F491659

General Info

Members Datasets Scaffolds Average Seq Length
1207 392 2414 118

Family's Representative Sequence

Representative Sequence 3300013102|Ga0157371_10821374|Ga0157371_108213741
Length 144
Sequence MVAEPMSISADAVRLIGDHPPRRKPMKYLLLIHQGDAPTPRDPEAWAKLSEEEQNRVFADYQALNQTPGVTPGLQMQGPEAATTVRVEDGQTLATDGPFVTVKEALAGWLVYDADDLDAAIELAARIPAARLGGAIEVRPLAGE

Samples

Sample ID Description Type Environment
1 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
2 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
3 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
4 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
5 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
34 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
35 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
36 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
37 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
38 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
39 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
40 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
41 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
48 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
49 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
55 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
56 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
57 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
58 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
61 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
62 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
63 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
64 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
65 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
66 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
67 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
68 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
69 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
70 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
71 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
72 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
73 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
74 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
75 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
76 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
77 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
78 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
79 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
80 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
81 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
82 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
83 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
84 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
85 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
86 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
87 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
88 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
90 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
91 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
92 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
93 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
94 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
95 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
96 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
97 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
98 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
99 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
100 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
101 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
102 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
103 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
104 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
105 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
106 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
107 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
108 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
109 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
110 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
111 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
112 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
113 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
114 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
115 3300012487 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 Metagenome Rhizosphere
116 3300012490 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 Metagenome Rhizosphere
117 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
118 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
119 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
120 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
121 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
122 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
123 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
124 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
125 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
126 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
127 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
128 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
129 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
130 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
131 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
132 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
133 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
134 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
135 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
136 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
137 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
138 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
139 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
140 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
200 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
201 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
202 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
206 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
207 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
208 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
209 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
210 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
211 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
212 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
213 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
214 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
215 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
216 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
217 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
218 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
219 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
220 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
221 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
222 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
223 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
224 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
225 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
226 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
227 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
228 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
229 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
230 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
231 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
232 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
233 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
234 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
235 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
236 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
237 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
238 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
239 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
240 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
241 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
242 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
243 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
244 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
245 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
246 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
247 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
248 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
249 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
250 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
251 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
252 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
253 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
254 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
255 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
256 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
257 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
258 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
259 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
260 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
261 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
262 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
263 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
264 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
265 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
266 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
267 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
268 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
269 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
270 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
271 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
272 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
273 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
274 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
275 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
276 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
277 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
278 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
279 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
280 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
281 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
282 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
283 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
284 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
285 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
286 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
287 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
288 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
289 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
290 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
291 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
292 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
293 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
294 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
295 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
296 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
297 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
298 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
299 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
300 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
301 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
302 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
303 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
304 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
305 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
306 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
307 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
308 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
309 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
310 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
311 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
312 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
313 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
314 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
315 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
316 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
317 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
318 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
319 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
320 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
321 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
322 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
323 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
324 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
325 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
326 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
327 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
328 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
329 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
330 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
331 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
332 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
333 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
334 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
335 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
336 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
337 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
338 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
339 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
340 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
341 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
342 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
343 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
344 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
345 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
346 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
347 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
348 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
349 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
350 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
351 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
352 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
353 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
354 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
355 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
356 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
357 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
358 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
359 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
360 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
361 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
362 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
363 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
364 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
365 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
366 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
367 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
368 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
369 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
370 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
371 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
372 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
373 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
374 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
375 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
376 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
377 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
378 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
379 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
380 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
381 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
382 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
383 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
384 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
385 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
386 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
387 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
388 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
389 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
390 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
391 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
392 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.67
Metatranscriptomes 1.33
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.49
Nodule 0
Rhizoplane 6.21
Rhizosphere 90.31
Stem 0
Stem Tuber 0
Unclassified 1.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157371_10821374 3300013102 Bacteria 701
2 2214761064 2209111006 Bacteria 837
3 ARcpr5yngRDRAFT_c002579 3300000043 Bacteria 1869
4 ARCol0yngRDRAFT_1005013 3300000652 Bacteria 954
5 JGI24746J21847_1050660 3300001977 Bacteria 584
6 JGI25406J46586_10010892 3300003203 Bacteria 4008
7 JGI25407J50210_10002530 3300003373 Bacteria 4317
8 JGI25407J50210_10049953 3300003373 Bacteria 1061
9 JGI25407J50210_10064244 3300003373 Bacteria 920
10 JGI25407J50210_10127034 3300003373 Bacteria 628
11 JGI25407J50210_10132576 3300003373 Bacteria 613
12 Ga0070658_10001210 3300005327 Bacteria 22122
13 Ga0070658_10020311 3300005327 Bacteria 5323
14 Ga0070676_10081619 3300005328 Bacteria 1962
15 Ga0070676_10828318 3300005328 Bacteria 685
16 Ga0070683_100005813 3300005329 Bacteria 10318
17 Ga0070683_100026739 3300005329 Bacteria 5200
18 Ga0070683_100058107 3300005329 Bacteria 3594
19 Ga0070683_100119568 3300005329 Bacteria 2488
20 Ga0070683_100473552 3300005329 Bacteria 1196
21 Ga0070690_100196399 3300005330 Bacteria 1401
22 Ga0070690_100889816 3300005330 Bacteria 696
23 Ga0070670_100860494 3300005331 Bacteria 820
24 Ga0070677_10302916 3300005333 Bacteria 813
25 Ga0068869_100034683 3300005334 Bacteria 3571
26 Ga0070680_100003139 3300005336 Bacteria 12276
27 Ga0070680_100023121 3300005336 Bacteria 4955
28 Ga0070680_100131595 3300005336 Bacteria 2093
29 Ga0070680_100155513 3300005336 Bacteria 1921
30 Ga0070682_100010853 3300005337 Bacteria 5184
31 Ga0070682_100046743 3300005337 Bacteria 2687
32 Ga0070682_100059809 3300005337 Bacteria 2407
33 Ga0070682_100533156 3300005337 Bacteria 915
34 Ga0070682_100843998 3300005337 Bacteria 748
35 Ga0070682_101929680 3300005337 Bacteria 518
36 Ga0068868_100158156 3300005338 Bacteria 1870
37 Ga0068868_101256228 3300005338 Bacteria 686
38 Ga0070660_100005363 3300005339 Bacteria 8873
39 Ga0070660_100014995 3300005339 Bacteria 5589
40 Ga0070660_100065830 3300005339 Bacteria 2821
41 Ga0070660_100528948 3300005339 Bacteria 982
42 Ga0070689_100040014 3300005340 Bacteria 3592
43 Ga0070689_100153268 3300005340 Bacteria 1859
44 Ga0070689_100636221 3300005340 Bacteria 927
45 Ga0070691_10006936 3300005341 Bacteria 5185
46 Ga0070691_10031222 3300005341 Bacteria 2497
47 Ga0070691_10313265 3300005341 Bacteria 861
48 Ga0070691_10365441 3300005341 Bacteria 805
49 Ga0070687_100143211 3300005343 Bacteria 1394
50 Ga0070687_100769744 3300005343 Bacteria 679
51 Ga0070661_100032533 3300005344 Bacteria 3776
52 Ga0070661_100118550 3300005344 Bacteria 1981
53 Ga0070661_100320406 3300005344 Bacteria 1211
54 Ga0070661_100768879 3300005344 Bacteria 789
55 Ga0070661_100779376 3300005344 Bacteria 783
56 Ga0070692_10006512 3300005345 Bacteria 5076
57 Ga0070692_10042279 3300005345 Bacteria 2339
58 Ga0070692_10257924 3300005345 Bacteria 1047
59 Ga0070692_10711679 3300005345 Bacteria 677
60 Ga0070668_100117590 3300005347 Bacteria 2121
61 Ga0070668_100149835 3300005347 Bacteria 1885
62 Ga0070668_100181054 3300005347 Bacteria 1722
63 Ga0070668_100396529 3300005347 Bacteria 1177
64 Ga0070669_100633049 3300005353 Bacteria 899
65 Ga0070669_100989995 3300005353 Bacteria 721
66 Ga0070675_100152742 3300005354 Bacteria 1980
67 Ga0070675_101577942 3300005354 Bacteria 605
68 Ga0070671_100114246 3300005355 Bacteria 2269
69 Ga0070674_100034034 3300005356 Bacteria 3398
70 Ga0070674_100295418 3300005356 Bacteria 1290
71 Ga0070674_100423802 3300005356 Bacteria 1092
72 Ga0070674_100825449 3300005356 Bacteria 802
73 Ga0070673_100009097 3300005364 Bacteria 6650
74 Ga0070673_100024804 3300005364 Bacteria 4402
75 Ga0070673_100760409 3300005364 Bacteria 893
76 Ga0070688_100032711 3300005365 Bacteria 3138
77 Ga0070659_100016345 3300005366 Bacteria 5570
78 Ga0070659_100019949 3300005366 Bacteria 5088
79 Ga0070659_100027921 3300005366 Bacteria 4352
80 Ga0070659_100548418 3300005366 Bacteria 989
81 Ga0070659_100708788 3300005366 Bacteria 871
82 Ga0070667_100185736 3300005367 Bacteria 1840
83 Ga0070703_10230566 3300005406 Bacteria 742
84 Ga0070709_10039522 3300005434 Bacteria 2895
85 Ga0070709_10495846 3300005434 Bacteria 927
86 Ga0070714_100018641 3300005435 Bacteria 5642
87 Ga0070714_100022772 3300005435 Bacteria 5139
88 Ga0070714_100029615 3300005435 Bacteria 4551
89 Ga0070714_101481908 3300005435 Bacteria 663
90 Ga0070713_100159519 3300005436 Bacteria 2012
91 Ga0070713_100212251 3300005436 Bacteria 1753
92 Ga0070713_101073455 3300005436 Bacteria 778
93 Ga0070710_11383163 3300005437 Bacteria 526
94 Ga0070705_100069387 3300005440 Bacteria 2125
95 Ga0070700_100010538 3300005441 Bacteria 5108
96 Ga0070700_100065856 3300005441 Bacteria 2298
97 Ga0070700_100080858 3300005441 Bacteria 2098
98 Ga0070700_100142713 3300005441 Bacteria 1629
99 Ga0070700_100190088 3300005441 Bacteria 1435
100 Ga0070700_100194100 3300005441 Bacteria 1422
101 Ga0070694_100036649 3300005444 Bacteria 3249
102 Ga0070694_100423929 3300005444 Bacteria 1046
103 Ga0070694_101027396 3300005444 Bacteria 685
104 Ga0070708_100564593 3300005445 Bacteria 1073
105 Ga0070708_100795963 3300005445 Bacteria 889
106 Ga0070663_101178015 3300005455 Bacteria 672
107 Ga0070678_100483625 3300005456 Bacteria 1090
108 Ga0070678_100824793 3300005456 Bacteria 843
109 Ga0070678_101269870 3300005456 Bacteria 684
110 Ga0070678_101445529 3300005456 Bacteria 643
111 Ga0070662_100002010 3300005457 Bacteria 12457
112 Ga0070662_100088603 3300005457 Bacteria 2320
113 Ga0070662_101054458 3300005457 Bacteria 697
114 Ga0070662_101756475 3300005457 Bacteria 536
115 Ga0070681_10024124 3300005458 Bacteria 6123
116 Ga0070681_10043543 3300005458 Bacteria 4496
117 Ga0070681_10130586 3300005458 Bacteria 2444
118 Ga0070681_10389699 3300005458 Bacteria 1304
119 Ga0070681_10529843 3300005458 Bacteria 1091
120 Ga0070681_10591602 3300005458 Bacteria 1024
121 Ga0070681_10795577 3300005458 Bacteria 863
122 Ga0068867_100419856 3300005459 Bacteria 1133
123 Ga0068867_100623705 3300005459 Bacteria 943
124 Ga0068867_101099938 3300005459 Bacteria 725
125 Ga0070685_10056787 3300005466 Bacteria 2277
126 Ga0070685_10066133 3300005466 Bacteria 2129
127 Ga0070685_10329123 3300005466 Unclassified 1038
128 Ga0070685_11106874 3300005466 Bacteria 599
129 Ga0070698_100027626 3300005471 Bacteria 5899
130 Ga0070699_100681186 3300005518 Bacteria 939
131 Ga0070699_101561311 3300005518 Bacteria 605
132 Ga0070679_100006758 3300005530 Bacteria 10697
133 Ga0070679_100105902 3300005530 Bacteria 2798
134 Ga0070679_100911572 3300005530 Bacteria 822
135 Ga0070679_101339437 3300005530 Bacteria 662
136 Ga0070679_101533781 3300005530 Bacteria 613
137 Ga0070679_101691573 3300005530 Bacteria 581
138 Ga0070679_102143879 3300005530 Bacteria 508
139 Ga0070684_100013347 3300005535 Bacteria 6621
140 Ga0070684_100016306 3300005535 Bacteria 6070
141 Ga0070684_100051346 3300005535 Bacteria 3582
142 Ga0070684_100054856 3300005535 Bacteria 3473
143 Ga0070684_100065746 3300005535 Bacteria 3183
144 Ga0070684_100087196 3300005535 Bacteria 2771
145 Ga0070684_100436759 3300005535 Bacteria 1209
146 Ga0070684_101046405 3300005535 Bacteria 766
147 Ga0070684_101289027 3300005535 Bacteria 687
148 Ga0070684_101520788 3300005535 Bacteria 631
149 Ga0070684_101688403 3300005535 Bacteria 597
150 Ga0070697_100954084 3300005536 Bacteria 762
151 Ga0068853_100075863 3300005539 Bacteria 2935
152 Ga0068853_100297293 3300005539 Bacteria 1491
153 Ga0068853_100519216 3300005539 Bacteria 1126
154 Ga0068853_101415842 3300005539 Bacteria 672
155 Ga0070672_100004115 3300005543 Bacteria 9497
156 Ga0070672_100713047 3300005543 Bacteria 879
157 Ga0070672_101173784 3300005543 Bacteria 683
158 Ga0070686_100064972 3300005544 Bacteria 2369
159 Ga0070686_100327847 3300005544 Bacteria 1143
160 Ga0070686_100815925 3300005544 Bacteria 753
161 Ga0070695_100477691 3300005545 Bacteria 960
162 Ga0070695_100606747 3300005545 Bacteria 860
163 Ga0070695_100710137 3300005545 Bacteria 799
164 Ga0070696_100021303 3300005546 Bacteria 4395
165 Ga0070696_100025271 3300005546 Bacteria 4037
166 Ga0070696_100042104 3300005546 Bacteria 3157
167 Ga0070693_100248306 3300005547 Bacteria 1178
168 Ga0070693_100348383 3300005547 Bacteria 1013
169 Ga0070693_100373211 3300005547 Bacteria 982
170 Ga0070693_100396582 3300005547 Bacteria 956
171 Ga0070693_100428380 3300005547 Bacteria 923
172 Ga0070693_101668369 3300005547 Bacteria 502
173 Ga0070665_100619112 3300005548 Bacteria 1096
174 Ga0070704_100367465 3300005549 Bacteria 1219
175 Ga0070704_100384959 3300005549 Bacteria 1193
176 Ga0070704_101237994 3300005549 Bacteria 681
177 Ga0070704_101901456 3300005549 Bacteria 551
178 Ga0070704_102225275 3300005549 Unclassified 510
179 Ga0068855_100038635 3300005563 Bacteria 5671
180 Ga0068855_100077517 3300005563 Bacteria 3856
181 Ga0068855_101274472 3300005563 Bacteria 762
182 Ga0068855_102545101 3300005563 Bacteria 508
183 Ga0070664_100745534 3300005564 Bacteria 914
184 Ga0070664_100965109 3300005564 Bacteria 800
185 Ga0070664_101819571 3300005564 Bacteria 578
186 Ga0070664_101832253 3300005564 Bacteria 575
187 Ga0070664_102368116 3300005564 Bacteria 503
188 Ga0068857_100048693 3300005577 Bacteria 3762
189 Ga0068857_100127205 3300005577 Bacteria 2297
190 Ga0068857_100178042 3300005577 Bacteria 1935
191 Ga0068857_100514011 3300005577 Bacteria 1125
192 Ga0068854_100003599 3300005578 Bacteria 9693
193 Ga0068854_100049668 3300005578 Bacteria 2997
194 Ga0068854_100369839 3300005578 Bacteria 1178
195 Ga0068854_100414873 3300005578 Bacteria 1117
196 Ga0068854_100417476 3300005578 Bacteria 1114
197 Ga0068854_101881907 3300005578 Bacteria 550
198 Ga0068856_100011442 3300005614 Bacteria 8609
199 Ga0068856_100032786 3300005614 Bacteria 5087
200 Ga0068856_100203494 3300005614 Bacteria 1994
201 Ga0068856_100330551 3300005614 Bacteria 1542
202 Ga0068856_101824888 3300005614 Bacteria 620
203 Ga0068856_102239080 3300005614 Bacteria 555
204 Ga0070702_100016921 3300005615 Bacteria 3753
205 Ga0070702_100234621 3300005615 Bacteria 1235
206 Ga0070702_100300139 3300005615 Bacteria 1111
207 Ga0070702_100325494 3300005615 Bacteria 1073
208 Ga0070702_100448155 3300005615 Bacteria 936
209 Ga0070702_100511709 3300005615 Bacteria 884
210 Ga0070702_101004492 3300005615 Bacteria 660
211 Ga0070702_101168233 3300005615 Bacteria 619
212 Ga0070702_101334072 3300005615 Bacteria 584
213 Ga0068852_100019221 3300005616 Bacteria 5400
214 Ga0068852_100159302 3300005616 Bacteria 2106
215 Ga0068852_100221047 3300005616 Bacteria 1801
216 Ga0068852_100334664 3300005616 Bacteria 1474
217 Ga0068852_100649924 3300005616 Bacteria 1062
218 Ga0068852_101486024 3300005616 Bacteria 700
219 Ga0068864_100047931 3300005618 Bacteria 3672
220 Ga0068864_102444296 3300005618 Bacteria 529
221 Ga0068866_10041680 3300005718 Bacteria 2279
222 Ga0068866_10204543 3300005718 Bacteria 1182
223 Ga0068866_10466678 3300005718 Bacteria 829
224 Ga0068866_11353610 3300005718 Bacteria 519
225 Ga0068861_100070700 3300005719 Bacteria 2703
226 Ga0068861_100453617 3300005719 Bacteria 1149
227 Ga0068861_100909325 3300005719 Bacteria 834
228 Ga0068851_10171147 3300005834 Bacteria 1199
229 Ga0068851_10283845 3300005834 Bacteria 947
230 Ga0068870_10110376 3300005840 Bacteria 1569
231 Ga0068870_10199978 3300005840 Bacteria 1211
232 Ga0068870_10452399 3300005840 Bacteria 847
233 Ga0068870_10569072 3300005840 Bacteria 765
234 Ga0068863_100058711 3300005841 Bacteria 3641
235 Ga0068863_100950696 3300005841 Bacteria 861
236 Ga0068863_101595374 3300005841 Bacteria 662
237 Ga0068858_100358287 3300005842 Bacteria 1398
238 Ga0068858_101644798 3300005842 Bacteria 634
239 Ga0068858_102290198 3300005842 Bacteria 534
240 Ga0068860_101307405 3300005843 Bacteria 746
241 Ga0068860_101562759 3300005843 Bacteria 681
242 Ga0068862_101281357 3300005844 Bacteria 734
243 Ga0068862_101459690 3300005844 Bacteria 689
244 Ga0081455_10000409 3300005937 Bacteria 56312
245 Ga0081455_10006380 3300005937 Bacteria 12661
246 Ga0081455_10011750 3300005937 Bacteria 8768
247 Ga0081455_10012132 3300005937 Bacteria 8610
248 Ga0081455_10020175 3300005937 Bacteria 6286
249 Ga0081455_10025162 3300005937 Bacteria 5499
250 Ga0081455_10025500 3300005937 Bacteria 5455
251 Ga0081455_10034687 3300005937 Bacteria 4518
252 Ga0081455_10049149 3300005937 Bacteria 3638
253 Ga0081455_10050932 3300005937 Bacteria 3555
254 Ga0081455_10077844 3300005937 Bacteria 2726
255 Ga0081455_10189521 3300005937 Bacteria 1550
256 Ga0081455_10278965 3300005937 Bacteria 1208
257 Ga0081455_10579318 3300005937 Bacteria 736
258 Ga0081455_10827100 3300005937 Bacteria 580
259 Ga0081538_10000088 3300005981 Bacteria 88922
260 Ga0081538_10000223 3300005981 Bacteria 63727
261 Ga0081538_10000700 3300005981 Bacteria 36835
262 Ga0081538_10001237 3300005981 Bacteria 26766
263 Ga0081538_10003189 3300005981 Bacteria 15573
264 Ga0081538_10003456 3300005981 Bacteria 14920
265 Ga0081538_10013797 3300005981 Bacteria 6378
266 Ga0081538_10018613 3300005981 Bacteria 5205
267 Ga0081538_10018785 3300005981 Bacteria 5172
268 Ga0081538_10043722 3300005981 Bacteria 2807
269 Ga0081538_10120621 3300005981 Bacteria 1261
270 Ga0081538_10150959 3300005981 Bacteria 1052
271 Ga0081538_10151292 3300005981 Bacteria 1050
272 Ga0081538_10354611 3300005981 Bacteria 531
273 Ga0081539_10000181 3300005985 Bacteria 148250
274 Ga0081539_10020069 3300005985 Bacteria 4541
275 Ga0081539_10177157 3300005985 Bacteria 1003
276 Ga0070717_10003782 3300006028 Bacteria 10876
277 Ga0070717_10007142 3300006028 Bacteria 8276
278 Ga0070717_10029505 3300006028 Bacteria 4400
279 Ga0070717_10177360 3300006028 Bacteria 1856
280 Ga0075365_10801178 3300006038 Bacteria 665
281 Ga0075363_100173779 3300006048 Bacteria 1224
282 Ga0075363_100658697 3300006048 Bacteria 630
283 Ga0075364_10187920 3300006051 Bacteria 1399
284 Ga0075364_10245254 3300006051 Bacteria 1217
285 Ga0075432_10000256 3300006058 Bacteria 14544
286 Ga0075432_10032306 3300006058 Bacteria 1814
287 Ga0075432_10074058 3300006058 Bacteria 1226
288 Ga0075432_10336844 3300006058 Unclassified 636
289 Ga0070716_100609765 3300006173 Bacteria 822
290 Ga0070712_100218303 3300006175 Bacteria 1508
291 Ga0075367_10128256 3300006178 Bacteria 1567
292 Ga0075367_10343372 3300006178 Bacteria 942
293 Ga0075367_10438822 3300006178 Bacteria 827
294 Ga0097621_100241707 3300006237 Bacteria 1578
295 Ga0097621_100723882 3300006237 Bacteria 917
296 Ga0097621_100874880 3300006237 Bacteria 836
297 Ga0068871_100147661 3300006358 Bacteria 2003
298 Ga0075428_100003661 3300006844 Bacteria 16849
299 Ga0075428_100032062 3300006844 Bacteria 5806
300 Ga0075428_100281718 3300006844 Bacteria 1789
301 Ga0075428_100291300 3300006844 Bacteria 1756
302 Ga0075428_101040936 3300006844 Bacteria 866
303 Ga0075428_101340724 3300006844 Bacteria 752
304 Ga0075430_100014889 3300006846 Bacteria 6624
305 Ga0075430_100027849 3300006846 Bacteria 4799
306 Ga0075430_101213596 3300006846 Bacteria 621
307 Ga0075431_100001077 3300006847 Bacteria 24422
308 Ga0075431_100167186 3300006847 Bacteria 2260
309 Ga0075431_100491920 3300006847 Bacteria 1218
310 Ga0075431_100616858 3300006847 Bacteria 1067
311 Ga0075433_10115382 3300006852 Bacteria 2383
312 Ga0075433_10207068 3300006852 Bacteria 1744
313 Ga0075433_10223885 3300006852 Bacteria 1671
314 Ga0075433_10821741 3300006852 Bacteria 812
315 Ga0075433_11590326 3300006852 Bacteria 564
316 Ga0075434_100038256 3300006871 Bacteria 4752
317 Ga0075434_100604381 3300006871 Bacteria 1116
318 Ga0075434_100723089 3300006871 Bacteria 1013
319 Ga0075434_101503012 3300006871 Bacteria 683
320 Ga0075434_101962825 3300006871 Bacteria 591
321 Ga0075434_102500516 3300006871 Bacteria 518
322 Ga0075429_100014763 3300006880 Bacteria 6769
323 Ga0075429_100033200 3300006880 Bacteria 4484
324 Ga0075429_100033952 3300006880 Bacteria 4433
325 Ga0075429_100287706 3300006880 Bacteria 1439
326 Ga0075429_100415079 3300006880 Bacteria 1179
327 Ga0068865_100007607 3300006881 Bacteria 6671
328 Ga0068865_100081051 3300006881 Bacteria 2330
329 Ga0068865_100406158 3300006881 Bacteria 1116
330 Ga0068865_100417941 3300006881 Bacteria 1102
331 Ga0068865_100940638 3300006881 Bacteria 754
332 Ga0068865_101986979 3300006881 Bacteria 527
333 Ga0075436_100027359 3300006914 Bacteria 3925
334 Ga0075436_100790733 3300006914 Bacteria 706
335 Ga0075436_101207218 3300006914 Bacteria 571
336 Ga0097620_100298659 3300006931 Bacteria 1704
337 Ga0075435_100002298 3300007076 Bacteria 12632
338 Ga0075435_100138419 3300007076 Bacteria 2041
339 Ga0075435_100920520 3300007076 Bacteria 763
340 Ga0105244_10158635 3300009036 Bacteria 1081
341 Ga0105240_10114379 3300009093 Bacteria 3259
342 Ga0105240_10248319 3300009093 Bacteria 2059
343 Ga0105240_11045129 3300009093 Bacteria 871
344 Ga0105240_11421724 3300009093 Bacteria 729
345 Ga0111539_10010353 3300009094 Bacteria 11741
346 Ga0111539_10076986 3300009094 Bacteria 3927
347 Ga0111539_10102498 3300009094 Bacteria 3359
348 Ga0111539_10268267 3300009094 Bacteria 1987
349 Ga0111539_10285575 3300009094 Bacteria 1920
350 Ga0111539_11702489 3300009094 Bacteria 731
351 Ga0111539_12084518 3300009094 Bacteria 658
352 Ga0105245_10000728 3300009098 Bacteria 29647
353 Ga0105245_10038111 3300009098 Bacteria 4276
354 Ga0105245_10094191 3300009098 Bacteria 2760
355 Ga0105245_10293967 3300009098 Bacteria 1592
356 Ga0105245_10407323 3300009098 Bacteria 1360
357 Ga0105245_10621307 3300009098 Bacteria 1109
358 Ga0105245_11427292 3300009098 Bacteria 742
359 Ga0105245_12690568 3300009098 Unclassified 550
360 Ga0105247_10154158 3300009101 Bacteria 1516
361 Ga0105247_10690525 3300009101 Bacteria 767
362 Ga0114129_10001306 3300009147 Bacteria 33269
363 Ga0114129_10010286 3300009147 Bacteria 13349
364 Ga0114129_10266311 3300009147 Bacteria 2294
365 Ga0114129_10305512 3300009147 Bacteria 2119
366 Ga0114129_10411171 3300009147 Bacteria 1781
367 Ga0114129_10475906 3300009147 Bacteria 1635
368 Ga0114129_10825794 3300009147 Bacteria 1180
369 Ga0114129_10976005 3300009147 Bacteria 1068
370 Ga0114129_11676968 3300009147 Bacteria 776
371 Ga0114129_12375288 3300009147 Bacteria 635
372 Ga0105243_10009337 3300009148 Bacteria 7478
373 Ga0105243_10071059 3300009148 Bacteria 2813
374 Ga0105243_10149343 3300009148 Bacteria 2003
375 Ga0105243_12803634 3300009148 Bacteria 528
376 Ga0105241_10060041 3300009174 Bacteria 2924
377 Ga0105242_10174879 3300009176 Bacteria 1889
378 Ga0105242_10341613 3300009176 Bacteria 1380
379 Ga0105248_10281187 3300009177 Bacteria 1873
380 Ga0105248_10831147 3300009177 Bacteria 1042
381 Ga0105248_12366852 3300009177 Bacteria 605
382 Ga0105237_10113563 3300009545 Bacteria 2701
383 Ga0105237_10925443 3300009545 Bacteria 879
384 Ga0105237_11167389 3300009545 Bacteria 777
385 Ga0105237_11982394 3300009545 Bacteria 591
386 Ga0105238_10004249 3300009551 Bacteria 14234
387 Ga0105238_10008781 3300009551 Bacteria 10111
388 Ga0105238_10045221 3300009551 Bacteria 4448
389 Ga0105238_10168462 3300009551 Bacteria 2166
390 Ga0105238_11992976 3300009551 Bacteria 614
391 Ga0105249_10011157 3300009553 Bacteria 7896
392 Ga0105249_10295924 3300009553 Bacteria 1622
393 Ga0105249_10362405 3300009553 Bacteria 1471
394 Ga0105249_10612361 3300009553 Bacteria 1144
395 Ga0105249_10996247 3300009553 Bacteria 907
396 Ga0105239_10030152 3300010375 Bacteria 5963
397 Ga0105239_10085742 3300010375 Bacteria 3471
398 Ga0105239_10112426 3300010375 Bacteria 3020
399 Ga0105239_10285681 3300010375 Bacteria 1858
400 Ga0105239_10410290 3300010375 Bacteria 1534
401 Ga0105246_10005274 3300011119 Bacteria 7863
402 Ga0105246_10080462 3300011119 Bacteria 2319
403 Ga0105246_10283424 3300011119 Bacteria 1330
404 Ga0105246_11312347 3300011119 Bacteria 671
405 Ga0105246_11354313 3300011119 Bacteria 662
406 Ga0105246_12589844 3300011119 Bacteria 501
407 Ga0157321_1036353 3300012487 Bacteria 525
408 Ga0157322_1003264 3300012490 Bacteria 981
409 Ga0157338_1012833 3300012515 Bacteria 882
410 Ga0157373_10181280 3300013100 Bacteria 1483
411 Ga0157373_10439331 3300013100 Bacteria 938
412 Ga0157371_10011988 3300013102 Bacteria 6646
413 Ga0157370_10064620 3300013104 Bacteria 3464
414 Ga0157370_10124409 3300013104 Bacteria 2408
415 Ga0157370_10703740 3300013104 Bacteria 922
416 Ga0157370_11012109 3300013104 Bacteria 752
417 Ga0157369_10001328 3300013105 Bacteria 30649
418 Ga0157369_10053576 3300013105 Bacteria 4359
419 Ga0157369_10413206 3300013105 Bacteria 1399
420 Ga0157369_10845248 3300013105 Bacteria 940
421 Ga0157369_10900662 3300013105 Bacteria 907
422 Ga0157374_10399513 3300013296 Bacteria 1371
423 Ga0163162_10034042 3300013306 Bacteria 5067
424 Ga0163162_10101306 3300013306 Bacteria 2972
425 Ga0163162_10331000 3300013306 Bacteria 1656
426 Ga0163162_10632360 3300013306 Bacteria 1195
427 Ga0163162_10680093 3300013306 Bacteria 1152
428 Ga0157372_10008081 3300013307 Bacteria 11187
429 Ga0157372_10143355 3300013307 Bacteria 2754
430 Ga0157372_10433488 3300013307 Bacteria 1532
431 Ga0157372_10464033 3300013307 Bacteria 1476
432 Ga0157372_11442377 3300013307 Bacteria 793
433 Ga0157375_10125935 3300013308 Bacteria 2676
434 Ga0157375_10143415 3300013308 Bacteria 2517
435 Ga0157375_10176488 3300013308 Bacteria 2286
436 Ga0157375_11383188 3300013308 Bacteria 829
437 Ga0163163_10042065 3300014325 Bacteria 4472
438 Ga0163163_10218705 3300014325 Bacteria 1953
439 Ga0163163_10359282 3300014325 Bacteria 1513
440 Ga0163163_10565156 3300014325 Bacteria 1200
441 Ga0163163_11424259 3300014325 Bacteria 754
442 Ga0157380_10015588 3300014326 Bacteria 5587
443 Ga0157380_10920534 3300014326 Bacteria 902
444 Ga0157380_12332498 3300014326 Bacteria 600
445 Ga0157377_10061973 3300014745 Bacteria 2139
446 Ga0157377_10069211 3300014745 Bacteria 2036
447 Ga0157377_10267290 3300014745 Bacteria 1115
448 Ga0157379_10031532 3300014968 Bacteria 4722
449 Ga0157379_10969177 3300014968 Bacteria 810
450 Ga0157379_11177067 3300014968 Bacteria 737
451 Ga0157379_11194513 3300014968 Bacteria 731
452 Ga0157376_10022706 3300014969 Bacteria 4897
453 Ga0157376_10516215 3300014969 Bacteria 1177
454 Ga0157376_10990217 3300014969 Bacteria 863
455 Ga0157376_11981450 3300014969 Bacteria 620
456 Ga0163161_10054053 3300017792 Bacteria 2914
457 Ga0163161_10911429 3300017792 Bacteria 745
458 Ga0206356_10012817 3300020070 Bacteria 2507
459 Ga0206356_10363621 3300020070 Bacteria 2015
460 Ga0206356_11001847 3300020070 Bacteria 1150
461 Ga0206356_11044246 3300020070 Bacteria 1053
462 Ga0206352_11028291 3300020078 Bacteria 759
463 Ga0206350_10466747 3300020080 Bacteria 736
464 Ga0206350_11376814 3300020080 Bacteria 1871
465 Ga0206354_10121218 3300020081 Bacteria 852
466 Ga0206354_10150264 3300020081 Bacteria 1565
467 Ga0206353_10169547 3300020082 Bacteria 1387
468 Ga0206353_10171946 3300020082 Unclassified 882
469 Ga0206353_11051339 3300020082 Bacteria 1836
470 Ga0206353_11592094 3300020082 Bacteria 1040
471 Ga0213874_10021196 3300021377 Bacteria 1789
472 Ga0213874_10281614 3300021377 Bacteria 621
473 Ga0213876_10019956 3300021384 Bacteria 3540
474 Ga0213876_10238317 3300021384 Bacteria 967
475 Ga0213876_10434198 3300021384 Unclassified 698
476 Ga0213875_10010182 3300021388 Bacteria 4723
477 Ga0224712_10109648 3300022467 Bacteria 1182
478 Ga0224712_10151535 3300022467 Bacteria 1028
479 Ga0224712_10409659 3300022467 Bacteria 647
480 Ga0207682_10180734 3300025893 Bacteria 963
481 Ga0207692_10034106 3300025898 Bacteria 2462
482 Ga0207692_10450494 3300025898 Bacteria 810
483 Ga0207642_10046376 3300025899 Bacteria 1936
484 Ga0207642_10129609 3300025899 Bacteria 1314
485 Ga0207642_10506101 3300025899 Bacteria 740
486 Ga0207642_10537453 3300025899 Bacteria 720
487 Ga0207710_10045236 3300025900 Bacteria 1963
488 Ga0207688_10067568 3300025901 Bacteria 2023
489 Ga0207680_10243584 3300025903 Bacteria 1240
490 Ga0207699_10211420 3300025906 Bacteria 1319
491 Ga0207699_10602540 3300025906 Bacteria 800
492 Ga0207699_10613196 3300025906 Bacteria 793
493 Ga0207645_10081751 3300025907 Bacteria 2071
494 Ga0207645_10779511 3300025907 Bacteria 650
495 Ga0207643_10004848 3300025908 Bacteria 7206
496 Ga0207643_10445923 3300025908 Bacteria 823
497 Ga0207643_10883162 3300025908 Unclassified 579
498 Ga0207705_10080433 3300025909 Bacteria 2374
499 Ga0207684_10299621 3300025910 Bacteria 1386
500 Ga0207707_10021775 3300025912 Bacteria 5602
501 Ga0207707_10115396 3300025912 Bacteria 2347
502 Ga0207707_10130797 3300025912 Bacteria 2195
503 Ga0207707_10196850 3300025912 Bacteria 1757
504 Ga0207707_10987762 3300025912 Bacteria 691
505 Ga0207707_11171133 3300025912 Bacteria 623
506 Ga0207695_10062875 3300025913 Bacteria 3829
507 Ga0207695_10426650 3300025913 Bacteria 1210
508 Ga0207695_10890720 3300025913 Bacteria 770
509 Ga0207671_10072688 3300025914 Bacteria 2567
510 Ga0207671_10207046 3300025914 Bacteria 1533
511 Ga0207671_10255872 3300025914 Bacteria 1377
512 Ga0207693_10249060 3300025915 Bacteria 1394
513 Ga0207693_10490809 3300025915 Bacteria 959
514 Ga0207693_10548709 3300025915 Bacteria 901
515 Ga0207663_10868790 3300025916 Bacteria 720
516 Ga0207660_10037033 3300025917 Bacteria 3396
517 Ga0207660_10062726 3300025917 Bacteria 2678
518 Ga0207660_10206251 3300025917 Bacteria 1537
519 Ga0207660_10568455 3300025917 Bacteria 923
520 Ga0207660_10577589 3300025917 Bacteria 915
521 Ga0207662_10096646 3300025918 Bacteria 1825
522 Ga0207662_10213813 3300025918 Bacteria 1253
523 Ga0207662_10627301 3300025918 Bacteria 749
524 Ga0207657_10009763 3300025919 Bacteria 9622
525 Ga0207657_10026437 3300025919 Bacteria 5335
526 Ga0207657_10049899 3300025919 Bacteria 3644
527 Ga0207657_10059931 3300025919 Bacteria 3268
528 Ga0207657_10245543 3300025919 Bacteria 1428
529 Ga0207657_10268176 3300025919 Bacteria 1357
530 Ga0207649_10028567 3300025920 Bacteria 3285
531 Ga0207649_10037756 3300025920 Bacteria 2920
532 Ga0207649_10090587 3300025920 Bacteria 2001
533 Ga0207649_10821109 3300025920 Bacteria 726
534 Ga0207652_10074262 3300025921 Bacteria 2960
535 Ga0207652_10086660 3300025921 Bacteria 2746
536 Ga0207652_10183337 3300025921 Unclassified 1882
537 Ga0207652_10569377 3300025921 Bacteria 1017
538 Ga0207681_10078268 3300025923 Bacteria 2327
539 Ga0207681_10373039 3300025923 Bacteria 1147
540 Ga0207681_10401129 3300025923 Bacteria 1108
541 Ga0207694_10009894 3300025924 Bacteria 7194
542 Ga0207694_10030576 3300025924 Bacteria 4112
543 Ga0207694_10064856 3300025924 Bacteria 2847
544 Ga0207694_10082899 3300025924 Bacteria 2521
545 Ga0207659_10198052 3300025926 Bacteria 1602
546 Ga0207687_10026451 3300025927 Bacteria 3886
547 Ga0207687_10078688 3300025927 Bacteria 2375
548 Ga0207687_10236404 3300025927 Bacteria 1446
549 Ga0207687_10308419 3300025927 Bacteria 1277
550 Ga0207687_10934635 3300025927 Bacteria 743
551 Ga0207687_11605386 3300025927 Bacteria 558
552 Ga0207687_11641806 3300025927 Bacteria 551
553 Ga0207700_10581769 3300025928 Bacteria 996
554 Ga0207700_11742979 3300025928 Bacteria 549
555 Ga0207664_10002561 3300025929 Bacteria 12017
556 Ga0207664_10199404 3300025929 Bacteria 1727
557 Ga0207664_10534052 3300025929 Bacteria 1052
558 Ga0207644_11056511 3300025931 Bacteria 682
559 Ga0207690_10027863 3300025932 Bacteria 3574
560 Ga0207690_10122354 3300025932 Bacteria 1892
561 Ga0207690_10505772 3300025932 Bacteria 978
562 Ga0207690_10648080 3300025932 Bacteria 865
563 Ga0207690_11143523 3300025932 Bacteria 649
564 Ga0207690_11229854 3300025932 Bacteria 625
565 Ga0207690_11539968 3300025932 Bacteria 556
566 Ga0207706_10009359 3300025933 Bacteria 8996
567 Ga0207706_10106807 3300025933 Bacteria 2464
568 Ga0207706_11360758 3300025933 Bacteria 584
569 Ga0207686_10183773 3300025934 Bacteria 1484
570 Ga0207686_11361693 3300025934 Bacteria 583
571 Ga0207709_10024597 3300025935 Bacteria 3440
572 Ga0207709_11076535 3300025935 Bacteria 659
573 Ga0207669_10122580 3300025937 Bacteria 1768
574 Ga0207669_10661054 3300025937 Bacteria 855
575 Ga0207704_10124744 3300025938 Bacteria 1770
576 Ga0207704_10273488 3300025938 Bacteria 1280
577 Ga0207704_10519345 3300025938 Bacteria 963
578 Ga0207665_10053714 3300025939 Bacteria 2716
579 Ga0207665_10142886 3300025939 Bacteria 1708
580 Ga0207665_10467547 3300025939 Bacteria 970
581 Ga0207691_10009233 3300025940 Bacteria 9466
582 Ga0207691_10021320 3300025940 Bacteria 6119
583 Ga0207711_10022899 3300025941 Bacteria 5228
584 Ga0207711_10559233 3300025941 Bacteria 1067
585 Ga0207689_10026816 3300025942 Bacteria 4825
586 Ga0207689_11110082 3300025942 Unclassified 667
587 Ga0207661_10071558 3300025944 Bacteria 2834
588 Ga0207661_10088638 3300025944 Bacteria 2572
589 Ga0207661_10118805 3300025944 Bacteria 2248
590 Ga0207661_10134057 3300025944 Bacteria 2125
591 Ga0207661_10181148 3300025944 Bacteria 1840
592 Ga0207661_10268249 3300025944 Bacteria 1522
593 Ga0207661_10370887 3300025944 Bacteria 1294
594 Ga0207661_10378741 3300025944 Bacteria 1280
595 Ga0207661_10510805 3300025944 Bacteria 1098
596 Ga0207661_11158061 3300025944 Bacteria 712
597 Ga0207679_11630988 3300025945 Bacteria 591
598 Ga0207667_10090837 3300025949 Bacteria 3156
599 Ga0207667_10354011 3300025949 Bacteria 1497
600 Ga0207667_10702016 3300025949 Bacteria 1014
601 Ga0207667_11983690 3300025949 Bacteria 543
602 Ga0207651_10138040 3300025960 Bacteria 1878
603 Ga0207651_11875718 3300025960 Bacteria 539
604 Ga0207712_10026692 3300025961 Bacteria 3851
605 Ga0207712_10192203 3300025961 Bacteria 1612
606 Ga0207712_10433628 3300025961 Bacteria 1111
607 Ga0207712_10529084 3300025961 Bacteria 1011
608 Ga0207668_10076687 3300025972 Bacteria 2408
609 Ga0207668_10194517 3300025972 Bacteria 1610
610 Ga0207668_10199679 3300025972 Bacteria 1591
611 Ga0207668_10253631 3300025972 Bacteria 1430
612 Ga0207640_10019291 3300025981 Bacteria 4026
613 Ga0207640_10037194 3300025981 Bacteria 3061
614 Ga0207640_12050091 3300025981 Bacteria 518
615 Ga0207658_11365849 3300025986 Bacteria 648
616 Ga0207677_10071495 3300026023 Bacteria 2449
617 Ga0207677_10241866 3300026023 Bacteria 1461
618 Ga0207677_10411831 3300026023 Bacteria 1149
619 Ga0207677_11903317 3300026023 Bacteria 553
620 Ga0207703_10430619 3300026035 Bacteria 1229
621 Ga0207703_11442341 3300026035 Bacteria 662
622 Ga0207639_10019032 3300026041 Bacteria 4890
623 Ga0207639_10234057 3300026041 Bacteria 1594
624 Ga0207639_10251433 3300026041 Bacteria 1541
625 Ga0207678_10120972 3300026067 Bacteria 2234
626 Ga0207678_10968217 3300026067 Bacteria 753
627 Ga0207678_11571384 3300026067 Bacteria 580
628 Ga0207708_10048736 3300026075 Bacteria 3225
629 Ga0207708_10128988 3300026075 Bacteria 1976
630 Ga0207708_10300812 3300026075 Bacteria 1305
631 Ga0207708_10328187 3300026075 Bacteria 1250
632 Ga0207702_10009233 3300026078 Bacteria 8287
633 Ga0207702_10082068 3300026078 Bacteria 2802
634 Ga0207702_10088484 3300026078 Bacteria 2706
635 Ga0207702_10179741 3300026078 Bacteria 1947
636 Ga0207702_10180699 3300026078 Bacteria 1943
637 Ga0207702_10781336 3300026078 Bacteria 943
638 Ga0207702_11396694 3300026078 Bacteria 694
639 Ga0207702_11688963 3300026078 Bacteria 626
640 Ga0207641_10195116 3300026088 Bacteria 1863
641 Ga0207648_10022472 3300026089 Bacteria 5662
642 Ga0207648_10116959 3300026089 Bacteria 2343
643 Ga0207648_10452118 3300026089 Bacteria 1170
644 Ga0207676_10248803 3300026095 Bacteria 1599
645 Ga0207674_10100343 3300026116 Bacteria 2876
646 Ga0207674_10127513 3300026116 Bacteria 2509
647 Ga0207674_10529376 3300026116 Bacteria 1138
648 Ga0207675_100005296 3300026118 Bacteria 12403
649 Ga0207675_101435886 3300026118 Bacteria 711
650 Ga0207683_10057688 3300026121 Bacteria 3408
651 Ga0207683_10606908 3300026121 Bacteria 1013
652 Ga0207683_11152455 3300026121 Bacteria 719
653 Ga0207698_10012962 3300026142 Bacteria 5481
654 Ga0207698_10330481 3300026142 Bacteria 1432
655 Ga0207698_10334964 3300026142 Bacteria 1423
656 Ga0207698_10484422 3300026142 Bacteria 1200
657 Ga0207698_11261969 3300026142 Bacteria 753
658 Ga0207698_12186124 3300026142 Bacteria 566
659 Ga0209966_1044871 3300027695 Bacteria 930
660 Ga0209974_10215247 3300027876 Bacteria 714
661 Ga0207428_10000536 3300027907 Bacteria 45269
662 Ga0207428_10069279 3300027907 Bacteria 2774
663 Ga0207428_10098037 3300027907 Bacteria 2268
664 Ga0207428_10224910 3300027907 Bacteria 1405
665 Ga0207428_10623301 3300027907 Bacteria 776
666 Ga0207428_10743751 3300027907 Bacteria 699
667 Ga0207428_11316860 3300027907 Bacteria 500
668 Ga0268266_10135556 3300028379 Bacteria 2205
669 Ga0268266_10429041 3300028379 Bacteria 1254
670 Ga0268265_10343589 3300028380 Bacteria 1360
671 Ga0268264_10106787 3300028381 Bacteria 2444
672 Ga0268264_11241512 3300028381 Bacteria 755
673 Ga0265338_10718956 3300028800 Bacteria 688
674 Ga0307408_100131785 3300031548 Bacteria 1951
675 Ga0307408_100967132 3300031548 Bacteria 783
676 Ga0307408_101394173 3300031548 Bacteria 660
677 Ga0307405_10276022 3300031731 Bacteria 1263
678 Ga0307405_10719348 3300031731 Bacteria 829
679 Ga0307405_10723093 3300031731 Bacteria 827
680 Ga0307413_11188699 3300031824 Bacteria 663
681 Ga0307413_11371419 3300031824 Bacteria 621
682 Ga0307410_10242127 3300031852 Bacteria 1398
683 Ga0307406_10112768 3300031901 Bacteria 1875
684 Ga0307406_10328851 3300031901 Bacteria 1185
685 Ga0307406_11188124 3300031901 Bacteria 662
686 Ga0307407_10180470 3300031903 Bacteria 1399
687 Ga0307407_10569224 3300031903 Bacteria 840
688 Ga0307407_11718938 3300031903 Bacteria 500
689 Ga0307412_10845102 3300031911 Bacteria 798
690 Ga0307412_11086338 3300031911 Bacteria 711
691 Ga0307412_11203446 3300031911 Bacteria 678
692 Ga0307409_100022182 3300031995 Bacteria 4371
693 Ga0307409_100156203 3300031995 Bacteria 1988
694 Ga0307409_100297482 3300031995 Bacteria 1500
695 Ga0307409_100941267 3300031995 Bacteria 879
696 Ga0307409_101794488 3300031995 Bacteria 642
697 Ga0307409_101952032 3300031995 Bacteria 616
698 Ga0307409_102615930 3300031995 Bacteria 533
699 Ga0307409_102833885 3300031995 Bacteria 512
700 Ga0307416_100057267 3300032002 Bacteria 3152
701 Ga0307416_100237167 3300032002 Bacteria 1764
702 Ga0307416_100297363 3300032002 Bacteria 1602
703 Ga0307416_100407160 3300032002 Bacteria 1400
704 Ga0307416_100813410 3300032002 Bacteria 1031
705 Ga0307416_101019299 3300032002 Bacteria 931
706 Ga0307416_101228696 3300032002 Bacteria 855
707 Ga0307416_101398845 3300032002 Bacteria 805
708 Ga0307416_102087903 3300032002 Bacteria 669
709 Ga0307416_102771560 3300032002 Bacteria 586
710 Ga0307414_10681818 3300032004 Bacteria 929
711 Ga0307414_11601177 3300032004 Bacteria 607
712 Ga0307411_10281846 3300032005 Bacteria 1323
713 Ga0307411_11556606 3300032005 Bacteria 609
714 Ga0307415_100061367 3300032126 Bacteria 2603
715 Ga0307415_100306345 3300032126 Bacteria 1318
716 Ga0307415_100934348 3300032126 Bacteria 802
717 Ga0307415_101312563 3300032126 Bacteria 686
718 Ga0307415_101705477 3300032126 Unclassified 608
719 Ga0307415_102380896 3300032126 Bacteria 520
720 Ga0373948_0071752 3300034817 Bacteria 777
721 Ga0373948_0182662 3300034817 Bacteria 539
722 Ga0373950_0091332 3300034818 Bacteria 647
723 Ga0373958_0145089 3300034819 Bacteria 590
724 Ga0373959_0012201 3300034820 Bacteria 1530
725 Ga0373949_0059154 3300035090 Bacteria 982
726 Ga0373951_0044713 3300035091 Bacteria 1076
727 Ga0373932_0329095 3300035112 Bacteria 576
728 Ga0373939_0238090 3300035114 Bacteria 703
729 Ga0373941_0237831 3300035115 Bacteria 706
730 Ga0373953_0091222 3300035117 Bacteria 1275
731 Ga0373960_0040339 3300035121 Bacteria 1347
732 Ga0373960_0067377 3300035121 Bacteria 1099
733 Ga0373942_0007804 3300035207 Bacteria 2488
734 Ga0373961_0032034 3300035241 Bacteria 1472
735 Ga0373961_0207331 3300035241 Bacteria 694
736 Ga0373962_0262573 3300035242 Bacteria 603
737 Ga0373931_0626288 3300035691 Unclassified 705
738 Ga0373935_0192585 3300035692 Bacteria 1405
739 Ga0373935_0639353 3300035692 Bacteria 780
740 Ga0373947_0061455 3300035725 Bacteria 2283
741 Ga0373937_0365247 3300036401 Bacteria 1368
742 Ga0373925_0017517 3300037068 Bacteria 5194
743 Ga0395899_0002166 3300037312 Bacteria 16131
744 Ga0395899_0010575 3300037312 Bacteria 7071
745 Ga0395899_0043259 3300037312 Bacteria 3360
746 Ga0395899_0171025 3300037312 Bacteria 1530
747 Ga0395899_0657264 3300037312 Bacteria 662
748 Ga0395900_0001810 3300037418 Bacteria 24466
749 Ga0395900_0007861 3300037418 Bacteria 10987
750 Ga0395900_0013234 3300037418 Bacteria 8431
751 Ga0395900_0062843 3300037418 Bacteria 3817
752 Ga0395900_0129062 3300037418 Bacteria 2592
753 Ga0395900_0130351 3300037418 Bacteria 2577
754 Ga0395900_0132237 3300037418 Bacteria 2557
755 Ga0395900_0132684 3300037418 Bacteria 2552
756 Ga0395900_0149094 3300037418 Bacteria 2390
757 Ga0395900_0189085 3300037418 Bacteria 2089
758 Ga0395900_0242378 3300037418 Bacteria 1808
759 Ga0395900_0446345 3300037418 Bacteria 1250
760 Ga0395900_0484617 3300037418 Bacteria 1189
761 Ga0395900_0720732 3300037418 Bacteria 930
762 Ga0395900_1607325 3300037418 Bacteria 561
763 Ga0395900_1848974 3300037418 Bacteria 514
764 Ga0395898_0057114 3300037466 Bacteria 3803
765 Ga0395898_0070469 3300037466 Bacteria 3379
766 Ga0395898_0082155 3300037466 Bacteria 3106
767 Ga0395898_0091338 3300037466 Bacteria 2929
768 Ga0395898_0112294 3300037466 Bacteria 2612
769 Ga0395898_0604189 3300037466 Bacteria 1040
770 Ga0395898_0865720 3300037466 Bacteria 842
771 Ga0395898_0937227 3300037466 Unclassified 803
772 Ga0395898_1273975 3300037466 Bacteria 665
773 Ga0395898_1555776 3300037466 Bacteria 586
774 Ga0395898_1792938 3300037466 Bacteria 535
775 Ga0395905_0007732 3300037471 Bacteria 10666
776 Ga0395905_0010542 3300037471 Bacteria 8976
777 Ga0395905_0090248 3300037471 Bacteria 2872
778 Ga0395905_0113970 3300037471 Bacteria 2540
779 Ga0395905_0148129 3300037471 Bacteria 2208
780 Ga0395905_0224600 3300037471 Bacteria 1757
781 Ga0395905_0451947 3300037471 Bacteria 1183
782 Ga0436364_0416730 3300037853 Bacteria 5655
783 Ga0436364_0611420 3300037853 Bacteria 1545
784 Ga0436364_0659879 3300037853 Bacteria 1901
785 Ga0395901_0018615 3300038443 Bacteria 7093
786 Ga0395901_0061243 3300038443 Unclassified 3916
787 Ga0395901_0064808 3300038443 Bacteria 3803
788 Ga0395901_0089635 3300038443 Bacteria 3218
789 Ga0395901_0093035 3300038443 Bacteria 3156
790 Ga0395901_0104604 3300038443 Bacteria 2971
791 Ga0395901_0122710 3300038443 Bacteria 2730
792 Ga0395901_0186957 3300038443 Unclassified 2173
793 Ga0395901_0234182 3300038443 Bacteria 1917
794 Ga0395901_0248679 3300038443 Bacteria 1853
795 Ga0395901_0716410 3300038443 Bacteria 997
796 Ga0395901_0733242 3300038443 Bacteria 983
797 Ga0395901_1026270 3300038443 Bacteria 799
798 Ga0395901_1538150 3300038443 Unclassified 620
799 Ga0395901_1654554 3300038443 Bacteria 592
800 Ga0436365_0195832 3300039437 Bacteria 931
801 Ga0436365_0367250 3300039437 Bacteria 626
802 Ga0436365_0385905 3300039437 Bacteria 890
803 Ga0436365_1133158 3300039437 Bacteria 3818
804 Ga0436365_1669235 3300039437 Bacteria 3495
805 Ga0436365_1802317 3300039437 Bacteria 633
806 Ga0436365_1920113 3300039437 Bacteria 20212
807 Ga0436360_0674701 3300039438 Bacteria 847
808 Ga0436363_0322404 3300039450 Bacteria 676
809 Ga0436363_0408190 3300039450 Bacteria 937
810 Ga0436363_0624360 3300039450 Bacteria 21380
811 Ga0436363_0955717 3300039450 Bacteria 5239
812 Ga0436363_1085623 3300039450 Bacteria 1922
813 Ga0436363_1485877 3300039450 Bacteria 685
814 Ga0436362_0003135 3300039453 Archaea 927
815 Ga0436362_0069468 3300039453 Bacteria 737
816 Ga0436362_0198547 3300039453 Bacteria 870
817 Ga0439453_0003819 3300041408 Bacteria 2199
818 Ga0451793_1459972 3300041452 Bacteria 541
819 Ga0451807_1432889 3300041486 Bacteria 694
820 Ga0451807_1472198 3300041486 Bacteria 580
821 Ga0451847_0782413 3300041503 Bacteria 510
822 Ga0451853_2175763 3300041512 Bacteria 669
823 Ga0439451_025740 3300042009 Bacteria 1185
824 Ga0450906_011235 3300042145 Bacteria 1679
825 Ga0450907_001078 3300042146 Bacteria 6320
826 Ga0439440_0097816 3300042993 Bacteria 795
827 Ga0466969_0032309 3300044656 Bacteria 2661
828 Ga0466969_0054971 3300044656 Bacteria 1949
829 Ga0466969_0154358 3300044656 Bacteria 1057
830 Ga0466965_0079752 3300044683 Bacteria 1654
831 Ga0466965_0118828 3300044683 Bacteria 1364
832 Ga0466966_0317478 3300044684 Bacteria 936
833 Ga0466961_0125535 3300044693 Bacteria 1610
834 Ga0466961_0229502 3300044693 Bacteria 1143
835 Ga0466961_0392657 3300044693 Bacteria 842
836 Ga0466963_0027918 3300044694 Bacteria 3618
837 Ga0466963_0175458 3300044694 Bacteria 1495
838 Ga0466963_0922500 3300044694 Bacteria 615
839 Ga0466964_0014291 3300044706 Bacteria 3018
840 Ga0466964_0221158 3300044706 Bacteria 920
841 Ga0453684_0812183 3300044712 Bacteria 1008
842 Ga0466971_0006309 3300044719 Bacteria 5148
843 Ga0466971_0024945 3300044719 Bacteria 2670
844 Ga0466971_0633027 3300044719 Bacteria 535
845 Ga0466968_0017802 3300044735 Bacteria 2845
846 Ga0466968_0036721 3300044735 Bacteria 2054
847 Ga0466968_0087584 3300044735 Bacteria 1376
848 Ga0466968_0308651 3300044735 Bacteria 762
849 Ga0466970_0085331 3300044765 Bacteria 1710
850 Ga0466970_0112832 3300044765 Bacteria 1485
851 Ga0466970_0580447 3300044765 Bacteria 649
852 Ga0466957_0195134 3300044842 Bacteria 1328
853 Ga0466957_0268700 3300044842 Bacteria 1138
854 Ga0466959_0000677 3300045049 Bacteria 19896
855 Ga0466959_0016170 3300045049 Bacteria 5447
856 Ga0466959_0031483 3300045049 Bacteria 3924
857 Ga0466959_0079121 3300045049 Bacteria 2370
858 Ga0466959_0130422 3300045049 Bacteria 1782
859 Ga0466959_0271352 3300045049 Bacteria 1166
860 Ga0466959_0651846 3300045049 Bacteria 707
861 Ga0466959_0695842 3300045049 Bacteria 681
862 Ga0466959_0709433 3300045049 Unclassified 674
863 Ga0466959_1033965 3300045049 Bacteria 547
864 Ga0451576_2715654 3300045051 Bacteria 504
865 Ga0466958_0000585 3300045836 Bacteria 15532
866 Ga0466958_0018505 3300045836 Bacteria 4044
867 Ga0466958_0020335 3300045836 Bacteria 3869
868 Ga0466958_0116538 3300045836 Bacteria 1670
869 Ga0466958_0150289 3300045836 Bacteria 1469
870 Ga0466958_0190789 3300045836 Bacteria 1302
871 Ga0466958_0254323 3300045836 Bacteria 1124
872 Ga0466958_0625464 3300045836 Bacteria 700
873 Ga0466967_0215943 3300045976 Bacteria 1820
874 Ga0466967_0305546 3300045976 Bacteria 1531
875 Ga0466967_0448128 3300045976 Bacteria 1261
876 Ga0466967_0922561 3300045976 Bacteria 869
877 Ga0466967_1081094 3300045976 Bacteria 799
878 Ga0466967_1274728 3300045976 Bacteria 732
879 Ga0466967_1568351 3300045976 Bacteria 656
880 Ga0466967_1748569 3300045976 Bacteria 619
881 Ga0495603_0056156 3300046455 Bacteria 2332
882 Ga0495603_0131900 3300046455 Bacteria 1454
883 Ga0495603_0194951 3300046455 Bacteria 1171
884 Ga0495629_0000475 3300046459 Bacteria 33620
885 Ga0495629_0070603 3300046459 Bacteria 2437
886 Ga0495629_0803587 3300046459 Bacteria 620
887 Ga0495629_1132558 3300046459 Bacteria 505
888 Ga0495641_0047602 3300046461 Bacteria 1968
889 Ga0495641_0109335 3300046461 Bacteria 1234
890 Ga0495641_0198551 3300046461 Bacteria 899
891 Ga0495651_0010178 3300046462 Bacteria 7221
892 Ga0495650_0000049 3300046471 Bacteria 325092
893 Ga0495580_0096515 3300046472 Bacteria 2056
894 Ga0495582_0000428 3300046473 Bacteria 22994
895 Ga0495582_0044405 3300046473 Bacteria 2447
896 Ga0495639_0116340 3300046475 Bacteria 1272
897 Ga0495584_0120451 3300046491 Bacteria 1329
898 Ga0495584_0250395 3300046491 Bacteria 901
899 Ga0495594_0196346 3300046499 Bacteria 1150
900 Ga0495594_0362418 3300046499 Bacteria 825
901 Ga0495594_0426607 3300046499 Bacteria 754
902 Ga0495596_0053215 3300046500 Bacteria 1584
903 Ga0495596_0242961 3300046500 Bacteria 699
904 Ga0495596_0400714 3300046500 Bacteria 535
905 Ga0495607_0128311 3300046501 Bacteria 1323
906 Ga0495607_0496892 3300046501 Bacteria 542
907 Ga0495608_0136463 3300046511 Bacteria 1567
908 Ga0495608_0548382 3300046511 Bacteria 697
909 Ga0495616_0395023 3300046513 Bacteria 569
910 Ga0495620_0143740 3300046515 Bacteria 932
911 Ga0495628_0018963 3300046516 Bacteria 5692
912 Ga0495628_0429453 3300046516 Bacteria 962
913 Ga0495628_0716485 3300046516 Bacteria 706
914 Ga0495628_1026703 3300046516 Bacteria 566
915 Ga0495630_0000167 3300046517 Bacteria 51244
916 Ga0495630_1088466 3300046517 Bacteria 606
917 Ga0495631_0076375 3300046518 Bacteria 1446
918 Ga0495644_0465705 3300046523 Bacteria 504
919 Ga0495663_0182511 3300046525 Bacteria 727
920 Ga0495666_0087134 3300046526 Bacteria 1475
921 Ga0495666_0151107 3300046526 Bacteria 1080
922 Ga0495642_0244915 3300046528 Bacteria 784
923 Ga0495642_0267284 3300046528 Bacteria 748
924 Ga0495652_0104299 3300046529 Bacteria 2293
925 Ga0495652_0179040 3300046529 Bacteria 1629
926 Ga0495652_0565641 3300046529 Bacteria 780
927 Ga0495654_0399729 3300046530 Bacteria 546
928 Ga0495640_0025304 3300046533 Bacteria 4307
929 Ga0495640_0552553 3300046533 Bacteria 698
930 Ga0495587_0105755 3300046536 Bacteria 1619
931 Ga0495598_0065751 3300046537 Bacteria 1130
932 Ga0495645_0101951 3300046543 Bacteria 2040
933 Ga0495645_0205092 3300046543 Bacteria 1335
934 Ga0495667_0101927 3300046559 Bacteria 1857
935 Ga0495667_0598708 3300046559 Bacteria 687
936 Ga0495656_0033155 3300046615 Bacteria 2106
937 Ga0495656_0488176 3300046615 Bacteria 652
938 Ga0495668_0454881 3300046616 Bacteria 705
939 Ga0495634_0031844 3300046642 Bacteria 3630
940 Ga0495635_0040049 3300046663 Bacteria 3239
941 Ga0495635_0954271 3300046663 Bacteria 547
942 Ga0495659_0183263 3300046664 Bacteria 853
943 Ga0495588_0512919 3300046674 Bacteria 628
944 Ga0495657_0092304 3300046675 Bacteria 1940
945 Ga0495599_0668750 3300046678 Bacteria 601
946 Ga0495647_0064412 3300046681 Bacteria 1453
947 Ga0495647_0447593 3300046681 Bacteria 597
948 Ga0495647_0475770 3300046681 Bacteria 580
949 Ga0495658_0000235 3300046683 Bacteria 31858
950 Ga0495658_0039208 3300046683 Bacteria 2628
951 Ga0495658_0078056 3300046683 Bacteria 1937
952 Ga0495658_0207997 3300046683 Bacteria 1222
953 Ga0495658_0269018 3300046683 Bacteria 1074
954 Ga0495658_0595633 3300046683 Bacteria 708
955 Ga0495658_0841463 3300046683 Bacteria 587
956 Ga0495613_0004377 3300046689 Bacteria 10568
957 Ga0495613_0013199 3300046689 Bacteria 6139
958 Ga0495613_0338556 3300046689 Bacteria 1035
959 Ga0495624_0111145 3300046690 Bacteria 1685
960 Ga0495624_0567949 3300046690 Bacteria 677
961 Ga0495670_0301943 3300046691 Bacteria 858
962 Ga0495600_0063480 3300046809 Bacteria 2414
963 Ga0495581_0000968 3300047315 Bacteria 15438
964 Ga0495581_0046940 3300047315 Bacteria 2496
965 Ga0495604_0032511 3300047317 Bacteria 4134
966 Ga0495604_0655103 3300047317 Bacteria 669
967 Ga0495636_0103171 3300047318 Bacteria 1249
968 Ga0495674_0022180 3300047319 Bacteria 5858
969 Ga0495674_0220966 3300047319 Bacteria 1566
970 Ga0495674_0407644 3300047319 Bacteria 1097
971 Ga0495676_0130480 3300047321 Bacteria 1815
972 Ga0495676_0231131 3300047321 Bacteria 1270
973 Ga0495676_0833406 3300047321 Bacteria 593
974 Ga0495680_0000756 3300047322 Bacteria 36274
975 Ga0495675_0045596 3300047444 Bacteria 2792
976 Ga0495677_0154259 3300047445 Bacteria 885
977 Ga0495593_0201465 3300047673 Bacteria 1000
978 Ga0495602_0747381 3300048088 Bacteria 660
979 Ga0495614_0309592 3300048089 Bacteria 731
980 Ga0496100_0050717 3300048903 Bacteria 2690
981 Ga0496100_0096750 3300048903 Bacteria 2026
982 Ga0496100_0608525 3300048903 Bacteria 849
983 Ga0496101_0012572 3300048904 Bacteria 5652
984 Ga0496101_0138953 3300048904 Bacteria 1850
985 Ga0496101_0302292 3300048904 Bacteria 1253
986 Ga0496101_0400309 3300048904 Bacteria 1081
987 Ga0496102_0013081 3300048905 Bacteria 7183
988 Ga0496102_0039679 3300048905 Bacteria 4255
989 Ga0496102_0165168 3300048905 Bacteria 2083
990 Ga0496102_0322250 3300048905 Bacteria 1456
991 Ga0496102_0348226 3300048905 Bacteria 1395
992 Ga0496102_0392035 3300048905 Bacteria 1306
993 Ga0496102_0399200 3300048905 Bacteria 1293
994 Ga0496102_0532686 3300048905 Bacteria 1097
995 Ga0496102_0740833 3300048905 Bacteria 906
996 Ga0496103_0111121 3300048906 Bacteria 1741
997 Ga0496103_0495566 3300048906 Bacteria 782
998 Ga0496104_0207888 3300048907 Bacteria 1869
999 Ga0496104_1120698 3300048907 Bacteria 690
1000 Ga0496106_0027485 3300048909 Bacteria 4237
1001 Ga0496106_0063570 3300048909 Bacteria 2805
1002 Ga0496106_0132612 3300048909 Bacteria 1954
1003 Ga0496106_0283665 3300048909 Bacteria 1327
1004 Ga0496106_0498401 3300048909 Bacteria 978
1005 Ga0496106_0686425 3300048909 Bacteria 817
1006 Ga0496107_0007203 3300048910 Bacteria 7662
1007 Ga0496107_0033250 3300048910 Bacteria 3689
1008 Ga0496107_0096720 3300048910 Bacteria 2161
1009 Ga0496107_0171053 3300048910 Bacteria 1612
1010 Ga0496107_0197570 3300048910 Bacteria 1495
1011 Ga0496107_0610482 3300048910 Bacteria 806
1012 Ga0496107_0976972 3300048910 Bacteria 615
1013 Ga0496108_0006589 3300048911 Bacteria 9417
1014 Ga0496108_0277669 3300048911 Bacteria 1459
1015 Ga0496108_1710708 3300048911 Bacteria 517
1016 Ga0496109_0011552 3300048912 Bacteria 7595
1017 Ga0496109_0028340 3300048912 Bacteria 5008
1018 Ga0496109_0209611 3300048912 Bacteria 1833
1019 Ga0496109_0333881 3300048912 Bacteria 1431
1020 Ga0496110_0010128 3300048913 Bacteria 7655
1021 Ga0496110_0117839 3300048913 Bacteria 2391
1022 Ga0496110_0144594 3300048913 Bacteria 2150
1023 Ga0496110_0158595 3300048913 Bacteria 2050
1024 Ga0496110_0252441 3300048913 Bacteria 1605
1025 Ga0496110_0603398 3300048913 Bacteria 996
1026 Ga0496110_0771969 3300048913 Bacteria 865
1027 Ga0496110_1234994 3300048913 Bacteria 656
1028 Ga0496110_1417220 3300048913 Bacteria 604
1029 Ga0496111_0010576 3300048914 Bacteria 6198
1030 Ga0496111_0026031 3300048914 Bacteria 4129
1031 Ga0496111_0227843 3300048914 Bacteria 1384
1032 Ga0496111_0414182 3300048914 Bacteria 995
1033 Ga0496111_1292572 3300048914 Bacteria 514
1034 Ga0496112_0100312 3300048915 Bacteria 2865
1035 Ga0496112_0116542 3300048915 Bacteria 2642
1036 Ga0496112_0177394 3300048915 Bacteria 2095
1037 Ga0496112_0356335 3300048915 Bacteria 1405
1038 Ga0496112_0911023 3300048915 Bacteria 801
1039 Ga0496113_0177469 3300048916 Bacteria 1688
1040 Ga0496113_0491556 3300048916 Bacteria 985
1041 Ga0496113_0967938 3300048916 Bacteria 671
1042 Ga0496113_1223249 3300048916 Bacteria 586
1043 Ga0496113_1243579 3300048916 Bacteria 580
1044 Ga0496114_0031573 3300048917 Bacteria 4358
1045 Ga0496114_0076881 3300048917 Bacteria 2813
1046 Ga0496114_0172338 3300048917 Bacteria 1886
1047 Ga0496115_0002214 3300048918 Bacteria 13937
1048 Ga0496115_0101487 3300048918 Bacteria 2359
1049 Ga0496115_0144377 3300048918 Bacteria 1964
1050 Ga0496115_0169163 3300048918 Bacteria 1808
1051 Ga0496115_1398479 3300048918 Bacteria 517
1052 Ga0501031_0077805 3300049568 Bacteria 2160
1053 Ga0501031_0183747 3300049568 Bacteria 1366
1054 Ga0501032_0217480 3300049569 Bacteria 1244
1055 Ga0501034_0218959 3300049571 Unclassified 1857
1056 Ga0501036_0072210 3300049572 Bacteria 2917
1057 Ga0501036_0077903 3300049572 Bacteria 2805
1058 Ga0501036_0334481 3300049572 Bacteria 1265
1059 Ga0501037_0211673 3300049573 Bacteria 1367
1060 Ga0501038_0044240 3300049574 Bacteria 3871
1061 Ga0501038_0189046 3300049574 Bacteria 1658
1062 Ga0501039_0132808 3300049575 Bacteria 1954
1063 Ga0501039_0526995 3300049575 Bacteria 927
1064 Ga0501039_0834197 3300049575 Bacteria 719
1065 Ga0501039_1448440 3300049575 Bacteria 528
1066 Ga0501040_0064153 3300049576 Bacteria 2528
1067 Ga0501041_0012244 3300049577 Bacteria 5082
1068 Ga0501041_0047093 3300049577 Bacteria 2624
1069 Ga0501041_0519181 3300049577 Bacteria 758
1070 Ga0501041_0949783 3300049577 Bacteria 553
1071 Ga0501042_0024843 3300049578 Bacteria 4205
1072 Ga0501042_0309881 3300049578 Bacteria 1140
1073 Ga0501043_0128070 3300049579 Bacteria 1990
1074 Ga0501043_1167521 3300049579 Unclassified 542
1075 Ga0501046_0081127 3300049580 Bacteria 2505
1076 Ga0501048_0017242 3300049582 Bacteria 5321
1077 Ga0501048_0038744 3300049582 Bacteria 3420
1078 Ga0501048_0140351 3300049582 Bacteria 1709
1079 Ga0501048_0236963 3300049582 Bacteria 1295
1080 Ga0501067_0390872 3300049583 Bacteria 776
1081 Ga0501068_0216631 3300049584 Bacteria 1216
1082 Ga0501069_0056499 3300049585 Bacteria 2187
1083 Ga0501070_0081253 3300049586 Bacteria 2681
1084 Ga0501071_0055897 3300049587 Bacteria 2849
1085 Ga0501071_0121562 3300049587 Bacteria 1935
1086 Ga0501071_0169884 3300049587 Bacteria 1632
1087 Ga0501071_0430750 3300049587 Bacteria 1008
1088 Ga0501072_0006757 3300049588 Bacteria 8714
1089 Ga0501072_0074262 3300049588 Bacteria 2689
1090 Ga0501072_0216980 3300049588 Bacteria 1524
1091 Ga0501072_0608085 3300049588 Bacteria 862
1092 Ga0501073_0106160 3300049589 Bacteria 1949
1093 Ga0501073_0288561 3300049589 Bacteria 1132
1094 Ga0501074_0016181 3300049590 Bacteria 5420
1095 Ga0501075_0011259 3300049591 Bacteria 6327
1096 Ga0501075_0012937 3300049591 Bacteria 5945
1097 Ga0501075_0053429 3300049591 Bacteria 3038
1098 Ga0501075_0413753 3300049591 Bacteria 1028
1099 Ga0501075_0473213 3300049591 Bacteria 956
1100 Ga0501075_1009385 3300049591 Bacteria 632
1101 Ga0501075_1254860 3300049591 Bacteria 562
1102 Ga0501076_0036450 3300049592 Bacteria 3853
1103 Ga0501076_0064843 3300049592 Bacteria 2911
1104 Ga0501076_0253221 3300049592 Bacteria 1441
1105 Ga0501077_0018389 3300049593 Bacteria 4422
1106 Ga0501077_0124011 3300049593 Bacteria 1637
1107 Ga0501077_0181174 3300049593 Bacteria 1339
1108 Ga0501077_0445082 3300049593 Bacteria 829
1109 Ga0501079_0121501 3300049741 Bacteria 2031
1110 Ga0501079_0523371 3300049741 Bacteria 932
1111 Ga0501079_0864215 3300049741 Bacteria 712
1112 Ga0501079_0954779 3300049741 Bacteria 675
1113 Ga0501079_1126652 3300049741 Unclassified 618
1114 Ga0501080_0051940 3300049742 Bacteria 3815
1115 Ga0501080_0158254 3300049742 Bacteria 2092
1116 Ga0501081_0023532 3300049743 Bacteria 4129
1117 Ga0501081_0394097 3300049743 Bacteria 1024
1118 Ga0501083_0073839 3300049744 Bacteria 2267
1119 Ga0501035_0036798 3300049822 Bacteria 4435
1120 Ga0501044_0289768 3300049823 Bacteria 1569
1121 Ga0501045_0053518 3300049824 Bacteria 2949
1122 Ga0501045_0097123 3300049824 Bacteria 2179
1123 Ga0501045_0175015 3300049824 Bacteria 1599
1124 nmdc:mga03n38_251270_c1 3300050490 Bacteria 934
1125 nmdc:mga03n38_82730_c1 3300050490 Bacteria 1512
1126 nmdc:mga00v17_170001_c1 3300050491 Bacteria 1405
1127 nmdc:mga00v17_371074_c1 3300050491 Bacteria 930
1128 nmdc:mga0yw44_219456_c1 3300050492 Bacteria 1260
1129 nmdc:mga0yw44_473366_c1 3300050492 Bacteria 849
1130 nmdc:mga0yw44_551496_c1 3300050492 Bacteria 783
1131 nmdc:mga0yw44_61291_c1 3300050492 Bacteria 2307
1132 nmdc:mga0yw44_936259_c1 3300050492 Bacteria 587
1133 nmdc:mga06z11_226538_c1 3300050494 Bacteria 1094
1134 nmdc:mga05p37_1197847_c1 3300050507 Bacteria 785
1135 nmdc:mga05p37_13812_c1 3300050507 Bacteria 9675
1136 nmdc:mga05p37_1408173_c1 3300050507 Bacteria 701
1137 nmdc:mga05p37_1462874_c1 3300050507 Bacteria 683
1138 nmdc:mga05p37_1884527_c1 3300050507 Bacteria 572
1139 nmdc:mga05p37_2685_c1 3300050507 Bacteria 20688
1140 nmdc:mga05p37_269214_c1 3300050507 Bacteria 2036
1141 nmdc:mga09592_127755_c1 3300050508 Bacteria 2186
1142 nmdc:mga09592_28274_c1 3300050508 Bacteria 4657
1143 nmdc:mga09592_569429_c1 3300050508 Bacteria 972
1144 nmdc:mga09592_8889_c1 3300050508 Bacteria 8167
1145 nmdc:mga0qj67_1246651_c1 3300050509 Bacteria 577
1146 nmdc:mga0qj67_13530_c1 3300050509 Bacteria 6154
1147 nmdc:mga0qj67_1419002_c1 3300050509 Bacteria 536
1148 nmdc:mga0qj67_529272_c1 3300050509 Bacteria 946
1149 nmdc:mga06r32_1204612_c1 3300050510 Bacteria 703
1150 nmdc:mga06r32_326256_c1 3300050510 Bacteria 1520
1151 nmdc:mga06r32_559130_c1 3300050510 Bacteria 1117
1152 nmdc:mga06r32_5698_c1 3300050510 Bacteria 11216
1153 nmdc:mga06r32_661008_c1 3300050510 Bacteria 1013
1154 nmdc:mga08y16_1202603_c1 3300050511 Bacteria 728
1155 nmdc:mga08y16_1364166_c1 3300050511 Bacteria 673
1156 nmdc:mga08y16_159200_c1 3300050511 Bacteria 2346
1157 nmdc:mga08y16_22001_c1 3300050511 Bacteria 6732
1158 nmdc:mga08y16_476897_c1 3300050511 Bacteria 1270
1159 nmdc:mga08y16_622625_c1 3300050511 Bacteria 1086
1160 nmdc:mga08y16_88261_c1 3300050511 Bacteria 3232
1161 nmdc:mga08y16_974821_c1 3300050511 Bacteria 829
1162 nmdc:mga0n895_10011_c1 3300050512 Bacteria 8346
1163 nmdc:mga0n895_1837573_c1 3300050512 Bacteria 566
1164 nmdc:mga0n895_322599_c1 3300050512 Bacteria 1565
1165 nmdc:mga0n895_897143_c1 3300050512 Bacteria 872
1166 nmdc:mga0n895_904777_c1 3300050512 Bacteria 868
1167 nmdc:mga0n895_99579_c1 3300050512 Bacteria 2915
1168 nmdc:mga0rr50_524034_c1 3300050513 Bacteria 1008
1169 nmdc:mga0rr50_595429_c1 3300050513 Bacteria 942
1170 nmdc:mga08x19_15269_c1 3300050514 Bacteria 4671
1171 nmdc:mga08x19_651112_c1 3300050514 Bacteria 747
1172 nmdc:mga0a205_1142591_c1 3300050515 Bacteria 626
1173 nmdc:mga0a205_1233060_c1 3300050515 Bacteria 596
1174 nmdc:mga0a205_160249_c1 3300050515 Bacteria 2147
1175 nmdc:mga0a205_237655_c1 3300050515 Bacteria 1703
1176 nmdc:mga0a205_243520_c1 3300050515 Bacteria 1679
1177 nmdc:mga0a205_831769_c1 3300050515 Bacteria 771
1178 Ga0495601_0003872 3300053077 Bacteria 8618
1179 Ga0495601_0167797 3300053077 Bacteria 1434
1180 Ga0495601_0402150 3300053077 Bacteria 888
1181 Ga0495612_0000022 3300053078 Bacteria 119126
1182 Ga0495612_0065011 3300053078 Bacteria 1515
1183 Ga0495612_0071028 3300053078 Bacteria 1452
1184 Ga0495655_0047427 3300053083 Bacteria 1124
1185 Ga0495655_0126887 3300053083 Bacteria 782
1186 Ga0495655_0151753 3300053083 Bacteria 729
1187 Ga0495655_0153462 3300053083 Bacteria 726
1188 Ga0495619_0000606 3300053085 Bacteria 23788
1189 Ga0495619_0046272 3300053085 Bacteria 2860
1190 Ga0495619_0062049 3300053085 Bacteria 2488
1191 Ga0495619_0176699 3300053085 Bacteria 1477
1192 Ga0501084_0013852 3300054114 Bacteria 6674
1193 Ga0501084_0043700 3300054114 Bacteria 3748
1194 Ga0501084_0119800 3300054114 Bacteria 2212
1195 Ga0501084_0257838 3300054114 Bacteria 1472
1196 Ga0501084_0637196 3300054114 Bacteria 900
1197 Ga0590074_012592 3300059423 Bacteria 1424
1198 Ga0501082_0013960 3300060353 Bacteria 6908
1199 Ga0501082_0079638 3300060353 Bacteria 2826
1200 Ga0501082_0101756 3300060353 Bacteria 2485
1201 Ga0501082_0329144 3300060353 Bacteria 1331
1202 Ga0466962_0117552 3300061719 Bacteria 1282
1203 Ga0466962_0415026 3300061719 Bacteria 675
1204 Ga0466962_0428101 3300061719 Bacteria 665
1205 Ga0530510_0005579 3300061734 Bacteria 8719
1206 Ga0530510_0136811 3300061734 Bacteria 1804
1207 Ga0530510_0209859 3300061734 Bacteria 1447
1208 Ga0157371_10821374
1209 2214761064
1210 ARcpr5yngRDRAFT_c002579
1211 ARCol0yngRDRAFT_1005013
1212 JGI24746J21847_1050660
1213 JGI25406J46586_10010892
1214 JGI25407J50210_10002530
1215 JGI25407J50210_10049953
1216 JGI25407J50210_10064244
1217 JGI25407J50210_10127034
1218 JGI25407J50210_10132576
1219 Ga0070658_10001210
1220 Ga0070658_10020311
1221 Ga0070676_10081619
1222 Ga0070676_10828318
1223 Ga0070683_100005813
1224 Ga0070683_100026739
1225 Ga0070683_100058107
1226 Ga0070683_100119568
1227 Ga0070683_100473552
1228 Ga0070690_100196399
1229 Ga0070690_100889816
1230 Ga0070670_100860494
1231 Ga0070677_10302916
1232 Ga0068869_100034683
1233 Ga0070680_100003139
1234 Ga0070680_100023121
1235 Ga0070680_100131595
1236 Ga0070680_100155513
1237 Ga0070682_100010853
1238 Ga0070682_100046743
1239 Ga0070682_100059809
1240 Ga0070682_100533156
1241 Ga0070682_100843998
1242 Ga0070682_101929680
1243 Ga0068868_100158156
1244 Ga0068868_101256228
1245 Ga0070660_100005363
1246 Ga0070660_100014995
1247 Ga0070660_100065830
1248 Ga0070660_100528948
1249 Ga0070689_100040014
1250 Ga0070689_100153268
1251 Ga0070689_100636221
1252 Ga0070691_10006936
1253 Ga0070691_10031222
1254 Ga0070691_10313265
1255 Ga0070691_10365441
1256 Ga0070687_100143211
1257 Ga0070687_100769744
1258 Ga0070661_100032533
1259 Ga0070661_100118550
1260 Ga0070661_100320406
1261 Ga0070661_100768879
1262 Ga0070661_100779376
1263 Ga0070692_10006512
1264 Ga0070692_10042279
1265 Ga0070692_10257924
1266 Ga0070692_10711679
1267 Ga0070668_100117590
1268 Ga0070668_100149835
1269 Ga0070668_100181054
1270 Ga0070668_100396529
1271 Ga0070669_100633049
1272 Ga0070669_100989995
1273 Ga0070675_100152742
1274 Ga0070675_101577942
1275 Ga0070671_100114246
1276 Ga0070674_100034034
1277 Ga0070674_100295418
1278 Ga0070674_100423802
1279 Ga0070674_100825449
1280 Ga0070673_100009097
1281 Ga0070673_100024804
1282 Ga0070673_100760409
1283 Ga0070688_100032711
1284 Ga0070659_100016345
1285 Ga0070659_100019949
1286 Ga0070659_100027921
1287 Ga0070659_100548418
1288 Ga0070659_100708788
1289 Ga0070667_100185736
1290 Ga0070703_10230566
1291 Ga0070709_10039522
1292 Ga0070709_10495846
1293 Ga0070714_100018641
1294 Ga0070714_100022772
1295 Ga0070714_100029615
1296 Ga0070714_101481908
1297 Ga0070713_100159519
1298 Ga0070713_100212251
1299 Ga0070713_101073455
1300 Ga0070710_11383163
1301 Ga0070705_100069387
1302 Ga0070700_100010538
1303 Ga0070700_100065856
1304 Ga0070700_100080858
1305 Ga0070700_100142713
1306 Ga0070700_100190088
1307 Ga0070700_100194100
1308 Ga0070694_100036649
1309 Ga0070694_100423929
1310 Ga0070694_101027396
1311 Ga0070708_100564593
1312 Ga0070708_100795963
1313 Ga0070663_101178015
1314 Ga0070678_100483625
1315 Ga0070678_100824793
1316 Ga0070678_101269870
1317 Ga0070678_101445529
1318 Ga0070662_100002010
1319 Ga0070662_100088603
1320 Ga0070662_101054458
1321 Ga0070662_101756475
1322 Ga0070681_10024124
1323 Ga0070681_10043543
1324 Ga0070681_10130586
1325 Ga0070681_10389699
1326 Ga0070681_10529843
1327 Ga0070681_10591602
1328 Ga0070681_10795577
1329 Ga0068867_100419856
1330 Ga0068867_100623705
1331 Ga0068867_101099938
1332 Ga0070685_10056787
1333 Ga0070685_10066133
1334 Ga0070685_10329123
1335 Ga0070685_11106874
1336 Ga0070698_100027626
1337 Ga0070699_100681186
1338 Ga0070699_101561311
1339 Ga0070679_100006758
1340 Ga0070679_100105902
1341 Ga0070679_100911572
1342 Ga0070679_101339437
1343 Ga0070679_101533781
1344 Ga0070679_101691573
1345 Ga0070679_102143879
1346 Ga0070684_100013347
1347 Ga0070684_100016306
1348 Ga0070684_100051346
1349 Ga0070684_100054856
1350 Ga0070684_100065746
1351 Ga0070684_100087196
1352 Ga0070684_100436759
1353 Ga0070684_101046405
1354 Ga0070684_101289027
1355 Ga0070684_101520788
1356 Ga0070684_101688403
1357 Ga0070697_100954084
1358 Ga0068853_100075863
1359 Ga0068853_100297293
1360 Ga0068853_100519216
1361 Ga0068853_101415842
1362 Ga0070672_100004115
1363 Ga0070672_100713047
1364 Ga0070672_101173784
1365 Ga0070686_100064972
1366 Ga0070686_100327847
1367 Ga0070686_100815925
1368 Ga0070695_100477691
1369 Ga0070695_100606747
1370 Ga0070695_100710137
1371 Ga0070696_100021303
1372 Ga0070696_100025271
1373 Ga0070696_100042104
1374 Ga0070693_100248306
1375 Ga0070693_100348383
1376 Ga0070693_100373211
1377 Ga0070693_100396582
1378 Ga0070693_100428380
1379 Ga0070693_101668369
1380 Ga0070665_100619112
1381 Ga0070704_100367465
1382 Ga0070704_100384959
1383 Ga0070704_101237994
1384 Ga0070704_101901456
1385 Ga0070704_102225275
1386 Ga0068855_100038635
1387 Ga0068855_100077517
1388 Ga0068855_101274472
1389 Ga0068855_102545101
1390 Ga0070664_100745534
1391 Ga0070664_100965109
1392 Ga0070664_101819571
1393 Ga0070664_101832253
1394 Ga0070664_102368116
1395 Ga0068857_100048693
1396 Ga0068857_100127205
1397 Ga0068857_100178042
1398 Ga0068857_100514011
1399 Ga0068854_100003599
1400 Ga0068854_100049668
1401 Ga0068854_100369839
1402 Ga0068854_100414873
1403 Ga0068854_100417476
1404 Ga0068854_101881907
1405 Ga0068856_100011442
1406 Ga0068856_100032786
1407 Ga0068856_100203494
1408 Ga0068856_100330551
1409 Ga0068856_101824888
1410 Ga0068856_102239080
1411 Ga0070702_100016921
1412 Ga0070702_100234621
1413 Ga0070702_100300139
1414 Ga0070702_100325494
1415 Ga0070702_100448155
1416 Ga0070702_100511709
1417 Ga0070702_101004492
1418 Ga0070702_101168233
1419 Ga0070702_101334072
1420 Ga0068852_100019221
1421 Ga0068852_100159302
1422 Ga0068852_100221047
1423 Ga0068852_100334664
1424 Ga0068852_100649924
1425 Ga0068852_101486024
1426 Ga0068864_100047931
1427 Ga0068864_102444296
1428 Ga0068866_10041680
1429 Ga0068866_10204543
1430 Ga0068866_10466678
1431 Ga0068866_11353610
1432 Ga0068861_100070700
1433 Ga0068861_100453617
1434 Ga0068861_100909325
1435 Ga0068851_10171147
1436 Ga0068851_10283845
1437 Ga0068870_10110376
1438 Ga0068870_10199978
1439 Ga0068870_10452399
1440 Ga0068870_10569072
1441 Ga0068863_100058711
1442 Ga0068863_100950696
1443 Ga0068863_101595374
1444 Ga0068858_100358287
1445 Ga0068858_101644798
1446 Ga0068858_102290198
1447 Ga0068860_101307405
1448 Ga0068860_101562759
1449 Ga0068862_101281357
1450 Ga0068862_101459690
1451 Ga0081455_10000409
1452 Ga0081455_10006380
1453 Ga0081455_10011750
1454 Ga0081455_10012132
1455 Ga0081455_10020175
1456 Ga0081455_10025162
1457 Ga0081455_10025500
1458 Ga0081455_10034687
1459 Ga0081455_10049149
1460 Ga0081455_10050932
1461 Ga0081455_10077844
1462 Ga0081455_10189521
1463 Ga0081455_10278965
1464 Ga0081455_10579318
1465 Ga0081455_10827100
1466 Ga0081538_10000088
1467 Ga0081538_10000223
1468 Ga0081538_10000700
1469 Ga0081538_10001237
1470 Ga0081538_10003189
1471 Ga0081538_10003456
1472 Ga0081538_10013797
1473 Ga0081538_10018613
1474 Ga0081538_10018785
1475 Ga0081538_10043722
1476 Ga0081538_10120621
1477 Ga0081538_10150959
1478 Ga0081538_10151292
1479 Ga0081538_10354611
1480 Ga0081539_10000181
1481 Ga0081539_10020069
1482 Ga0081539_10177157
1483 Ga0070717_10003782
1484 Ga0070717_10007142
1485 Ga0070717_10029505
1486 Ga0070717_10177360
1487 Ga0075365_10801178
1488 Ga0075363_100173779
1489 Ga0075363_100658697
1490 Ga0075364_10187920
1491 Ga0075364_10245254
1492 Ga0075432_10000256
1493 Ga0075432_10032306
1494 Ga0075432_10074058
1495 Ga0075432_10336844
1496 Ga0070716_100609765
1497 Ga0070712_100218303
1498 Ga0075367_10128256
1499 Ga0075367_10343372
1500 Ga0075367_10438822
1501 Ga0097621_100241707
1502 Ga0097621_100723882
1503 Ga0097621_100874880
1504 Ga0068871_100147661
1505 Ga0075428_100003661
1506 Ga0075428_100032062
1507 Ga0075428_100281718
1508 Ga0075428_100291300
1509 Ga0075428_101040936
1510 Ga0075428_101340724
1511 Ga0075430_100014889
1512 Ga0075430_100027849
1513 Ga0075430_101213596
1514 Ga0075431_100001077
1515 Ga0075431_100167186
1516 Ga0075431_100491920
1517 Ga0075431_100616858
1518 Ga0075433_10115382
1519 Ga0075433_10207068
1520 Ga0075433_10223885
1521 Ga0075433_10821741
1522 Ga0075433_11590326
1523 Ga0075434_100038256
1524 Ga0075434_100604381
1525 Ga0075434_100723089
1526 Ga0075434_101503012
1527 Ga0075434_101962825
1528 Ga0075434_102500516
1529 Ga0075429_100014763
1530 Ga0075429_100033200
1531 Ga0075429_100033952
1532 Ga0075429_100287706
1533 Ga0075429_100415079
1534 Ga0068865_100007607
1535 Ga0068865_100081051
1536 Ga0068865_100406158
1537 Ga0068865_100417941
1538 Ga0068865_100940638
1539 Ga0068865_101986979
1540 Ga0075436_100027359
1541 Ga0075436_100790733
1542 Ga0075436_101207218
1543 Ga0097620_100298659
1544 Ga0075435_100002298
1545 Ga0075435_100138419
1546 Ga0075435_100920520
1547 Ga0105244_10158635
1548 Ga0105240_10114379
1549 Ga0105240_10248319
1550 Ga0105240_11045129
1551 Ga0105240_11421724
1552 Ga0111539_10010353
1553 Ga0111539_10076986
1554 Ga0111539_10102498
1555 Ga0111539_10268267
1556 Ga0111539_10285575
1557 Ga0111539_11702489
1558 Ga0111539_12084518
1559 Ga0105245_10000728
1560 Ga0105245_10038111
1561 Ga0105245_10094191
1562 Ga0105245_10293967
1563 Ga0105245_10407323
1564 Ga0105245_10621307
1565 Ga0105245_11427292
1566 Ga0105245_12690568
1567 Ga0105247_10154158
1568 Ga0105247_10690525
1569 Ga0114129_10001306
1570 Ga0114129_10010286
1571 Ga0114129_10266311
1572 Ga0114129_10305512
1573 Ga0114129_10411171
1574 Ga0114129_10475906
1575 Ga0114129_10825794
1576 Ga0114129_10976005
1577 Ga0114129_11676968
1578 Ga0114129_12375288
1579 Ga0105243_10009337
1580 Ga0105243_10071059
1581 Ga0105243_10149343
1582 Ga0105243_12803634
1583 Ga0105241_10060041
1584 Ga0105242_10174879
1585 Ga0105242_10341613
1586 Ga0105248_10281187
1587 Ga0105248_10831147
1588 Ga0105248_12366852
1589 Ga0105237_10113563
1590 Ga0105237_10925443
1591 Ga0105237_11167389
1592 Ga0105237_11982394
1593 Ga0105238_10004249
1594 Ga0105238_10008781
1595 Ga0105238_10045221
1596 Ga0105238_10168462
1597 Ga0105238_11992976
1598 Ga0105249_10011157
1599 Ga0105249_10295924
1600 Ga0105249_10362405
1601 Ga0105249_10612361
1602 Ga0105249_10996247
1603 Ga0105239_10030152
1604 Ga0105239_10085742
1605 Ga0105239_10112426
1606 Ga0105239_10285681
1607 Ga0105239_10410290
1608 Ga0105246_10005274
1609 Ga0105246_10080462
1610 Ga0105246_10283424
1611 Ga0105246_11312347
1612 Ga0105246_11354313
1613 Ga0105246_12589844
1614 Ga0157321_1036353
1615 Ga0157322_1003264
1616 Ga0157338_1012833
1617 Ga0157373_10181280
1618 Ga0157373_10439331
1619 Ga0157371_10011988
1620 Ga0157370_10064620
1621 Ga0157370_10124409
1622 Ga0157370_10703740
1623 Ga0157370_11012109
1624 Ga0157369_10001328
1625 Ga0157369_10053576
1626 Ga0157369_10413206
1627 Ga0157369_10845248
1628 Ga0157369_10900662
1629 Ga0157374_10399513
1630 Ga0163162_10034042
1631 Ga0163162_10101306
1632 Ga0163162_10331000
1633 Ga0163162_10632360
1634 Ga0163162_10680093
1635 Ga0157372_10008081
1636 Ga0157372_10143355
1637 Ga0157372_10433488
1638 Ga0157372_10464033
1639 Ga0157372_11442377
1640 Ga0157375_10125935
1641 Ga0157375_10143415
1642 Ga0157375_10176488
1643 Ga0157375_11383188
1644 Ga0163163_10042065
1645 Ga0163163_10218705
1646 Ga0163163_10359282
1647 Ga0163163_10565156
1648 Ga0163163_11424259
1649 Ga0157380_10015588
1650 Ga0157380_10920534
1651 Ga0157380_12332498
1652 Ga0157377_10061973
1653 Ga0157377_10069211
1654 Ga0157377_10267290
1655 Ga0157379_10031532
1656 Ga0157379_10969177
1657 Ga0157379_11177067
1658 Ga0157379_11194513
1659 Ga0157376_10022706
1660 Ga0157376_10516215
1661 Ga0157376_10990217
1662 Ga0157376_11981450
1663 Ga0163161_10054053
1664 Ga0163161_10911429
1665 Ga0206356_10012817
1666 Ga0206356_10363621
1667 Ga0206356_11001847
1668 Ga0206356_11044246
1669 Ga0206352_11028291
1670 Ga0206350_10466747
1671 Ga0206350_11376814
1672 Ga0206354_10121218
1673 Ga0206354_10150264
1674 Ga0206353_10169547
1675 Ga0206353_10171946
1676 Ga0206353_11051339
1677 Ga0206353_11592094
1678 Ga0213874_10021196
1679 Ga0213874_10281614
1680 Ga0213876_10019956
1681 Ga0213876_10238317
1682 Ga0213876_10434198
1683 Ga0213875_10010182
1684 Ga0224712_10109648
1685 Ga0224712_10151535
1686 Ga0224712_10409659
1687 Ga0207682_10180734
1688 Ga0207692_10034106
1689 Ga0207692_10450494
1690 Ga0207642_10046376
1691 Ga0207642_10129609
1692 Ga0207642_10506101
1693 Ga0207642_10537453
1694 Ga0207710_10045236
1695 Ga0207688_10067568
1696 Ga0207680_10243584
1697 Ga0207699_10211420
1698 Ga0207699_10602540
1699 Ga0207699_10613196
1700 Ga0207645_10081751
1701 Ga0207645_10779511
1702 Ga0207643_10004848
1703 Ga0207643_10445923
1704 Ga0207643_10883162
1705 Ga0207705_10080433
1706 Ga0207684_10299621
1707 Ga0207707_10021775
1708 Ga0207707_10115396
1709 Ga0207707_10130797
1710 Ga0207707_10196850
1711 Ga0207707_10987762
1712 Ga0207707_11171133
1713 Ga0207695_10062875
1714 Ga0207695_10426650
1715 Ga0207695_10890720
1716 Ga0207671_10072688
1717 Ga0207671_10207046
1718 Ga0207671_10255872
1719 Ga0207693_10249060
1720 Ga0207693_10490809
1721 Ga0207693_10548709
1722 Ga0207663_10868790
1723 Ga0207660_10037033
1724 Ga0207660_10062726
1725 Ga0207660_10206251
1726 Ga0207660_10568455
1727 Ga0207660_10577589
1728 Ga0207662_10096646
1729 Ga0207662_10213813
1730 Ga0207662_10627301
1731 Ga0207657_10009763
1732 Ga0207657_10026437
1733 Ga0207657_10049899
1734 Ga0207657_10059931
1735 Ga0207657_10245543
1736 Ga0207657_10268176
1737 Ga0207649_10028567
1738 Ga0207649_10037756
1739 Ga0207649_10090587
1740 Ga0207649_10821109
1741 Ga0207652_10074262
1742 Ga0207652_10086660
1743 Ga0207652_10183337
1744 Ga0207652_10569377
1745 Ga0207681_10078268
1746 Ga0207681_10373039
1747 Ga0207681_10401129
1748 Ga0207694_10009894
1749 Ga0207694_10030576
1750 Ga0207694_10064856
1751 Ga0207694_10082899
1752 Ga0207659_10198052
1753 Ga0207687_10026451
1754 Ga0207687_10078688
1755 Ga0207687_10236404
1756 Ga0207687_10308419
1757 Ga0207687_10934635
1758 Ga0207687_11605386
1759 Ga0207687_11641806
1760 Ga0207700_10581769
1761 Ga0207700_11742979
1762 Ga0207664_10002561
1763 Ga0207664_10199404
1764 Ga0207664_10534052
1765 Ga0207644_11056511
1766 Ga0207690_10027863
1767 Ga0207690_10122354
1768 Ga0207690_10505772
1769 Ga0207690_10648080
1770 Ga0207690_11143523
1771 Ga0207690_11229854
1772 Ga0207690_11539968
1773 Ga0207706_10009359
1774 Ga0207706_10106807
1775 Ga0207706_11360758
1776 Ga0207686_10183773
1777 Ga0207686_11361693
1778 Ga0207709_10024597
1779 Ga0207709_11076535
1780 Ga0207669_10122580
1781 Ga0207669_10661054
1782 Ga0207704_10124744
1783 Ga0207704_10273488
1784 Ga0207704_10519345
1785 Ga0207665_10053714
1786 Ga0207665_10142886
1787 Ga0207665_10467547
1788 Ga0207691_10009233
1789 Ga0207691_10021320
1790 Ga0207711_10022899
1791 Ga0207711_10559233
1792 Ga0207689_10026816
1793 Ga0207689_11110082
1794 Ga0207661_10071558
1795 Ga0207661_10088638
1796 Ga0207661_10118805
1797 Ga0207661_10134057
1798 Ga0207661_10181148
1799 Ga0207661_10268249
1800 Ga0207661_10370887
1801 Ga0207661_10378741
1802 Ga0207661_10510805
1803 Ga0207661_11158061
1804 Ga0207679_11630988
1805 Ga0207667_10090837
1806 Ga0207667_10354011
1807 Ga0207667_10702016
1808 Ga0207667_11983690
1809 Ga0207651_10138040
1810 Ga0207651_11875718
1811 Ga0207712_10026692
1812 Ga0207712_10192203
1813 Ga0207712_10433628
1814 Ga0207712_10529084
1815 Ga0207668_10076687
1816 Ga0207668_10194517
1817 Ga0207668_10199679
1818 Ga0207668_10253631
1819 Ga0207640_10019291
1820 Ga0207640_10037194
1821 Ga0207640_12050091
1822 Ga0207658_11365849
1823 Ga0207677_10071495
1824 Ga0207677_10241866
1825 Ga0207677_10411831
1826 Ga0207677_11903317
1827 Ga0207703_10430619
1828 Ga0207703_11442341
1829 Ga0207639_10019032
1830 Ga0207639_10234057
1831 Ga0207639_10251433
1832 Ga0207678_10120972
1833 Ga0207678_10968217
1834 Ga0207678_11571384
1835 Ga0207708_10048736
1836 Ga0207708_10128988
1837 Ga0207708_10300812
1838 Ga0207708_10328187
1839 Ga0207702_10009233
1840 Ga0207702_10082068
1841 Ga0207702_10088484
1842 Ga0207702_10179741
1843 Ga0207702_10180699
1844 Ga0207702_10781336
1845 Ga0207702_11396694
1846 Ga0207702_11688963
1847 Ga0207641_10195116
1848 Ga0207648_10022472
1849 Ga0207648_10116959
1850 Ga0207648_10452118
1851 Ga0207676_10248803
1852 Ga0207674_10100343
1853 Ga0207674_10127513
1854 Ga0207674_10529376
1855 Ga0207675_100005296
1856 Ga0207675_101435886
1857 Ga0207683_10057688
1858 Ga0207683_10606908
1859 Ga0207683_11152455
1860 Ga0207698_10012962
1861 Ga0207698_10330481
1862 Ga0207698_10334964
1863 Ga0207698_10484422
1864 Ga0207698_11261969
1865 Ga0207698_12186124
1866 Ga0209966_1044871
1867 Ga0209974_10215247
1868 Ga0207428_10000536
1869 Ga0207428_10069279
1870 Ga0207428_10098037
1871 Ga0207428_10224910
1872 Ga0207428_10623301
1873 Ga0207428_10743751
1874 Ga0207428_11316860
1875 Ga0268266_10135556
1876 Ga0268266_10429041
1877 Ga0268265_10343589
1878 Ga0268264_10106787
1879 Ga0268264_11241512
1880 Ga0265338_10718956
1881 Ga0307408_100131785
1882 Ga0307408_100967132
1883 Ga0307408_101394173
1884 Ga0307405_10276022
1885 Ga0307405_10719348
1886 Ga0307405_10723093
1887 Ga0307413_11188699
1888 Ga0307413_11371419
1889 Ga0307410_10242127
1890 Ga0307406_10112768
1891 Ga0307406_10328851
1892 Ga0307406_11188124
1893 Ga0307407_10180470
1894 Ga0307407_10569224
1895 Ga0307407_11718938
1896 Ga0307412_10845102
1897 Ga0307412_11086338
1898 Ga0307412_11203446
1899 Ga0307409_100022182
1900 Ga0307409_100156203
1901 Ga0307409_100297482
1902 Ga0307409_100941267
1903 Ga0307409_101794488
1904 Ga0307409_101952032
1905 Ga0307409_102615930
1906 Ga0307409_102833885
1907 Ga0307416_100057267
1908 Ga0307416_100237167
1909 Ga0307416_100297363
1910 Ga0307416_100407160
1911 Ga0307416_100813410
1912 Ga0307416_101019299
1913 Ga0307416_101228696
1914 Ga0307416_101398845
1915 Ga0307416_102087903
1916 Ga0307416_102771560
1917 Ga0307414_10681818
1918 Ga0307414_11601177
1919 Ga0307411_10281846
1920 Ga0307411_11556606
1921 Ga0307415_100061367
1922 Ga0307415_100306345
1923 Ga0307415_100934348
1924 Ga0307415_101312563
1925 Ga0307415_101705477
1926 Ga0307415_102380896
1927 Ga0373948_0071752
1928 Ga0373948_0182662
1929 Ga0373950_0091332
1930 Ga0373958_0145089
1931 Ga0373959_0012201
1932 Ga0373949_0059154
1933 Ga0373951_0044713
1934 Ga0373932_0329095
1935 Ga0373939_0238090
1936 Ga0373941_0237831
1937 Ga0373953_0091222
1938 Ga0373960_0040339
1939 Ga0373960_0067377
1940 Ga0373942_0007804
1941 Ga0373961_0032034
1942 Ga0373961_0207331
1943 Ga0373962_0262573
1944 Ga0373931_0626288
1945 Ga0373935_0192585
1946 Ga0373935_0639353
1947 Ga0373947_0061455
1948 Ga0373937_0365247
1949 Ga0373925_0017517
1950 Ga0395899_0002166
1951 Ga0395899_0010575
1952 Ga0395899_0043259
1953 Ga0395899_0171025
1954 Ga0395899_0657264
1955 Ga0395900_0001810
1956 Ga0395900_0007861
1957 Ga0395900_0013234
1958 Ga0395900_0062843
1959 Ga0395900_0129062
1960 Ga0395900_0130351
1961 Ga0395900_0132237
1962 Ga0395900_0132684
1963 Ga0395900_0149094
1964 Ga0395900_0189085
1965 Ga0395900_0242378
1966 Ga0395900_0446345
1967 Ga0395900_0484617
1968 Ga0395900_0720732
1969 Ga0395900_1607325
1970 Ga0395900_1848974
1971 Ga0395898_0057114
1972 Ga0395898_0070469
1973 Ga0395898_0082155
1974 Ga0395898_0091338
1975 Ga0395898_0112294
1976 Ga0395898_0604189
1977 Ga0395898_0865720
1978 Ga0395898_0937227
1979 Ga0395898_1273975
1980 Ga0395898_1555776
1981 Ga0395898_1792938
1982 Ga0395905_0007732
1983 Ga0395905_0010542
1984 Ga0395905_0090248
1985 Ga0395905_0113970
1986 Ga0395905_0148129
1987 Ga0395905_0224600
1988 Ga0395905_0451947
1989 Ga0436364_0416730
1990 Ga0436364_0611420
1991 Ga0436364_0659879
1992 Ga0395901_0018615
1993 Ga0395901_0061243
1994 Ga0395901_0064808
1995 Ga0395901_0089635
1996 Ga0395901_0093035
1997 Ga0395901_0104604
1998 Ga0395901_0122710
1999 Ga0395901_0186957
2000 Ga0395901_0234182
2001 Ga0395901_0248679
2002 Ga0395901_0716410
2003 Ga0395901_0733242
2004 Ga0395901_1026270
2005 Ga0395901_1538150
2006 Ga0395901_1654554
2007 Ga0436365_0195832
2008 Ga0436365_0367250
2009 Ga0436365_0385905
2010 Ga0436365_1133158
2011 Ga0436365_1669235
2012 Ga0436365_1802317
2013 Ga0436365_1920113
2014 Ga0436360_0674701
2015 Ga0436363_0322404
2016 Ga0436363_0408190
2017 Ga0436363_0624360
2018 Ga0436363_0955717
2019 Ga0436363_1085623
2020 Ga0436363_1485877
2021 Ga0436362_0003135
2022 Ga0436362_0069468
2023 Ga0436362_0198547
2024 Ga0439453_0003819
2025 Ga0451793_1459972
2026 Ga0451807_1432889
2027 Ga0451807_1472198
2028 Ga0451847_0782413
2029 Ga0451853_2175763
2030 Ga0439451_025740
2031 Ga0450906_011235
2032 Ga0450907_001078
2033 Ga0439440_0097816
2034 Ga0466969_0032309
2035 Ga0466969_0054971
2036 Ga0466969_0154358
2037 Ga0466965_0079752
2038 Ga0466965_0118828
2039 Ga0466966_0317478
2040 Ga0466961_0125535
2041 Ga0466961_0229502
2042 Ga0466961_0392657
2043 Ga0466963_0027918
2044 Ga0466963_0175458
2045 Ga0466963_0922500
2046 Ga0466964_0014291
2047 Ga0466964_0221158
2048 Ga0453684_0812183
2049 Ga0466971_0006309
2050 Ga0466971_0024945
2051 Ga0466971_0633027
2052 Ga0466968_0017802
2053 Ga0466968_0036721
2054 Ga0466968_0087584
2055 Ga0466968_0308651
2056 Ga0466970_0085331
2057 Ga0466970_0112832
2058 Ga0466970_0580447
2059 Ga0466957_0195134
2060 Ga0466957_0268700
2061 Ga0466959_0000677
2062 Ga0466959_0016170
2063 Ga0466959_0031483
2064 Ga0466959_0079121
2065 Ga0466959_0130422
2066 Ga0466959_0271352
2067 Ga0466959_0651846
2068 Ga0466959_0695842
2069 Ga0466959_0709433
2070 Ga0466959_1033965
2071 Ga0451576_2715654
2072 Ga0466958_0000585
2073 Ga0466958_0018505
2074 Ga0466958_0020335
2075 Ga0466958_0116538
2076 Ga0466958_0150289
2077 Ga0466958_0190789
2078 Ga0466958_0254323
2079 Ga0466958_0625464
2080 Ga0466967_0215943
2081 Ga0466967_0305546
2082 Ga0466967_0448128
2083 Ga0466967_0922561
2084 Ga0466967_1081094
2085 Ga0466967_1274728
2086 Ga0466967_1568351
2087 Ga0466967_1748569
2088 Ga0495603_0056156
2089 Ga0495603_0131900
2090 Ga0495603_0194951
2091 Ga0495629_0000475
2092 Ga0495629_0070603
2093 Ga0495629_0803587
2094 Ga0495629_1132558
2095 Ga0495641_0047602
2096 Ga0495641_0109335
2097 Ga0495641_0198551
2098 Ga0495651_0010178
2099 Ga0495650_0000049
2100 Ga0495580_0096515
2101 Ga0495582_0000428
2102 Ga0495582_0044405
2103 Ga0495639_0116340
2104 Ga0495584_0120451
2105 Ga0495584_0250395
2106 Ga0495594_0196346
2107 Ga0495594_0362418
2108 Ga0495594_0426607
2109 Ga0495596_0053215
2110 Ga0495596_0242961
2111 Ga0495596_0400714
2112 Ga0495607_0128311
2113 Ga0495607_0496892
2114 Ga0495608_0136463
2115 Ga0495608_0548382
2116 Ga0495616_0395023
2117 Ga0495620_0143740
2118 Ga0495628_0018963
2119 Ga0495628_0429453
2120 Ga0495628_0716485
2121 Ga0495628_1026703
2122 Ga0495630_0000167
2123 Ga0495630_1088466
2124 Ga0495631_0076375
2125 Ga0495644_0465705
2126 Ga0495663_0182511
2127 Ga0495666_0087134
2128 Ga0495666_0151107
2129 Ga0495642_0244915
2130 Ga0495642_0267284
2131 Ga0495652_0104299
2132 Ga0495652_0179040
2133 Ga0495652_0565641
2134 Ga0495654_0399729
2135 Ga0495640_0025304
2136 Ga0495640_0552553
2137 Ga0495587_0105755
2138 Ga0495598_0065751
2139 Ga0495645_0101951
2140 Ga0495645_0205092
2141 Ga0495667_0101927
2142 Ga0495667_0598708
2143 Ga0495656_0033155
2144 Ga0495656_0488176
2145 Ga0495668_0454881
2146 Ga0495634_0031844
2147 Ga0495635_0040049
2148 Ga0495635_0954271
2149 Ga0495659_0183263
2150 Ga0495588_0512919
2151 Ga0495657_0092304
2152 Ga0495599_0668750
2153 Ga0495647_0064412
2154 Ga0495647_0447593
2155 Ga0495647_0475770
2156 Ga0495658_0000235
2157 Ga0495658_0039208
2158 Ga0495658_0078056
2159 Ga0495658_0207997
2160 Ga0495658_0269018
2161 Ga0495658_0595633
2162 Ga0495658_0841463
2163 Ga0495613_0004377
2164 Ga0495613_0013199
2165 Ga0495613_0338556
2166 Ga0495624_0111145
2167 Ga0495624_0567949
2168 Ga0495670_0301943
2169 Ga0495600_0063480
2170 Ga0495581_0000968
2171 Ga0495581_0046940
2172 Ga0495604_0032511
2173 Ga0495604_0655103
2174 Ga0495636_0103171
2175 Ga0495674_0022180
2176 Ga0495674_0220966
2177 Ga0495674_0407644
2178 Ga0495676_0130480
2179 Ga0495676_0231131
2180 Ga0495676_0833406
2181 Ga0495680_0000756
2182 Ga0495675_0045596
2183 Ga0495677_0154259
2184 Ga0495593_0201465
2185 Ga0495602_0747381
2186 Ga0495614_0309592
2187 Ga0496100_0050717
2188 Ga0496100_0096750
2189 Ga0496100_0608525
2190 Ga0496101_0012572
2191 Ga0496101_0138953
2192 Ga0496101_0302292
2193 Ga0496101_0400309
2194 Ga0496102_0013081
2195 Ga0496102_0039679
2196 Ga0496102_0165168
2197 Ga0496102_0322250
2198 Ga0496102_0348226
2199 Ga0496102_0392035
2200 Ga0496102_0399200
2201 Ga0496102_0532686
2202 Ga0496102_0740833
2203 Ga0496103_0111121
2204 Ga0496103_0495566
2205 Ga0496104_0207888
2206 Ga0496104_1120698
2207 Ga0496106_0027485
2208 Ga0496106_0063570
2209 Ga0496106_0132612
2210 Ga0496106_0283665
2211 Ga0496106_0498401
2212 Ga0496106_0686425
2213 Ga0496107_0007203
2214 Ga0496107_0033250
2215 Ga0496107_0096720
2216 Ga0496107_0171053
2217 Ga0496107_0197570
2218 Ga0496107_0610482
2219 Ga0496107_0976972
2220 Ga0496108_0006589
2221 Ga0496108_0277669
2222 Ga0496108_1710708
2223 Ga0496109_0011552
2224 Ga0496109_0028340
2225 Ga0496109_0209611
2226 Ga0496109_0333881
2227 Ga0496110_0010128
2228 Ga0496110_0117839
2229 Ga0496110_0144594
2230 Ga0496110_0158595
2231 Ga0496110_0252441
2232 Ga0496110_0603398
2233 Ga0496110_0771969
2234 Ga0496110_1234994
2235 Ga0496110_1417220
2236 Ga0496111_0010576
2237 Ga0496111_0026031
2238 Ga0496111_0227843
2239 Ga0496111_0414182
2240 Ga0496111_1292572
2241 Ga0496112_0100312
2242 Ga0496112_0116542
2243 Ga0496112_0177394
2244 Ga0496112_0356335
2245 Ga0496112_0911023
2246 Ga0496113_0177469
2247 Ga0496113_0491556
2248 Ga0496113_0967938
2249 Ga0496113_1223249
2250 Ga0496113_1243579
2251 Ga0496114_0031573
2252 Ga0496114_0076881
2253 Ga0496114_0172338
2254 Ga0496115_0002214
2255 Ga0496115_0101487
2256 Ga0496115_0144377
2257 Ga0496115_0169163
2258 Ga0496115_1398479
2259 Ga0501031_0077805
2260 Ga0501031_0183747
2261 Ga0501032_0217480
2262 Ga0501034_0218959
2263 Ga0501036_0072210
2264 Ga0501036_0077903
2265 Ga0501036_0334481
2266 Ga0501037_0211673
2267 Ga0501038_0044240
2268 Ga0501038_0189046
2269 Ga0501039_0132808
2270 Ga0501039_0526995
2271 Ga0501039_0834197
2272 Ga0501039_1448440
2273 Ga0501040_0064153
2274 Ga0501041_0012244
2275 Ga0501041_0047093
2276 Ga0501041_0519181
2277 Ga0501041_0949783
2278 Ga0501042_0024843
2279 Ga0501042_0309881
2280 Ga0501043_0128070
2281 Ga0501043_1167521
2282 Ga0501046_0081127
2283 Ga0501048_0017242
2284 Ga0501048_0038744
2285 Ga0501048_0140351
2286 Ga0501048_0236963
2287 Ga0501067_0390872
2288 Ga0501068_0216631
2289 Ga0501069_0056499
2290 Ga0501070_0081253
2291 Ga0501071_0055897
2292 Ga0501071_0121562
2293 Ga0501071_0169884
2294 Ga0501071_0430750
2295 Ga0501072_0006757
2296 Ga0501072_0074262
2297 Ga0501072_0216980
2298 Ga0501072_0608085
2299 Ga0501073_0106160
2300 Ga0501073_0288561
2301 Ga0501074_0016181
2302 Ga0501075_0011259
2303 Ga0501075_0012937
2304 Ga0501075_0053429
2305 Ga0501075_0413753
2306 Ga0501075_0473213
2307 Ga0501075_1009385
2308 Ga0501075_1254860
2309 Ga0501076_0036450
2310 Ga0501076_0064843
2311 Ga0501076_0253221
2312 Ga0501077_0018389
2313 Ga0501077_0124011
2314 Ga0501077_0181174
2315 Ga0501077_0445082
2316 Ga0501079_0121501
2317 Ga0501079_0523371
2318 Ga0501079_0864215
2319 Ga0501079_0954779
2320 Ga0501079_1126652
2321 Ga0501080_0051940
2322 Ga0501080_0158254
2323 Ga0501081_0023532
2324 Ga0501081_0394097
2325 Ga0501083_0073839
2326 Ga0501035_0036798
2327 Ga0501044_0289768
2328 Ga0501045_0053518
2329 Ga0501045_0097123
2330 Ga0501045_0175015
2331 nmdc:mga03n38_251270_c1
2332 nmdc:mga03n38_82730_c1
2333 nmdc:mga00v17_170001_c1
2334 nmdc:mga00v17_371074_c1
2335 nmdc:mga0yw44_219456_c1
2336 nmdc:mga0yw44_473366_c1
2337 nmdc:mga0yw44_551496_c1
2338 nmdc:mga0yw44_61291_c1
2339 nmdc:mga0yw44_936259_c1
2340 nmdc:mga06z11_226538_c1
2341 nmdc:mga05p37_1197847_c1
2342 nmdc:mga05p37_13812_c1
2343 nmdc:mga05p37_1408173_c1
2344 nmdc:mga05p37_1462874_c1
2345 nmdc:mga05p37_1884527_c1
2346 nmdc:mga05p37_2685_c1
2347 nmdc:mga05p37_269214_c1
2348 nmdc:mga09592_127755_c1
2349 nmdc:mga09592_28274_c1
2350 nmdc:mga09592_569429_c1
2351 nmdc:mga09592_8889_c1
2352 nmdc:mga0qj67_1246651_c1
2353 nmdc:mga0qj67_13530_c1
2354 nmdc:mga0qj67_1419002_c1
2355 nmdc:mga0qj67_529272_c1
2356 nmdc:mga06r32_1204612_c1
2357 nmdc:mga06r32_326256_c1
2358 nmdc:mga06r32_559130_c1
2359 nmdc:mga06r32_5698_c1
2360 nmdc:mga06r32_661008_c1
2361 nmdc:mga08y16_1202603_c1
2362 nmdc:mga08y16_1364166_c1
2363 nmdc:mga08y16_159200_c1
2364 nmdc:mga08y16_22001_c1
2365 nmdc:mga08y16_476897_c1
2366 nmdc:mga08y16_622625_c1
2367 nmdc:mga08y16_88261_c1
2368 nmdc:mga08y16_974821_c1
2369 nmdc:mga0n895_10011_c1
2370 nmdc:mga0n895_1837573_c1
2371 nmdc:mga0n895_322599_c1
2372 nmdc:mga0n895_897143_c1
2373 nmdc:mga0n895_904777_c1
2374 nmdc:mga0n895_99579_c1
2375 nmdc:mga0rr50_524034_c1
2376 nmdc:mga0rr50_595429_c1
2377 nmdc:mga08x19_15269_c1
2378 nmdc:mga08x19_651112_c1
2379 nmdc:mga0a205_1142591_c1
2380 nmdc:mga0a205_1233060_c1
2381 nmdc:mga0a205_160249_c1
2382 nmdc:mga0a205_237655_c1
2383 nmdc:mga0a205_243520_c1
2384 nmdc:mga0a205_831769_c1
2385 Ga0495601_0003872
2386 Ga0495601_0167797
2387 Ga0495601_0402150
2388 Ga0495612_0000022
2389 Ga0495612_0065011
2390 Ga0495612_0071028
2391 Ga0495655_0047427
2392 Ga0495655_0126887
2393 Ga0495655_0151753
2394 Ga0495655_0153462
2395 Ga0495619_0000606
2396 Ga0495619_0046272
2397 Ga0495619_0062049
2398 Ga0495619_0176699
2399 Ga0501084_0013852
2400 Ga0501084_0043700
2401 Ga0501084_0119800
2402 Ga0501084_0257838
2403 Ga0501084_0637196
2404 Ga0590074_012592
2405 Ga0501082_0013960
2406 Ga0501082_0079638
2407 Ga0501082_0101756
2408 Ga0501082_0329144
2409 Ga0466962_0117552
2410 Ga0466962_0415026
2411 Ga0466962_0428101
2412 Ga0530510_0005579
2413 Ga0530510_0136811
2414 Ga0530510_0209859

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03795

YCII

YCII-related domain

26

142

0.72

Structural Annotation

Top 5 Hits

ID Description Score Start End
1s7i-assembly1.cif.gz_A-2 1.8 a crystal structure of a protein of unknown function pa1349 from pseudomonas aeruginosa 0.786 1 118
1s7i-assembly1.cif.gz_A-2 1.8 a crystal structure of a protein of unknown function pa1349 from pseudomonas aeruginosa 0.7517 1 118
3znj-assembly3.cif.gz_9 crystal structure of unliganded clcf from r.opacus 1cp in crystal form 1. 0.661 1 119
3zo7-assembly1.cif.gz_E crystal structure of clcfe27a with substrate 0.66 1 119
3zo7-assembly1.cif.gz_F crystal structure of clcfe27a with substrate 0.6557 1 119
ID Description Score Start End Superfamily
1s7iA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.786 1 118 3.30.70.1060
1s7iA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.7517 1 118 3.30.70.1060
1yfbA00 Mainly Beta;Ribbon;Pemi-like Protein 1; Chain: D; 0.7187 55 73 2.10.260.10
3znj100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.6418 1 119 3.30.70.1060
af_M9PHH0_754_932_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.6343 51 72 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A534G938-F1-model_v4 YCII-related domain-containing protein 0.9728 1 119
AF-A0A514X0U4-F1-model_v4 Uncharacterized protein 0.9712 1 119
AF-A0A534CTY2-F1-model_v4 Amidohydrolase-related domain-containing protein 0.971 1 119 GO:0016810
AF-I0HF34-F1-model_v4 YCII-related domain-containing protein 0.9621 1 119
AF-A0A6L5G7D1-F1-model_v4 YCII-related domain-containing protein 0.9573 1 117

Map