1122 3300048904 Ga0496101_0004545 Ga0496101_0004545_1940_2335 131
1123 3300048904 Ga0496101_0246999 Ga0496101_0246999_425_820 131
1124 3300048904 Ga0496101_0275889 Ga0496101_0275889_468_863 131
1125 3300048905 Ga0496102_0091640 Ga0496102_0091640_1366_1761 131
1126 3300048905 Ga0496102_0244942 Ga0496102_0244942_492_887 131
1127 3300048905 Ga0496102_1129669 Ga0496102_1129669_89_484 131
1128 3300048906 Ga0496103_0021461 Ga0496103_0021461_2445_2840 131
1129 3300048907 Ga0496104_0001506 Ga0496104_0001506_1389_1784 131
1130 3300048907 Ga0496104_0003793 Ga0496104_0003793_230_625 131
1131 3300048907 Ga0496104_0082253 Ga0496104_0082253_1177_1572 131
1132 3300048907 Ga0496104_0124102 Ga0496104_0124102_581_976 131
1133 3300048908 Ga0496105_0000442 Ga0496105_0000442_23156_23551 131
1134 3300048908 Ga0496105_0000721 Ga0496105_0000721_4485_4880 131
1135 3300048908 Ga0496105_0013118 Ga0496105_0013118_1802_2197 131
1136 3300048909 Ga0496106_0004293 Ga0496106_0004293_2165_2560 131
1137 3300048909 Ga0496106_0049748 Ga0496106_0049748_2210_2623 131
1138 3300048909 Ga0496106_0063696 Ga0496106_0063696_1505_1912 131
1139 3300048910 Ga0496107_0014835 Ga0496107_0014835_3112_3507 131
1140 3300048910 Ga0496107_0261289 Ga0496107_0261289_397_792 131
1141 3300048911 Ga0496108_0006478 Ga0496108_0006478_7597_7992 131
1142 3300048911 Ga0496108_0008634 Ga0496108_0008634_4358_4753 131
1143 3300048911 Ga0496108_0015824 Ga0496108_0015824_3382_3777 131
1144 3300048912 Ga0496109_0000392 Ga0496109_0000392_4374_4769 131
1145 3300048912 Ga0496109_0001446 Ga0496109_0001446_12098_12493 131
1146 3300048912 Ga0496109_0080259 Ga0496109_0080259_1366_1761 131
1147 3300048912 Ga0496109_0313767 Ga0496109_0313767_645_1040 131
1148 3300048913 Ga0496110_0006715 Ga0496110_0006715_7222_7617 131
1149 3300048913 Ga0496110_0012186 Ga0496110_0012186_1641_2036 131
1150 3300048913 Ga0496110_0093217 Ga0496110_0093217_1296_1691 131
1151 3300048913 Ga0496110_0116199 Ga0496110_0116199_366_761 131
1152 3300048913 Ga0496110_0909370 Ga0496110_0909370_106_501 131
1153 3300048914 Ga0496111_0002114 Ga0496111_0002114_1849_2244 131
1154 3300048914 Ga0496111_0003367 Ga0496111_0003367_2722_3117 131
1155 3300048914 Ga0496111_0009885 Ga0496111_0009885_5624_6019 131
1156 3300048914 Ga0496111_0018577 Ga0496111_0018577_3329_3724 131
1157 3300048915 Ga0496112_0001759 Ga0496112_0001759_10476_10871 131
1158 3300048915 Ga0496112_0007831 Ga0496112_0007831_1518_1913 131
1159 3300048915 Ga0496112_0070610 Ga0496112_0070610_1331_1726 131
1160 3300048915 Ga0496112_0946614 Ga0496112_0946614_236_631 131
1161 3300048916 Ga0496113_0000243 Ga0496113_0000243_3727_4122 131
1162 3300048916 Ga0496113_0002540 Ga0496113_0002540_9632_10027 131
1163 3300048916 Ga0496113_0068120 Ga0496113_0068120_1227_1622 131
1164 3300048917 Ga0496114_0001511 Ga0496114_0001511_12773_13168 131
1165 3300048917 Ga0496114_0317220 Ga0496114_0317220_836_1285 131
1166 3300048918 Ga0496115_0002949 Ga0496115_0002949_380_775 131
1167 3300048918 Ga0496115_0021101 Ga0496115_0021101_2468_2863 131
1168 3300048924 Ga0496121_0204092 Ga0496121_0204092_332_727 131
1169 3300048925 Ga0496122_0150687 Ga0496122_0150687_53_451 131
1170 3300048928 Ga0496125_0018828 Ga0496125_0018828_4631_5026 131
1171 3300048929 Ga0496126_0311405 Ga0496126_0311405_345_740 131
1172 3300049459 Ga0495678_063215 Ga0495678_063215_848_1243 131
1173 3300049672 Ga0501239_044813 Ga0501239_044813_188_583 131
1174 3300049851 Ga0501212_039679 Ga0501212_039679_341_736 131
1175 3300050492 nmdc:mga0yw44_45115_c1 nmdc:mga0yw44_45115_c1_644_1039 131
1176 3300050493 nmdc:mga0k408_109126_c1 nmdc:mga0k408_109126_c1_1077_1472 131
1177 3300050507 nmdc:mga05p37_25457_c1 nmdc:mga05p37_25457_c1_2477_2872 131
1178 3300050507 nmdc:mga05p37_639258_c1 nmdc:mga05p37_639258_c1_749_1144 131
1179 3300050508 nmdc:mga09592_242341_c1 nmdc:mga09592_242341_c1_220_615 131
1180 3300050510 nmdc:mga06r32_131586_c1 nmdc:mga06r32_131586_c1_1491_1886 131
1181 3300050512 nmdc:mga0n895_407568_c1 nmdc:mga0n895_407568_c1_228_623 131
1182 3300050516 nmdc:mga0sz30_312452_c1 nmdc:mga0sz30_312452_c1_140_547 131
1183 3300053079 Ga0500610_0012561 Ga0500610_0012561_133_528 131
1184 3300053085 Ga0495619_0004858 Ga0495619_0004858_3369_3764 131
1185 3300053085 Ga0495619_0244597 Ga0495619_0244597_442_837 131
1186 3300053093 Ga0500651_0037407 Ga0500651_0037407_1114_1509 131
1187 3300053094 Ga0500566_0003029 Ga0500566_0003029_5956_6351 131
1188 3300053096 Ga0500641_0151233 Ga0500641_0151233_485_883 131
1189 3300053105 Ga0500557_085519 Ga0500557_085519_249_644 131
1190 3300053109 Ga0500569_128241 Ga0500569_128241_150_545 131
1191 3300053111 Ga0500572_000747 Ga0500572_000747_1214_1609 131
1192 3300053118 Ga0500594_0000512 Ga0500594_0000512_4723_5118 131
1193 3300053119 Ga0500595_003507 Ga0500595_003507_1413_1808 131
1194 3300053122 Ga0500608_016509 Ga0500608_016509_2485_2880 131
1195 3300053130 Ga0500642_0051142 Ga0500642_0051142_708_1103 131
1196 3300053134 Ga0500658_0147560 Ga0500658_0147560_341_739 131
1197 3300053136 Ga0500559_0118613 Ga0500559_0118613_782_1177 131
1198 3300053142 Ga0500577_0066143 Ga0500577_0066143_348_794 131
1199 3300053142 Ga0500577_0158353 Ga0500577_0158353_327_722 131
1200 3300053150 Ga0500603_000740 Ga0500603_000740_2027_2422 131
1201 3300053151 Ga0500604_0193389 Ga0500604_0193389_40_447 131
1202 3300053159 Ga0500630_002258 Ga0500630_002258_3980_4375 131
1203 3300053163 Ga0500639_000035 Ga0500639_000035_62508_62903 131
1204 3300053178 Ga0500637_0135353 Ga0500637_0135353_1017_1412 131
1205 3300053731 Ga0500609_039661 Ga0500609_039661_205_600 131
1206 3300053737 Ga0500601_002331 Ga0500601_002331_1261_1656 131
1207 3300060353 Ga0501082_0177318 Ga0501082_0177318_1333_1728 131

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12680

SnoaL_2

SnoaL-like domain

40

134

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3f40-assembly1.cif.gz_A-2 crystal structure of ntf2-like protein of unknown function (yp_677363.1) from cytophaga hutchinsonii atcc 33406 at 1.27 a resolution 0.9106 6 108
6uae-assembly4.cif.gz_D ketosteroid isomerase (c. testosteroni) with truncated & designed loop for precise positioning of a catalytic e38 0.9007 4 110
6uad-assembly1.cif.gz_A ketosteroid isomerase (c. testosteroni) with truncated & designed loop for precise positioning of a catalytic e38 0.8848 4 110
5aii-assembly1.cif.gz_H discovery and characterization of thermophilic limonene-1,2-epoxide hydrolases from hot spring metagenomic libraries. ch55-sample-peg complex 0.883 8 108
3f8h-assembly1.cif.gz_B crystal structure of a putative polyketide cyclase (tm1040_3560) from silicibacter sp. tm1040 at 2.00 a resolution 0.8819 4 108
ID Description Score Start End Superfamily
3en8A01 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.954 3 110 3.10.450.50
3en8A01 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.9285 3 110 3.10.450.50
3f40A00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.914 6 108 3.10.450.50
2bngA00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8868 4 108 3.10.450.50
5aiiN00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8863 8 108 3.10.450.50
ID Description Score Start End GO Terms
AF-A0A838J2U5-F1-model_v4 Nuclear transport factor 2 family protein 0.9866 1 97
AF-A0A838J2U5-F1-model_v4 Nuclear transport factor 2 family protein 0.9766 1 97
AF-A0A328EGT5-F1-model_v4 SnoaL-like domain-containing protein 0.9532 61 108
AF-A0A7Y2IYY7-F1-model_v4 SnoaL-like domain-containing protein 0.9359 18 110
AF-A0A6J4VCE0-F1-model_v4 SnoaL-like domain-containing protein 0.9357 6 107

Feature Viewer

pLDDT pTM Quality
91.41 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map