F491652
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1206 | 784 | 857 | 397 |
Family's Representative Sequence
| Representative Sequence | 3300053093|Ga0500651_0022868|Ga0500651_0022868_12_1433 |
| Length | 464 |
| Sequence | MFSSTTNRICPQARKITVIAAMNNRALTMLSANYLRARKNVSCDIPRPVGFGSSRASSTQRALMWRPEMSNFHYRWVIVAAGGLLGCVAIGGMFSLPVFLQPIARDTGWSVTGISSAMTIGFLAMAVTSMIWGTLSDRLGPLPVVLTGSVVLASSLXXXSLATSLVAFQFIFGLMVGGATAAIFAPMMATVTGWFDTHRSLAVSLVSAGMGMAPMTMSPLAAWLVSNHDWRTSMQIVALVVAAIMIPVSLLVRRAPALEGAPFAPSAEPVQAEMSRAQALRSPQFIILLLTNFFCCATHSGPIIHTVSYAISCGIPLVAAVTIYSVEGLAGMGGRIAFGLLGDRFGAKRVLVLLGFVFVRELGGFYTVAAVFGFIYAGTMPLYAVLARENFPLRMMGTVIGGTAMAGSLGMATGPLAGGLIYDAFASYAWLYIGSWIMGLGAFLIAMTFRPMPVAKAEPAPLPA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501122 | Ensifer yinggardensis WSM1721 | Isolate | Nodule |
| 2 | 2509276019 | Ensifer aridi TW10 | Isolate | Nodule |
| 3 | 2510065057 | Sinorhizobium meliloti WSM1022 | Isolate | Nodule |
| 4 | 2511231052 | Sinorhizobium meliloti AK58 | Isolate | Nodule |
| 5 | 2512047086 | Sinorhizobium arboris LMG 14919 | Isolate | Nodule |
| 6 | 2512875026 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 7 | 2513237086 | Sinorhizobium meliloti MVII-I | Isolate | Nodule |
| 8 | 2513237089 | Sinorhizobium medicae DI28 | Isolate | Nodule |
| 9 | 2513237091 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 10 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 11 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 12 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 13 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 14 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 15 | 2513237140 | Sinorhizobium meliloti GVPV12 | Isolate | Nodule |
| 16 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 17 | 2513237143 | Sinorhizobium meliloti Mlalz-1 | Isolate | Nodule |
| 18 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 19 | 2513237160 | Sinorhizobium medicae WSM244 | Isolate | Nodule |
| 20 | 2513237351 | Mesorhizobium alhagi CCNWXJ12-2 | Isolate | Nodule |
| 21 | 2515154107 | Sinorhizobium meliloti 4H41 | Isolate | Nodule |
| 22 | 2516653046 | Sinorhizobium meliloti BO21CC | Isolate | Nodule |
| 23 | 2517487022 | Sinorhizobium medicae WSM4191 | Isolate | Nodule |
| 24 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 25 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 26 | 2524023207 | Ensifer sp. USDA 6670 | Isolate | Nodule |
| 27 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 28 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 29 | 2551306084 | Sinorhizobium meliloti 5A14 | Isolate | Nodule |
| 30 | 2551306085 | Sinorhizobium meliloti AE608H | Isolate | Nodule |
| 31 | 2551306086 | Sinorhizobium meliloti AK11 | Isolate | Nodule |
| 32 | 2551306087 | Sinorhizobium meliloti A0643DD | Isolate | Nodule |
| 33 | 2551306089 | Sinorhizobium meliloti 1A42 | Isolate | Nodule |
| 34 | 2551306090 | Sinorhizobium meliloti A0641M | Isolate | Nodule |
| 35 | 2551306091 | Sinorhizobium meliloti C0431A | Isolate | Nodule |
| 36 | 2551306092 | Sinorhizobium meliloti AK75 | Isolate | Nodule |
| 37 | 2551306093 | Sinorhizobium meliloti C0438LL | Isolate | Nodule |
| 38 | 2558860100 | Sinorhizobium sp. PC2 | Isolate | Nodule |
| 39 | 2582581283 | Rhizobium sp. OK665 | Isolate | Rhizosphere |
| 40 | 2582581306 | Rhizobium sp. YR295 | Isolate | Rhizosphere |
| 41 | 2582581865 | Rhizobium sp. CF258 | Isolate | Rhizosphere |
| 42 | 2585427633 | Neorhizobium galegae bv. officinalis HAMBI 1141 | Isolate | Nodule |
| 43 | 2585428057 | Methylibium sp. YR605 | Isolate | Rhizosphere |
| 44 | 2585428058 | Methylibium sp. CF468 | Isolate | Rhizosphere |
| 45 | 2588253510 | Rhizobacter sp. OV335 | Isolate | Rhizosphere |
| 46 | 2599185239 | Burkholderia sp. NFACC38-1 | Isolate | Rhizoplane |
| 47 | 2599185240 | Burkholderia sp. NFPP32 | Isolate | Rhizoplane |
| 48 | 2599185352 | Sinorhizobium sp. NFACC03 | Isolate | Rhizoplane |
| 49 | 2599185355 | Burkholderia sp. NFACC33-1 | Isolate | Rhizoplane |
| 50 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 51 | 2643221544 | Pelomonas sp. Root1444 | Isolate | Unclassified |
| 52 | 2643221550 | Mesorhizobium sp. Root552 | Isolate | Unclassified |
| 53 | 2643221557 | Ensifer sp. Root558 | Isolate | Unclassified |
| 54 | 2643221585 | Pelomonas sp. Root662 | Isolate | Unclassified |
| 55 | 2643221592 | Rhizobacter sp. Root16D2 | Isolate | Unclassified |
| 56 | 2643221607 | Rhizobium sp. Root73 | Isolate | Unclassified |
| 57 | 2643221610 | Ensifer sp. Root74 | Isolate | Unclassified |
| 58 | 2643221618 | Ensifer sp. Root231 | Isolate | Unclassified |
| 59 | 2643221625 | Rhizobacter sp. Root29 | Isolate | Unclassified |
| 60 | 2643221626 | Ensifer sp. Root31 | Isolate | Unclassified |
| 61 | 2643221636 | Rhizobium sp. Root1204 | Isolate | Unclassified |
| 62 | 2643221637 | Rhizobium sp. Root1212 | Isolate | Unclassified |
| 63 | 2643221639 | Pelomonas sp. Root1217 | Isolate | Unclassified |
| 64 | 2643221646 | Pelomonas sp. Root1237 | Isolate | Unclassified |
| 65 | 2643221648 | Rhizobacter sp. Root1238 | Isolate | Unclassified |
| 66 | 2643221655 | Ensifer sp. Root1252 | Isolate | Unclassified |
| 67 | 2643221656 | Pelomonas sp. Root405 | Isolate | Unclassified |
| 68 | 2643221659 | Ensifer sp. Root127 | Isolate | Unclassified |
| 69 | 2643221668 | Ensifer sp. Root423 | Isolate | Unclassified |
| 70 | 2643221675 | Ensifer sp. Root1298 | Isolate | Unclassified |
| 71 | 2643221680 | Ensifer sp. Root1312 | Isolate | Unclassified |
| 72 | 2643221686 | Rhizobium sp. Root1334 | Isolate | Unclassified |
| 73 | 2643221688 | Rhizobium sp. Root482 | Isolate | Unclassified |
| 74 | 2643221698 | Ensifer sp. Root142 | Isolate | Unclassified |
| 75 | 2643221712 | Ensifer sp. Root258 | Isolate | Unclassified |
| 76 | 2643221718 | Rhizobium sp. Root268 | Isolate | Unclassified |
| 77 | 2643221723 | Ensifer sp. Root278 | Isolate | Unclassified |
| 78 | 2643221726 | Ensifer sp. Root954 | Isolate | Unclassified |
| 79 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 80 | 2675903129 | Burkholderia pyrrocinia NFIX32 | Isolate | Rhizoplane |
| 81 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 82 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 83 | 2738541317 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 84 | 2738541337 | Pelomonas sp. BT06 | Isolate | Unclassified |
| 85 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 86 | 2751185800 | Brucella pituitosa AA2 | Isolate | Unclassified |
| 87 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 88 | 2791355199 | |||
| 89 | 2802428858 | Sinorhizobium medicae M14-1 | Isolate | Nodule |
| 90 | 2802428859 | Sinorhizobium medicae SF3.41 | Isolate | Nodule |
| 91 | 2802428860 | Sinorhizobium medicae M19-1 | Isolate | Nodule |
| 92 | 2802428861 | Sinorhizobium medicae USDA1037 | Isolate | Nodule |
| 93 | 2802428862 | Sinorhizobium medicae M7-4 | Isolate | Nodule |
| 94 | 2802428863 | Sinorhizobium medicae M26-2 | Isolate | Nodule |
| 95 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 96 | 2818991452 | Burkholderia cepacia 561 | Isolate | Unclassified |
| 97 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 98 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 99 | 2841760612 | Bosea sp. Tri-49 | Isolate | Nodule |
| 100 | 2844104063 | Bosea sp. Tri-39 | Isolate | Nodule |
| 101 | 2844163670 | Ensifer sp. 1H6 | Isolate | Unclassified |
| 102 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 103 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 104 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 105 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 106 | 2850079185 | Ensifer aridi JNVU TP6 | Isolate | Unclassified |
| 107 | 2851182111 | Bosea sp. Tri-44 | Isolate | Nodule |
| 108 | 2851246043 | Bosea sp. Tri-54 | Isolate | Nodule |
| 109 | 2855825444 | Sinorhizobium meliloti CXM1-105 | Isolate | Nodule |
| 110 | 2855839649 | Sinorhizobium meliloti AK555 | Isolate | Unclassified |
| 111 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 112 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 113 | 2858800743 | Sinorhizobium meliloti AK170 | Isolate | Unclassified |
| 114 | 2863421361 | Burkholderia cenocepacia CACua-24 | Isolate | Rhizosphere |
| 115 | 2870068957 | Burkholderia sp. JP2-270 | Isolate | Unclassified |
| 116 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 117 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 118 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 119 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 120 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 121 | 2883291878 | Hypericibacter terrae R5913 | Isolate | Rhizosphere |
| 122 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 123 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 124 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 125 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 126 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 127 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 128 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 129 | 2904564687 | Burkholderia sp. 571 | Isolate | Unclassified |
| 130 | 2904571731 | Burkholderia cenocepacia 574 | Isolate | Unclassified |
| 131 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 132 | 2904699407 | |||
| 133 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 134 | 2906610324 | |||
| 135 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 136 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 137 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 138 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 139 | 2913295892 | Sinorhizobium kostiensis DSM 13372 | Isolate | Nodule |
| 140 | 2913308742 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 141 | 2915980308 | Sinorhizobium medicae USDA1149 | Isolate | Nodule |
| 142 | 2915986958 | Sinorhizobium meliloti USDA1659 | Isolate | Nodule |
| 143 | 2915993759 | Sinorhizobium meliloti USDA1336 | Isolate | Nodule |
| 144 | 2916000859 | Sinorhizobium meliloti USDA1562 | Isolate | Nodule |
| 145 | 2916007675 | Sinorhizobium meliloti USDA1289 | Isolate | Nodule |
| 146 | 2916014648 | Sinorhizobium meliloti USDA1583 | Isolate | Nodule |
| 147 | 2916021584 | Sinorhizobium meliloti USDA1550 | Isolate | Nodule |
| 148 | 2916028427 | Sinorhizobium meliloti USDA1613 | Isolate | Nodule |
| 149 | 2916035215 | Sinorhizobium meliloti 3011 | Isolate | Nodule |
| 150 | 2916041962 | Sinorhizobium meliloti USDA1795 | Isolate | Nodule |
| 151 | 2916048683 | Sinorhizobium meliloti USDA1796 | Isolate | Nodule |
| 152 | 2916055098 | Sinorhizobium meliloti USDA1770 | Isolate | Nodule |
| 153 | 2916061851 | Sinorhizobium medicae USDA1638 | Isolate | Nodule |
| 154 | 2916076590 | Sinorhizobium meliloti USDA1661 | Isolate | Nodule |
| 155 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 156 | 2920760137 | Ensifer psoraleae CCBAU 65732 | Isolate | Unclassified |
| 157 | 2920822456 | Ensifer sesbaniae CCBAU 65729 | Isolate | Unclassified |
| 158 | 2921201388 | Sinorhizobium meliloti USDA1692 | Isolate | Nodule |
| 159 | 2921208531 | Sinorhizobium meliloti USDA1660 | Isolate | Nodule |
| 160 | 2921237296 | Sinorhizobium meliloti USDA1508 | Isolate | Nodule |
| 161 | 2921244191 | Sinorhizobium meliloti 2119 | Isolate | Nodule |
| 162 | 2921250672 | Sinorhizobium medicae USDA1169 | Isolate | Nodule |
| 163 | 2921257292 | Sinorhizobium meliloti USDA1320 | Isolate | Nodule |
| 164 | 2921263974 | Sinorhizobium meliloti USDA1107 | Isolate | Nodule |
| 165 | 2921282425 | Sinorhizobium meliloti USDA1203 | Isolate | Nodule |
| 166 | 2921289301 | Sinorhizobium meliloti USDA1730 | Isolate | Nodule |
| 167 | 2921296804 | Sinorhizobium meliloti USDA1200 | Isolate | Nodule |
| 168 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 169 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 170 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 171 | 2922425934 | |||
| 172 | 2924144063 | Sinorhizobium meliloti USDA1022 | Isolate | Nodule |
| 173 | 2924150972 | Sinorhizobium meliloti USDA1700 | Isolate | Nodule |
| 174 | 2924158325 | Sinorhizobium meliloti USDA1146 | Isolate | Nodule |
| 175 | 2924165586 | Sinorhizobium meliloti USDA1264 | Isolate | Nodule |
| 176 | 2924172951 | Sinorhizobium meliloti USDA1626 | Isolate | Nodule |
| 177 | 2924179722 | Sinorhizobium meliloti USDA1280 | Isolate | Nodule |
| 178 | 2924186466 | Sinorhizobium meliloti USDA1389 | Isolate | Nodule |
| 179 | 2924193448 | Sinorhizobium meliloti USDA1158 | Isolate | Nodule |
| 180 | 2924200457 | Sinorhizobium meliloti USDA1007 | Isolate | Nodule |
| 181 | 2924207177 | Sinorhizobium meliloti USDA1589 | Isolate | Nodule |
| 182 | 2924214083 | Sinorhizobium meliloti USDA1702 | Isolate | Nodule |
| 183 | 2924221636 | Sinorhizobium meliloti USDA1416 | Isolate | Nodule |
| 184 | 2924228884 | Sinorhizobium meliloti USDA1581 | Isolate | Nodule |
| 185 | 2928157003 | Burkholderia ambifaria 566 | Isolate | Unclassified |
| 186 | 2928163908 | Burkholderia sp. 567 | Isolate | Unclassified |
| 187 | 2928170801 | Burkholderia sp. 572 | Isolate | Unclassified |
| 188 | 2928536128 | Burkholderia sola 565 | Isolate | Unclassified |
| 189 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 190 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 191 | 2936996657 | Sinorhizobium meliloti USDA1025 | Isolate | Nodule |
| 192 | 2937002841 | Sinorhizobium meliloti USDA1006 | Isolate | Nodule |
| 193 | 2937009748 | Sinorhizobium meliloti USDA1162 | Isolate | Nodule |
| 194 | 2937016420 | Sinorhizobium meliloti USDA1027 | Isolate | Nodule |
| 195 | 2937023124 | Sinorhizobium meliloti USDA1335 | Isolate | Nodule |
| 196 | 2937029754 | Sinorhizobium medicae USDA1624 | Isolate | Nodule |
| 197 | 2937036028 | Sinorhizobium medicae USDA1608 | Isolate | Nodule |
| 198 | 2937042894 | Sinorhizobium meliloti USDA1687 | Isolate | Nodule |
| 199 | 2937049772 | Sinorhizobium meliloti USDA1691 | Isolate | Nodule |
| 200 | 2937056579 | Sinorhizobium meliloti USDA1357 | Isolate | Nodule |
| 201 | 2937063883 | Sinorhizobium meliloti USDA1808 | Isolate | Nodule |
| 202 | 2937071275 | Sinorhizobium meliloti USDA1623 | Isolate | Nodule |
| 203 | 2937078374 | Sinorhizobium medicae USDA1004 | Isolate | Nodule |
| 204 | 2937084907 | Sinorhizobium medicae USDA1664 | Isolate | Nodule |
| 205 | 2937091812 | Sinorhizobium meliloti USDA1221 | Isolate | Nodule |
| 206 | 2937098957 | Sinorhizobium meliloti USDA1519 | Isolate | Nodule |
| 207 | 2937106411 | Sinorhizobium meliloti USDA1214 | Isolate | Nodule |
| 208 | 2937113482 | Sinorhizobium meliloti USDA1180 | Isolate | Nodule |
| 209 | 2937119839 | Sinorhizobium meliloti USDA1790 | Isolate | Nodule |
| 210 | 2937126314 | Sinorhizobium meliloti USDA1612 | Isolate | Nodule |
| 211 | 2941499720 | Ensifer sp. 4252 | Isolate | Rhizosphere |
| 212 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 213 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 214 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 215 | 2957375807 | Sinorhizobium medicae USDA1632 | Isolate | Nodule |
| 216 | 2957382221 | Sinorhizobium meliloti USDA1919 | Isolate | Nodule |
| 217 | 2957388812 | Sinorhizobium meliloti USDA1195 | Isolate | Nodule |
| 218 | 2957395598 | Sinorhizobium meliloti USDA1237 | Isolate | Nodule |
| 219 | 2957402308 | Sinorhizobium meliloti USDA1794 | Isolate | Nodule |
| 220 | 2957408893 | Sinorhizobium meliloti USDA1163 | Isolate | Nodule |
| 221 | 2957415311 | Sinorhizobium meliloti USDA1724 | Isolate | Nodule |
| 222 | 2957422303 | Sinorhizobium meliloti USDA1497 | Isolate | Nodule |
| 223 | 2957430029 | Sinorhizobium meliloti USDA1590 | Isolate | Nodule |
| 224 | 2957437181 | Sinorhizobium medicae USDA1694 | Isolate | Nodule |
| 225 | 2957443900 | Sinorhizobium meliloti USDA1734 | Isolate | Nodule |
| 226 | 2957450854 | Sinorhizobium meliloti USDA1655 | Isolate | Nodule |
| 227 | 2957457609 | Sinorhizobium meliloti USDA1751 | Isolate | Nodule |
| 228 | 2957464669 | Sinorhizobium meliloti USDA1520 | Isolate | Nodule |
| 229 | 2957471148 | Sinorhizobium meliloti USDA1204 | Isolate | Nodule |
| 230 | 2957478035 | Sinorhizobium meliloti USDA1171 | Isolate | Nodule |
| 231 | 2957484790 | Sinorhizobium meliloti USDA1464 | Isolate | Nodule |
| 232 | 2957491536 | Sinorhizobium meliloti USDA1804 | Isolate | Nodule |
| 233 | 2957498199 | Sinorhizobium meliloti USDA1561 | Isolate | Nodule |
| 234 | 2957505466 | Sinorhizobium meliloti USDA1696 | Isolate | Nodule |
| 235 | 2960584000 | Sinorhizobium meliloti USDA1530 | Isolate | Nodule |
| 236 | 2960591022 | Sinorhizobium medicae USDA1066 | Isolate | Nodule |
| 237 | 2960597568 | Sinorhizobium meliloti 3085 | Isolate | Nodule |
| 238 | 2960603979 | Sinorhizobium meliloti USDA1580 | Isolate | Nodule |
| 239 | 2960610863 | Sinorhizobium meliloti USDA1792 | Isolate | Nodule |
| 240 | 2960617483 | Sinorhizobium meliloti USDA1719 | Isolate | Nodule |
| 241 | 2960624210 | Sinorhizobium meliloti USDA1415 | Isolate | Nodule |
| 242 | 2960631154 | Sinorhizobium medicae USDA1629 | Isolate | Nodule |
| 243 | 2960637947 | Sinorhizobium meliloti USDA1202 | Isolate | Nodule |
| 244 | 2960645483 | Sinorhizobium meliloti USDA1703 | Isolate | Nodule |
| 245 | 2960652885 | Sinorhizobium meliloti USDA1199 | Isolate | Nodule |
| 246 | 2960660292 | Sinorhizobium meliloti USDA1883 | Isolate | Nodule |
| 247 | 2960667422 | Sinorhizobium meliloti USDA1170 | Isolate | Nodule |
| 248 | 2960674078 | Sinorhizobium meliloti USDA1666 | Isolate | Nodule |
| 249 | 2960680706 | Sinorhizobium medicae USDA1150 | Isolate | Nodule |
| 250 | 2960687367 | Sinorhizobium meliloti USDA1462 | Isolate | Nodule |
| 251 | 2960693952 | Sinorhizobium medicae USDA1630 | Isolate | Nodule |
| 252 | 2964607997 | Sinorhizobium meliloti USDA1212 | Isolate | Nodule |
| 253 | 2964615318 | Sinorhizobium meliloti USDA1248 | Isolate | Nodule |
| 254 | 2964621998 | Sinorhizobium meliloti USDA1235 | Isolate | Nodule |
| 255 | 2964628898 | Sinorhizobium meliloti USDA1191 | Isolate | Nodule |
| 256 | 2964636051 | Sinorhizobium meliloti USDA1594 | Isolate | Nodule |
| 257 | 2964643177 | Sinorhizobium meliloti USDA1760 | Isolate | Nodule |
| 258 | 2964649959 | Sinorhizobium meliloti USDA1591 | Isolate | Nodule |
| 259 | 2964656573 | Sinorhizobium meliloti USDA1308 | Isolate | Nodule |
| 260 | 2964663802 | Sinorhizobium meliloti USDA1688 | Isolate | Nodule |
| 261 | 2964670856 | Sinorhizobium meliloti USDA1211 | Isolate | Nodule |
| 262 | 2964678106 | Sinorhizobium meliloti USDA1210 | Isolate | Nodule |
| 263 | 2964685014 | Sinorhizobium meliloti USDA1232 | Isolate | Nodule |
| 264 | 2964691889 | Sinorhizobium meliloti USDA1379 | Isolate | Nodule |
| 265 | 2964698721 | Sinorhizobium meliloti USDA1656 | Isolate | Nodule |
| 266 | 2964705432 | Sinorhizobium meliloti USDA1614 | Isolate | Nodule |
| 267 | 2964712639 | Sinorhizobium meliloti USDA1616 | Isolate | Nodule |
| 268 | 2964719344 | Sinorhizobium meliloti USDA1456 | Isolate | Nodule |
| 269 | 2967664464 | Sinorhizobium meliloti USDA1208 | Isolate | Nodule |
| 270 | 2967671571 | Sinorhizobium meliloti USDA1496 | Isolate | Nodule |
| 271 | 2967678726 | Sinorhizobium meliloti USDA1467 | Isolate | Nodule |
| 272 | 2967686174 | Sinorhizobium medicae USDA1641 | Isolate | Nodule |
| 273 | 2967693043 | Sinorhizobium meliloti USDA1183 | Isolate | Nodule |
| 274 | 2967699805 | Sinorhizobium meliloti USDA1695 | Isolate | Nodule |
| 275 | 2967706974 | Sinorhizobium meliloti USDA1206 | Isolate | Nodule |
| 276 | 2967714385 | Sinorhizobium meliloti USDA1023 | Isolate | Nodule |
| 277 | 2967721400 | Sinorhizobium meliloti USDA1742 | Isolate | Nodule |
| 278 | 2967728569 | Sinorhizobium medicae USDA1607 | Isolate | Nodule |
| 279 | 2967735183 | Sinorhizobium meliloti USDA1710 | Isolate | Nodule |
| 280 | 2967742019 | Sinorhizobium meliloti USDA1676 | Isolate | Nodule |
| 281 | 2967748971 | Sinorhizobium meliloti USDA1024A | Isolate | Nodule |
| 282 | 2967755722 | Sinorhizobium meliloti USDA1302 | Isolate | Nodule |
| 283 | 2967762386 | Sinorhizobium meliloti USDA1397 | Isolate | Nodule |
| 284 | 2967769361 | Sinorhizobium meliloti USDA1005 | Isolate | Nodule |
| 285 | 2967775926 | Sinorhizobium meliloti USDA1678 | Isolate | Nodule |
| 286 | 2970026789 | Sinorhizobium medicae USDA1611 | Isolate | Nodule |
| 287 | 2970033650 | Sinorhizobium meliloti USDA1565 | Isolate | Nodule |
| 288 | 2970040964 | Sinorhizobium meliloti USDA1501 | Isolate | Nodule |
| 289 | 2970047711 | Sinorhizobium meliloti USDA1793 | Isolate | Nodule |
| 290 | 2970054988 | Sinorhizobium meliloti USDA1031 | Isolate | Nodule |
| 291 | 2970061556 | Sinorhizobium meliloti USDA1810 | Isolate | Nodule |
| 292 | 2970068827 | Sinorhizobium meliloti USDA1227 | Isolate | Nodule |
| 293 | 2970076120 | Sinorhizobium meliloti USDA1706 | Isolate | Nodule |
| 294 | 2970082768 | Sinorhizobium meliloti USDA1803 | Isolate | Nodule |
| 295 | 2970088815 | Sinorhizobium meliloti USDA1819 | Isolate | Nodule |
| 296 | 2970095765 | Sinorhizobium meliloti USDA1225 | Isolate | Nodule |
| 297 | 2970102677 | Sinorhizobium meliloti USDA1325 | Isolate | Nodule |
| 298 | 2970109326 | Sinorhizobium meliloti USDA1186 | Isolate | Nodule |
| 299 | 2970116247 | Sinorhizobium meliloti USDA1566 | Isolate | Nodule |
| 300 | 2970122695 | Sinorhizobium medicae 3082 | Isolate | Nodule |
| 301 | 2970129317 | Sinorhizobium meliloti USDA1008 | Isolate | Nodule |
| 302 | 2970136068 | Sinorhizobium meliloti USDA1699 | Isolate | Nodule |
| 303 | 2970143518 | Sinorhizobium medicae USDA1652 | Isolate | Nodule |
| 304 | 2970149975 | Sinorhizobium meliloti USDA1215 | Isolate | Nodule |
| 305 | 2970156795 | Sinorhizobium meliloti USDA1491 | Isolate | Nodule |
| 306 | 2970164137 | Sinorhizobium meliloti USDA1018 | Isolate | Nodule |
| 307 | 2970170962 | Sinorhizobium meliloti USDA1571 | Isolate | Nodule |
| 308 | 2970177841 | Sinorhizobium meliloti USDA1533 | Isolate | Nodule |
| 309 | 2970184632 | Sinorhizobium meliloti USDA1593 | Isolate | Nodule |
| 310 | 2970191845 | Sinorhizobium meliloti USDA1187 | Isolate | Nodule |
| 311 | 2977516862 | Sinorhizobium meliloti USDA1791 | Isolate | Nodule |
| 312 | 2977523885 | Sinorhizobium meliloti USDA1777 | Isolate | Nodule |
| 313 | 2977530762 | Sinorhizobium medicae USDA1606 | Isolate | Nodule |
| 314 | 2977537788 | Sinorhizobium meliloti USDA1184 | Isolate | Nodule |
| 315 | 2977544691 | Sinorhizobium medicae USDA1631 | Isolate | Nodule |
| 316 | 2977551784 | Sinorhizobium meliloti USDA1035 | Isolate | Nodule |
| 317 | 2977558990 | Sinorhizobium meliloti USDA1222 | Isolate | Nodule |
| 318 | 2977565890 | Sinorhizobium meliloti USDA1617 | Isolate | Nodule |
| 319 | 2977572785 | Sinorhizobium meliloti USDA1767 | Isolate | Nodule |
| 320 | 2977579622 | Sinorhizobium meliloti USDA1161 | Isolate | Nodule |
| 321 | 2981990288 | Burkholderia sp. PvR073 | Isolate | Rhizosphere |
| 322 | 2989349275 | Shinella kummerowiae CCBAU 25048 | Isolate | Unclassified |
| 323 | 2996336353 | Mesorhizobium sp. YM1C-6-2 | Isolate | Unclassified |
| 324 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 325 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 326 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 327 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 328 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 329 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 330 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 331 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 332 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 333 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 334 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 335 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 336 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 337 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 338 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 339 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 340 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 341 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 342 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 343 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 344 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 345 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 346 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 347 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 348 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 349 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 350 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 351 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 352 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 353 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 354 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 355 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 356 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 357 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 358 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 359 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 360 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 361 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 362 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 363 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 364 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 365 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 366 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 367 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 368 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 369 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 370 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 371 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 372 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 373 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 374 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 375 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 376 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 377 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 378 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 379 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 380 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 381 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 382 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 383 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 384 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 385 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 386 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 387 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 388 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 389 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 390 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 391 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 392 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 393 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 394 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 395 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 396 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 397 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 398 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 399 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 400 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 401 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 402 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 403 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 404 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 405 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 406 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 407 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 408 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 409 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 410 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 411 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 412 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 413 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 414 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 415 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 416 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 417 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 418 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 419 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 420 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 421 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 422 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 423 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 424 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 425 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 426 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 427 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 428 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 429 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 430 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 431 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 432 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 433 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 434 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 435 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 436 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 437 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 438 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 439 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 440 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 441 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 442 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 443 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 444 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 445 | 3300022739 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules | Metagenome | Nodule |
| 446 | 3300022740 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules | Metagenome | Nodule |
| 447 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 448 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 449 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 450 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 451 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 452 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 453 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 454 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 455 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 456 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 457 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 458 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 459 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 460 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 461 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 462 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 463 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 464 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 465 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 466 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 467 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 468 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 469 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 470 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 471 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 472 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 473 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 474 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 475 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 476 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 477 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 478 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 479 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 480 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 481 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 482 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 483 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 484 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 485 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 486 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 487 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 488 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 489 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 490 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 491 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 492 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 493 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 494 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 495 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 496 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 497 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 498 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 499 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 500 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 501 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 502 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 503 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 504 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 505 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 506 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 507 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 508 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 509 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 510 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 511 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 512 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 513 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 514 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 515 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 516 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 517 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 518 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 519 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 520 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 521 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 522 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 523 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 524 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 525 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 526 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 527 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 528 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 529 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 530 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 531 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 532 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 533 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 534 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 535 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 536 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 537 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 538 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 539 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 540 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 541 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 542 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 543 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 544 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 545 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 546 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 547 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 548 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 549 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 550 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 551 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 552 | 3300031967 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules | Metagenome | Nodule |
| 553 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 554 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 555 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 556 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 557 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 558 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 559 | 3300033430 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules | Metagenome | Nodule |
| 560 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 561 | 3300033464 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules | Metagenome | Nodule |
| 562 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 563 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 564 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 565 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 566 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 567 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 568 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 569 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 570 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 571 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 572 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 573 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 574 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 575 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 576 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 577 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 578 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 579 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 580 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 581 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 582 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 583 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 584 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 585 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 586 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 587 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 588 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 589 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 590 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 591 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 592 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 593 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 594 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 595 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 596 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 597 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 598 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 599 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 600 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 601 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 602 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 603 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 604 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 605 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 606 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 607 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 608 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 609 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 610 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 611 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 612 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 613 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 614 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 615 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 616 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 617 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 618 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 619 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 620 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 621 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 622 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 623 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 624 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 625 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 626 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 627 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 628 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 629 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 630 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 631 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 632 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 633 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 634 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 635 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 636 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 637 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 638 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 639 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 640 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 641 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 642 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 643 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 644 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 645 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 646 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 647 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 648 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 649 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 650 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 651 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 652 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 653 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 654 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 655 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 656 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 657 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 658 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 659 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 660 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 661 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 662 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 663 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 664 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 665 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 666 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 667 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 668 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 669 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 670 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 671 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 672 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 673 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 674 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 675 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 676 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 677 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 678 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 679 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 680 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 681 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 682 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 683 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 684 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 685 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 686 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 687 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 688 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 689 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 690 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 691 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 692 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 693 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 694 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 695 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 696 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 697 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 698 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 699 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 700 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 701 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 702 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 703 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 704 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 705 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 706 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 707 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 708 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 709 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 710 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 711 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 712 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 713 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 714 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 715 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 716 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 717 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 718 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 719 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 720 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 721 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 722 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 723 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 724 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 725 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 726 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 727 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 728 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 729 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 730 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 731 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 732 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 733 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 734 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 735 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 736 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 737 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 738 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 739 | 3300053115 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere | Metagenome | Endosphere |
| 740 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 741 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 742 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 743 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 744 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 745 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 746 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 747 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 748 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 749 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 750 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 751 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 752 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 753 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 754 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 755 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 756 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 757 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 758 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 759 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 760 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 761 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 762 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 763 | 648276728 | Sinorhizobium meliloti BL225C | Isolate | Nodule |
| 764 | 8003992118 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 765 | 8003999396 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 766 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 767 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 768 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 769 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 770 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 771 | 8018845410 | Burkholderia reimsis BE51 | Isolate | Rhizosphere |
| 772 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 773 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 774 | 8020938398 | Burkholderia sp. BE12 | Isolate | Rhizosphere |
| 775 | 8020953355 | Burkholderia sp. BE24 | Isolate | Rhizosphere |
| 776 | 8021120328 | Burkholderia sp. LS-044 | Isolate | Rhizosphere |
| 777 | 8039098773 | Burkholderia multivorans MSMB612WGS | Isolate | Unclassified |
| 778 | 8054558443 | Rhizobium alarense TRM95111 | Isolate | Nodule |
| 779 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 780 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 781 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 782 | 8056875544 | Rhizobium halophilum TRM95001 | Isolate | Rhizosphere |
| 783 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
| 784 | 8057529695 | Bosea vestrisii A18/4-2 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 71.13 |
| Metatranscriptomes | 0.17 |
| Isolates | 28.7 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 12.35 |
| Nodule | 22.47 |
| Rhizoplane | 4.15 |
| Rhizosphere | 47.6 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 13.43 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10005337 | 3300001989 | Bacteria | 4893 |
| 2 | JGI25152J39213_1001786 | 3300002773 | Bacteria | 8753 |
| 3 | JGI25406J46586_10000047 | 3300003203 | Bacteria | 54770 |
| 4 | JGI25406J46586_10010338 | 3300003203 | Bacteria | 4143 |
| 5 | JGI25153J46596_10001087 | 3300003215 | Bacteria | 16573 |
| 6 | JGI25153J46596_10004173 | 3300003215 | Bacteria | 7840 |
| 7 | JGI25153J46596_10006828 | 3300003215 | Bacteria | 5710 |
| 8 | rootH1_10001161 | 3300003316 | Bacteria | 9871 |
| 9 | rootL2_10019891 | 3300003322 | Bacteria | 13677 |
| 10 | rootL2_10034669 | 3300003322 | Bacteria | 6142 |
| 11 | rootH1_10034711 | 3300003323 | Bacteria | 5777 |
| 12 | rootH1_10130802 | 3300003323 | Bacteria | 3494 |
| 13 | JGI25160J50197_1024513 | 3300003354 | Bacteria | 1710 |
| 14 | JGI25404J52841_10009459 | 3300003659 | Bacteria | 2084 |
| 15 | JGI25404J52841_10015804 | 3300003659 | Bacteria | 1637 |
| 16 | JGI25404J52841_10019938 | 3300003659 | Bacteria | 1453 |
| 17 | Ga0055532_1000336 | 3300003758 | Bacteria | 25720 |
| 18 | Ga0055532_1000487 | 3300003758 | Bacteria | 17732 |
| 19 | Ga0055532_1000625 | 3300003758 | Bacteria | 13853 |
| 20 | Ga0055527_1000433 | 3300003760 | Bacteria | 16809 |
| 21 | Ga0055535_1000645 | 3300003761 | Bacteria | 27787 |
| 22 | Ga0055535_1001075 | 3300003761 | Bacteria | 16809 |
| 23 | Ga0055542_1000667 | 3300003762 | Bacteria | 27814 |
| 24 | Ga0055529_1000485 | 3300003763 | Bacteria | 37024 |
| 25 | Ga0055536_1000494 | 3300003781 | Bacteria | 27289 |
| 26 | Ga0055530_10006225 | 3300003791 | Bacteria | 5387 |
| 27 | Ga0055531_10000007 | 3300003794 | Bacteria | 225289 |
| 28 | Ga0055531_10000751 | 3300003794 | Bacteria | 27289 |
| 29 | Ga0058692_1007459 | 3300003856 | Bacteria | 2900 |
| 30 | Ga0065165_1001016 | 3300005262 | Bacteria | 34080 |
| 31 | Ga0065165_1003660 | 3300005262 | Bacteria | 10496 |
| 32 | Ga0065707_10090722 | 3300005295 | Bacteria | 4079 |
| 33 | Ga0070683_100003949 | 3300005329 | Bacteria | 12137 |
| 34 | Ga0070683_100008752 | 3300005329 | Bacteria | 8604 |
| 35 | Ga0070670_100069354 | 3300005331 | Bacteria | 3026 |
| 36 | Ga0070670_100131893 | 3300005331 | Bacteria | 2158 |
| 37 | Ga0070680_100088646 | 3300005336 | Bacteria | 2560 |
| 38 | Ga0068868_100089535 | 3300005338 | Bacteria | 2477 |
| 39 | Ga0068868_100254042 | 3300005338 | Bacteria | 1480 |
| 40 | Ga0070660_100004626 | 3300005339 | Bacteria | 9527 |
| 41 | Ga0070661_100011984 | 3300005344 | Bacteria | 6057 |
| 42 | Ga0070668_100049968 | 3300005347 | Bacteria | 3218 |
| 43 | Ga0070669_100016208 | 3300005353 | Bacteria | 5315 |
| 44 | Ga0070671_100006532 | 3300005355 | Bacteria | 9322 |
| 45 | Ga0070671_100130488 | 3300005355 | Bacteria | 2117 |
| 46 | Ga0070674_100037323 | 3300005356 | Bacteria | 3267 |
| 47 | Ga0070673_100005015 | 3300005364 | Bacteria | 8447 |
| 48 | Ga0070688_100062477 | 3300005365 | Bacteria | 2358 |
| 49 | Ga0070688_100112071 | 3300005365 | Bacteria | 1815 |
| 50 | Ga0070659_100000096 | 3300005366 | Bacteria | 66336 |
| 51 | Ga0070659_100255603 | 3300005366 | Bacteria | 1453 |
| 52 | Ga0070667_100000046 | 3300005367 | Bacteria | 162942 |
| 53 | Ga0070709_10082900 | 3300005434 | Bacteria | 2096 |
| 54 | Ga0070709_10121061 | 3300005434 | Bacteria | 1774 |
| 55 | Ga0070714_100015299 | 3300005435 | Bacteria | 6173 |
| 56 | Ga0070714_100097495 | 3300005435 | Bacteria | 2585 |
| 57 | Ga0070713_100043527 | 3300005436 | Bacteria | 3671 |
| 58 | Ga0070713_100047166 | 3300005436 | Bacteria | 3539 |
| 59 | Ga0070710_10001502 | 3300005437 | Bacteria | 10994 |
| 60 | Ga0070711_100016359 | 3300005439 | Bacteria | 4709 |
| 61 | Ga0070711_100097355 | 3300005439 | Bacteria | 2133 |
| 62 | Ga0070694_100061484 | 3300005444 | Bacteria | 2563 |
| 63 | Ga0070663_100007285 | 3300005455 | Bacteria | 6725 |
| 64 | Ga0070663_100049819 | 3300005455 | Bacteria | 2976 |
| 65 | Ga0070678_100032249 | 3300005456 | Bacteria | 3624 |
| 66 | Ga0070678_100064892 | 3300005456 | Bacteria | 2708 |
| 67 | Ga0070681_10018623 | 3300005458 | Bacteria | 6944 |
| 68 | Ga0070681_10019757 | 3300005458 | Bacteria | 6747 |
| 69 | Ga0070681_10082606 | 3300005458 | Bacteria | 3167 |
| 70 | Ga0070681_10092243 | 3300005458 | Bacteria | 2978 |
| 71 | Ga0068867_100000114 | 3300005459 | Bacteria | 51011 |
| 72 | Ga0068867_100148148 | 3300005459 | Bacteria | 1841 |
| 73 | Ga0070706_100053290 | 3300005467 | Bacteria | 3733 |
| 74 | Ga0070707_100192144 | 3300005468 | Bacteria | 1990 |
| 75 | Ga0070679_100240777 | 3300005530 | Bacteria | 1766 |
| 76 | Ga0070684_100004025 | 3300005535 | Bacteria | 11121 |
| 77 | Ga0070684_100119270 | 3300005535 | Bacteria | 2372 |
| 78 | Ga0068853_100006217 | 3300005539 | Bacteria | 9458 |
| 79 | Ga0068853_100157379 | 3300005539 | Bacteria | 2048 |
| 80 | Ga0070672_100002864 | 3300005543 | Bacteria | 11080 |
| 81 | Ga0070672_100215073 | 3300005543 | Bacteria | 1611 |
| 82 | Ga0070672_100253054 | 3300005543 | Bacteria | 1484 |
| 83 | Ga0070696_100024364 | 3300005546 | Bacteria | 4113 |
| 84 | Ga0070665_100096284 | 3300005548 | Bacteria | 2965 |
| 85 | Ga0068855_100025743 | 3300005563 | Bacteria | 7035 |
| 86 | Ga0068855_100030991 | 3300005563 | Bacteria | 6391 |
| 87 | Ga0068855_100112346 | 3300005563 | Bacteria | 3126 |
| 88 | Ga0068857_100066630 | 3300005577 | Bacteria | 3204 |
| 89 | Ga0068857_100182640 | 3300005577 | Bacteria | 1909 |
| 90 | Ga0068854_100049351 | 3300005578 | Bacteria | 3006 |
| 91 | Ga0068854_100112613 | 3300005578 | Bacteria | 2055 |
| 92 | Ga0068856_100001367 | 3300005614 | Bacteria | 25662 |
| 93 | Ga0068856_100001863 | 3300005614 | Bacteria | 22015 |
| 94 | Ga0068856_100092848 | 3300005614 | Bacteria | 3003 |
| 95 | Ga0068852_100018555 | 3300005616 | Bacteria | 5483 |
| 96 | Ga0068852_100110232 | 3300005616 | Bacteria | 2501 |
| 97 | Ga0068859_100334942 | 3300005617 | Bacteria | 1607 |
| 98 | Ga0068861_100044771 | 3300005719 | Bacteria | 3329 |
| 99 | Ga0068861_100066781 | 3300005719 | Bacteria | 2774 |
| 100 | Ga0068861_100087742 | 3300005719 | Bacteria | 2448 |
| 101 | Ga0068861_100161430 | 3300005719 | Bacteria | 1849 |
| 102 | Ga0068870_10006240 | 3300005840 | Bacteria | 5245 |
| 103 | Ga0068863_100007146 | 3300005841 | Bacteria | 10954 |
| 104 | Ga0068863_100109795 | 3300005841 | Bacteria | 2626 |
| 105 | Ga0068863_100338906 | 3300005841 | Bacteria | 1463 |
| 106 | Ga0068860_100081526 | 3300005843 | Bacteria | 3076 |
| 107 | Ga0068860_100120072 | 3300005843 | Bacteria | 2517 |
| 108 | Ga0068860_100132747 | 3300005843 | Bacteria | 2390 |
| 109 | Ga0068862_100022007 | 3300005844 | Bacteria | 5332 |
| 110 | Ga0081455_10001796 | 3300005937 | Bacteria | 25915 |
| 111 | Ga0081455_10007694 | 3300005937 | Bacteria | 11311 |
| 112 | Ga0081455_10021438 | 3300005937 | Bacteria | 6060 |
| 113 | Ga0081455_10162057 | 3300005937 | Bacteria | 1713 |
| 114 | Ga0081540_1000430 | 3300005983 | Bacteria | 41337 |
| 115 | Ga0081540_1003122 | 3300005983 | Bacteria | 13262 |
| 116 | Ga0081540_1003695 | 3300005983 | Bacteria | 11992 |
| 117 | Ga0081540_1006483 | 3300005983 | Bacteria | 8514 |
| 118 | Ga0081540_1010556 | 3300005983 | Bacteria | 6240 |
| 119 | Ga0081540_1029244 | 3300005983 | Bacteria | 3075 |
| 120 | Ga0081539_10000140 | 3300005985 | Bacteria | 166746 |
| 121 | Ga0081539_10001457 | 3300005985 | Bacteria | 40268 |
| 122 | Ga0081539_10055593 | 3300005985 | Bacteria | 2201 |
| 123 | Ga0070717_10064914 | 3300006028 | Bacteria | 3033 |
| 124 | Ga0070717_10186287 | 3300006028 | Bacteria | 1812 |
| 125 | Ga0075365_10004360 | 3300006038 | Bacteria | 7480 |
| 126 | Ga0075365_10058843 | 3300006038 | Bacteria | 2559 |
| 127 | Ga0075365_10102264 | 3300006038 | Bacteria | 1963 |
| 128 | Ga0075368_10029402 | 3300006042 | Bacteria | 2124 |
| 129 | Ga0075363_100001666 | 3300006048 | Bacteria | 8590 |
| 130 | Ga0075363_100163292 | 3300006048 | Bacteria | 1262 |
| 131 | Ga0075364_10041422 | 3300006051 | Bacteria | 2991 |
| 132 | Ga0075364_10047344 | 3300006051 | Bacteria | 2800 |
| 133 | Ga0070715_10001855 | 3300006163 | Bacteria | 6321 |
| 134 | Ga0070716_100004571 | 3300006173 | Bacteria | 6629 |
| 135 | Ga0070712_100143062 | 3300006175 | Bacteria | 1827 |
| 136 | Ga0075367_10011824 | 3300006178 | Bacteria | 4635 |
| 137 | Ga0075367_10012672 | 3300006178 | Bacteria | 4508 |
| 138 | Ga0075367_10013751 | 3300006178 | Bacteria | 4363 |
| 139 | Ga0075367_10051022 | 3300006178 | Bacteria | 2444 |
| 140 | Ga0075367_10057130 | 3300006178 | Bacteria | 2320 |
| 141 | Ga0075369_10022854 | 3300006186 | Bacteria | 2582 |
| 142 | Ga0075366_10005924 | 3300006195 | Bacteria | 6646 |
| 143 | Ga0075366_10012466 | 3300006195 | Bacteria | 4823 |
| 144 | Ga0075366_10019567 | 3300006195 | Bacteria | 3920 |
| 145 | Ga0075366_10060384 | 3300006195 | Bacteria | 2252 |
| 146 | Ga0075370_10000054 | 3300006353 | Bacteria | 34222 |
| 147 | Ga0075370_10003024 | 3300006353 | Bacteria | 7927 |
| 148 | Ga0075370_10005197 | 3300006353 | Bacteria | 6437 |
| 149 | Ga0075370_10008336 | 3300006353 | Bacteria | 5329 |
| 150 | Ga0075370_10023284 | 3300006353 | Bacteria | 3410 |
| 151 | Ga0075370_10074949 | 3300006353 | Bacteria | 1939 |
| 152 | Ga0068871_100034578 | 3300006358 | Bacteria | 4011 |
| 153 | Ga0075428_100144634 | 3300006844 | Bacteria | 2585 |
| 154 | Ga0075428_100251449 | 3300006844 | Bacteria | 1905 |
| 155 | Ga0075433_10005585 | 3300006852 | Bacteria | 9883 |
| 156 | Ga0075434_100006322 | 3300006871 | Bacteria | 10859 |
| 157 | Ga0068865_100048816 | 3300006881 | Bacteria | 2914 |
| 158 | Ga0097620_100334959 | 3300006931 | Bacteria | 1607 |
| 159 | Ga0099822_1006420 | 3300006943 | Bacteria | 15307 |
| 160 | Ga0099823_1022490 | 3300006944 | Bacteria | 5831 |
| 161 | Ga0079104_1002719 | 3300006946 | Bacteria | 9048 |
| 162 | Ga0075435_100131190 | 3300007076 | Bacteria | 2097 |
| 163 | Ga0105240_10002728 | 3300009093 | Bacteria | 28006 |
| 164 | Ga0105240_10015349 | 3300009093 | Bacteria | 10417 |
| 165 | Ga0105240_10039788 | 3300009093 | Bacteria | 6018 |
| 166 | Ga0105240_10060516 | 3300009093 | Bacteria | 4721 |
| 167 | Ga0105240_10082573 | 3300009093 | Bacteria | 3946 |
| 168 | Ga0105240_10232942 | 3300009093 | Bacteria | 2139 |
| 169 | Ga0111539_10001545 | 3300009094 | Bacteria | 30641 |
| 170 | Ga0111539_10024722 | 3300009094 | Bacteria | 7368 |
| 171 | Ga0111539_10283371 | 3300009094 | Bacteria | 1928 |
| 172 | Ga0105245_10009601 | 3300009098 | Bacteria | 8438 |
| 173 | Ga0105245_10079039 | 3300009098 | Bacteria | 3002 |
| 174 | Ga0105247_10015519 | 3300009101 | Bacteria | 4561 |
| 175 | Ga0105247_10078735 | 3300009101 | Bacteria | 2074 |
| 176 | Ga0114129_10005987 | 3300009147 | Bacteria | 17229 |
| 177 | Ga0114129_10030992 | 3300009147 | Bacteria | 7564 |
| 178 | Ga0114129_10086742 | 3300009147 | Bacteria | 4341 |
| 179 | Ga0114129_10132303 | 3300009147 | Bacteria | 3425 |
| 180 | Ga0105243_10010808 | 3300009148 | Bacteria | 6908 |
| 181 | Ga0105243_10107602 | 3300009148 | Bacteria | 2326 |
| 182 | Ga0105241_10014736 | 3300009174 | Bacteria | 5723 |
| 183 | Ga0105241_10023623 | 3300009174 | Bacteria | 4560 |
| 184 | Ga0105241_10137847 | 3300009174 | Bacteria | 1983 |
| 185 | Ga0105242_10011167 | 3300009176 | Bacteria | 6901 |
| 186 | Ga0105248_10037249 | 3300009177 | Bacteria | 5441 |
| 187 | Ga0105248_10040535 | 3300009177 | Bacteria | 5221 |
| 188 | Ga0105248_10050503 | 3300009177 | Bacteria | 4665 |
| 189 | Ga0105237_10005346 | 3300009545 | Bacteria | 14530 |
| 190 | Ga0105237_10036635 | 3300009545 | Bacteria | 4964 |
| 191 | Ga0105237_10037912 | 3300009545 | Bacteria | 4869 |
| 192 | Ga0105237_10242019 | 3300009545 | Bacteria | 1805 |
| 193 | Ga0105238_10006144 | 3300009551 | Bacteria | 11923 |
| 194 | Ga0105238_10034527 | 3300009551 | Bacteria | 5144 |
| 195 | Ga0105238_10078501 | 3300009551 | Bacteria | 3291 |
| 196 | Ga0105238_10254919 | 3300009551 | Bacteria | 1733 |
| 197 | Ga0105238_10374994 | 3300009551 | Bacteria | 1414 |
| 198 | Ga0105249_10011337 | 3300009553 | Bacteria | 7827 |
| 199 | Ga0105249_10017301 | 3300009553 | Bacteria | 6400 |
| 200 | Ga0105249_10064400 | 3300009553 | Bacteria | 3370 |
| 201 | Ga0105239_10008694 | 3300010375 | Bacteria | 11496 |
| 202 | Ga0105239_10014915 | 3300010375 | Bacteria | 8614 |
| 203 | Ga0105239_10024305 | 3300010375 | Bacteria | 6674 |
| 204 | Ga0105239_10027738 | 3300010375 | Bacteria | 6230 |
| 205 | Ga0105239_10078805 | 3300010375 | Bacteria | 3625 |
| 206 | Ga0105239_10223788 | 3300010375 | Bacteria | 2110 |
| 207 | Ga0105239_10389100 | 3300010375 | Bacteria | 1577 |
| 208 | Ga0105239_10443021 | 3300010375 | Bacteria | 1473 |
| 209 | Ga0105246_10006065 | 3300011119 | Bacteria | 7375 |
| 210 | Ga0105246_10216145 | 3300011119 | Bacteria | 1499 |
| 211 | Ga0157370_10256064 | 3300013104 | Bacteria | 1618 |
| 212 | Ga0157369_10006104 | 3300013105 | Bacteria | 13985 |
| 213 | Ga0157369_10018323 | 3300013105 | Bacteria | 7851 |
| 214 | Ga0157369_10067796 | 3300013105 | Bacteria | 3835 |
| 215 | Ga0157374_10154340 | 3300013296 | Bacteria | 2233 |
| 216 | Ga0157378_10140977 | 3300013297 | Bacteria | 2238 |
| 217 | Ga0163162_10037622 | 3300013306 | Bacteria | 4829 |
| 218 | Ga0163162_10105133 | 3300013306 | Bacteria | 2918 |
| 219 | Ga0163162_10193308 | 3300013306 | Bacteria | 2163 |
| 220 | Ga0163162_10288935 | 3300013306 | Bacteria | 1772 |
| 221 | Ga0163162_10344808 | 3300013306 | Bacteria | 1622 |
| 222 | Ga0157375_10042147 | 3300013308 | Bacteria | 4416 |
| 223 | Ga0157375_10187874 | 3300013308 | Bacteria | 2220 |
| 224 | Ga0157380_10003721 | 3300014326 | Bacteria | 10487 |
| 225 | Ga0157380_10078449 | 3300014326 | Bacteria | 2694 |
| 226 | Ga0182008_10012706 | 3300014497 | Bacteria | 4441 |
| 227 | Ga0157377_10000016 | 3300014745 | Bacteria | 190613 |
| 228 | Ga0157377_10073055 | 3300014745 | Bacteria | 1986 |
| 229 | Ga0157379_10085734 | 3300014968 | Bacteria | 2823 |
| 230 | Ga0214544_1000130 | 3300021320 | Bacteria | 108844 |
| 231 | Ga0214542_1000014 | 3300021321 | Bacteria | 233825 |
| 232 | Ga0214543_1000056 | 3300021327 | Bacteria | 134292 |
| 233 | Ga0213876_10001505 | 3300021384 | Bacteria | 14427 |
| 234 | Ga0213876_10088101 | 3300021384 | Bacteria | 1644 |
| 235 | Ga0213875_10018065 | 3300021388 | Bacteria | 3402 |
| 236 | Ga0213871_10027702 | 3300021441 | Bacteria | 1457 |
| 237 | Ga0213871_10028365 | 3300021441 | Bacteria | 1444 |
| 238 | Ga0228711_1000005 | 3300022739 | Bacteria | 215594 |
| 239 | Ga0228710_1000141 | 3300022740 | Bacteria | 66299 |
| 240 | Ga0209566_100744 | 3300025225 | Bacteria | 17997 |
| 241 | Ga0209672_100014 | 3300025228 | Bacteria | 546252 |
| 242 | Ga0209672_100023 | 3300025228 | Bacteria | 371758 |
| 243 | Ga0209147_100094 | 3300025229 | Bacteria | 167145 |
| 244 | Ga0209147_100104 | 3300025229 | Bacteria | 158375 |
| 245 | Ga0209147_100246 | 3300025229 | Bacteria | 52692 |
| 246 | Ga0209258_100040 | 3300025242 | Bacteria | 385401 |
| 247 | Ga0209258_100142 | 3300025242 | Bacteria | 165865 |
| 248 | Ga0207425_1000292 | 3300025245 | Bacteria | 36526 |
| 249 | Ga0209148_1000035 | 3300025254 | Bacteria | 548413 |
| 250 | Ga0209148_1000420 | 3300025254 | Bacteria | 47555 |
| 251 | Ga0209148_1001163 | 3300025254 | Bacteria | 15301 |
| 252 | Ga0209148_1002212 | 3300025254 | Bacteria | 7158 |
| 253 | Ga0209129_1000025 | 3300025258 | Bacteria | 413639 |
| 254 | Ga0209233_1008977 | 3300025261 | Bacteria | 3059 |
| 255 | Ga0209455_1000072 | 3300025272 | Bacteria | 293074 |
| 256 | Ga0209455_1000290 | 3300025272 | Bacteria | 53526 |
| 257 | Ga0209455_1000724 | 3300025272 | Bacteria | 19116 |
| 258 | Ga0209673_1000030 | 3300025273 | Bacteria | 351933 |
| 259 | Ga0209673_1008534 | 3300025273 | Bacteria | 4550 |
| 260 | Ga0209676_1001218 | 3300025292 | Bacteria | 27313 |
| 261 | Ga0209564_1000039 | 3300025295 | Bacteria | 413604 |
| 262 | Ga0209564_1019094 | 3300025295 | Bacteria | 2579 |
| 263 | Ga0209758_1000163 | 3300025297 | Bacteria | 151988 |
| 264 | Ga0209758_1001092 | 3300025297 | Bacteria | 35145 |
| 265 | Ga0209758_1008732 | 3300025297 | Bacteria | 6475 |
| 266 | Ga0209758_1014674 | 3300025297 | Bacteria | 4143 |
| 267 | Ga0209050_1002131 | 3300025298 | Bacteria | 18032 |
| 268 | Ga0207426_1000822 | 3300025302 | Bacteria | 33249 |
| 269 | Ga0209051_1002753 | 3300025303 | Bacteria | 12174 |
| 270 | Ga0209257_1000021 | 3300025304 | Bacteria | 771986 |
| 271 | Ga0209257_1000282 | 3300025304 | Bacteria | 113789 |
| 272 | Ga0207692_10004784 | 3300025898 | Bacteria | 5382 |
| 273 | Ga0207710_10015256 | 3300025900 | Bacteria | 3244 |
| 274 | Ga0207688_10099259 | 3300025901 | Bacteria | 1680 |
| 275 | Ga0207647_10003764 | 3300025904 | Bacteria | 11341 |
| 276 | Ga0207699_10024636 | 3300025906 | Bacteria | 3293 |
| 277 | Ga0207699_10046650 | 3300025906 | Bacteria | 2536 |
| 278 | Ga0207699_10100166 | 3300025906 | Bacteria | 1837 |
| 279 | Ga0207645_10137230 | 3300025907 | Bacteria | 1593 |
| 280 | Ga0207643_10009590 | 3300025908 | Bacteria | 5200 |
| 281 | Ga0207643_10019696 | 3300025908 | Bacteria | 3699 |
| 282 | Ga0207705_10095723 | 3300025909 | Bacteria | 2179 |
| 283 | Ga0207705_10125201 | 3300025909 | Bacteria | 1909 |
| 284 | Ga0207684_10039118 | 3300025910 | Bacteria | 4025 |
| 285 | Ga0207684_10193404 | 3300025910 | Bacteria | 1755 |
| 286 | Ga0207707_10002222 | 3300025912 | Bacteria | 17546 |
| 287 | Ga0207707_10033012 | 3300025912 | Bacteria | 4531 |
| 288 | Ga0207707_10094516 | 3300025912 | Bacteria | 2612 |
| 289 | Ga0207695_10000910 | 3300025913 | Bacteria | 53286 |
| 290 | Ga0207695_10002575 | 3300025913 | Bacteria | 26635 |
| 291 | Ga0207695_10027361 | 3300025913 | Bacteria | 6351 |
| 292 | Ga0207695_10052282 | 3300025913 | Bacteria | 4281 |
| 293 | Ga0207695_10107737 | 3300025913 | Bacteria | 2772 |
| 294 | Ga0207695_10243577 | 3300025913 | Bacteria | 1699 |
| 295 | Ga0207695_10287245 | 3300025913 | Bacteria | 1538 |
| 296 | Ga0207671_10055232 | 3300025914 | Bacteria | 2942 |
| 297 | Ga0207693_10007521 | 3300025915 | Bacteria | 8946 |
| 298 | Ga0207693_10147646 | 3300025915 | Bacteria | 1849 |
| 299 | Ga0207663_10001619 | 3300025916 | Bacteria | 10601 |
| 300 | Ga0207663_10175850 | 3300025916 | Bacteria | 1524 |
| 301 | Ga0207657_10000004 | 3300025919 | Bacteria | 247179 |
| 302 | Ga0207652_10047896 | 3300025921 | Bacteria | 3652 |
| 303 | Ga0207652_10083224 | 3300025921 | Bacteria | 2802 |
| 304 | Ga0207681_10001545 | 3300025923 | Bacteria | 14838 |
| 305 | Ga0207681_10215298 | 3300025923 | Bacteria | 1483 |
| 306 | Ga0207694_10245725 | 3300025924 | Bacteria | 1463 |
| 307 | Ga0207650_10033523 | 3300025925 | Bacteria | 3720 |
| 308 | Ga0207650_10188508 | 3300025925 | Bacteria | 1647 |
| 309 | Ga0207659_10052620 | 3300025926 | Bacteria | 2901 |
| 310 | Ga0207700_10040248 | 3300025928 | Bacteria | 3410 |
| 311 | Ga0207700_10062918 | 3300025928 | Bacteria | 2820 |
| 312 | Ga0207664_10084044 | 3300025929 | Bacteria | 2596 |
| 313 | Ga0207644_10028183 | 3300025931 | Bacteria | 3885 |
| 314 | Ga0207644_10122094 | 3300025931 | Bacteria | 1984 |
| 315 | Ga0207690_10000015 | 3300025932 | Bacteria | 257457 |
| 316 | Ga0207706_10018459 | 3300025933 | Bacteria | 6275 |
| 317 | Ga0207706_10068405 | 3300025933 | Bacteria | 3124 |
| 318 | Ga0207709_10007776 | 3300025935 | Bacteria | 5940 |
| 319 | Ga0207709_10109719 | 3300025935 | Bacteria | 1842 |
| 320 | Ga0207704_10088455 | 3300025938 | Bacteria | 2026 |
| 321 | Ga0207665_10003514 | 3300025939 | Bacteria | 10466 |
| 322 | Ga0207691_10110334 | 3300025940 | Bacteria | 2447 |
| 323 | Ga0207691_10132839 | 3300025940 | Bacteria | 2197 |
| 324 | Ga0207711_10038488 | 3300025941 | Bacteria | 4068 |
| 325 | Ga0207711_10123071 | 3300025941 | Bacteria | 2318 |
| 326 | Ga0207689_10020193 | 3300025942 | Bacteria | 5611 |
| 327 | Ga0207661_10003202 | 3300025944 | Bacteria | 11342 |
| 328 | Ga0207667_10072260 | 3300025949 | Bacteria | 3586 |
| 329 | Ga0207667_10213867 | 3300025949 | Bacteria | 1976 |
| 330 | Ga0207712_10002593 | 3300025961 | Bacteria | 11609 |
| 331 | Ga0207712_10008695 | 3300025961 | Bacteria | 6422 |
| 332 | Ga0207712_10191700 | 3300025961 | Bacteria | 1614 |
| 333 | Ga0207668_10085779 | 3300025972 | Bacteria | 2298 |
| 334 | Ga0207668_10137508 | 3300025972 | Bacteria | 1874 |
| 335 | Ga0207668_10172403 | 3300025972 | Bacteria | 1698 |
| 336 | Ga0207640_10038292 | 3300025981 | Bacteria | 3024 |
| 337 | Ga0207640_10081019 | 3300025981 | Bacteria | 2218 |
| 338 | Ga0207658_10000058 | 3300025986 | Bacteria | 122331 |
| 339 | Ga0207658_10150217 | 3300025986 | Bacteria | 1897 |
| 340 | Ga0207677_10033178 | 3300026023 | Bacteria | 3327 |
| 341 | Ga0207677_10126221 | 3300026023 | Bacteria | 1934 |
| 342 | Ga0207677_10200032 | 3300026023 | Bacteria | 1587 |
| 343 | Ga0207703_10025822 | 3300026035 | Bacteria | 4623 |
| 344 | Ga0207639_10048147 | 3300026041 | Bacteria | 3225 |
| 345 | Ga0207639_10145366 | 3300026041 | Bacteria | 1980 |
| 346 | Ga0207678_10004789 | 3300026067 | Bacteria | 12146 |
| 347 | Ga0207678_10012877 | 3300026067 | Bacteria | 7341 |
| 348 | Ga0207678_10016652 | 3300026067 | Bacteria | 6457 |
| 349 | Ga0207678_10042320 | 3300026067 | Bacteria | 3947 |
| 350 | Ga0207678_10142331 | 3300026067 | Bacteria | 2047 |
| 351 | Ga0207708_10148399 | 3300026075 | Bacteria | 1844 |
| 352 | Ga0207702_10000106 | 3300026078 | Bacteria | 97204 |
| 353 | Ga0207702_10000761 | 3300026078 | Bacteria | 34283 |
| 354 | Ga0207641_10000557 | 3300026088 | Bacteria | 41685 |
| 355 | Ga0207641_10202459 | 3300026088 | Bacteria | 1831 |
| 356 | Ga0207648_10000343 | 3300026089 | Bacteria | 51081 |
| 357 | Ga0207648_10004572 | 3300026089 | Bacteria | 14186 |
| 358 | Ga0207648_10145222 | 3300026089 | Bacteria | 2092 |
| 359 | Ga0207676_10042731 | 3300026095 | Bacteria | 3486 |
| 360 | Ga0207676_10241343 | 3300026095 | Bacteria | 1621 |
| 361 | Ga0207674_10078198 | 3300026116 | Bacteria | 3313 |
| 362 | Ga0207674_10083238 | 3300026116 | Bacteria | 3199 |
| 363 | Ga0207674_10083292 | 3300026116 | Bacteria | 3198 |
| 364 | Ga0207675_100037251 | 3300026118 | Bacteria | 4538 |
| 365 | Ga0207675_100151390 | 3300026118 | Bacteria | 2208 |
| 366 | Ga0207683_10088182 | 3300026121 | Bacteria | 2760 |
| 367 | Ga0207683_10100833 | 3300026121 | Bacteria | 2577 |
| 368 | Ga0207683_10253213 | 3300026121 | Bacteria | 1607 |
| 369 | Ga0207683_10288810 | 3300026121 | Bacteria | 1499 |
| 370 | Ga0207698_10014336 | 3300026142 | Bacteria | 5266 |
| 371 | Ga0207698_10089502 | 3300026142 | Bacteria | 2514 |
| 372 | Ga0207698_10188439 | 3300026142 | Bacteria | 1835 |
| 373 | Ga0207698_10250772 | 3300026142 | Bacteria | 1619 |
| 374 | Ga0209281_1000111 | 3300027111 | Bacteria | 215615 |
| 375 | Ga0209281_1000185 | 3300027111 | Bacteria | 144489 |
| 376 | Ga0209389_1000201 | 3300027296 | Bacteria | 42938 |
| 377 | Ga0209371_1000079 | 3300027312 | Bacteria | 187621 |
| 378 | Ga0209589_1000001 | 3300027357 | Bacteria | 794224 |
| 379 | Ga0209489_100001 | 3300027361 | Bacteria | 794224 |
| 380 | Ga0209489_100035 | 3300027361 | Bacteria | 168255 |
| 381 | Ga0209700_100001 | 3300027363 | Bacteria | 794224 |
| 382 | Ga0209700_100005 | 3300027363 | Bacteria | 573969 |
| 383 | Ga0209282_1000012 | 3300027666 | Bacteria | 215614 |
| 384 | Ga0209998_10006506 | 3300027717 | Bacteria | 2428 |
| 385 | Ga0209974_10007537 | 3300027876 | Bacteria | 3745 |
| 386 | Ga0207428_10006944 | 3300027907 | Bacteria | 10375 |
| 387 | Ga0268266_10001162 | 3300028379 | Bacteria | 32576 |
| 388 | Ga0268266_10026905 | 3300028379 | Bacteria | 4893 |
| 389 | Ga0268266_10030473 | 3300028379 | Bacteria | 4583 |
| 390 | Ga0268266_10053037 | 3300028379 | Bacteria | 3483 |
| 391 | Ga0268266_10232940 | 3300028379 | Bacteria | 1697 |
| 392 | Ga0268265_10002240 | 3300028380 | Bacteria | 14837 |
| 393 | Ga0268265_10022190 | 3300028380 | Bacteria | 4457 |
| 394 | Ga0268265_10063058 | 3300028380 | Bacteria | 2850 |
| 395 | Ga0268265_10364830 | 3300028380 | Bacteria | 1323 |
| 396 | Ga0268264_10000149 | 3300028381 | Bacteria | 163972 |
| 397 | Ga0268264_10320483 | 3300028381 | Bacteria | 1465 |
| 398 | Ga0268264_10391601 | 3300028381 | Bacteria | 1333 |
| 399 | Ga0307517_10000249 | 3300028786 | Bacteria | 91911 |
| 400 | Ga0307515_10000112 | 3300028794 | Bacteria | 195015 |
| 401 | Ga0307515_10000305 | 3300028794 | Bacteria | 121634 |
| 402 | Ga0307515_10025474 | 3300028794 | Bacteria | 10232 |
| 403 | Ga0307515_10033784 | 3300028794 | Bacteria | 8406 |
| 404 | Ga0307515_10082891 | 3300028794 | Bacteria | 4140 |
| 405 | Ga0307515_10132804 | 3300028794 | Bacteria | 2728 |
| 406 | Ga0307515_10154087 | 3300028794 | Bacteria | 2384 |
| 407 | Ga0265338_10005146 | 3300028800 | Bacteria | 17218 |
| 408 | Ga0268256_1000090 | 3300030500 | Bacteria | 153976 |
| 409 | Ga0307511_10000499 | 3300030521 | Bacteria | 42317 |
| 410 | Ga0307511_10026995 | 3300030521 | Bacteria | 5253 |
| 411 | Ga0307512_10043165 | 3300030522 | Bacteria | 3722 |
| 412 | Ga0265770_1000176 | 3300030878 | Bacteria | 8371 |
| 413 | Ga0265760_10014223 | 3300031090 | Bacteria | 2278 |
| 414 | Ga0265330_10005426 | 3300031235 | Bacteria | 6358 |
| 415 | Ga0265330_10095064 | 3300031235 | Bacteria | 1277 |
| 416 | Ga0265332_10029936 | 3300031238 | Bacteria | 2378 |
| 417 | Ga0265332_10081475 | 3300031238 | Bacteria | 1372 |
| 418 | Ga0265340_10000710 | 3300031247 | Bacteria | 18813 |
| 419 | Ga0265340_10015636 | 3300031247 | Bacteria | 3941 |
| 420 | Ga0265340_10051469 | 3300031247 | Bacteria | 1994 |
| 421 | Ga0265327_10092159 | 3300031251 | Bacteria | 1475 |
| 422 | Ga0265316_10083710 | 3300031344 | Bacteria | 2444 |
| 423 | Ga0307513_10016740 | 3300031456 | Bacteria | 8823 |
| 424 | Ga0307513_10113846 | 3300031456 | Bacteria | 2692 |
| 425 | Ga0307513_10133705 | 3300031456 | Bacteria | 2420 |
| 426 | Ga0307509_10001175 | 3300031507 | Bacteria | 44735 |
| 427 | Ga0307509_10001769 | 3300031507 | Bacteria | 35880 |
| 428 | Ga0307509_10002906 | 3300031507 | Bacteria | 27071 |
| 429 | Ga0307509_10004311 | 3300031507 | Bacteria | 20669 |
| 430 | Ga0307509_10031909 | 3300031507 | Bacteria | 5809 |
| 431 | Ga0307509_10077533 | 3300031507 | Bacteria | 3446 |
| 432 | Ga0307509_10151997 | 3300031507 | Bacteria | 2228 |
| 433 | Ga0307509_10239140 | 3300031507 | Bacteria | 1610 |
| 434 | Ga0307408_100000056 | 3300031548 | Bacteria | 140709 |
| 435 | Ga0307408_100001506 | 3300031548 | Bacteria | 17302 |
| 436 | Ga0307508_10000072 | 3300031616 | Bacteria | 118449 |
| 437 | Ga0307508_10000430 | 3300031616 | Bacteria | 49980 |
| 438 | Ga0307508_10002376 | 3300031616 | Bacteria | 19911 |
| 439 | Ga0307508_10122475 | 3300031616 | Bacteria | 2203 |
| 440 | Ga0307514_10028882 | 3300031649 | Bacteria | 4468 |
| 441 | Ga0307514_10041387 | 3300031649 | Bacteria | 3629 |
| 442 | Ga0265314_10008385 | 3300031711 | Bacteria | 8856 |
| 443 | Ga0265314_10011610 | 3300031711 | Bacteria | 7251 |
| 444 | Ga0265314_10019075 | 3300031711 | Bacteria | 5321 |
| 445 | Ga0265342_10054655 | 3300031712 | Bacteria | 2372 |
| 446 | Ga0307516_10015162 | 3300031730 | Bacteria | 8117 |
| 447 | Ga0307516_10061104 | 3300031730 | Bacteria | 3657 |
| 448 | Ga0307516_10064210 | 3300031730 | Bacteria | 3552 |
| 449 | Ga0307516_10077272 | 3300031730 | Bacteria | 3178 |
| 450 | Ga0307516_10082010 | 3300031730 | Bacteria | 3067 |
| 451 | Ga0307516_10082809 | 3300031730 | Bacteria | 3050 |
| 452 | Ga0307405_10003030 | 3300031731 | Bacteria | 7609 |
| 453 | Ga0307405_10056976 | 3300031731 | Bacteria | 2453 |
| 454 | Ga0307405_10087039 | 3300031731 | Bacteria | 2058 |
| 455 | Ga0307413_10050405 | 3300031824 | Bacteria | 2501 |
| 456 | Ga0307410_10007285 | 3300031852 | Bacteria | 6045 |
| 457 | Ga0307410_10048850 | 3300031852 | Bacteria | 2837 |
| 458 | Ga0307406_10027612 | 3300031901 | Bacteria | 3422 |
| 459 | Ga0307406_10049264 | 3300031901 | Bacteria | 2665 |
| 460 | Ga0315914_1000007 | 3300031967 | Bacteria | 215597 |
| 461 | Ga0307409_100025031 | 3300031995 | Bacteria | 4177 |
| 462 | Ga0307416_100033232 | 3300032002 | Bacteria | 3908 |
| 463 | Ga0307416_100058427 | 3300032002 | Bacteria | 3127 |
| 464 | Ga0307411_10000184 | 3300032005 | Bacteria | 20004 |
| 465 | Ga0307415_100100709 | 3300032126 | Bacteria | 2118 |
| 466 | Ga0307415_100168688 | 3300032126 | Bacteria | 1705 |
| 467 | Ga0307507_10013480 | 3300033179 | Bacteria | 9918 |
| 468 | Ga0307510_10002529 | 3300033180 | Bacteria | 20856 |
| 469 | Ga0307510_10012250 | 3300033180 | Bacteria | 10166 |
| 470 | Ga0307510_10012673 | 3300033180 | Bacteria | 10003 |
| 471 | Ga0307510_10086716 | 3300033180 | Bacteria | 3001 |
| 472 | Ga0315913_1000003 | 3300033430 | Bacteria | 215608 |
| 473 | Ga0315911_1000006 | 3300033442 | Bacteria | 414563 |
| 474 | Ga0315915_1000011 | 3300033464 | Bacteria | 215597 |
| 475 | Ga0373958_0020001 | 3300034819 | Bacteria | 1229 |
| 476 | Ga0373934_0004161 | 3300035086 | Bacteria | 5335 |
| 477 | Ga0373940_0012551 | 3300035088 | Bacteria | 2031 |
| 478 | Ga0373923_0000671 | 3300035111 | Bacteria | 8698 |
| 479 | Ga0373923_0010258 | 3300035111 | Bacteria | 3403 |
| 480 | Ga0373936_0027462 | 3300035113 | Bacteria | 2232 |
| 481 | Ga0373936_0028913 | 3300035113 | Bacteria | 2181 |
| 482 | Ga0373939_0000105 | 3300035114 | Bacteria | 25682 |
| 483 | Ga0373939_0020896 | 3300035114 | Bacteria | 1785 |
| 484 | Ga0373954_0000658 | 3300035118 | Bacteria | 13209 |
| 485 | Ga0373956_0003745 | 3300035119 | Bacteria | 6128 |
| 486 | Ga0373957_0009633 | 3300035120 | Bacteria | 3166 |
| 487 | Ga0373957_0051578 | 3300035120 | Bacteria | 1574 |
| 488 | Ga0373960_0003723 | 3300035121 | Bacteria | 3465 |
| 489 | Ga0373943_0010364 | 3300035170 | Bacteria | 4179 |
| 490 | Ga0373924_0003932 | 3300035410 | Bacteria | 5154 |
| 491 | Ga0373931_0004715 | 3300035691 | Bacteria | 6247 |
| 492 | Ga0373931_0037889 | 3300035691 | Bacteria | 2519 |
| 493 | Ga0373935_0084706 | 3300035692 | Bacteria | 2065 |
| 494 | Ga0373927_0029189 | 3300035695 | Bacteria | 3594 |
| 495 | Ga0373927_0029952 | 3300035695 | Bacteria | 3551 |
| 496 | Ga0373927_0063702 | 3300035695 | Bacteria | 2385 |
| 497 | Ga0373933_0000445 | 3300035724 | Bacteria | 25820 |
| 498 | Ga0373933_0033552 | 3300035724 | Bacteria | 2986 |
| 499 | Ga0373933_0046371 | 3300035724 | Plasmid | 2581 |
| 500 | Ga0373947_0027904 | 3300035725 | Bacteria | 3306 |
| 501 | Ga0373947_0094310 | 3300035725 | Bacteria | 1871 |
| 502 | Ga0373937_0022764 | 3300036401 | Bacteria | 5636 |
| 503 | Ga0373925_0034849 | 3300037068 | Bacteria | 3711 |
| 504 | Ga0373925_0091397 | 3300037068 | Bacteria | 2327 |
| 505 | Ga0395900_0021186 | 3300037418 | Bacteria | 6645 |
| 506 | Ga0395900_0137440 | 3300037418 | Bacteria | 2504 |
| 507 | Ga0395900_0204267 | 3300037418 | Bacteria | 1997 |
| 508 | Ga0395898_0011538 | 3300037466 | Bacteria | 9179 |
| 509 | Ga0395898_0023551 | 3300037466 | Bacteria | 6220 |
| 510 | Ga0395898_0033644 | 3300037466 | Bacteria | 5113 |
| 511 | Ga0395898_0063125 | 3300037466 | Bacteria | 3595 |
| 512 | Ga0395898_0076260 | 3300037466 | Bacteria | 3238 |
| 513 | Ga0395898_0096379 | 3300037466 | Bacteria | 2842 |
| 514 | Ga0395898_0177440 | 3300037466 | Bacteria | 2036 |
| 515 | Ga0395905_0000016 | 3300037471 | Bacteria | 382308 |
| 516 | Ga0395905_0000374 | 3300037471 | Bacteria | 63889 |
| 517 | Ga0395905_0000697 | 3300037471 | Bacteria | 44516 |
| 518 | Ga0395905_0002583 | 3300037471 | Bacteria | 19936 |
| 519 | Ga0395905_0003009 | 3300037471 | Bacteria | 18259 |
| 520 | Ga0395905_0026559 | 3300037471 | Bacteria | 5458 |
| 521 | Ga0395905_0028159 | 3300037471 | Bacteria | 5296 |
| 522 | Ga0395905_0097858 | 3300037471 | Bacteria | 2755 |
| 523 | Ga0395905_0105527 | 3300037471 | Bacteria | 2646 |
| 524 | Ga0436364_0541406 | 3300037853 | Bacteria | 8515 |
| 525 | Ga0436364_0552267 | 3300037853 | Bacteria | 1331 |
| 526 | Ga0436364_1234034 | 3300037853 | Bacteria | 3332 |
| 527 | Ga0395901_0021993 | 3300038443 | Bacteria | 6537 |
| 528 | Ga0395901_0168521 | 3300038443 | Bacteria | 2298 |
| 529 | Ga0395901_0270621 | 3300038443 | Bacteria | 1767 |
| 530 | Ga0436365_0063749 | 3300039437 | Bacteria | 4703 |
| 531 | Ga0436365_0244982 | 3300039437 | Bacteria | 68861 |
| 532 | Ga0436365_0465598 | 3300039437 | Bacteria | 1861 |
| 533 | Ga0436365_0894462 | 3300039437 | Bacteria | 1908 |
| 534 | Ga0436365_1765855 | 3300039437 | Bacteria | 3829 |
| 535 | Ga0436365_1808909 | 3300039437 | Bacteria | 4123 |
| 536 | Ga0436360_0207100 | 3300039438 | Bacteria | 2316 |
| 537 | Ga0436360_0924956 | 3300039438 | Bacteria | 3958 |
| 538 | Ga0436361_0505806 | 3300039447 | Bacteria | 4778 |
| 539 | Ga0436361_1206490 | 3300039447 | Bacteria | 2413 |
| 540 | Ga0436363_1091027 | 3300039450 | Bacteria | 2325 |
| 541 | Ga0436362_0338861 | 3300039453 | Bacteria | 16043 |
| 542 | Ga0451793_1434285 | 3300041452 | Bacteria | 1667 |
| 543 | Ga0439433_0014692 | 3300041999 | Bacteria | 1725 |
| 544 | Ga0450920_013347 | 3300042122 | Bacteria | 1547 |
| 545 | Ga0439446_0000150 | 3300042156 | Bacteria | 12148 |
| 546 | Ga0439434_0000316 | 3300042435 | Bacteria | 13750 |
| 547 | Ga0439435_0000897 | 3300042436 | Bacteria | 5126 |
| 548 | Ga0450893_0002178 | 3300042532 | Bacteria | 3052 |
| 549 | Ga0466961_0004454 | 3300044693 | Bacteria | 8773 |
| 550 | Ga0466961_0074107 | 3300044693 | Bacteria | 2158 |
| 551 | Ga0466971_0004450 | 3300044719 | Bacteria | 6049 |
| 552 | Ga0466968_0030638 | 3300044735 | Bacteria | 2229 |
| 553 | Ga0466970_0001623 | 3300044765 | Bacteria | 10834 |
| 554 | Ga0466957_0059415 | 3300044842 | Bacteria | 2343 |
| 555 | Ga0466957_0138351 | 3300044842 | Bacteria | 1567 |
| 556 | Ga0466960_0081901 | 3300044901 | Bacteria | 1628 |
| 557 | Ga0466959_0059990 | 3300045049 | Bacteria | 2769 |
| 558 | Ga0466959_0117709 | 3300045049 | Bacteria | 1891 |
| 559 | Ga0451576_0120588 | 3300045051 | Bacteria | 2730 |
| 560 | Ga0466958_0005689 | 3300045836 | Bacteria | 6732 |
| 561 | Ga0466967_0006585 | 3300045976 | Bacteria | 8248 |
| 562 | Ga0466967_0021602 | 3300045976 | Bacteria | 5232 |
| 563 | Ga0466967_0058613 | 3300045976 | Bacteria | 3404 |
| 564 | Ga0495592_0000322 | 3300046454 | Bacteria | 40072 |
| 565 | Ga0495592_0016498 | 3300046454 | Bacteria | 5604 |
| 566 | Ga0495592_0102968 | 3300046454 | Bacteria | 2032 |
| 567 | Ga0495603_0010741 | 3300046455 | Bacteria | 5554 |
| 568 | Ga0495603_0036333 | 3300046455 | Bacteria | 2958 |
| 569 | Ga0495603_0075863 | 3300046455 | Bacteria | 1973 |
| 570 | Ga0495590_0053025 | 3300046457 | Bacteria | 1416 |
| 571 | Ga0495629_0121590 | 3300046459 | Bacteria | 1819 |
| 572 | Ga0495638_0025665 | 3300046460 | Bacteria | 3827 |
| 573 | Ga0495638_0040056 | 3300046460 | Bacteria | 2970 |
| 574 | Ga0495638_0074296 | 3300046460 | Bacteria | 2073 |
| 575 | Ga0495638_0132377 | 3300046460 | Bacteria | 1464 |
| 576 | Ga0495651_0114037 | 3300046462 | Bacteria | 1995 |
| 577 | Ga0495653_0000358 | 3300046463 | Bacteria | 36893 |
| 578 | Ga0495653_0264615 | 3300046463 | Bacteria | 1135 |
| 579 | Ga0495580_0009429 | 3300046472 | Bacteria | 7679 |
| 580 | Ga0495582_0025546 | 3300046473 | Bacteria | 3235 |
| 581 | Ga0495639_0011249 | 3300046475 | Bacteria | 3855 |
| 582 | Ga0495639_0088521 | 3300046475 | Bacteria | 1450 |
| 583 | Ga0495664_0003614 | 3300046477 | Bacteria | 8427 |
| 584 | Ga0495664_0017108 | 3300046477 | Bacteria | 4142 |
| 585 | Ga0495594_0118300 | 3300046499 | Bacteria | 1497 |
| 586 | Ga0495607_0061847 | 3300046501 | Bacteria | 2126 |
| 587 | Ga0495610_0002018 | 3300046512 | Bacteria | 17370 |
| 588 | Ga0495610_0073817 | 3300046512 | Bacteria | 1584 |
| 589 | Ga0495618_0052656 | 3300046514 | Bacteria | 2573 |
| 590 | Ga0495628_0028749 | 3300046516 | Bacteria | 4515 |
| 591 | Ga0495631_0056940 | 3300046518 | Bacteria | 1702 |
| 592 | Ga0495632_0001413 | 3300046519 | Bacteria | 20041 |
| 593 | Ga0495632_0004544 | 3300046519 | Bacteria | 9402 |
| 594 | Ga0495644_0024072 | 3300046523 | Bacteria | 2316 |
| 595 | Ga0495644_0033741 | 3300046523 | Bacteria | 1933 |
| 596 | Ga0495648_0072804 | 3300046524 | Bacteria | 1987 |
| 597 | Ga0495652_0025038 | 3300046529 | Bacteria | 5280 |
| 598 | Ga0495652_0106723 | 3300046529 | Unclassified | 2261 |
| 599 | Ga0495640_0045777 | 3300046533 | Bacteria | 3035 |
| 600 | Ga0495640_0058499 | 3300046533 | Bacteria | 2628 |
| 601 | Ga0495586_0048581 | 3300046535 | Bacteria | 2293 |
| 602 | Ga0495587_0010166 | 3300046536 | Bacteria | 6002 |
| 603 | Ga0495645_0028522 | 3300046543 | Bacteria | 4057 |
| 604 | Ga0495622_0097391 | 3300046557 | Bacteria | 1349 |
| 605 | Ga0495633_0028261 | 3300046558 | Bacteria | 2735 |
| 606 | Ga0495633_0108569 | 3300046558 | Bacteria | 1287 |
| 607 | Ga0495667_0030252 | 3300046559 | Bacteria | 3641 |
| 608 | Ga0495656_0003759 | 3300046615 | Bacteria | 5156 |
| 609 | Ga0495656_0028162 | 3300046615 | Bacteria | 2252 |
| 610 | Ga0495668_0066881 | 3300046616 | Bacteria | 1977 |
| 611 | Ga0495668_0088265 | 3300046616 | Bacteria | 1700 |
| 612 | Ga0495634_0002891 | 3300046642 | Bacteria | 14092 |
| 613 | Ga0495634_0024961 | 3300046642 | Bacteria | 4189 |
| 614 | Ga0495625_0006941 | 3300046660 | Bacteria | 9989 |
| 615 | Ga0495635_0000466 | 3300046663 | Bacteria | 25585 |
| 616 | Ga0495659_0050390 | 3300046664 | Bacteria | 1514 |
| 617 | Ga0495588_0013610 | 3300046674 | Bacteria | 3878 |
| 618 | Ga0495588_0097857 | 3300046674 | Bacteria | 1540 |
| 619 | Ga0495599_0002741 | 3300046678 | Bacteria | 10274 |
| 620 | Ga0495646_0007558 | 3300046680 | Bacteria | 6907 |
| 621 | Ga0495624_0016010 | 3300046690 | Bacteria | 5047 |
| 622 | Ga0495624_0027650 | 3300046690 | Bacteria | 3712 |
| 623 | Ga0495670_0072209 | 3300046691 | Bacteria | 1748 |
| 624 | Ga0495600_0001173 | 3300046809 | Bacteria | 14303 |
| 625 | Ga0495660_0028118 | 3300046810 | Bacteria | 3178 |
| 626 | Ga0495581_0007629 | 3300047315 | Bacteria | 6259 |
| 627 | Ga0495604_0031510 | 3300047317 | Bacteria | 4205 |
| 628 | Ga0495636_0039860 | 3300047318 | Bacteria | 1946 |
| 629 | Ga0495674_0032928 | 3300047319 | Bacteria | 4698 |
| 630 | Ga0495674_0038270 | 3300047319 | Bacteria | 4306 |
| 631 | Ga0495672_0009646 | 3300047320 | Bacteria | 6967 |
| 632 | Ga0495680_0006795 | 3300047322 | Bacteria | 10567 |
| 633 | Ga0495687_000248 | 3300047443 | Bacteria | 72947 |
| 634 | Ga0495687_007648 | 3300047443 | Bacteria | 6326 |
| 635 | Ga0495673_0021977 | 3300047469 | Bacteria | 3135 |
| 636 | Ga0495684_0000357 | 3300047471 | Bacteria | 36963 |
| 637 | Ga0495686_0053930 | 3300047472 | Bacteria | 2518 |
| 638 | Ga0495686_0068321 | 3300047472 | Bacteria | 2192 |
| 639 | Ga0495686_0109400 | 3300047472 | Bacteria | 1659 |
| 640 | Ga0495593_0005202 | 3300047673 | Bacteria | 7689 |
| 641 | Ga0495593_0040169 | 3300047673 | Bacteria | 2520 |
| 642 | Ga0495593_0124683 | 3300047673 | Bacteria | 1309 |
| 643 | Ga0495615_0007287 | 3300048090 | Bacteria | 2093 |
| 644 | Ga0496100_0037558 | 3300048903 | Bacteria | 3063 |
| 645 | Ga0496100_0053476 | 3300048903 | Bacteria | 2630 |
| 646 | Ga0496101_0090063 | 3300048904 | Bacteria | 2281 |
| 647 | Ga0496101_0098815 | 3300048904 | Bacteria | 2181 |
| 648 | Ga0496102_0003487 | 3300048905 | Bacteria | 13334 |
| 649 | Ga0496102_0139192 | 3300048905 | Bacteria | 2275 |
| 650 | Ga0496104_0000277 | 3300048907 | Bacteria | 45742 |
| 651 | Ga0496104_0031694 | 3300048907 | Bacteria | 4917 |
| 652 | Ga0496104_0258515 | 3300048907 | Bacteria | 1654 |
| 653 | Ga0496105_0010743 | 3300048908 | Bacteria | 7208 |
| 654 | Ga0496105_0054856 | 3300048908 | Bacteria | 3290 |
| 655 | Ga0496105_0266548 | 3300048908 | Bacteria | 1384 |
| 656 | Ga0496106_0053866 | 3300048909 | Bacteria | 3039 |
| 657 | Ga0496106_0072635 | 3300048909 | Bacteria | 2631 |
| 658 | Ga0496106_0074522 | 3300048909 | Bacteria | 2599 |
| 659 | Ga0496106_0108946 | 3300048909 | Bacteria | 2155 |
| 660 | Ga0496107_0009774 | 3300048910 | Bacteria | 6653 |
| 661 | Ga0496108_0005114 | 3300048911 | Bacteria | 10600 |
| 662 | Ga0496108_0045123 | 3300048911 | Bacteria | 3680 |
| 663 | Ga0496108_0051741 | 3300048911 | Bacteria | 3441 |
| 664 | Ga0496108_0208262 | 3300048911 | Bacteria | 1697 |
| 665 | Ga0496109_0009447 | 3300048912 | Bacteria | 8314 |
| 666 | Ga0496109_0122570 | 3300048912 | Bacteria | 2422 |
| 667 | Ga0496110_0034834 | 3300048913 | Bacteria | 4364 |
| 668 | Ga0496110_0205904 | 3300048913 | Bacteria | 1788 |
| 669 | Ga0496110_0209820 | 3300048913 | Bacteria | 1770 |
| 670 | Ga0496110_0269069 | 3300048913 | Bacteria | 1551 |
| 671 | Ga0496110_0321376 | 3300048913 | Bacteria | 1410 |
| 672 | Ga0496111_0009657 | 3300048914 | Bacteria | 6447 |
| 673 | Ga0496111_0065631 | 3300048914 | Bacteria | 2635 |
| 674 | Ga0496112_0000004 | 3300048915 | Bacteria | 553294 |
| 675 | Ga0496112_0003582 | 3300048915 | Bacteria | 12913 |
| 676 | Ga0496112_0037196 | 3300048915 | Bacteria | 4751 |
| 677 | Ga0496112_0037747 | 3300048915 | Bacteria | 4716 |
| 678 | Ga0496112_0158815 | 3300048915 | Bacteria | 2227 |
| 679 | Ga0496112_0195894 | 3300048915 | Bacteria | 1981 |
| 680 | Ga0496113_0003658 | 3300048916 | Bacteria | 9251 |
| 681 | Ga0496113_0068406 | 3300048916 | Bacteria | 2695 |
| 682 | Ga0496114_0102995 | 3300048917 | Bacteria | 2439 |
| 683 | Ga0496115_0001987 | 3300048918 | Bacteria | 14603 |
| 684 | Ga0496115_0037006 | 3300048918 | Bacteria | 3866 |
| 685 | Ga0496115_0291620 | 3300048918 | Bacteria | 1338 |
| 686 | Ga0496116_0001246 | 3300048919 | Bacteria | 29566 |
| 687 | Ga0496117_0016248 | 3300048920 | Bacteria | 6290 |
| 688 | Ga0496117_0033732 | 3300048920 | Bacteria | 3866 |
| 689 | Ga0496117_0078953 | 3300048920 | Bacteria | 2170 |
| 690 | Ga0496117_0109159 | 3300048920 | Bacteria | 1728 |
| 691 | Ga0496118_0012336 | 3300048921 | Bacteria | 8221 |
| 692 | Ga0496118_0088173 | 3300048921 | Bacteria | 2147 |
| 693 | Ga0496118_0110427 | 3300048921 | Bacteria | 1826 |
| 694 | Ga0496121_0000667 | 3300048924 | Bacteria | 64115 |
| 695 | Ga0496121_0001254 | 3300048924 | Bacteria | 43970 |
| 696 | Ga0496121_0001728 | 3300048924 | Bacteria | 35654 |
| 697 | Ga0496121_0116985 | 3300048924 | Bacteria | 2020 |
| 698 | Ga0496121_0117977 | 3300048924 | Bacteria | 2010 |
| 699 | Ga0496122_0010121 | 3300048925 | Bacteria | 9782 |
| 700 | Ga0496122_0025770 | 3300048925 | Bacteria | 5094 |
| 701 | Ga0496124_0030053 | 3300048927 | Bacteria | 4830 |
| 702 | Ga0496125_0001227 | 3300048928 | Bacteria | 38397 |
| 703 | Ga0496125_0108472 | 3300048928 | Bacteria | 2019 |
| 704 | Ga0496126_0005037 | 3300048929 | Bacteria | 15358 |
| 705 | Ga0496126_0007721 | 3300048929 | Bacteria | 11736 |
| 706 | Ga0496126_0008802 | 3300048929 | Bacteria | 10828 |
| 707 | Ga0496126_0015170 | 3300048929 | Bacteria | 7759 |
| 708 | Ga0496126_0054514 | 3300048929 | Bacteria | 3621 |
| 709 | Ga0496126_0060043 | 3300048929 | Bacteria | 3422 |
| 710 | Ga0496126_0075712 | 3300048929 | Bacteria | 2987 |
| 711 | Ga0496126_0136764 | 3300048929 | Bacteria | 2113 |
| 712 | Ga0496126_0156271 | 3300048929 | Bacteria | 1951 |
| 713 | Ga0496126_0210219 | 3300048929 | Bacteria | 1638 |
| 714 | Ga0501031_0000013 | 3300049568 | Bacteria | 129659 |
| 715 | Ga0501032_0000061 | 3300049569 | Bacteria | 94724 |
| 716 | Ga0501033_0000044 | 3300049570 | Bacteria | 129614 |
| 717 | Ga0501033_0121719 | 3300049570 | Bacteria | 1893 |
| 718 | Ga0501033_0166728 | 3300049570 | Bacteria | 1583 |
| 719 | Ga0501034_0000155 | 3300049571 | Bacteria | 129711 |
| 720 | Ga0501034_0099144 | 3300049571 | Bacteria | 2908 |
| 721 | Ga0501034_0115571 | 3300049571 | Bacteria | 2672 |
| 722 | Ga0501034_0153118 | 3300049571 | Bacteria | 2281 |
| 723 | Ga0501034_0227900 | 3300049571 | Bacteria | 1813 |
| 724 | Ga0501036_0000016 | 3300049572 | Bacteria | 129660 |
| 725 | Ga0501037_0000033 | 3300049573 | Bacteria | 129768 |
| 726 | Ga0501037_0093882 | 3300049573 | Bacteria | 2169 |
| 727 | Ga0501038_0000290 | 3300049574 | Bacteria | 42746 |
| 728 | Ga0501038_0022383 | 3300049574 | Bacteria | 5665 |
| 729 | Ga0501038_0077055 | 3300049574 | Bacteria | 2815 |
| 730 | Ga0501038_0101096 | 3300049574 | Bacteria | 2400 |
| 731 | Ga0501038_0122620 | 3300049574 | Bacteria | 2141 |
| 732 | Ga0501039_0000007 | 3300049575 | Bacteria | 277831 |
| 733 | Ga0501039_0023581 | 3300049575 | Bacteria | 4722 |
| 734 | Ga0501040_0054481 | 3300049576 | Bacteria | 2742 |
| 735 | Ga0501040_0077618 | 3300049576 | Bacteria | 2298 |
| 736 | Ga0501043_0000439 | 3300049579 | Bacteria | 37482 |
| 737 | Ga0501043_0003008 | 3300049579 | Bacteria | 14030 |
| 738 | Ga0501046_0001371 | 3300049580 | Bacteria | 23462 |
| 739 | Ga0501046_0026043 | 3300049580 | Bacteria | 4779 |
| 740 | Ga0501046_0084959 | 3300049580 | Bacteria | 2440 |
| 741 | Ga0501047_0000069 | 3300049581 | Bacteria | 129231 |
| 742 | Ga0501047_0000791 | 3300049581 | Bacteria | 33098 |
| 743 | Ga0501047_0016182 | 3300049581 | Bacteria | 7116 |
| 744 | Ga0501047_0072670 | 3300049581 | Bacteria | 3310 |
| 745 | Ga0501047_0169296 | 3300049581 | Bacteria | 2054 |
| 746 | Ga0501048_0001073 | 3300049582 | Bacteria | 20497 |
| 747 | Ga0501068_0059104 | 3300049584 | Bacteria | 2327 |
| 748 | Ga0501069_0031087 | 3300049585 | Bacteria | 2935 |
| 749 | Ga0501070_0003738 | 3300049586 | Bacteria | 13142 |
| 750 | Ga0501070_0038271 | 3300049586 | Bacteria | 4002 |
| 751 | Ga0501072_0231556 | 3300049588 | Bacteria | 1472 |
| 752 | Ga0501073_0028200 | 3300049589 | Bacteria | 4012 |
| 753 | Ga0501074_0061935 | 3300049590 | Bacteria | 2695 |
| 754 | Ga0501222_003521 | 3300049662 | Bacteria | 2136 |
| 755 | Ga0501080_0046026 | 3300049742 | Bacteria | 4063 |
| 756 | Ga0501080_0099386 | 3300049742 | Bacteria | 2700 |
| 757 | Ga0501081_0233660 | 3300049743 | Bacteria | 1340 |
| 758 | Ga0501083_0040764 | 3300049744 | Bacteria | 3151 |
| 759 | Ga0501265_000947 | 3300049762 | Bacteria | 3256 |
| 760 | Ga0501035_0000397 | 3300049822 | Bacteria | 49863 |
| 761 | Ga0501035_0030269 | 3300049822 | Bacteria | 4936 |
| 762 | Ga0501035_0227770 | 3300049822 | Bacteria | 1589 |
| 763 | Ga0501044_0000001 | 3300049823 | Bacteria | 418087 |
| 764 | Ga0501044_0004750 | 3300049823 | Bacteria | 15189 |
| 765 | Ga0501044_0048718 | 3300049823 | Bacteria | 4375 |
| 766 | Ga0501044_0078543 | 3300049823 | Bacteria | 3344 |
| 767 | Ga0501044_0230145 | 3300049823 | Bacteria | 1801 |
| 768 | Ga0501044_0235107 | 3300049823 | Bacteria | 1778 |
| 769 | Ga0501045_0011250 | 3300049824 | Bacteria | 6280 |
| 770 | nmdc:mga03n38_34483_c1 | 3300050490 | Bacteria | 2162 |
| 771 | nmdc:mga03n38_63424_c1 | 3300050490 | Bacteria | 1689 |
| 772 | nmdc:mga03n38_72078_c1 | 3300050490 | Bacteria | 1601 |
| 773 | nmdc:mga03n38_73019_c1 | 3300050490 | Bacteria | 1592 |
| 774 | nmdc:mga00v17_115752_c1 | 3300050491 | Bacteria | 1704 |
| 775 | nmdc:mga0yw44_100474_c1 | 3300050492 | Bacteria | 1842 |
| 776 | nmdc:mga0yw44_31484_c1 | 3300050492 | Bacteria | 3085 |
| 777 | nmdc:mga0k408_566_c1 | 3300050493 | Bacteria | 6669 |
| 778 | nmdc:mga06z11_41649_c1 | 3300050494 | Bacteria | 2299 |
| 779 | nmdc:mga04h51_8429_c1 | 3300050495 | Bacteria | 2757 |
| 780 | nmdc:mga07m45_10166_c1 | 3300050496 | Bacteria | 4908 |
| 781 | nmdc:mga07m45_105885_c1 | 3300050496 | Bacteria | 1618 |
| 782 | nmdc:mga07m45_2835_c1 | 3300050496 | Bacteria | 8202 |
| 783 | nmdc:mga07m45_29113_c1 | 3300050496 | Bacteria | 3052 |
| 784 | nmdc:mga07m45_6102_c1 | 3300050496 | Bacteria | 6073 |
| 785 | nmdc:mga07m45_61884_c1 | 3300050496 | Bacteria | 2120 |
| 786 | nmdc:mga07m45_8137_c1 | 3300050496 | Bacteria | 5375 |
| 787 | nmdc:mga07m45_9498_c1 | 3300050496 | Bacteria | 5048 |
| 788 | nmdc:mga08y16_100803_c1 | 3300050511 | Bacteria | 3006 |
| 789 | nmdc:mga08y16_173490_c1 | 3300050511 | Bacteria | 2239 |
| 790 | nmdc:mga08y16_34344_c1 | 3300050511 | Bacteria | 5328 |
| 791 | nmdc:mga08y16_60391_c1 | 3300050511 | Bacteria | 3960 |
| 792 | nmdc:mga0n895_9230_c1 | 3300050512 | Bacteria | 8618 |
| 793 | nmdc:mga0rr50_28637_c1 | 3300050513 | Bacteria | 3918 |
| 794 | nmdc:mga0a205_7893_c1 | 3300050515 | Bacteria | 9664 |
| 795 | nmdc:mga0sz30_3001_c1 | 3300050516 | Bacteria | 6055 |
| 796 | Ga0495612_0019088 | 3300053078 | Bacteria | 2746 |
| 797 | Ga0500635_0014548 | 3300053080 | Bacteria | 2308 |
| 798 | Ga0495595_0042851 | 3300053084 | Unclassified | 2074 |
| 799 | Ga0495619_0000176 | 3300053085 | Bacteria | 47128 |
| 800 | Ga0495619_0028237 | 3300053085 | Bacteria | 3619 |
| 801 | Ga0500578_0000263 | 3300053086 | Bacteria | 65524 |
| 802 | Ga0500578_0046520 | 3300053086 | Bacteria | 2784 |
| 803 | Ga0500643_000014 | 3300053087 | Bacteria | 318249 |
| 804 | Ga0500644_0002707 | 3300053088 | Bacteria | 4426 |
| 805 | Ga0500644_0020983 | 3300053088 | Bacteria | 1950 |
| 806 | Ga0500646_0022036 | 3300053090 | Bacteria | 1701 |
| 807 | Ga0500583_0010304 | 3300053092 | Bacteria | 3462 |
| 808 | Ga0500651_0022868 | 3300053093 | Bacteria | 3909 |
| 809 | Ga0500566_0000009 | 3300053094 | Bacteria | 131668 |
| 810 | Ga0500566_0000463 | 3300053094 | Bacteria | 22603 |
| 811 | Ga0500640_000013 | 3300053095 | Bacteria | 31437 |
| 812 | Ga0500641_0005568 | 3300053096 | Bacteria | 4460 |
| 813 | Ga0500650_0000464 | 3300053098 | Bacteria | 10143 |
| 814 | Ga0500556_0018243 | 3300053104 | Bacteria | 2211 |
| 815 | Ga0500572_000248 | 3300053111 | Bacteria | 19379 |
| 816 | Ga0500591_036935 | 3300053115 | Bacteria | 2341 |
| 817 | Ga0500593_037431 | 3300053117 | Bacteria | 2173 |
| 818 | Ga0500595_000075 | 3300053119 | Bacteria | 69432 |
| 819 | Ga0500595_001300 | 3300053119 | Bacteria | 13578 |
| 820 | Ga0500595_001390 | 3300053119 | Bacteria | 12967 |
| 821 | Ga0500595_001530 | 3300053119 | Bacteria | 12274 |
| 822 | Ga0500608_017051 | 3300053122 | Bacteria | 3293 |
| 823 | Ga0500618_008124 | 3300053125 | Bacteria | 2949 |
| 824 | Ga0500628_000977 | 3300053129 | Bacteria | 5022 |
| 825 | Ga0500642_0014027 | 3300053130 | Bacteria | 2968 |
| 826 | Ga0500652_000423 | 3300053131 | Bacteria | 15081 |
| 827 | Ga0500652_000513 | 3300053131 | Bacteria | 13653 |
| 828 | Ga0500658_0006825 | 3300053134 | Bacteria | 4223 |
| 829 | Ga0500559_0001229 | 3300053136 | Bacteria | 15171 |
| 830 | Ga0500568_0000500 | 3300053139 | Bacteria | 28859 |
| 831 | Ga0500568_0003726 | 3300053139 | Bacteria | 8350 |
| 832 | Ga0500568_0006128 | 3300053139 | Bacteria | 6092 |
| 833 | Ga0500568_0006214 | 3300053139 | Bacteria | 6032 |
| 834 | Ga0500568_0012099 | 3300053139 | Bacteria | 3978 |
| 835 | Ga0500568_0023660 | 3300053139 | Bacteria | 2612 |
| 836 | Ga0500590_010398 | 3300053148 | Bacteria | 4701 |
| 837 | Ga0500590_057115 | 3300053148 | Bacteria | 1970 |
| 838 | Ga0500603_000016 | 3300053150 | Bacteria | 56563 |
| 839 | Ga0500604_0001474 | 3300053151 | Bacteria | 6572 |
| 840 | Ga0500604_0048138 | 3300053151 | Bacteria | 1308 |
| 841 | Ga0500616_0000150 | 3300053153 | Bacteria | 117918 |
| 842 | Ga0500616_0019168 | 3300053153 | Bacteria | 3858 |
| 843 | Ga0500622_0000447 | 3300053156 | Bacteria | 39298 |
| 844 | Ga0500622_0000502 | 3300053156 | Bacteria | 36464 |
| 845 | Ga0500622_0000973 | 3300053156 | Bacteria | 24257 |
| 846 | Ga0500634_0068707 | 3300053161 | Bacteria | 1860 |
| 847 | Ga0500639_000017 | 3300053163 | Bacteria | 114464 |
| 848 | Ga0500636_0000824 | 3300053177 | Bacteria | 16693 |
| 849 | Ga0500637_0000483 | 3300053178 | Bacteria | 15404 |
| 850 | Ga0500637_0015162 | 3300053178 | Bacteria | 4079 |
| 851 | Ga0500645_009170 | 3300053730 | Bacteria | 3337 |
| 852 | Ga0500645_016506 | 3300053730 | Bacteria | 2324 |
| 853 | Ga0500596_000051 | 3300053735 | Bacteria | 15770 |
| 854 | Ga0500596_012146 | 3300053735 | Bacteria | 1310 |
| 855 | Ga0501082_0083193 | 3300060353 | Bacteria | 2761 |
| 856 | Ga0501082_0340848 | 3300060353 | Bacteria | 1306 |
| 857 | Ga0466962_0000117 | 3300061719 | Bacteria | 32210 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049581 | Ga0501047_0169296 | Ga0501047_0169296_56_1033 | 285 |
| 2 | 3300046463 | Ga0495653_0264615 | Ga0495653_0264615_124_1122 | 310 |
| 3 | 3300048929 | Ga0496126_0136764 | Ga0496126_0136764_29_1123 | 312 |
| 4 | 3300034819 | Ga0373958_0020001 | Ga0373958_0020001_143_1207 | 320 |
| 5 | 3300037466 | Ga0395898_0096379 | Ga0395898_0096379_13_1068 | 320 |
| 6 | 3300050494 | nmdc:mga06z11_41649_c1 | nmdc:mga06z11_41649_c1_215_1243 | 320 |
| 7 | 3300053115 | Ga0500591_036935 | Ga0500591_036935_1292_2329 | 320 |
| 8 | 3300047472 | Ga0495686_0109400 | Ga0495686_0109400_11_1066 | 325 |
| 9 | 3300006195 | Ga0075366_10012466 | Ga0075366_100124662 | 327 |
| 10 | 3300006353 | Ga0075370_10008336 | Ga0075370_100083364 | 327 |
| 11 | 3300050496 | nmdc:mga07m45_10166_c1 | nmdc:mga07m45_10166_c1_2391_3623 | 327 |
| 12 | 3300047673 | Ga0495593_0124683 | Ga0495593_0124683_187_1254 | 328 |
| 13 | iso_pu_bacteria | 2920760137 | 2920761788 | 328 |
| 14 | 3300031507 | Ga0307509_10001175 | Ga0307509_1000117516 | 329 |
| 15 | 3300050490 | nmdc:mga03n38_72078_c1 | nmdc:mga03n38_72078_c1_18_1097 | 329 |
| 16 | 3300046499 | Ga0495594_0118300 | Ga0495594_0118300_421_1485 | 331 |
| 17 | 3300048903 | Ga0496100_0053476 | Ga0496100_0053476_29_1102 | 332 |
| 18 | iso_pu_bacteria | 2957443900 | 2957445850 | 333 |
| 19 | iso_pu_bacteria | 2960660292 | 2960663850 | 333 |
| 20 | 3300028794 | Ga0307515_10033784 | Ga0307515_100337848 | 335 |
| 21 | 3300031507 | Ga0307509_10077533 | Ga0307509_100775332 | 341 |
| 22 | 3300049568 | Ga0501031_0000013 | Ga0501031_0000013_31903_33156 | 346 |
| 23 | 3300049569 | Ga0501032_0000061 | Ga0501032_0000061_61487_62740 | 346 |
| 24 | 3300049570 | Ga0501033_0000044 | Ga0501033_0000044_96504_97757 | 346 |
| 25 | 3300049571 | Ga0501034_0000155 | Ga0501034_0000155_96504_97757 | 346 |
| 26 | 3300049572 | Ga0501036_0000016 | Ga0501036_0000016_96504_97757 | 346 |
| 27 | 3300049573 | Ga0501037_0000033 | Ga0501037_0000033_32012_33265 | 346 |
| 28 | 3300049574 | Ga0501038_0000290 | Ga0501038_0000290_24064_25317 | 346 |
| 29 | 3300049575 | Ga0501039_0000007 | Ga0501039_0000007_96504_97757 | 346 |
| 30 | 3300049576 | Ga0501040_0077618 | Ga0501040_0077618_994_2247 | 346 |
| 31 | 3300049579 | Ga0501043_0003008 | Ga0501043_0003008_8159_9412 | 346 |
| 32 | 3300049581 | Ga0501047_0000791 | Ga0501047_0000791_29009_30262 | 346 |
| 33 | 3300049586 | Ga0501070_0003738 | Ga0501070_0003738_371_1624 | 346 |
| 34 | 3300049822 | Ga0501035_0000397 | Ga0501035_0000397_31844_33097 | 346 |
| 35 | 3300049823 | Ga0501044_0000001 | Ga0501044_0000001_17417_18670 | 346 |
| 36 | 3300053139 | Ga0500568_0003726 | Ga0500568_0003726_2680_3957 | 346 |
| 37 | 3300005985 | Ga0081539_10055593 | Ga0081539_100555932 | 347 |
| 38 | 3300006946 | Ga0079104_1002719 | Ga0079104_100271911 | 349 |
| 39 | 3300026118 | Ga0207675_100151390 | Ga0207675_1001513902 | 349 |
| 40 | 3300027111 | Ga0209281_1000185 | Ga0209281_100018555 | 349 |
| 41 | 3300042122 | Ga0450920_013347 | Ga0450920_013347_380_1522 | 349 |
| 42 | iso_pu_bacteria | 2551306092 | 2551736305 | 349 |
| 43 | 3300049570 | Ga0501033_0166728 | Ga0501033_0166728_43_1299 | 350 |
| 44 | 3300049574 | Ga0501038_0122620 | Ga0501038_0122620_755_1969 | 350 |
| 45 | 3300049743 | Ga0501081_0233660 | Ga0501081_0233660_15_1229 | 350 |
| 46 | 3300049822 | Ga0501035_0030269 | Ga0501035_0030269_2401_3657 | 350 |
| 47 | 3300049823 | Ga0501044_0078543 | Ga0501044_0078543_606_1862 | 350 |
| 48 | 3300060353 | Ga0501082_0083193 | Ga0501082_0083193_1048_2262 | 350 |
| 49 | 3300005439 | Ga0070711_100097355 | Ga0070711_1000973552 | 351 |
| 50 | 3300006175 | Ga0070712_100143062 | Ga0070712_1001430622 | 351 |
| 51 | 3300009551 | Ga0105238_10078501 | Ga0105238_100785013 | 351 |
| 52 | 3300025915 | Ga0207693_10147646 | Ga0207693_101476462 | 351 |
| 53 | 3300025916 | Ga0207663_10175850 | Ga0207663_101758501 | 351 |
| 54 | 3300025942 | Ga0207689_10020193 | Ga0207689_100201932 | 351 |
| 55 | 3300048907 | Ga0496104_0000277 | Ga0496104_0000277_41152_42399 | 351 |
| 56 | 3300048908 | Ga0496105_0010743 | Ga0496105_0010743_5733_6947 | 351 |
| 57 | 3300048911 | Ga0496108_0045123 | Ga0496108_0045123_13_1260 | 351 |
| 58 | 3300048912 | Ga0496109_0009447 | Ga0496109_0009447_4389_5636 | 351 |
| 59 | 3300048913 | Ga0496110_0209820 | Ga0496110_0209820_34_1248 | 351 |
| 60 | 3300048914 | Ga0496111_0009657 | Ga0496111_0009657_2594_3841 | 351 |
| 61 | 3300048915 | Ga0496112_0195894 | Ga0496112_0195894_138_1385 | 351 |
| 62 | 3300048916 | Ga0496113_0003658 | Ga0496113_0003658_5337_6584 | 351 |
| 63 | 3300048927 | Ga0496124_0030053 | Ga0496124_0030053_1019_2251 | 351 |
| 64 | 3300003659 | JGI25404J52841_10019938 | JGI25404J52841_100199381 | 352 |
| 65 | 3300005262 | Ga0065165_1003660 | Ga0065165_10036605 | 352 |
| 66 | 3300005983 | Ga0081540_1003122 | Ga0081540_10031226 | 352 |
| 67 | 3300009551 | Ga0105238_10006144 | Ga0105238_1000614410 | 352 |
| 68 | 3300025273 | Ga0209673_1008534 | Ga0209673_10085345 | 352 |
| 69 | 3300025906 | Ga0207699_10024636 | Ga0207699_100246362 | 352 |
| 70 | 3300037466 | Ga0395898_0063125 | Ga0395898_0063125_270_1496 | 352 |
| 71 | 3300042532 | Ga0450893_0002178 | Ga0450893_0002178_1617_2837 | 352 |
| 72 | 3300046460 | Ga0495638_0040056 | Ga0495638_0040056_1249_2469 | 352 |
| 73 | 3300050513 | nmdc:mga0rr50_28637_c1 | nmdc:mga0rr50_28637_c1_1783_3030 | 352 |
| 74 | 3300053151 | Ga0500604_0048138 | Ga0500604_0048138_15_1235 | 352 |
| 75 | 3300006195 | Ga0075366_10019567 | Ga0075366_100195674 | 353 |
| 76 | 3300031730 | Ga0307516_10082010 | Ga0307516_100820105 | 353 |
| 77 | 3300037471 | Ga0395905_0000374 | Ga0395905_0000374_12544_13845 | 353 |
| 78 | 3300048929 | Ga0496126_0156271 | Ga0496126_0156271_47_1276 | 353 |
| 79 | 3300050496 | nmdc:mga07m45_61884_c1 | nmdc:mga07m45_61884_c1_629_1846 | 353 |
| 80 | 3300053090 | Ga0500646_0022036 | Ga0500646_0022036_469_1674 | 353 |
| 81 | 3300053092 | Ga0500583_0010304 | Ga0500583_0010304_2134_3348 | 353 |
| 82 | 3300053139 | Ga0500568_0023660 | Ga0500568_0023660_300_1514 | 353 |
| 83 | 3300025254 | Ga0209148_1000420 | Ga0209148_100042032 | 354 |
| 84 | 3300025272 | Ga0209455_1000290 | Ga0209455_100029024 | 354 |
| 85 | 3300028794 | Ga0307515_10132804 | Ga0307515_101328041 | 354 |
| 86 | 3300031730 | Ga0307516_10061104 | Ga0307516_100611042 | 354 |
| 87 | 3300046460 | Ga0495638_0025665 | Ga0495638_0025665_2248_3468 | 354 |
| 88 | 3300047443 | Ga0495687_000248 | Ga0495687_000248_41317_42552 | 354 |
| 89 | 3300049823 | Ga0501044_0230145 | Ga0501044_0230145_145_1350 | 354 |
| 90 | 3300028794 | Ga0307515_10000112 | Ga0307515_1000011226 | 355 |
| 91 | 3300037471 | Ga0395905_0003009 | Ga0395905_0003009_10475_11701 | 355 |
| 92 | 3300045976 | Ga0466967_0006585 | Ga0466967_0006585_1865_3109 | 355 |
| 93 | 3300046512 | Ga0495610_0073817 | Ga0495610_0073817_274_1530 | 355 |
| 94 | 3300046519 | Ga0495632_0001413 | Ga0495632_0001413_8670_9926 | 355 |
| 95 | 3300046660 | Ga0495625_0006941 | Ga0495625_0006941_428_1660 | 355 |
| 96 | 3300046810 | Ga0495660_0028118 | Ga0495660_0028118_1565_2821 | 355 |
| 97 | 3300047443 | Ga0495687_007648 | Ga0495687_007648_4399_5655 | 355 |
| 98 | 3300049570 | Ga0501033_0121719 | Ga0501033_0121719_586_1797 | 355 |
| 99 | 3300049573 | Ga0501037_0093882 | Ga0501037_0093882_276_1493 | 355 |
| 100 | 3300049574 | Ga0501038_0077055 | Ga0501038_0077055_1156_2475 | 355 |
| 101 | 3300049574 | Ga0501038_0101096 | Ga0501038_0101096_805_2022 | 355 |
| 102 | 3300049575 | Ga0501039_0023581 | Ga0501039_0023581_3373_4590 | 355 |
| 103 | 3300049576 | Ga0501040_0054481 | Ga0501040_0054481_1518_2732 | 355 |
| 104 | 3300049580 | Ga0501046_0084959 | Ga0501046_0084959_936_2150 | 355 |
| 105 | 3300049581 | Ga0501047_0072670 | Ga0501047_0072670_1648_2862 | 355 |
| 106 | 3300049584 | Ga0501068_0059104 | Ga0501068_0059104_745_1962 | 355 |
| 107 | 3300049588 | Ga0501072_0231556 | Ga0501072_0231556_231_1451 | 355 |
| 108 | 3300049590 | Ga0501074_0061935 | Ga0501074_0061935_1112_2329 | 355 |
| 109 | 3300049742 | Ga0501080_0046026 | Ga0501080_0046026_1700_2914 | 355 |
| 110 | 3300049823 | Ga0501044_0048718 | Ga0501044_0048718_97_1314 | 355 |
| 111 | 3300049823 | Ga0501044_0235107 | Ga0501044_0235107_305_1519 | 355 |
| 112 | 3300053086 | Ga0500578_0046520 | Ga0500578_0046520_717_1973 | 355 |
| 113 | 3300053134 | Ga0500658_0006825 | Ga0500658_0006825_926_2182 | 355 |
| 114 | 3300053161 | Ga0500634_0068707 | Ga0500634_0068707_282_1496 | 355 |
| 115 | 3300005841 | Ga0068863_100007146 | Ga0068863_1000071468 | 356 |
| 116 | 3300026088 | Ga0207641_10000557 | Ga0207641_100005577 | 356 |
| 117 | 3300031507 | Ga0307509_10151997 | Ga0307509_101519971 | 356 |
| 118 | 3300032126 | Ga0307415_100168688 | Ga0307415_1001686882 | 356 |
| 119 | 3300041999 | Ga0439433_0014692 | Ga0439433_0014692_27_1241 | 356 |
| 120 | 3300042156 | Ga0439446_0000150 | Ga0439446_0000150_10353_11567 | 356 |
| 121 | 3300042435 | Ga0439434_0000316 | Ga0439434_0000316_5138_6352 | 356 |
| 122 | 3300048907 | Ga0496104_0031694 | Ga0496104_0031694_3452_4609 | 356 |
| 123 | 3300048908 | Ga0496105_0266548 | Ga0496105_0266548_48_1262 | 356 |
| 124 | 3300048912 | Ga0496109_0122570 | Ga0496109_0122570_332_1489 | 356 |
| 125 | 3300048913 | Ga0496110_0269069 | Ga0496110_0269069_60_1217 | 356 |
| 126 | 3300048918 | Ga0496115_0291620 | Ga0496115_0291620_154_1311 | 356 |
| 127 | 3300009098 | Ga0105245_10009601 | Ga0105245_100096017 | 357 |
| 128 | 3300009147 | Ga0114129_10030992 | Ga0114129_100309924 | 357 |
| 129 | 3300014497 | Ga0182008_10012706 | Ga0182008_100127065 | 357 |
| 130 | 3300026023 | Ga0207677_10126221 | Ga0207677_101262213 | 357 |
| 131 | 3300028786 | Ga0307517_10000249 | Ga0307517_1000024984 | 357 |
| 132 | 3300031730 | Ga0307516_10064210 | Ga0307516_100642103 | 357 |
| 133 | 3300041452 | Ga0451793_1434285 | Ga0451793_1434285_163_1446 | 357 |
| 134 | 3300044693 | Ga0466961_0074107 | Ga0466961_0074107_350_1567 | 357 |
| 135 | 3300048915 | Ga0496112_0000004 | Ga0496112_0000004_246197_247408 | 357 |
| 136 | 3300053088 | Ga0500644_0002707 | Ga0500644_0002707_104_1387 | 357 |
| 137 | 3300053129 | Ga0500628_000977 | Ga0500628_000977_3270_4553 | 357 |
| 138 | 3300053130 | Ga0500642_0014027 | Ga0500642_0014027_1368_2651 | 357 |
| 139 | 3300053131 | Ga0500652_000423 | Ga0500652_000423_8699_9982 | 357 |
| 140 | 3300053156 | Ga0500622_0000447 | Ga0500622_0000447_4725_6008 | 357 |
| 141 | 3300030521 | Ga0307511_10000499 | Ga0307511_100004995 | 358 |
| 142 | 3300031251 | Ga0265327_10092159 | Ga0265327_100921592 | 358 |
| 143 | 3300035113 | Ga0373936_0028913 | Ga0373936_0028913_800_2062 | 358 |
| 144 | 3300048921 | Ga0496118_0088173 | Ga0496118_0088173_859_2076 | 358 |
| 145 | 3300050495 | nmdc:mga04h51_8429_c1 | nmdc:mga04h51_8429_c1_237_1484 | 358 |
| 146 | 3300050516 | nmdc:mga0sz30_3001_c1 | nmdc:mga0sz30_3001_c1_2926_4173 | 358 |
| 147 | 3300014968 | Ga0157379_10085734 | Ga0157379_100857343 | 359 |
| 148 | 3300021441 | Ga0213871_10027702 | Ga0213871_100277021 | 359 |
| 149 | 3300039438 | Ga0436360_0924956 | Ga0436360_0924956_2526_3746 | 359 |
| 150 | 3300039447 | Ga0436361_0505806 | Ga0436361_0505806_636_1856 | 359 |
| 151 | 3300045049 | Ga0466959_0059990 | Ga0466959_0059990_281_1507 | 359 |
| 152 | 3300046518 | Ga0495631_0056940 | Ga0495631_0056940_317_1534 | 359 |
| 153 | 3300005468 | Ga0070707_100192144 | Ga0070707_1001921441 | 360 |
| 154 | 3300005841 | Ga0068863_100338906 | Ga0068863_1003389062 | 360 |
| 155 | 3300009093 | Ga0105240_10060516 | Ga0105240_100605163 | 360 |
| 156 | 3300009545 | Ga0105237_10242019 | Ga0105237_102420191 | 360 |
| 157 | 3300025913 | Ga0207695_10052282 | Ga0207695_100522823 | 360 |
| 158 | 3300048907 | Ga0496104_0258515 | Ga0496104_0258515_356_1567 | 360 |
| 159 | 3300048913 | Ga0496110_0205904 | Ga0496110_0205904_18_1229 | 360 |
| 160 | 3300048928 | Ga0496125_0001227 | Ga0496125_0001227_35779_36996 | 360 |
| 161 | 3300005937 | Ga0081455_10007694 | Ga0081455_1000769412 | 361 |
| 162 | 3300010375 | Ga0105239_10024305 | Ga0105239_100243054 | 361 |
| 163 | 3300026067 | Ga0207678_10042320 | Ga0207678_100423203 | 361 |
| 164 | 3300028794 | Ga0307515_10154087 | Ga0307515_101540872 | 361 |
| 165 | 3300031616 | Ga0307508_10000072 | Ga0307508_1000007225 | 361 |
| 166 | 3300035724 | Ga0373933_0046371 | Ga0373933_0046371_726_1877 | 361 |
| 167 | 3300046616 | Ga0495668_0088265 | Ga0495668_0088265_36_1271 | 361 |
| 168 | 3300046674 | Ga0495588_0097857 | Ga0495588_0097857_95_1312 | 361 |
| 169 | 3300047472 | Ga0495686_0068321 | Ga0495686_0068321_121_1338 | 361 |
| 170 | 3300048913 | Ga0496110_0321376 | Ga0496110_0321376_47_1258 | 361 |
| 171 | 3300048920 | Ga0496117_0033732 | Ga0496117_0033732_1289_2506 | 361 |
| 172 | 3300048920 | Ga0496117_0109159 | Ga0496117_0109159_308_1525 | 361 |
| 173 | 3300048925 | Ga0496122_0025770 | Ga0496122_0025770_201_1418 | 361 |
| 174 | 3300050492 | nmdc:mga0yw44_31484_c1 | nmdc:mga0yw44_31484_c1_1053_2270 | 361 |
| 175 | 3300053085 | Ga0495619_0028237 | Ga0495619_0028237_1829_2980 | 361 |
| 176 | 3300053088 | Ga0500644_0020983 | Ga0500644_0020983_613_1830 | 361 |
| 177 | 3300053096 | Ga0500641_0005568 | Ga0500641_0005568_31_1245 | 361 |
| 178 | 3300053098 | Ga0500650_0000464 | Ga0500650_0000464_4540_5757 | 361 |
| 179 | 3300053104 | Ga0500556_0018243 | Ga0500556_0018243_155_1372 | 361 |
| 180 | 3300053117 | Ga0500593_037431 | Ga0500593_037431_902_2119 | 361 |
| 181 | 3300053131 | Ga0500652_000513 | Ga0500652_000513_4122_5339 | 361 |
| 182 | 3300053139 | Ga0500568_0006128 | Ga0500568_0006128_4596_5813 | 361 |
| 183 | 3300053151 | Ga0500604_0001474 | Ga0500604_0001474_2720_3937 | 361 |
| 184 | 3300053156 | Ga0500622_0000502 | Ga0500622_0000502_20438_21655 | 361 |
| 185 | 3300031649 | Ga0307514_10041387 | Ga0307514_100413873 | 362 |
| 186 | 3300037471 | Ga0395905_0105527 | Ga0395905_0105527_1202_2410 | 362 |
| 187 | 3300053178 | Ga0500637_0015162 | Ga0500637_0015162_1708_2913 | 362 |
| 188 | 3300005616 | Ga0068852_100110232 | Ga0068852_1001102323 | 363 |
| 189 | 3300005617 | Ga0068859_100334942 | Ga0068859_1003349421 | 363 |
| 190 | 3300006931 | Ga0097620_100334959 | Ga0097620_1003349591 | 363 |
| 191 | 3300026142 | Ga0207698_10089502 | Ga0207698_100895023 | 363 |
| 192 | 3300028794 | Ga0307515_10000305 | Ga0307515_10000305120 | 363 |
| 193 | 3300028794 | Ga0307515_10082891 | Ga0307515_100828913 | 363 |
| 194 | 3300031649 | Ga0307514_10028882 | Ga0307514_100288823 | 363 |
| 195 | 3300037471 | Ga0395905_0000697 | Ga0395905_0000697_11830_13050 | 363 |
| 196 | 3300039437 | Ga0436365_1765855 | Ga0436365_1765855_777_1982 | 363 |
| 197 | 3300048919 | Ga0496116_0001246 | Ga0496116_0001246_10253_11470 | 363 |
| 198 | 3300048929 | Ga0496126_0060043 | Ga0496126_0060043_1938_3152 | 363 |
| 199 | 3300049571 | Ga0501034_0227900 | Ga0501034_0227900_523_1734 | 363 |
| 200 | 3300025273 | Ga0209673_1000030 | Ga0209673_1000030140 | 364 |
| 201 | 3300031616 | Ga0307508_10002376 | Ga0307508_1000237615 | 364 |
| 202 | 3300045049 | Ga0466959_0117709 | Ga0466959_0117709_24_1256 | 364 |
| 203 | 3300053139 | Ga0500568_0012099 | Ga0500568_0012099_2144_3376 | 364 |
| 204 | 3300005548 | Ga0070665_100096284 | Ga0070665_1000962844 | 365 |
| 205 | 3300005937 | Ga0081455_10162057 | Ga0081455_101620571 | 365 |
| 206 | 3300006353 | Ga0075370_10003024 | Ga0075370_100030246 | 365 |
| 207 | 3300006844 | Ga0075428_100251449 | Ga0075428_1002514492 | 365 |
| 208 | 3300006943 | Ga0099822_1006420 | Ga0099822_10064205 | 365 |
| 209 | 3300026095 | Ga0207676_10042731 | Ga0207676_100427314 | 365 |
| 210 | 3300027357 | Ga0209589_1000001 | Ga0209589_1000001102 | 365 |
| 211 | 3300027361 | Ga0209489_100001 | Ga0209489_100001102 | 365 |
| 212 | 3300027363 | Ga0209700_100001 | Ga0209700_100001102 | 365 |
| 213 | 3300028379 | Ga0268266_10232940 | Ga0268266_102329402 | 365 |
| 214 | 3300031901 | Ga0307406_10027612 | Ga0307406_100276123 | 365 |
| 215 | 3300035114 | Ga0373939_0000105 | Ga0373939_0000105_16761_17987 | 365 |
| 216 | 3300035121 | Ga0373960_0003723 | Ga0373960_0003723_274_1500 | 365 |
| 217 | 3300035691 | Ga0373931_0004715 | Ga0373931_0004715_4806_6032 | 365 |
| 218 | 3300044693 | Ga0466961_0004454 | Ga0466961_0004454_392_1669 | 365 |
| 219 | 3300045836 | Ga0466958_0005689 | Ga0466958_0005689_2403_3680 | 365 |
| 220 | 3300046616 | Ga0495668_0066881 | Ga0495668_0066881_122_1372 | 365 |
| 221 | 3300048929 | Ga0496126_0075712 | Ga0496126_0075712_1671_2891 | 365 |
| 222 | 3300050496 | nmdc:mga07m45_9498_c1 | nmdc:mga07m45_9498_c1_1149_2420 | 365 |
| 223 | 3300005434 | Ga0070709_10121061 | Ga0070709_101210612 | 366 |
| 224 | 3300005435 | Ga0070714_100097495 | Ga0070714_1000974952 | 366 |
| 225 | 3300005546 | Ga0070696_100024364 | Ga0070696_1000243643 | 366 |
| 226 | 3300031507 | Ga0307509_10004311 | Ga0307509_100043118 | 366 |
| 227 | 3300031730 | Ga0307516_10015162 | Ga0307516_100151629 | 366 |
| 228 | 3300037471 | Ga0395905_0026559 | Ga0395905_0026559_4152_5387 | 366 |
| 229 | 3300037853 | Ga0436364_1234034 | Ga0436364_1234034_284_1516 | 366 |
| 230 | 3300053139 | Ga0500568_0006214 | Ga0500568_0006214_1420_2631 | 366 |
| 231 | 3300003215 | JGI25153J46596_10004173 | JGI25153J46596_100041736 | 367 |
| 232 | 3300003758 | Ga0055532_1000487 | Ga0055532_10004871 | 367 |
| 233 | 3300003761 | Ga0055535_1000645 | Ga0055535_100064514 | 367 |
| 234 | 3300003762 | Ga0055542_1000667 | Ga0055542_100066714 | 367 |
| 235 | 3300003763 | Ga0055529_1000485 | Ga0055529_100048514 | 367 |
| 236 | 3300003856 | Ga0058692_1007459 | Ga0058692_10074593 | 367 |
| 237 | 3300005338 | Ga0068868_100089535 | Ga0068868_1000895353 | 367 |
| 238 | 3300005344 | Ga0070661_100011984 | Ga0070661_1000119841 | 367 |
| 239 | 3300005366 | Ga0070659_100255603 | Ga0070659_1002556032 | 367 |
| 240 | 3300005455 | Ga0070663_100049819 | Ga0070663_1000498192 | 367 |
| 241 | 3300005539 | Ga0068853_100006217 | Ga0068853_1000062176 | 367 |
| 242 | 3300005539 | Ga0068853_100157379 | Ga0068853_1001573792 | 367 |
| 243 | 3300005563 | Ga0068855_100112346 | Ga0068855_1001123462 | 367 |
| 244 | 3300005614 | Ga0068856_100092848 | Ga0068856_1000928482 | 367 |
| 245 | 3300005937 | Ga0081455_10021438 | Ga0081455_100214385 | 367 |
| 246 | 3300005983 | Ga0081540_1000430 | Ga0081540_10004304 | 367 |
| 247 | 3300005983 | Ga0081540_1003695 | Ga0081540_10036958 | 367 |
| 248 | 3300006042 | Ga0075368_10029402 | Ga0075368_100294022 | 367 |
| 249 | 3300006051 | Ga0075364_10047344 | Ga0075364_100473443 | 367 |
| 250 | 3300006178 | Ga0075367_10011824 | Ga0075367_100118245 | 367 |
| 251 | 3300006178 | Ga0075367_10057130 | Ga0075367_100571302 | 367 |
| 252 | 3300006195 | Ga0075366_10060384 | Ga0075366_100603842 | 367 |
| 253 | 3300009093 | Ga0105240_10015349 | Ga0105240_100153493 | 367 |
| 254 | 3300009098 | Ga0105245_10079039 | Ga0105245_100790392 | 367 |
| 255 | 3300009174 | Ga0105241_10023623 | Ga0105241_100236232 | 367 |
| 256 | 3300009177 | Ga0105248_10037249 | Ga0105248_100372493 | 367 |
| 257 | 3300009545 | Ga0105237_10005346 | Ga0105237_1000534610 | 367 |
| 258 | 3300010375 | Ga0105239_10027738 | Ga0105239_100277385 | 367 |
| 259 | 3300022739 | Ga0228711_1000005 | Ga0228711_1000005144 | 367 |
| 260 | 3300022740 | Ga0228710_1000141 | Ga0228710_10001414 | 367 |
| 261 | 3300025225 | Ga0209566_100744 | Ga0209566_10074417 | 367 |
| 262 | 3300025228 | Ga0209672_100014 | Ga0209672_100014229 | 367 |
| 263 | 3300025229 | Ga0209147_100104 | Ga0209147_10010452 | 367 |
| 264 | 3300025242 | Ga0209258_100040 | Ga0209258_100040276 | 367 |
| 265 | 3300025254 | Ga0209148_1000035 | Ga0209148_1000035276 | 367 |
| 266 | 3300025254 | Ga0209148_1002212 | Ga0209148_10022128 | 367 |
| 267 | 3300025261 | Ga0209233_1008977 | Ga0209233_10089772 | 367 |
| 268 | 3300025272 | Ga0209455_1000072 | Ga0209455_1000072176 | 367 |
| 269 | 3300025297 | Ga0209758_1008732 | Ga0209758_10087324 | 367 |
| 270 | 3300025941 | Ga0207711_10038488 | Ga0207711_100384882 | 367 |
| 271 | 3300025949 | Ga0207667_10213867 | Ga0207667_102138671 | 367 |
| 272 | 3300026041 | Ga0207639_10048147 | Ga0207639_100481474 | 367 |
| 273 | 3300026041 | Ga0207639_10145366 | Ga0207639_101453662 | 367 |
| 274 | 3300026067 | Ga0207678_10004789 | Ga0207678_100047897 | 367 |
| 275 | 3300026095 | Ga0207676_10241343 | Ga0207676_102413431 | 367 |
| 276 | 3300026121 | Ga0207683_10288810 | Ga0207683_102888101 | 367 |
| 277 | 3300027111 | Ga0209281_1000111 | Ga0209281_1000111144 | 367 |
| 278 | 3300027312 | Ga0209371_1000079 | Ga0209371_100007925 | 367 |
| 279 | 3300027666 | Ga0209282_1000012 | Ga0209282_1000012144 | 367 |
| 280 | 3300028379 | Ga0268266_10026905 | Ga0268266_100269051 | 367 |
| 281 | 3300028380 | Ga0268265_10063058 | Ga0268265_100630582 | 367 |
| 282 | 3300028381 | Ga0268264_10000149 | Ga0268264_1000014925 | 367 |
| 283 | 3300030500 | Ga0268256_1000090 | Ga0268256_100009028 | 367 |
| 284 | 3300031711 | Ga0265314_10019075 | Ga0265314_100190759 | 367 |
| 285 | 3300031967 | Ga0315914_1000007 | Ga0315914_100000770 | 367 |
| 286 | 3300033430 | Ga0315913_1000003 | Ga0315913_1000003144 | 367 |
| 287 | 3300033464 | Ga0315915_1000011 | Ga0315915_100001170 | 367 |
| 288 | 3300046475 | Ga0495639_0088521 | Ga0495639_0088521_200_1414 | 367 |
| 289 | 3300046674 | Ga0495588_0013610 | Ga0495588_0013610_1162_2376 | 367 |
| 290 | 3300048905 | Ga0496102_0139192 | Ga0496102_0139192_633_1844 | 367 |
| 291 | 3300048915 | Ga0496112_0158815 | Ga0496112_0158815_293_1504 | 367 |
| 292 | 3300048924 | Ga0496121_0001728 | Ga0496121_0001728_1689_2900 | 367 |
| 293 | 3300049571 | Ga0501034_0099144 | Ga0501034_0099144_550_1758 | 367 |
| 294 | 3300049574 | Ga0501038_0022383 | Ga0501038_0022383_4185_5393 | 367 |
| 295 | 3300049580 | Ga0501046_0026043 | Ga0501046_0026043_1219_2421 | 367 |
| 296 | 3300049585 | Ga0501069_0031087 | Ga0501069_0031087_1269_2480 | 367 |
| 297 | 3300049822 | Ga0501035_0227770 | Ga0501035_0227770_65_1273 | 367 |
| 298 | 3300049823 | Ga0501044_0004750 | Ga0501044_0004750_4924_6132 | 367 |
| 299 | 3300050490 | nmdc:mga03n38_34483_c1 | nmdc:mga03n38_34483_c1_508_1719 | 367 |
| 300 | 3300050491 | nmdc:mga00v17_115752_c1 | nmdc:mga00v17_115752_c1_32_1243 | 367 |
| 301 | 3300050496 | nmdc:mga07m45_105885_c1 | nmdc:mga07m45_105885_c1_22_1233 | 367 |
| 302 | 3300053153 | Ga0500616_0019168 | Ga0500616_0019168_2093_3331 | 367 |
| 303 | 3300053730 | Ga0500645_009170 | Ga0500645_009170_1032_2246 | 367 |
| 304 | 3300003323 | rootH1_10034711 | rootH1_100347114 | 368 |
| 305 | 3300005355 | Ga0070671_100130488 | Ga0070671_1001304881 | 368 |
| 306 | 3300005456 | Ga0070678_100032249 | Ga0070678_1000322491 | 368 |
| 307 | 3300006048 | Ga0075363_100001666 | Ga0075363_1000016665 | 368 |
| 308 | 3300006048 | Ga0075363_100163292 | Ga0075363_1001632921 | 368 |
| 309 | 3300006178 | Ga0075367_10012672 | Ga0075367_100126721 | 368 |
| 310 | 3300006178 | Ga0075367_10013751 | Ga0075367_100137512 | 368 |
| 311 | 3300006353 | Ga0075370_10023284 | Ga0075370_100232841 | 368 |
| 312 | 3300006353 | Ga0075370_10074949 | Ga0075370_100749492 | 368 |
| 313 | 3300009101 | Ga0105247_10078735 | Ga0105247_100787352 | 368 |
| 314 | 3300009174 | Ga0105241_10014736 | Ga0105241_100147363 | 368 |
| 315 | 3300010375 | Ga0105239_10078805 | Ga0105239_100788054 | 368 |
| 316 | 3300011119 | Ga0105246_10006065 | Ga0105246_100060657 | 368 |
| 317 | 3300013306 | Ga0163162_10105133 | Ga0163162_101051333 | 368 |
| 318 | 3300025901 | Ga0207688_10099259 | Ga0207688_100992592 | 368 |
| 319 | 3300025907 | Ga0207645_10137230 | Ga0207645_101372301 | 368 |
| 320 | 3300025908 | Ga0207643_10009590 | Ga0207643_100095903 | 368 |
| 321 | 3300025913 | Ga0207695_10000910 | Ga0207695_1000091048 | 368 |
| 322 | 3300025972 | Ga0207668_10137508 | Ga0207668_101375081 | 368 |
| 323 | 3300026023 | Ga0207677_10033178 | Ga0207677_100331782 | 368 |
| 324 | 3300026023 | Ga0207677_10200032 | Ga0207677_102000322 | 368 |
| 325 | 3300026067 | Ga0207678_10016652 | Ga0207678_100166526 | 368 |
| 326 | 3300026075 | Ga0207708_10148399 | Ga0207708_101483992 | 368 |
| 327 | 3300028379 | Ga0268266_10001162 | Ga0268266_1000116214 | 368 |
| 328 | 3300028380 | Ga0268265_10364830 | Ga0268265_103648301 | 368 |
| 329 | 3300031507 | Ga0307509_10031909 | Ga0307509_100319097 | 368 |
| 330 | 3300031731 | Ga0307405_10056976 | Ga0307405_100569762 | 368 |
| 331 | 3300033180 | Ga0307510_10002529 | Ga0307510_100025293 | 368 |
| 332 | 3300037418 | Ga0395900_0021186 | Ga0395900_0021186_3133_4338 | 368 |
| 333 | 3300037466 | Ga0395898_0011538 | Ga0395898_0011538_6990_8195 | 368 |
| 334 | 3300037471 | Ga0395905_0000016 | Ga0395905_0000016_161896_163128 | 368 |
| 335 | 3300038443 | Ga0395901_0021993 | Ga0395901_0021993_5226_6431 | 368 |
| 336 | 3300046457 | Ga0495590_0053025 | Ga0495590_0053025_42_1256 | 368 |
| 337 | 3300046460 | Ga0495638_0074296 | Ga0495638_0074296_344_1558 | 368 |
| 338 | 3300046501 | Ga0495607_0061847 | Ga0495607_0061847_407_1621 | 368 |
| 339 | 3300046519 | Ga0495632_0004544 | Ga0495632_0004544_1378_2655 | 368 |
| 340 | 3300046523 | Ga0495644_0024072 | Ga0495644_0024072_492_1706 | 368 |
| 341 | 3300046524 | Ga0495648_0072804 | Ga0495648_0072804_749_1963 | 368 |
| 342 | 3300046558 | Ga0495633_0028261 | Ga0495633_0028261_988_2202 | 368 |
| 343 | 3300046615 | Ga0495656_0003759 | Ga0495656_0003759_3702_4916 | 368 |
| 344 | 3300047318 | Ga0495636_0039860 | Ga0495636_0039860_159_1373 | 368 |
| 345 | 3300047469 | Ga0495673_0021977 | Ga0495673_0021977_1412_2623 | 368 |
| 346 | 3300048909 | Ga0496106_0072635 | Ga0496106_0072635_1343_2554 | 368 |
| 347 | 3300048911 | Ga0496108_0005114 | Ga0496108_0005114_2477_3688 | 368 |
| 348 | 3300048913 | Ga0496110_0034834 | Ga0496110_0034834_1522_2733 | 368 |
| 349 | 3300048914 | Ga0496111_0065631 | Ga0496111_0065631_1275_2486 | 368 |
| 350 | 3300048918 | Ga0496115_0001987 | Ga0496115_0001987_3555_4766 | 368 |
| 351 | 3300048929 | Ga0496126_0005037 | Ga0496126_0005037_5656_6870 | 368 |
| 352 | 3300050490 | nmdc:mga03n38_63424_c1 | nmdc:mga03n38_63424_c1_185_1399 | 368 |
| 353 | 3300050490 | nmdc:mga03n38_73019_c1 | nmdc:mga03n38_73019_c1_183_1400 | 368 |
| 354 | 3300050496 | nmdc:mga07m45_8137_c1 | nmdc:mga07m45_8137_c1_185_1399 | 368 |
| 355 | 3300005458 | Ga0070681_10018623 | Ga0070681_100186237 | 369 |
| 356 | 3300005614 | Ga0068856_100001367 | Ga0068856_10000136724 | 369 |
| 357 | 3300021320 | Ga0214544_1000130 | Ga0214544_1000130108 | 369 |
| 358 | 3300025912 | Ga0207707_10002222 | Ga0207707_1000222219 | 369 |
| 359 | 3300025921 | Ga0207652_10047896 | Ga0207652_100478963 | 369 |
| 360 | 3300025940 | Ga0207691_10110334 | Ga0207691_101103342 | 369 |
| 361 | 3300026078 | Ga0207702_10000761 | Ga0207702_1000076122 | 369 |
| 362 | 3300037466 | Ga0395898_0076260 | Ga0395898_0076260_1701_2924 | 369 |
| 363 | 3300039437 | Ga0436365_1808909 | Ga0436365_1808909_1886_3280 | 369 |
| 364 | 3300044719 | Ga0466971_0004450 | Ga0466971_0004450_1163_2458 | 369 |
| 365 | 3300044765 | Ga0466970_0001623 | Ga0466970_0001623_4169_5455 | 369 |
| 366 | 3300044901 | Ga0466960_0081901 | Ga0466960_0081901_117_1454 | 369 |
| 367 | 3300061719 | Ga0466962_0000117 | Ga0466962_0000117_27997_29292 | 369 |
| 368 | 3300005436 | Ga0070713_100043527 | Ga0070713_1000435271 | 370 |
| 369 | 3300005614 | Ga0068856_100001863 | Ga0068856_10000186311 | 370 |
| 370 | 3300011119 | Ga0105246_10216145 | Ga0105246_102161451 | 370 |
| 371 | 3300025295 | Ga0209564_1019094 | Ga0209564_10190942 | 370 |
| 372 | 3300025297 | Ga0209758_1014674 | Ga0209758_10146743 | 370 |
| 373 | 3300025928 | Ga0207700_10040248 | Ga0207700_100402482 | 370 |
| 374 | 3300026078 | Ga0207702_10000106 | Ga0207702_1000010670 | 370 |
| 375 | 3300027717 | Ga0209998_10006506 | Ga0209998_100065063 | 370 |
| 376 | 3300030521 | Ga0307511_10026995 | Ga0307511_100269953 | 370 |
| 377 | 3300031235 | Ga0265330_10005426 | Ga0265330_100054262 | 370 |
| 378 | 3300031238 | Ga0265332_10029936 | Ga0265332_100299361 | 370 |
| 379 | 3300031247 | Ga0265340_10000710 | Ga0265340_100007101 | 370 |
| 380 | 3300031507 | Ga0307509_10239140 | Ga0307509_102391401 | 370 |
| 381 | 3300031711 | Ga0265314_10011610 | Ga0265314_100116105 | 370 |
| 382 | 3300032002 | Ga0307416_100033232 | Ga0307416_1000332323 | 370 |
| 383 | 3300033179 | Ga0307507_10013480 | Ga0307507_100134807 | 370 |
| 384 | 3300033442 | Ga0315911_1000006 | Ga0315911_100000648 | 370 |
| 385 | 3300035692 | Ga0373935_0084706 | Ga0373935_0084706_656_1867 | 370 |
| 386 | 3300046454 | Ga0495592_0000322 | Ga0495592_0000322_12697_13932 | 370 |
| 387 | 3300047320 | Ga0495672_0009646 | Ga0495672_0009646_1779_3008 | 370 |
| 388 | 3300048924 | Ga0496121_0001254 | Ga0496121_0001254_21599_22810 | 370 |
| 389 | 3300048925 | Ga0496122_0010121 | Ga0496122_0010121_4616_5836 | 370 |
| 390 | 3300048929 | Ga0496126_0007721 | Ga0496126_0007721_9547_10767 | 370 |
| 391 | 3300049762 | Ga0501265_000947 | Ga0501265_000947_1360_2592 | 370 |
| 392 | 3300053080 | Ga0500635_0014548 | Ga0500635_0014548_900_2114 | 370 |
| 393 | 3300053119 | Ga0500595_001300 | Ga0500595_001300_9217_10428 | 370 |
| 394 | 3300053119 | Ga0500595_001390 | Ga0500595_001390_5416_6627 | 370 |
| 395 | 3300053153 | Ga0500616_0000150 | Ga0500616_0000150_48236_49453 | 370 |
| 396 | 3300053178 | Ga0500637_0000483 | Ga0500637_0000483_10291_11502 | 370 |
| 397 | 3300005347 | Ga0070668_100049968 | Ga0070668_1000499683 | 371 |
| 398 | 3300005356 | Ga0070674_100037323 | Ga0070674_1000373233 | 371 |
| 399 | 3300005365 | Ga0070688_100062477 | Ga0070688_1000624772 | 371 |
| 400 | 3300005365 | Ga0070688_100112071 | Ga0070688_1001120712 | 371 |
| 401 | 3300005456 | Ga0070678_100064892 | Ga0070678_1000648923 | 371 |
| 402 | 3300005458 | Ga0070681_10082606 | Ga0070681_100826062 | 371 |
| 403 | 3300005535 | Ga0070684_100119270 | Ga0070684_1001192702 | 371 |
| 404 | 3300005563 | Ga0068855_100025743 | Ga0068855_1000257436 | 371 |
| 405 | 3300005578 | Ga0068854_100049351 | Ga0068854_1000493511 | 371 |
| 406 | 3300005578 | Ga0068854_100112613 | Ga0068854_1001126132 | 371 |
| 407 | 3300005719 | Ga0068861_100087742 | Ga0068861_1000877422 | 371 |
| 408 | 3300005843 | Ga0068860_100120072 | Ga0068860_1001200722 | 371 |
| 409 | 3300006881 | Ga0068865_100048816 | Ga0068865_1000488163 | 371 |
| 410 | 3300009093 | Ga0105240_10082573 | Ga0105240_100825732 | 371 |
| 411 | 3300009553 | Ga0105249_10064400 | Ga0105249_100644002 | 371 |
| 412 | 3300010375 | Ga0105239_10443021 | Ga0105239_104430212 | 371 |
| 413 | 3300013306 | Ga0163162_10288935 | Ga0163162_102889352 | 371 |
| 414 | 3300013308 | Ga0157375_10042147 | Ga0157375_100421474 | 371 |
| 415 | 3300014326 | Ga0157380_10078449 | Ga0157380_100784492 | 371 |
| 416 | 3300025909 | Ga0207705_10095723 | Ga0207705_100957233 | 371 |
| 417 | 3300025912 | Ga0207707_10094516 | Ga0207707_100945163 | 371 |
| 418 | 3300025913 | Ga0207695_10243577 | Ga0207695_102435771 | 371 |
| 419 | 3300025923 | Ga0207681_10215298 | Ga0207681_102152981 | 371 |
| 420 | 3300025928 | Ga0207700_10062918 | Ga0207700_100629183 | 371 |
| 421 | 3300025929 | Ga0207664_10084044 | Ga0207664_100840442 | 371 |
| 422 | 3300025933 | Ga0207706_10018459 | Ga0207706_100184596 | 371 |
| 423 | 3300025940 | Ga0207691_10132839 | Ga0207691_101328392 | 371 |
| 424 | 3300025972 | Ga0207668_10085779 | Ga0207668_100857793 | 371 |
| 425 | 3300025981 | Ga0207640_10038292 | Ga0207640_100382921 | 371 |
| 426 | 3300026089 | Ga0207648_10145222 | Ga0207648_101452221 | 371 |
| 427 | 3300026118 | Ga0207675_100037251 | Ga0207675_1000372513 | 371 |
| 428 | 3300026121 | Ga0207683_10088182 | Ga0207683_100881821 | 371 |
| 429 | 3300028379 | Ga0268266_10030473 | Ga0268266_100304733 | 371 |
| 430 | 3300028381 | Ga0268264_10320483 | Ga0268264_103204832 | 371 |
| 431 | 3300028381 | Ga0268264_10391601 | Ga0268264_103916011 | 371 |
| 432 | 3300031456 | Ga0307513_10113846 | Ga0307513_101138462 | 371 |
| 433 | 3300031712 | Ga0265342_10054655 | Ga0265342_100546552 | 371 |
| 434 | 3300032002 | Ga0307416_100058427 | Ga0307416_1000584274 | 371 |
| 435 | 3300032126 | Ga0307415_100100709 | Ga0307415_1001007091 | 371 |
| 436 | 3300033180 | Ga0307510_10086716 | Ga0307510_100867163 | 371 |
| 437 | 3300046459 | Ga0495629_0121590 | Ga0495629_0121590_107_1321 | 371 |
| 438 | 3300046523 | Ga0495644_0033741 | Ga0495644_0033741_625_1836 | 371 |
| 439 | 3300046558 | Ga0495633_0108569 | Ga0495633_0108569_45_1256 | 371 |
| 440 | 3300046615 | Ga0495656_0028162 | Ga0495656_0028162_248_1459 | 371 |
| 441 | 3300046664 | Ga0495659_0050390 | Ga0495659_0050390_68_1279 | 371 |
| 442 | 3300046691 | Ga0495670_0072209 | Ga0495670_0072209_258_1469 | 371 |
| 443 | 3300048090 | Ga0495615_0007287 | Ga0495615_0007287_218_1429 | 371 |
| 444 | 3300048929 | Ga0496126_0015170 | Ga0496126_0015170_1696_2919 | 371 |
| 445 | 3300050511 | nmdc:mga08y16_173490_c1 | nmdc:mga08y16_173490_c1_561_1772 | 371 |
| 446 | 3300050512 | nmdc:mga0n895_9230_c1 | nmdc:mga0n895_9230_c1_4577_5761 | 371 |
| 447 | 3300050515 | nmdc:mga0a205_7893_c1 | nmdc:mga0a205_7893_c1_3958_5142 | 371 |
| 448 | 3300053139 | Ga0500568_0000500 | Ga0500568_0000500_1877_3088 | 371 |
| 449 | 3300006195 | Ga0075366_10005924 | Ga0075366_100059247 | 372 |
| 450 | 3300006353 | Ga0075370_10000054 | Ga0075370_1000005422 | 372 |
| 451 | 3300025297 | Ga0209758_1001092 | Ga0209758_10010924 | 372 |
| 452 | 3300025912 | Ga0207707_10033012 | Ga0207707_100330125 | 372 |
| 453 | 3300025913 | Ga0207695_10287245 | Ga0207695_102872451 | 372 |
| 454 | 3300025933 | Ga0207706_10068405 | Ga0207706_100684053 | 372 |
| 455 | 3300026067 | Ga0207678_10142331 | Ga0207678_101423312 | 372 |
| 456 | 3300026116 | Ga0207674_10078198 | Ga0207674_100781984 | 372 |
| 457 | 3300031731 | Ga0307405_10087039 | Ga0307405_100870392 | 372 |
| 458 | 3300031824 | Ga0307413_10050405 | Ga0307413_100504053 | 372 |
| 459 | 3300031852 | Ga0307410_10007285 | Ga0307410_100072854 | 372 |
| 460 | 3300031995 | Ga0307409_100025031 | Ga0307409_1000250313 | 372 |
| 461 | 3300045976 | Ga0466967_0058613 | Ga0466967_0058613_1890_3125 | 372 |
| 462 | 3300046557 | Ga0495622_0097391 | Ga0495622_0097391_31_1248 | 372 |
| 463 | 3300048905 | Ga0496102_0003487 | Ga0496102_0003487_147_1379 | 372 |
| 464 | 3300048918 | Ga0496115_0037006 | Ga0496115_0037006_1680_2900 | 372 |
| 465 | 3300048928 | Ga0496125_0108472 | Ga0496125_0108472_612_1829 | 372 |
| 466 | 3300049571 | Ga0501034_0115571 | Ga0501034_0115571_362_1600 | 372 |
| 467 | 3300050493 | nmdc:mga0k408_566_c1 | nmdc:mga0k408_566_c1_287_1519 | 372 |
| 468 | 3300050496 | nmdc:mga07m45_2835_c1 | nmdc:mga07m45_2835_c1_4723_5955 | 372 |
| 469 | 3300053093 | Ga0500651_0022868 | Ga0500651_0022868_12_1433 | 372 |
| 470 | 3300053094 | Ga0500566_0000463 | Ga0500566_0000463_6398_7615 | 372 |
| 471 | 3300053119 | Ga0500595_001530 | Ga0500595_001530_9412_10623 | 372 |
| 472 | 3300053122 | Ga0500608_017051 | Ga0500608_017051_350_1567 | 372 |
| 473 | 3300053125 | Ga0500618_008124 | Ga0500618_008124_866_2083 | 372 |
| 474 | 3300053136 | Ga0500559_0001229 | Ga0500559_0001229_3934_5151 | 372 |
| 475 | 3300053177 | Ga0500636_0000824 | Ga0500636_0000824_5283_6500 | 372 |
| 476 | 3300053735 | Ga0500596_012146 | Ga0500596_012146_82_1299 | 372 |
| 477 | iso_pu_bacteria | 2512875026 | 2512968871 | 372 |
| 478 | iso_pu_bacteria | 8003999396 | 8004004848 | 372 |
| 479 | 3300003203 | JGI25406J46586_10000047 | JGI25406J46586_1000004730 | 373 |
| 480 | 3300005338 | Ga0068868_100254042 | Ga0068868_1002540422 | 373 |
| 481 | 3300005985 | Ga0081539_10000140 | Ga0081539_1000014083 | 373 |
| 482 | 3300006038 | Ga0075365_10102264 | Ga0075365_101022642 | 373 |
| 483 | 3300030522 | Ga0307512_10043165 | Ga0307512_100431654 | 373 |
| 484 | 3300031507 | Ga0307509_10002906 | Ga0307509_1000290624 | 373 |
| 485 | 3300031852 | Ga0307410_10048850 | Ga0307410_100488503 | 373 |
| 486 | 3300031901 | Ga0307406_10049264 | Ga0307406_100492642 | 373 |
| 487 | 3300042436 | Ga0439435_0000897 | Ga0439435_0000897_3757_4971 | 373 |
| 488 | 3300045976 | Ga0466967_0021602 | Ga0466967_0021602_625_1851 | 373 |
| 489 | 3300046512 | Ga0495610_0002018 | Ga0495610_0002018_11146_12396 | 373 |
| 490 | 3300048909 | Ga0496106_0074522 | Ga0496106_0074522_469_1656 | 373 |
| 491 | 3300048929 | Ga0496126_0008802 | Ga0496126_0008802_4466_5710 | 373 |
| 492 | 3300048929 | Ga0496126_0210219 | Ga0496126_0210219_360_1589 | 373 |
| 493 | 3300005329 | Ga0070683_100008752 | Ga0070683_1000087523 | 374 |
| 494 | 3300005459 | Ga0068867_100148148 | Ga0068867_1001481482 | 374 |
| 495 | 3300005535 | Ga0070684_100004025 | Ga0070684_1000040258 | 374 |
| 496 | 3300025906 | Ga0207699_10046650 | Ga0207699_100466503 | 374 |
| 497 | 3300025944 | Ga0207661_10003202 | Ga0207661_100032024 | 374 |
| 498 | 3300027876 | Ga0209974_10007537 | Ga0209974_100075374 | 374 |
| 499 | 3300037466 | Ga0395898_0177440 | Ga0395898_0177440_169_1383 | 374 |
| 500 | iso_pu_bacteria | 2516653046 | 2516895670 | 374 |
| 501 | iso_pu_bacteria | 2599185239 | 2599736624 | 374 |
| 502 | iso_pu_bacteria | 2643221550 | 2643770476 | 374 |
| 503 | iso_pu_bacteria | 2921257292 | 2921259298 | 374 |
| 504 | iso_pu_bacteria | 2937023124 | 2937025324 | 374 |
| 505 | iso_pu_bacteria | 2957395598 | 2957400103 | 374 |
| 506 | iso_pu_bacteria | 2964615318 | 2964620222 | 374 |
| 507 | iso_pu_bacteria | 2967755722 | 2967755818 | 374 |
| 508 | iso_pu_bacteria | 2970102677 | 2970102773 | 374 |
| 509 | iso_pu_bacteria | 2981990288 | 2981994762 | 374 |
| 510 | 3300005530 | Ga0070679_100240777 | Ga0070679_1002407771 | 375 |
| 511 | 3300005563 | Ga0068855_100030991 | Ga0068855_1000309917 | 375 |
| 512 | 3300013297 | Ga0157378_10140977 | Ga0157378_101409772 | 375 |
| 513 | 3300025921 | Ga0207652_10083224 | Ga0207652_100832243 | 375 |
| 514 | 3300025961 | Ga0207712_10008695 | Ga0207712_100086958 | 375 |
| 515 | 3300046462 | Ga0495651_0114037 | Ga0495651_0114037_298_1494 | 375 |
| 516 | 3300046529 | Ga0495652_0106723 | Ga0495652_0106723_680_1876 | 375 |
| 517 | 3300053084 | Ga0495595_0042851 | Ga0495595_0042851_367_1563 | 375 |
| 518 | iso_pu_bacteria | 2508501122 | 2509110609 | 375 |
| 519 | iso_pu_bacteria | 2509276019 | 2509377428 | 375 |
| 520 | iso_pu_bacteria | 2510065057 | 2510303102 | 375 |
| 521 | iso_pu_bacteria | 2511231052 | 2511497100 | 375 |
| 522 | iso_pu_bacteria | 2512047086 | 2512529572 | 375 |
| 523 | iso_pu_bacteria | 2513237086 | 2513582729 | 375 |
| 524 | iso_pu_bacteria | 2513237089 | 2513606480 | 375 |
| 525 | iso_pu_bacteria | 2513237091 | 2513614783 | 375 |
| 526 | iso_pu_bacteria | 2513237140 | 2513882299 | 375 |
| 527 | iso_pu_bacteria | 2513237143 | 2513901764 | 375 |
| 528 | iso_pu_bacteria | 2513237160 | 2514006078 | 375 |
| 529 | iso_pu_bacteria | 2513237351 | 2514589098 | 375 |
| 530 | iso_pu_bacteria | 2515154107 | 2515611694 | 375 |
| 531 | iso_pu_bacteria | 2517487022 | 2517566377 | 375 |
| 532 | iso_pu_bacteria | 2524023207 | 2524449352 | 375 |
| 533 | iso_pu_bacteria | 2551306084 | 2551678859 | 375 |
| 534 | iso_pu_bacteria | 2551306084 | 2551682097 | 375 |
| 535 | iso_pu_bacteria | 2551306085 | 2551683411 | 375 |
| 536 | iso_pu_bacteria | 2551306086 | 2551692962 | 375 |
| 537 | iso_pu_bacteria | 2551306087 | 2551697879 | 375 |
| 538 | iso_pu_bacteria | 2551306089 | 2551712438 | 375 |
| 539 | iso_pu_bacteria | 2551306090 | 2551719234 | 375 |
| 540 | iso_pu_bacteria | 2551306091 | 2551726087 | 375 |
| 541 | iso_pu_bacteria | 2551306093 | 2551743864 | 375 |
| 542 | iso_pu_bacteria | 2558860100 | 2558864961 | 375 |
| 543 | iso_pu_bacteria | 2721755755 | 2723844851 | 375 |
| 544 | iso_pu_bacteria | 2802428858 | 2802719717 | 375 |
| 545 | iso_pu_bacteria | 2802428859 | 2802728337 | 375 |
| 546 | iso_pu_bacteria | 2802428860 | 2802733547 | 375 |
| 547 | iso_pu_bacteria | 2802428861 | 2802738777 | 375 |
| 548 | iso_pu_bacteria | 2802428862 | 2802745623 | 375 |
| 549 | iso_pu_bacteria | 2802428863 | 2802751388 | 375 |
| 550 | iso_pu_bacteria | 2850079185 | 2850084680 | 375 |
| 551 | iso_pu_bacteria | 2855825444 | 2855829514 | 375 |
| 552 | iso_pu_bacteria | 2855839649 | 2855844613 | 375 |
| 553 | iso_pu_bacteria | 2857509624 | 2857514105 | 375 |
| 554 | iso_pu_bacteria | 2858800743 | 2858805926 | 375 |
| 555 | iso_pu_bacteria | 2915980308 | 2915982127 | 375 |
| 556 | iso_pu_bacteria | 2915986958 | 2915988367 | 375 |
| 557 | iso_pu_bacteria | 2915993759 | 2916000488 | 375 |
| 558 | iso_pu_bacteria | 2916000859 | 2916003404 | 375 |
| 559 | iso_pu_bacteria | 2916007675 | 2916007771 | 375 |
| 560 | iso_pu_bacteria | 2916014648 | 2916015979 | 375 |
| 561 | iso_pu_bacteria | 2916021584 | 2916021823 | 375 |
| 562 | iso_pu_bacteria | 2916028427 | 2916030979 | 375 |
| 563 | iso_pu_bacteria | 2916035215 | 2916037370 | 375 |
| 564 | iso_pu_bacteria | 2916041962 | 2916042174 | 375 |
| 565 | iso_pu_bacteria | 2916048683 | 2916048946 | 375 |
| 566 | iso_pu_bacteria | 2916055098 | 2916057252 | 375 |
| 567 | iso_pu_bacteria | 2916061851 | 2916066916 | 375 |
| 568 | iso_pu_bacteria | 2916076590 | 2916079291 | 375 |
| 569 | iso_pu_bacteria | 2921201388 | 2921202356 | 375 |
| 570 | iso_pu_bacteria | 2921208531 | 2921213815 | 375 |
| 571 | iso_pu_bacteria | 2921237296 | 2921242155 | 375 |
| 572 | iso_pu_bacteria | 2921244191 | 2921246332 | 375 |
| 573 | iso_pu_bacteria | 2921250672 | 2921256713 | 375 |
| 574 | iso_pu_bacteria | 2921263974 | 2921269771 | 375 |
| 575 | iso_pu_bacteria | 2921282425 | 2921286680 | 375 |
| 576 | iso_pu_bacteria | 2921289301 | 2921293623 | 375 |
| 577 | iso_pu_bacteria | 2921296804 | 2921304632 | 375 |
| 578 | iso_pu_bacteria | 2924144063 | 2924147987 | 375 |
| 579 | iso_pu_bacteria | 2924150972 | 2924152872 | 375 |
| 580 | iso_pu_bacteria | 2924158325 | 2924161863 | 375 |
| 581 | iso_pu_bacteria | 2924165586 | 2924165699 | 375 |
| 582 | iso_pu_bacteria | 2924172951 | 2924173966 | 375 |
| 583 | iso_pu_bacteria | 2924179722 | 2924184280 | 375 |
| 584 | iso_pu_bacteria | 2924186466 | 2924186657 | 375 |
| 585 | iso_pu_bacteria | 2924193448 | 2924197905 | 375 |
| 586 | iso_pu_bacteria | 2924200457 | 2924200692 | 375 |
| 587 | iso_pu_bacteria | 2924207177 | 2924207315 | 375 |
| 588 | iso_pu_bacteria | 2924214083 | 2924214161 | 375 |
| 589 | iso_pu_bacteria | 2924221636 | 2924222464 | 375 |
| 590 | iso_pu_bacteria | 2924228884 | 2924229032 | 375 |
| 591 | iso_pu_bacteria | 2936996657 | 2936997153 | 375 |
| 592 | iso_pu_bacteria | 2937002841 | 2937003156 | 375 |
| 593 | iso_pu_bacteria | 2937009748 | 2937010004 | 375 |
| 594 | iso_pu_bacteria | 2937016420 | 2937020442 | 375 |
| 595 | iso_pu_bacteria | 2937029754 | 2937033714 | 375 |
| 596 | iso_pu_bacteria | 2937036028 | 2937037570 | 375 |
| 597 | iso_pu_bacteria | 2937042894 | 2937046146 | 375 |
| 598 | iso_pu_bacteria | 2937049772 | 2937050598 | 375 |
| 599 | iso_pu_bacteria | 2937056579 | 2937060379 | 375 |
| 600 | iso_pu_bacteria | 2937063883 | 2937064082 | 375 |
| 601 | iso_pu_bacteria | 2937071275 | 2937071817 | 375 |
| 602 | iso_pu_bacteria | 2937078374 | 2937084590 | 375 |
| 603 | iso_pu_bacteria | 2937084907 | 2937091556 | 375 |
| 604 | iso_pu_bacteria | 2937091812 | 2937095794 | 375 |
| 605 | iso_pu_bacteria | 2937098957 | 2937100936 | 375 |
| 606 | iso_pu_bacteria | 2937106411 | 2937113189 | 375 |
| 607 | iso_pu_bacteria | 2937113482 | 2937115586 | 375 |
| 608 | iso_pu_bacteria | 2937119839 | 2937119934 | 375 |
| 609 | iso_pu_bacteria | 2937126314 | 2937132466 | 375 |
| 610 | iso_pu_bacteria | 2957375807 | 2957381162 | 375 |
| 611 | iso_pu_bacteria | 2957382221 | 2957382431 | 375 |
| 612 | iso_pu_bacteria | 2957388812 | 2957395363 | 375 |
| 613 | iso_pu_bacteria | 2957402308 | 2957404123 | 375 |
| 614 | iso_pu_bacteria | 2957408893 | 2957411509 | 375 |
| 615 | iso_pu_bacteria | 2957415311 | 2957416374 | 375 |
| 616 | iso_pu_bacteria | 2957422303 | 2957424183 | 375 |
| 617 | iso_pu_bacteria | 2957430029 | 2957432796 | 375 |
| 618 | iso_pu_bacteria | 2957437181 | 2957441841 | 375 |
| 619 | iso_pu_bacteria | 2957450854 | 2957450952 | 375 |
| 620 | iso_pu_bacteria | 2957457609 | 2957462823 | 375 |
| 621 | iso_pu_bacteria | 2957464669 | 2957465368 | 375 |
| 622 | iso_pu_bacteria | 2957471148 | 2957474937 | 375 |
| 623 | iso_pu_bacteria | 2957478035 | 2957478804 | 375 |
| 624 | iso_pu_bacteria | 2957484790 | 2957487512 | 375 |
| 625 | iso_pu_bacteria | 2957491536 | 2957493345 | 375 |
| 626 | iso_pu_bacteria | 2957498199 | 2957498564 | 375 |
| 627 | iso_pu_bacteria | 2957505466 | 2957507733 | 375 |
| 628 | iso_pu_bacteria | 2960584000 | 2960590294 | 375 |
| 629 | iso_pu_bacteria | 2960591022 | 2960597002 | 375 |
| 630 | iso_pu_bacteria | 2960597568 | 2960600124 | 375 |
| 631 | iso_pu_bacteria | 2960603979 | 2960604002 | 375 |
| 632 | iso_pu_bacteria | 2960610863 | 2960611104 | 375 |
| 633 | iso_pu_bacteria | 2960617483 | 2960622464 | 375 |
| 634 | iso_pu_bacteria | 2960624210 | 2960625269 | 375 |
| 635 | iso_pu_bacteria | 2960637947 | 2960644305 | 375 |
| 636 | iso_pu_bacteria | 2960645483 | 2960647294 | 375 |
| 637 | iso_pu_bacteria | 2960652885 | 2960657778 | 375 |
| 638 | iso_pu_bacteria | 2960667422 | 2960667663 | 375 |
| 639 | iso_pu_bacteria | 2960674078 | 2960679229 | 375 |
| 640 | iso_pu_bacteria | 2960680706 | 2960682206 | 375 |
| 641 | iso_pu_bacteria | 2960687367 | 2960691886 | 375 |
| 642 | iso_pu_bacteria | 2960693952 | 2960697992 | 375 |
| 643 | iso_pu_bacteria | 2964607997 | 2964615019 | 375 |
| 644 | iso_pu_bacteria | 2964621998 | 2964626732 | 375 |
| 645 | iso_pu_bacteria | 2964628898 | 2964629115 | 375 |
| 646 | iso_pu_bacteria | 2964636051 | 2964636226 | 375 |
| 647 | iso_pu_bacteria | 2964643177 | 2964643272 | 375 |
| 648 | iso_pu_bacteria | 2964649959 | 2964653815 | 375 |
| 649 | iso_pu_bacteria | 2964656573 | 2964662080 | 375 |
| 650 | iso_pu_bacteria | 2964663802 | 2964663898 | 375 |
| 651 | iso_pu_bacteria | 2964670856 | 2964674319 | 375 |
| 652 | iso_pu_bacteria | 2964678106 | 2964678195 | 375 |
| 653 | iso_pu_bacteria | 2964685014 | 2964685224 | 375 |
| 654 | iso_pu_bacteria | 2964691889 | 2964694173 | 375 |
| 655 | iso_pu_bacteria | 2964698721 | 2964699016 | 375 |
| 656 | iso_pu_bacteria | 2964705432 | 2964710825 | 375 |
| 657 | iso_pu_bacteria | 2964712639 | 2964716654 | 375 |
| 658 | iso_pu_bacteria | 2964719344 | 2964723448 | 375 |
| 659 | iso_pu_bacteria | 2967664464 | 2967666122 | 375 |
| 660 | iso_pu_bacteria | 2967671571 | 2967671667 | 375 |
| 661 | iso_pu_bacteria | 2967678726 | 2967681532 | 375 |
| 662 | iso_pu_bacteria | 2967686174 | 2967689512 | 375 |
| 663 | iso_pu_bacteria | 2967693043 | 2967698415 | 375 |
| 664 | iso_pu_bacteria | 2967699805 | 2967699907 | 375 |
| 665 | iso_pu_bacteria | 2967706974 | 2967708151 | 375 |
| 666 | iso_pu_bacteria | 2967714385 | 2967718487 | 375 |
| 667 | iso_pu_bacteria | 2967721400 | 2967721513 | 375 |
| 668 | iso_pu_bacteria | 2967728569 | 2967730282 | 375 |
| 669 | iso_pu_bacteria | 2967735183 | 2967737303 | 375 |
| 670 | iso_pu_bacteria | 2967742019 | 2967745128 | 375 |
| 671 | iso_pu_bacteria | 2967748971 | 2967749068 | 375 |
| 672 | iso_pu_bacteria | 2967762386 | 2967764254 | 375 |
| 673 | iso_pu_bacteria | 2967769361 | 2967769556 | 375 |
| 674 | iso_pu_bacteria | 2967775926 | 2967781714 | 375 |
| 675 | iso_pu_bacteria | 2970026789 | 2970028970 | 375 |
| 676 | iso_pu_bacteria | 2970033650 | 2970033746 | 375 |
| 677 | iso_pu_bacteria | 2970040964 | 2970043932 | 375 |
| 678 | iso_pu_bacteria | 2970047711 | 2970050144 | 375 |
| 679 | iso_pu_bacteria | 2970054988 | 2970055716 | 375 |
| 680 | iso_pu_bacteria | 2970061556 | 2970064432 | 375 |
| 681 | iso_pu_bacteria | 2970068827 | 2970068922 | 375 |
| 682 | iso_pu_bacteria | 2970076120 | 2970078120 | 375 |
| 683 | iso_pu_bacteria | 2970082768 | 2970084355 | 375 |
| 684 | iso_pu_bacteria | 2970088815 | 2970092009 | 375 |
| 685 | iso_pu_bacteria | 2970095765 | 2970095862 | 375 |
| 686 | iso_pu_bacteria | 2970109326 | 2970111235 | 375 |
| 687 | iso_pu_bacteria | 2970116247 | 2970119160 | 375 |
| 688 | iso_pu_bacteria | 2970122695 | 2970125676 | 375 |
| 689 | iso_pu_bacteria | 2970129317 | 2970135226 | 375 |
| 690 | iso_pu_bacteria | 2970136068 | 2970136162 | 375 |
| 691 | iso_pu_bacteria | 2970143518 | 2970149459 | 375 |
| 692 | iso_pu_bacteria | 2970149975 | 2970152023 | 375 |
| 693 | iso_pu_bacteria | 2970156795 | 2970162473 | 375 |
| 694 | iso_pu_bacteria | 2970164137 | 2970168958 | 375 |
| 695 | iso_pu_bacteria | 2970170962 | 2970171058 | 375 |
| 696 | iso_pu_bacteria | 2970177841 | 2970180128 | 375 |
| 697 | iso_pu_bacteria | 2970184632 | 2970189556 | 375 |
| 698 | iso_pu_bacteria | 2970191845 | 2970191963 | 375 |
| 699 | iso_pu_bacteria | 2977516862 | 2977518414 | 375 |
| 700 | iso_pu_bacteria | 2977523885 | 2977526425 | 375 |
| 701 | iso_pu_bacteria | 2977530762 | 2977534591 | 375 |
| 702 | iso_pu_bacteria | 2977537788 | 2977539727 | 375 |
| 703 | iso_pu_bacteria | 2977544691 | 2977548900 | 375 |
| 704 | iso_pu_bacteria | 2977551784 | 2977556047 | 375 |
| 705 | iso_pu_bacteria | 2977558990 | 2977560573 | 375 |
| 706 | iso_pu_bacteria | 2977565890 | 2977566189 | 375 |
| 707 | iso_pu_bacteria | 2977572785 | 2977573652 | 375 |
| 708 | iso_pu_bacteria | 2977579622 | 2977585133 | 375 |
| 709 | iso_pu_bacteria | 648276728 | 648735624 | 375 |
| 710 | iso_pu_bacteria | 8003992118 | 8003997138 | 375 |
| 711 | iso_pu_bacteria | 8006926726 | 8006931358 | 375 |
| 712 | iso_pu_bacteria | 8056875544 | 8056876797 | 375 |
| 713 | 3300009093 | Ga0105240_10002728 | Ga0105240_1000272828 | 376 |
| 714 | 3300025913 | Ga0207695_10002575 | Ga0207695_100025756 | 376 |
| 715 | 3300053730 | Ga0500645_016506 | Ga0500645_016506_489_1727 | 376 |
| 716 | iso_pu_bacteria | 2582581283 | 2585168712 | 376 |
| 717 | iso_pu_bacteria | 2582581306 | 2585269958 | 376 |
| 718 | iso_pu_bacteria | 2582581865 | 2585390640 | 376 |
| 719 | iso_pu_bacteria | 2599185352 | 2600197303 | 376 |
| 720 | iso_pu_bacteria | 2643221544 | 2643746033 | 376 |
| 721 | iso_pu_bacteria | 2643221607 | 2644048704 | 376 |
| 722 | iso_pu_bacteria | 2643221618 | 2644107366 | 376 |
| 723 | iso_pu_bacteria | 2643221626 | 2644150933 | 376 |
| 724 | iso_pu_bacteria | 2643221636 | 2644201977 | 376 |
| 725 | iso_pu_bacteria | 2643221637 | 2644209160 | 376 |
| 726 | iso_pu_bacteria | 2643221655 | 2644308761 | 376 |
| 727 | iso_pu_bacteria | 2643221659 | 2644335578 | 376 |
| 728 | iso_pu_bacteria | 2643221686 | 2644481506 | 376 |
| 729 | iso_pu_bacteria | 2643221688 | 2644495276 | 376 |
| 730 | iso_pu_bacteria | 2643221698 | 2644539984 | 376 |
| 731 | iso_pu_bacteria | 2643221712 | 2644614702 | 376 |
| 732 | iso_pu_bacteria | 2643221718 | 2644652634 | 376 |
| 733 | iso_pu_bacteria | 2728368998 | 2728749555 | 376 |
| 734 | iso_pu_bacteria | 2738541317 | 2738948814 | 376 |
| 735 | iso_pu_bacteria | 2751185800 | 2753361548 | 376 |
| 736 | iso_pu_bacteria | 2791355199 | 2793082273 | 376 |
| 737 | iso_pu_bacteria | 2841760612 | 2841765866 | 376 |
| 738 | iso_pu_bacteria | 2844104063 | 2844107476 | 376 |
| 739 | iso_pu_bacteria | 2844163670 | 2844166647 | 376 |
| 740 | iso_pu_bacteria | 2851182111 | 2851187736 | 376 |
| 741 | iso_pu_bacteria | 2851246043 | 2851249516 | 376 |
| 742 | iso_pu_bacteria | 2874604998 | 2874605430 | 376 |
| 743 | iso_pu_bacteria | 2889033259 | 2889039619 | 376 |
| 744 | iso_pu_bacteria | 2913308742 | 2913313775 | 376 |
| 745 | iso_pu_bacteria | 2922361189 | 2922365572 | 376 |
| 746 | iso_pu_bacteria | 2941499720 | 2941502214 | 376 |
| 747 | iso_pu_bacteria | 8006964411 | 8006967107 | 376 |
| 748 | iso_pu_bacteria | 8057529695 | 8057531893 | 376 |
| 749 | 3300003316 | rootH1_10001161 | rootH1_100011616 | 377 |
| 750 | 3300003322 | rootL2_10019891 | rootL2_100198917 | 377 |
| 751 | 3300003323 | rootH1_10130802 | rootH1_101308023 | 377 |
| 752 | 3300005295 | Ga0065707_10090722 | Ga0065707_100907224 | 377 |
| 753 | 3300005331 | Ga0070670_100069354 | Ga0070670_1000693543 | 377 |
| 754 | 3300005353 | Ga0070669_100016208 | Ga0070669_1000162082 | 377 |
| 755 | 3300005444 | Ga0070694_100061484 | Ga0070694_1000614844 | 377 |
| 756 | 3300005577 | Ga0068857_100066630 | Ga0068857_1000666304 | 377 |
| 757 | 3300005719 | Ga0068861_100066781 | Ga0068861_1000667815 | 377 |
| 758 | 3300005840 | Ga0068870_10006240 | Ga0068870_100062403 | 377 |
| 759 | 3300005844 | Ga0068862_100022007 | Ga0068862_1000220072 | 377 |
| 760 | 3300009093 | Ga0105240_10232942 | Ga0105240_102329422 | 377 |
| 761 | 3300009094 | Ga0111539_10283371 | Ga0111539_102833711 | 377 |
| 762 | 3300009553 | Ga0105249_10011337 | Ga0105249_100113375 | 377 |
| 763 | 3300013306 | Ga0163162_10037622 | Ga0163162_100376222 | 377 |
| 764 | 3300014326 | Ga0157380_10003721 | Ga0157380_100037213 | 377 |
| 765 | 3300021384 | Ga0213876_10001505 | Ga0213876_100015055 | 377 |
| 766 | 3300021388 | Ga0213875_10018065 | Ga0213875_100180652 | 377 |
| 767 | 3300025908 | Ga0207643_10019696 | Ga0207643_100196964 | 377 |
| 768 | 3300025913 | Ga0207695_10027361 | Ga0207695_100273612 | 377 |
| 769 | 3300025923 | Ga0207681_10001545 | Ga0207681_100015452 | 377 |
| 770 | 3300025961 | Ga0207712_10002593 | Ga0207712_100025932 | 377 |
| 771 | 3300025972 | Ga0207668_10172403 | Ga0207668_101724031 | 377 |
| 772 | 3300026116 | Ga0207674_10083292 | Ga0207674_100832924 | 377 |
| 773 | 3300028380 | Ga0268265_10002240 | Ga0268265_100022406 | 377 |
| 774 | 3300031548 | Ga0307408_100000056 | Ga0307408_100000056122 | 377 |
| 775 | 3300037853 | Ga0436364_0541406 | Ga0436364_0541406_1784_3007 | 377 |
| 776 | 3300039437 | Ga0436365_0244982 | Ga0436365_0244982_59341_60564 | 377 |
| 777 | 3300039450 | Ga0436363_1091027 | Ga0436363_1091027_578_1801 | 377 |
| 778 | 3300039453 | Ga0436362_0338861 | Ga0436362_0338861_5176_6399 | 377 |
| 779 | 3300045051 | Ga0451576_0120588 | Ga0451576_0120588_1328_2563 | 377 |
| 780 | 3300046690 | Ga0495624_0027650 | Ga0495624_0027650_1887_3119 | 377 |
| 781 | 3300048903 | Ga0496100_0037558 | Ga0496100_0037558_565_1773 | 377 |
| 782 | 3300049571 | Ga0501034_0153118 | Ga0501034_0153118_261_1466 | 377 |
| 783 | 3300049589 | Ga0501073_0028200 | Ga0501073_0028200_956_2194 | 377 |
| 784 | 3300050511 | nmdc:mga08y16_100803_c1 | nmdc:mga08y16_100803_c1_1439_2692 | 377 |
| 785 | iso_pu_bacteria | 2513237096 | 2513657970 | 377 |
| 786 | iso_pu_bacteria | 2513237098 | 2513676056 | 377 |
| 787 | iso_pu_bacteria | 2513237101 | 2513692770 | 377 |
| 788 | iso_pu_bacteria | 2513237137 | 2513855671 | 377 |
| 789 | iso_pu_bacteria | 2513237139 | 2513872969 | 377 |
| 790 | iso_pu_bacteria | 2513237141 | 2513894730 | 377 |
| 791 | iso_pu_bacteria | 2513237145 | 2513919937 | 377 |
| 792 | iso_pu_bacteria | 2517572143 | 2517892208 | 377 |
| 793 | iso_pu_bacteria | 2524023205 | 2524437555 | 377 |
| 794 | iso_pu_bacteria | 2524023210 | 2524465718 | 377 |
| 795 | iso_pu_bacteria | 2524023228 | 2524534300 | 377 |
| 796 | iso_pu_bacteria | 2585427633 | 2585997940 | 377 |
| 797 | iso_pu_bacteria | 2585428058 | 2587736923 | 377 |
| 798 | iso_pu_bacteria | 2588253510 | 2588295465 | 377 |
| 799 | iso_pu_bacteria | 2599185240 | 2599744681 | 377 |
| 800 | iso_pu_bacteria | 2599185355 | 2600205958 | 377 |
| 801 | iso_pu_bacteria | 2602042107 | 2603862365 | 377 |
| 802 | iso_pu_bacteria | 2643221557 | 2643804956 | 377 |
| 803 | iso_pu_bacteria | 2643221585 | 2643936998 | 377 |
| 804 | iso_pu_bacteria | 2643221592 | 2643971911 | 377 |
| 805 | iso_pu_bacteria | 2643221610 | 2644065800 | 377 |
| 806 | iso_pu_bacteria | 2643221625 | 2644139405 | 377 |
| 807 | iso_pu_bacteria | 2643221639 | 2644218080 | 377 |
| 808 | iso_pu_bacteria | 2643221646 | 2644260900 | 377 |
| 809 | iso_pu_bacteria | 2643221648 | 2644275015 | 377 |
| 810 | iso_pu_bacteria | 2643221656 | 2644318163 | 377 |
| 811 | iso_pu_bacteria | 2643221668 | 2644376907 | 377 |
| 812 | iso_pu_bacteria | 2643221675 | 2644417692 | 377 |
| 813 | iso_pu_bacteria | 2643221680 | 2644453796 | 377 |
| 814 | iso_pu_bacteria | 2643221723 | 2644677684 | 377 |
| 815 | iso_pu_bacteria | 2643221726 | 2644688431 | 377 |
| 816 | iso_pu_bacteria | 2667528175 | 2671120541 | 377 |
| 817 | iso_pu_bacteria | 2675903129 | 2676742807 | 377 |
| 818 | iso_pu_bacteria | 2738541337 | 2739056389 | 377 |
| 819 | iso_pu_bacteria | 2744054633 | 2745079662 | 377 |
| 820 | iso_pu_bacteria | 2791355197 | 2793068721 | 377 |
| 821 | iso_pu_bacteria | 2802429603 | 2805915133 | 377 |
| 822 | iso_pu_bacteria | 2818991452 | 2819631108 | 377 |
| 823 | iso_pu_bacteria | 2824679649 | 2824685864 | 377 |
| 824 | iso_pu_bacteria | 2824696289 | 2824702479 | 377 |
| 825 | iso_pu_bacteria | 2844315083 | 2844319262 | 377 |
| 826 | iso_pu_bacteria | 2847930680 | 2847936417 | 377 |
| 827 | iso_pu_bacteria | 2847939898 | 2847946770 | 377 |
| 828 | iso_pu_bacteria | 2849076700 | 2849079122 | 377 |
| 829 | iso_pu_bacteria | 2857524615 | 2857525745 | 377 |
| 830 | iso_pu_bacteria | 2870068957 | 2870071054 | 377 |
| 831 | iso_pu_bacteria | 2876761206 | 2876764728 | 377 |
| 832 | iso_pu_bacteria | 2876808645 | 2876810996 | 377 |
| 833 | iso_pu_bacteria | 2879083081 | 2879090199 | 377 |
| 834 | iso_pu_bacteria | 2879110137 | 2879115719 | 377 |
| 835 | iso_pu_bacteria | 2883291878 | 2883295185 | 377 |
| 836 | iso_pu_bacteria | 2885383462 | 2885389263 | 377 |
| 837 | iso_pu_bacteria | 2888388044 | 2888393614 | 377 |
| 838 | iso_pu_bacteria | 2893066018 | 2893067961 | 377 |
| 839 | iso_pu_bacteria | 2903727486 | 2903731104 | 377 |
| 840 | iso_pu_bacteria | 2903748898 | 2903751578 | 377 |
| 841 | iso_pu_bacteria | 2903768456 | 2903772461 | 377 |
| 842 | iso_pu_bacteria | 2904690495 | 2904694654 | 377 |
| 843 | iso_pu_bacteria | 2904699407 | 2904702353 | 377 |
| 844 | iso_pu_bacteria | 2906602504 | 2906607389 | 377 |
| 845 | iso_pu_bacteria | 2906610324 | 2906617331 | 377 |
| 846 | iso_pu_bacteria | 2906635258 | 2906642644 | 377 |
| 847 | iso_pu_bacteria | 2906660503 | 2906666178 | 377 |
| 848 | iso_pu_bacteria | 2908739725 | 2908742486 | 377 |
| 849 | iso_pu_bacteria | 2908756301 | 2908760204 | 377 |
| 850 | iso_pu_bacteria | 2919073203 | 2919074391 | 377 |
| 851 | iso_pu_bacteria | 2920822456 | 2920826866 | 377 |
| 852 | iso_pu_bacteria | 2922386360 | 2922391190 | 377 |
| 853 | iso_pu_bacteria | 2922393267 | 2922400595 | 377 |
| 854 | iso_pu_bacteria | 2922425934 | 2922430493 | 377 |
| 855 | iso_pu_bacteria | 2928157003 | 2928160084 | 377 |
| 856 | iso_pu_bacteria | 2928163908 | 2928168524 | 377 |
| 857 | iso_pu_bacteria | 2928170801 | 2928171776 | 377 |
| 858 | iso_pu_bacteria | 2935630451 | 2935631470 | 377 |
| 859 | iso_pu_bacteria | 2935959822 | 2935960613 | 377 |
| 860 | iso_pu_bacteria | 2941507105 | 2941510212 | 377 |
| 861 | iso_pu_bacteria | 2941515067 | 2941518702 | 377 |
| 862 | iso_pu_bacteria | 2941523033 | 2941525611 | 377 |
| 863 | iso_pu_bacteria | 2960631154 | 2960631497 | 377 |
| 864 | iso_pu_bacteria | 2989349275 | 2989349800 | 377 |
| 865 | iso_pu_bacteria | 3005474847 | 3005480403 | 377 |
| 866 | iso_pu_bacteria | 3005506211 | 3005510520 | 377 |
| 867 | iso_pu_bacteria | 3005718088 | 3005722506 | 377 |
| 868 | iso_pu_bacteria | 8006933436 | 8006940472 | 377 |
| 869 | iso_pu_bacteria | 8006973647 | 8006980161 | 377 |
| 870 | iso_pu_bacteria | 8006984368 | 8006986618 | 377 |
| 871 | iso_pu_bacteria | 8018845410 | 8018851415 | 377 |
| 872 | iso_pu_bacteria | 8019555841 | 8019556544 | 377 |
| 873 | iso_pu_bacteria | 8019565922 | 8019568765 | 377 |
| 874 | iso_pu_bacteria | 8021120328 | 8021122251 | 377 |
| 875 | iso_pu_bacteria | 8039098773 | 8039102503 | 377 |
| 876 | iso_pu_bacteria | 8054558443 | 8054559342 | 377 |
| 877 | iso_pu_bacteria | 8056673599 | 8056673641 | 377 |
| 878 | iso_pu_bacteria | 8056681323 | 8056686831 | 377 |
| 879 | iso_pu_bacteria | 8056689827 | 8056691328 | 377 |
| 880 | iso_pu_bacteria | 8056967851 | 8056968233 | 377 |
| 881 | 3300002773 | JGI25152J39213_1001786 | JGI25152J39213_10017867 | 378 |
| 882 | 3300005329 | Ga0070683_100003949 | Ga0070683_10000394911 | 378 |
| 883 | 3300005336 | Ga0070680_100088646 | Ga0070680_1000886463 | 378 |
| 884 | 3300006038 | Ga0075365_10058843 | Ga0075365_100588432 | 378 |
| 885 | 3300006051 | Ga0075364_10041422 | Ga0075364_100414223 | 378 |
| 886 | 3300006186 | Ga0075369_10022854 | Ga0075369_100228542 | 378 |
| 887 | 3300006353 | Ga0075370_10005197 | Ga0075370_100051975 | 378 |
| 888 | 3300006358 | Ga0068871_100034578 | Ga0068871_1000345782 | 378 |
| 889 | 3300013105 | Ga0157369_10067796 | Ga0157369_100677965 | 378 |
| 890 | 3300025245 | Ga0207425_1000292 | Ga0207425_100029220 | 378 |
| 891 | 3300025258 | Ga0209129_1000025 | Ga0209129_1000025339 | 378 |
| 892 | 3300025295 | Ga0209564_1000039 | Ga0209564_1000039339 | 378 |
| 893 | 3300025297 | Ga0209758_1000163 | Ga0209758_100016399 | 378 |
| 894 | 3300026116 | Ga0207674_10083238 | Ga0207674_100832384 | 378 |
| 895 | 3300028800 | Ga0265338_10005146 | Ga0265338_100051464 | 378 |
| 896 | 3300031238 | Ga0265332_10081475 | Ga0265332_100814751 | 378 |
| 897 | 3300031247 | Ga0265340_10015636 | Ga0265340_100156363 | 378 |
| 898 | 3300031247 | Ga0265340_10051469 | Ga0265340_100514692 | 378 |
| 899 | 3300031344 | Ga0265316_10083710 | Ga0265316_100837103 | 378 |
| 900 | 3300031711 | Ga0265314_10008385 | Ga0265314_1000838511 | 378 |
| 901 | 3300037418 | Ga0395900_0204267 | Ga0395900_0204267_549_1763 | 378 |
| 902 | 3300037466 | Ga0395898_0023551 | Ga0395898_0023551_403_1617 | 378 |
| 903 | 3300037471 | Ga0395905_0002583 | Ga0395905_0002583_11407_12633 | 378 |
| 904 | 3300038443 | Ga0395901_0168521 | Ga0395901_0168521_1062_2273 | 378 |
| 905 | 3300038443 | Ga0395901_0270621 | Ga0395901_0270621_234_1448 | 378 |
| 906 | 3300046477 | Ga0495664_0003614 | Ga0495664_0003614_4613_5827 | 378 |
| 907 | 3300046543 | Ga0495645_0028522 | Ga0495645_0028522_1958_3172 | 378 |
| 908 | 3300050496 | nmdc:mga07m45_6102_c1 | nmdc:mga07m45_6102_c1_3618_4838 | 378 |
| 909 | iso_pu_bacteria | 2585428057 | 2587726774 | 378 |
| 910 | 3300003322 | rootL2_10034669 | rootL2_100346696 | 379 |
| 911 | 3300003659 | JGI25404J52841_10009459 | JGI25404J52841_100094593 | 379 |
| 912 | 3300003659 | JGI25404J52841_10015804 | JGI25404J52841_100158041 | 379 |
| 913 | 3300003781 | Ga0055536_1000494 | Ga0055536_100049417 | 379 |
| 914 | 3300003791 | Ga0055530_10006225 | Ga0055530_100062253 | 379 |
| 915 | 3300003794 | Ga0055531_10000007 | Ga0055531_1000000754 | 379 |
| 916 | 3300003794 | Ga0055531_10000751 | Ga0055531_100007514 | 379 |
| 917 | 3300005459 | Ga0068867_100000114 | Ga0068867_1000001149 | 379 |
| 918 | 3300005467 | Ga0070706_100053290 | Ga0070706_1000532904 | 379 |
| 919 | 3300005543 | Ga0070672_100002864 | Ga0070672_1000028643 | 379 |
| 920 | 3300005719 | Ga0068861_100044771 | Ga0068861_1000447714 | 379 |
| 921 | 3300005843 | Ga0068860_100081526 | Ga0068860_1000815262 | 379 |
| 922 | 3300005843 | Ga0068860_100132747 | Ga0068860_1001327472 | 379 |
| 923 | 3300005937 | Ga0081455_10001796 | Ga0081455_1000179621 | 379 |
| 924 | 3300005983 | Ga0081540_1006483 | Ga0081540_10064832 | 379 |
| 925 | 3300005983 | Ga0081540_1010556 | Ga0081540_10105561 | 379 |
| 926 | 3300006178 | Ga0075367_10051022 | Ga0075367_100510223 | 379 |
| 927 | 3300009148 | Ga0105243_10010808 | Ga0105243_100108084 | 379 |
| 928 | 3300009148 | Ga0105243_10107602 | Ga0105243_101076022 | 379 |
| 929 | 3300009174 | Ga0105241_10137847 | Ga0105241_101378471 | 379 |
| 930 | 3300009176 | Ga0105242_10011167 | Ga0105242_1001116710 | 379 |
| 931 | 3300010375 | Ga0105239_10223788 | Ga0105239_102237882 | 379 |
| 932 | 3300014745 | Ga0157377_10000016 | Ga0157377_1000001690 | 379 |
| 933 | 3300021384 | Ga0213876_10088101 | Ga0213876_100881012 | 379 |
| 934 | 3300025292 | Ga0209676_1001218 | Ga0209676_100121817 | 379 |
| 935 | 3300025298 | Ga0209050_1002131 | Ga0209050_100213110 | 379 |
| 936 | 3300025303 | Ga0209051_1002753 | Ga0209051_100275313 | 379 |
| 937 | 3300025304 | Ga0209257_1000021 | Ga0209257_1000021174 | 379 |
| 938 | 3300025304 | Ga0209257_1000282 | Ga0209257_100028217 | 379 |
| 939 | 3300025910 | Ga0207684_10039118 | Ga0207684_100391182 | 379 |
| 940 | 3300025931 | Ga0207644_10122094 | Ga0207644_101220942 | 379 |
| 941 | 3300025935 | Ga0207709_10007776 | Ga0207709_100077764 | 379 |
| 942 | 3300025935 | Ga0207709_10109719 | Ga0207709_101097192 | 379 |
| 943 | 3300025938 | Ga0207704_10088455 | Ga0207704_100884552 | 379 |
| 944 | 3300025961 | Ga0207712_10191700 | Ga0207712_101917002 | 379 |
| 945 | 3300025981 | Ga0207640_10081019 | Ga0207640_100810192 | 379 |
| 946 | 3300025986 | Ga0207658_10150217 | Ga0207658_101502172 | 379 |
| 947 | 3300026089 | Ga0207648_10000343 | Ga0207648_100003439 | 379 |
| 948 | 3300026089 | Ga0207648_10004572 | Ga0207648_100045725 | 379 |
| 949 | 3300028380 | Ga0268265_10022190 | Ga0268265_100221904 | 379 |
| 950 | 3300031235 | Ga0265330_10095064 | Ga0265330_100950641 | 379 |
| 951 | 3300031456 | Ga0307513_10133705 | Ga0307513_101337051 | 379 |
| 952 | 3300031507 | Ga0307509_10001769 | Ga0307509_1000176925 | 379 |
| 953 | 3300031616 | Ga0307508_10000430 | Ga0307508_1000043017 | 379 |
| 954 | 3300031616 | Ga0307508_10122475 | Ga0307508_101224752 | 379 |
| 955 | 3300031731 | Ga0307405_10003030 | Ga0307405_100030306 | 379 |
| 956 | 3300032005 | Ga0307411_10000184 | Ga0307411_100001842 | 379 |
| 957 | 3300033180 | Ga0307510_10012673 | Ga0307510_100126732 | 379 |
| 958 | 3300035695 | Ga0373927_0029952 | Ga0373927_0029952_169_1416 | 379 |
| 959 | 3300035695 | Ga0373927_0063702 | Ga0373927_0063702_108_1328 | 379 |
| 960 | 3300037068 | Ga0373925_0091397 | Ga0373925_0091397_500_1747 | 379 |
| 961 | 3300039437 | Ga0436365_0465598 | Ga0436365_0465598_204_1469 | 379 |
| 962 | 3300046535 | Ga0495586_0048581 | Ga0495586_0048581_1005_2234 | 379 |
| 963 | 3300048924 | Ga0496121_0117977 | Ga0496121_0117977_334_1566 | 379 |
| 964 | 3300049579 | Ga0501043_0000439 | Ga0501043_0000439_28561_29793 | 379 |
| 965 | 3300049580 | Ga0501046_0001371 | Ga0501046_0001371_14448_15680 | 379 |
| 966 | 3300049581 | Ga0501047_0000069 | Ga0501047_0000069_61353_62585 | 379 |
| 967 | 3300049582 | Ga0501048_0001073 | Ga0501048_0001073_5295_6527 | 379 |
| 968 | 3300049662 | Ga0501222_003521 | Ga0501222_003521_708_1940 | 379 |
| 969 | 3300049744 | Ga0501083_0040764 | Ga0501083_0040764_391_1617 | 379 |
| 970 | 3300049824 | Ga0501045_0011250 | Ga0501045_0011250_2594_3826 | 379 |
| 971 | 3300050496 | nmdc:mga07m45_29113_c1 | nmdc:mga07m45_29113_c1_1149_2381 | 379 |
| 972 | 3300053086 | Ga0500578_0000263 | Ga0500578_0000263_16063_17304 | 379 |
| 973 | 3300053148 | Ga0500590_010398 | Ga0500590_010398_1686_2918 | 379 |
| 974 | 3300060353 | Ga0501082_0340848 | Ga0501082_0340848_20_1240 | 379 |
| 975 | iso_pu_bacteria | 2996336353 | 2996338418 | 379 |
| 976 | 3300003203 | JGI25406J46586_10010338 | JGI25406J46586_100103385 | 380 |
| 977 | 3300005331 | Ga0070670_100131893 | Ga0070670_1001318932 | 380 |
| 978 | 3300005339 | Ga0070660_100004626 | Ga0070660_1000046263 | 380 |
| 979 | 3300005366 | Ga0070659_100000096 | Ga0070659_10000009626 | 380 |
| 980 | 3300005543 | Ga0070672_100215073 | Ga0070672_1002150731 | 380 |
| 981 | 3300005719 | Ga0068861_100161430 | Ga0068861_1001614302 | 380 |
| 982 | 3300005841 | Ga0068863_100109795 | Ga0068863_1001097952 | 380 |
| 983 | 3300005983 | Ga0081540_1029244 | Ga0081540_10292442 | 380 |
| 984 | 3300005985 | Ga0081539_10001457 | Ga0081539_100014574 | 380 |
| 985 | 3300009177 | Ga0105248_10040535 | Ga0105248_100405355 | 380 |
| 986 | 3300009177 | Ga0105248_10050503 | Ga0105248_100505032 | 380 |
| 987 | 3300009545 | Ga0105237_10036635 | Ga0105237_100366354 | 380 |
| 988 | 3300009551 | Ga0105238_10254919 | Ga0105238_102549193 | 380 |
| 989 | 3300009551 | Ga0105238_10374994 | Ga0105238_103749941 | 380 |
| 990 | 3300009553 | Ga0105249_10017301 | Ga0105249_100173014 | 380 |
| 991 | 3300010375 | Ga0105239_10014915 | Ga0105239_100149153 | 380 |
| 992 | 3300013306 | Ga0163162_10193308 | Ga0163162_101933082 | 380 |
| 993 | 3300013308 | Ga0157375_10187874 | Ga0157375_101878742 | 380 |
| 994 | 3300025914 | Ga0207671_10055232 | Ga0207671_100552324 | 380 |
| 995 | 3300025919 | Ga0207657_10000004 | Ga0207657_10000004102 | 380 |
| 996 | 3300025925 | Ga0207650_10188508 | Ga0207650_101885081 | 380 |
| 997 | 3300025932 | Ga0207690_10000015 | Ga0207690_10000015191 | 380 |
| 998 | 3300025941 | Ga0207711_10123071 | Ga0207711_101230712 | 380 |
| 999 | 3300026035 | Ga0207703_10025822 | Ga0207703_100258222 | 380 |
| 1000 | 3300026088 | Ga0207641_10202459 | Ga0207641_102024592 | 380 |
| 1001 | 3300026121 | Ga0207683_10100833 | Ga0207683_101008333 | 380 |
| 1002 | 3300026121 | Ga0207683_10253213 | Ga0207683_102532132 | 380 |
| 1003 | 3300026142 | Ga0207698_10250772 | Ga0207698_102507722 | 380 |
| 1004 | 3300028379 | Ga0268266_10053037 | Ga0268266_100530371 | 380 |
| 1005 | 3300028794 | Ga0307515_10025474 | Ga0307515_100254746 | 380 |
| 1006 | 3300030878 | Ga0265770_1000176 | Ga0265770_10001766 | 380 |
| 1007 | 3300031090 | Ga0265760_10014223 | Ga0265760_100142232 | 380 |
| 1008 | 3300035695 | Ga0373927_0029189 | Ga0373927_0029189_1902_3113 | 380 |
| 1009 | 3300035725 | Ga0373947_0027904 | Ga0373947_0027904_746_1957 | 380 |
| 1010 | 3300037471 | Ga0395905_0028159 | Ga0395905_0028159_679_1896 | 380 |
| 1011 | 3300037471 | Ga0395905_0097858 | Ga0395905_0097858_754_1965 | 380 |
| 1012 | 3300037853 | Ga0436364_0552267 | Ga0436364_0552267_19_1242 | 380 |
| 1013 | 3300039437 | Ga0436365_0894462 | Ga0436365_0894462_112_1338 | 380 |
| 1014 | 3300046455 | Ga0495603_0036333 | Ga0495603_0036333_1629_2840 | 380 |
| 1015 | 3300046455 | Ga0495603_0075863 | Ga0495603_0075863_721_1938 | 380 |
| 1016 | 3300047472 | Ga0495686_0053930 | Ga0495686_0053930_1230_2480 | 380 |
| 1017 | 3300048904 | Ga0496101_0098815 | Ga0496101_0098815_867_2096 | 380 |
| 1018 | 3300048908 | Ga0496105_0054856 | Ga0496105_0054856_960_2189 | 380 |
| 1019 | 3300048909 | Ga0496106_0053866 | Ga0496106_0053866_919_2148 | 380 |
| 1020 | 3300048910 | Ga0496107_0009774 | Ga0496107_0009774_650_1879 | 380 |
| 1021 | 3300048911 | Ga0496108_0051741 | Ga0496108_0051741_1411_2640 | 380 |
| 1022 | 3300048917 | Ga0496114_0102995 | Ga0496114_0102995_1076_2305 | 380 |
| 1023 | 3300050492 | nmdc:mga0yw44_100474_c1 | nmdc:mga0yw44_100474_c1_611_1831 | 380 |
| 1024 | 3300053119 | Ga0500595_000075 | Ga0500595_000075_31776_33002 | 380 |
| 1025 | 3300001989 | JGI24739J22299_10005337 | JGI24739J22299_100053372 | 381 |
| 1026 | 3300003215 | JGI25153J46596_10001087 | JGI25153J46596_1000108718 | 381 |
| 1027 | 3300003215 | JGI25153J46596_10006828 | JGI25153J46596_100068282 | 381 |
| 1028 | 3300003354 | JGI25160J50197_1024513 | JGI25160J50197_10245132 | 381 |
| 1029 | 3300003758 | Ga0055532_1000336 | Ga0055532_10003361 | 381 |
| 1030 | 3300003758 | Ga0055532_1000625 | Ga0055532_10006259 | 381 |
| 1031 | 3300003760 | Ga0055527_1000433 | Ga0055527_100043313 | 381 |
| 1032 | 3300003761 | Ga0055535_1001075 | Ga0055535_100107513 | 381 |
| 1033 | 3300005262 | Ga0065165_1001016 | Ga0065165_100101621 | 381 |
| 1034 | 3300005355 | Ga0070671_100006532 | Ga0070671_1000065322 | 381 |
| 1035 | 3300005364 | Ga0070673_100005015 | Ga0070673_1000050159 | 381 |
| 1036 | 3300005367 | Ga0070667_100000046 | Ga0070667_10000004698 | 381 |
| 1037 | 3300005434 | Ga0070709_10082900 | Ga0070709_100829002 | 381 |
| 1038 | 3300005435 | Ga0070714_100015299 | Ga0070714_1000152997 | 381 |
| 1039 | 3300005436 | Ga0070713_100047166 | Ga0070713_1000471663 | 381 |
| 1040 | 3300005437 | Ga0070710_10001502 | Ga0070710_1000150211 | 381 |
| 1041 | 3300005439 | Ga0070711_100016359 | Ga0070711_1000163594 | 381 |
| 1042 | 3300005455 | Ga0070663_100007285 | Ga0070663_1000072853 | 381 |
| 1043 | 3300005458 | Ga0070681_10019757 | Ga0070681_100197572 | 381 |
| 1044 | 3300005458 | Ga0070681_10092243 | Ga0070681_100922432 | 381 |
| 1045 | 3300005543 | Ga0070672_100253054 | Ga0070672_1002530541 | 381 |
| 1046 | 3300005577 | Ga0068857_100182640 | Ga0068857_1001826401 | 381 |
| 1047 | 3300005616 | Ga0068852_100018555 | Ga0068852_1000185556 | 381 |
| 1048 | 3300006028 | Ga0070717_10064914 | Ga0070717_100649142 | 381 |
| 1049 | 3300006028 | Ga0070717_10186287 | Ga0070717_101862871 | 381 |
| 1050 | 3300006038 | Ga0075365_10004360 | Ga0075365_100043609 | 381 |
| 1051 | 3300006163 | Ga0070715_10001855 | Ga0070715_100018552 | 381 |
| 1052 | 3300006173 | Ga0070716_100004571 | Ga0070716_1000045713 | 381 |
| 1053 | 3300006844 | Ga0075428_100144634 | Ga0075428_1001446342 | 381 |
| 1054 | 3300006852 | Ga0075433_10005585 | Ga0075433_100055856 | 381 |
| 1055 | 3300006871 | Ga0075434_100006322 | Ga0075434_1000063228 | 381 |
| 1056 | 3300006944 | Ga0099823_1022490 | Ga0099823_10224903 | 381 |
| 1057 | 3300007076 | Ga0075435_100131190 | Ga0075435_1001311903 | 381 |
| 1058 | 3300009093 | Ga0105240_10039788 | Ga0105240_100397886 | 381 |
| 1059 | 3300009094 | Ga0111539_10001545 | Ga0111539_1000154527 | 381 |
| 1060 | 3300009094 | Ga0111539_10024722 | Ga0111539_100247223 | 381 |
| 1061 | 3300009101 | Ga0105247_10015519 | Ga0105247_100155193 | 381 |
| 1062 | 3300009147 | Ga0114129_10005987 | Ga0114129_100059872 | 381 |
| 1063 | 3300009147 | Ga0114129_10086742 | Ga0114129_100867423 | 381 |
| 1064 | 3300009147 | Ga0114129_10132303 | Ga0114129_101323032 | 381 |
| 1065 | 3300009545 | Ga0105237_10037912 | Ga0105237_100379123 | 381 |
| 1066 | 3300009551 | Ga0105238_10034527 | Ga0105238_100345275 | 381 |
| 1067 | 3300010375 | Ga0105239_10008694 | Ga0105239_1000869410 | 381 |
| 1068 | 3300010375 | Ga0105239_10389100 | Ga0105239_103891001 | 381 |
| 1069 | 3300013104 | Ga0157370_10256064 | Ga0157370_102560642 | 381 |
| 1070 | 3300013105 | Ga0157369_10006104 | Ga0157369_1000610415 | 381 |
| 1071 | 3300013105 | Ga0157369_10018323 | Ga0157369_100183237 | 381 |
| 1072 | 3300013296 | Ga0157374_10154340 | Ga0157374_101543403 | 381 |
| 1073 | 3300013306 | Ga0163162_10344808 | Ga0163162_103448081 | 381 |
| 1074 | 3300014745 | Ga0157377_10073055 | Ga0157377_100730552 | 381 |
| 1075 | 3300021321 | Ga0214542_1000014 | Ga0214542_1000014120 | 381 |
| 1076 | 3300021327 | Ga0214543_1000056 | Ga0214543_100005698 | 381 |
| 1077 | 3300021441 | Ga0213871_10028365 | Ga0213871_100283651 | 381 |
| 1078 | 3300025228 | Ga0209672_100023 | Ga0209672_100023251 | 381 |
| 1079 | 3300025229 | Ga0209147_100094 | Ga0209147_10009491 | 381 |
| 1080 | 3300025229 | Ga0209147_100246 | Ga0209147_10024618 | 381 |
| 1081 | 3300025242 | Ga0209258_100142 | Ga0209258_10014280 | 381 |
| 1082 | 3300025254 | Ga0209148_1001163 | Ga0209148_100116315 | 381 |
| 1083 | 3300025272 | Ga0209455_1000724 | Ga0209455_10007248 | 381 |
| 1084 | 3300025302 | Ga0207426_1000822 | Ga0207426_100082212 | 381 |
| 1085 | 3300025898 | Ga0207692_10004784 | Ga0207692_100047841 | 381 |
| 1086 | 3300025900 | Ga0207710_10015256 | Ga0207710_100152562 | 381 |
| 1087 | 3300025904 | Ga0207647_10003764 | Ga0207647_100037646 | 381 |
| 1088 | 3300025906 | Ga0207699_10100166 | Ga0207699_101001661 | 381 |
| 1089 | 3300025909 | Ga0207705_10125201 | Ga0207705_101252011 | 381 |
| 1090 | 3300025910 | Ga0207684_10193404 | Ga0207684_101934042 | 381 |
| 1091 | 3300025913 | Ga0207695_10107737 | Ga0207695_101077373 | 381 |
| 1092 | 3300025915 | Ga0207693_10007521 | Ga0207693_1000752110 | 381 |
| 1093 | 3300025916 | Ga0207663_10001619 | Ga0207663_1000161911 | 381 |
| 1094 | 3300025924 | Ga0207694_10245725 | Ga0207694_102457251 | 381 |
| 1095 | 3300025925 | Ga0207650_10033523 | Ga0207650_100335232 | 381 |
| 1096 | 3300025926 | Ga0207659_10052620 | Ga0207659_100526203 | 381 |
| 1097 | 3300025931 | Ga0207644_10028183 | Ga0207644_100281832 | 381 |
| 1098 | 3300025939 | Ga0207665_10003514 | Ga0207665_1000351411 | 381 |
| 1099 | 3300025949 | Ga0207667_10072260 | Ga0207667_100722603 | 381 |
| 1100 | 3300025986 | Ga0207658_10000058 | Ga0207658_1000005848 | 381 |
| 1101 | 3300026067 | Ga0207678_10012877 | Ga0207678_100128777 | 381 |
| 1102 | 3300026142 | Ga0207698_10014336 | Ga0207698_100143362 | 381 |
| 1103 | 3300026142 | Ga0207698_10188439 | Ga0207698_101884392 | 381 |
| 1104 | 3300027296 | Ga0209389_1000201 | Ga0209389_100020119 | 381 |
| 1105 | 3300027361 | Ga0209489_100035 | Ga0209489_10003532 | 381 |
| 1106 | 3300027363 | Ga0209700_100005 | Ga0209700_10000534 | 381 |
| 1107 | 3300027907 | Ga0207428_10006944 | Ga0207428_1000694410 | 381 |
| 1108 | 3300031456 | Ga0307513_10016740 | Ga0307513_100167402 | 381 |
| 1109 | 3300031548 | Ga0307408_100001506 | Ga0307408_1000015064 | 381 |
| 1110 | 3300031730 | Ga0307516_10077272 | Ga0307516_100772721 | 381 |
| 1111 | 3300031730 | Ga0307516_10082809 | Ga0307516_100828093 | 381 |
| 1112 | 3300033180 | Ga0307510_10012250 | Ga0307510_100122508 | 381 |
| 1113 | 3300035086 | Ga0373934_0004161 | Ga0373934_0004161_3610_4857 | 381 |
| 1114 | 3300035088 | Ga0373940_0012551 | Ga0373940_0012551_275_1522 | 381 |
| 1115 | 3300035111 | Ga0373923_0000671 | Ga0373923_0000671_232_1479 | 381 |
| 1116 | 3300035111 | Ga0373923_0010258 | Ga0373923_0010258_643_1875 | 381 |
| 1117 | 3300035113 | Ga0373936_0027462 | Ga0373936_0027462_13_1233 | 381 |
| 1118 | 3300035114 | Ga0373939_0020896 | Ga0373939_0020896_14_1261 | 381 |
| 1119 | 3300035118 | Ga0373954_0000658 | Ga0373954_0000658_2760_4007 | 381 |
| 1120 | 3300035119 | Ga0373956_0003745 | Ga0373956_0003745_2472_3719 | 381 |
| 1121 | 3300035120 | Ga0373957_0009633 | Ga0373957_0009633_25_1272 | 381 |
| 1122 | 3300035120 | Ga0373957_0051578 | Ga0373957_0051578_197_1429 | 381 |
| 1123 | 3300035170 | Ga0373943_0010364 | Ga0373943_0010364_1668_2900 | 381 |
| 1124 | 3300035410 | Ga0373924_0003932 | Ga0373924_0003932_821_2053 | 381 |
| 1125 | 3300035691 | Ga0373931_0037889 | Ga0373931_0037889_763_2010 | 381 |
| 1126 | 3300035724 | Ga0373933_0000445 | Ga0373933_0000445_22933_24159 | 381 |
| 1127 | 3300035724 | Ga0373933_0033552 | Ga0373933_0033552_1055_2287 | 381 |
| 1128 | 3300035725 | Ga0373947_0094310 | Ga0373947_0094310_309_1541 | 381 |
| 1129 | 3300036401 | Ga0373937_0022764 | Ga0373937_0022764_613_1860 | 381 |
| 1130 | 3300037068 | Ga0373925_0034849 | Ga0373925_0034849_2089_3321 | 381 |
| 1131 | 3300037418 | Ga0395900_0137440 | Ga0395900_0137440_84_1316 | 381 |
| 1132 | 3300037466 | Ga0395898_0033644 | Ga0395898_0033644_1172_2404 | 381 |
| 1133 | 3300039437 | Ga0436365_0063749 | Ga0436365_0063749_2954_4171 | 381 |
| 1134 | 3300039438 | Ga0436360_0207100 | Ga0436360_0207100_974_2206 | 381 |
| 1135 | 3300039447 | Ga0436361_1206490 | Ga0436361_1206490_993_2213 | 381 |
| 1136 | 3300044735 | Ga0466968_0030638 | Ga0466968_0030638_955_2172 | 381 |
| 1137 | 3300044842 | Ga0466957_0059415 | Ga0466957_0059415_525_1754 | 381 |
| 1138 | 3300044842 | Ga0466957_0138351 | Ga0466957_0138351_123_1349 | 381 |
| 1139 | 3300046454 | Ga0495592_0016498 | Ga0495592_0016498_708_1955 | 381 |
| 1140 | 3300046454 | Ga0495592_0102968 | Ga0495592_0102968_400_1632 | 381 |
| 1141 | 3300046455 | Ga0495603_0010741 | Ga0495603_0010741_4060_5292 | 381 |
| 1142 | 3300046460 | Ga0495638_0132377 | Ga0495638_0132377_64_1296 | 381 |
| 1143 | 3300046463 | Ga0495653_0000358 | Ga0495653_0000358_10675_11922 | 381 |
| 1144 | 3300046472 | Ga0495580_0009429 | Ga0495580_0009429_6059_7291 | 381 |
| 1145 | 3300046473 | Ga0495582_0025546 | Ga0495582_0025546_446_1678 | 381 |
| 1146 | 3300046475 | Ga0495639_0011249 | Ga0495639_0011249_643_1875 | 381 |
| 1147 | 3300046477 | Ga0495664_0017108 | Ga0495664_0017108_1090_2322 | 381 |
| 1148 | 3300046514 | Ga0495618_0052656 | Ga0495618_0052656_760_1992 | 381 |
| 1149 | 3300046516 | Ga0495628_0028749 | Ga0495628_0028749_1368_2600 | 381 |
| 1150 | 3300046529 | Ga0495652_0025038 | Ga0495652_0025038_1143_2390 | 381 |
| 1151 | 3300046533 | Ga0495640_0045777 | Ga0495640_0045777_1363_2595 | 381 |
| 1152 | 3300046533 | Ga0495640_0058499 | Ga0495640_0058499_642_1889 | 381 |
| 1153 | 3300046536 | Ga0495587_0010166 | Ga0495587_0010166_2172_3419 | 381 |
| 1154 | 3300046559 | Ga0495667_0030252 | Ga0495667_0030252_281_1513 | 381 |
| 1155 | 3300046642 | Ga0495634_0002891 | Ga0495634_0002891_9393_10640 | 381 |
| 1156 | 3300046642 | Ga0495634_0024961 | Ga0495634_0024961_756_1988 | 381 |
| 1157 | 3300046663 | Ga0495635_0000466 | Ga0495635_0000466_23603_24850 | 381 |
| 1158 | 3300046678 | Ga0495599_0002741 | Ga0495599_0002741_1054_2301 | 381 |
| 1159 | 3300046680 | Ga0495646_0007558 | Ga0495646_0007558_5223_6470 | 381 |
| 1160 | 3300046690 | Ga0495624_0016010 | Ga0495624_0016010_559_1791 | 381 |
| 1161 | 3300046809 | Ga0495600_0001173 | Ga0495600_0001173_11845_13092 | 381 |
| 1162 | 3300047315 | Ga0495581_0007629 | Ga0495581_0007629_210_1442 | 381 |
| 1163 | 3300047317 | Ga0495604_0031510 | Ga0495604_0031510_449_1681 | 381 |
| 1164 | 3300047319 | Ga0495674_0032928 | Ga0495674_0032928_2314_3561 | 381 |
| 1165 | 3300047319 | Ga0495674_0038270 | Ga0495674_0038270_1309_2541 | 381 |
| 1166 | 3300047322 | Ga0495680_0006795 | Ga0495680_0006795_1668_2915 | 381 |
| 1167 | 3300047471 | Ga0495684_0000357 | Ga0495684_0000357_24089_25336 | 381 |
| 1168 | 3300047673 | Ga0495593_0005202 | Ga0495593_0005202_2510_3757 | 381 |
| 1169 | 3300047673 | Ga0495593_0040169 | Ga0495593_0040169_898_2130 | 381 |
| 1170 | 3300048904 | Ga0496101_0090063 | Ga0496101_0090063_818_2038 | 381 |
| 1171 | 3300048909 | Ga0496106_0108946 | Ga0496106_0108946_736_1956 | 381 |
| 1172 | 3300048911 | Ga0496108_0208262 | Ga0496108_0208262_296_1534 | 381 |
| 1173 | 3300048915 | Ga0496112_0003582 | Ga0496112_0003582_4937_6157 | 381 |
| 1174 | 3300048915 | Ga0496112_0037196 | Ga0496112_0037196_3500_4738 | 381 |
| 1175 | 3300048915 | Ga0496112_0037747 | Ga0496112_0037747_1177_2397 | 381 |
| 1176 | 3300048916 | Ga0496113_0068406 | Ga0496113_0068406_944_2182 | 381 |
| 1177 | 3300048920 | Ga0496117_0016248 | Ga0496117_0016248_171_1382 | 381 |
| 1178 | 3300048920 | Ga0496117_0078953 | Ga0496117_0078953_554_1771 | 381 |
| 1179 | 3300048921 | Ga0496118_0012336 | Ga0496118_0012336_834_2045 | 381 |
| 1180 | 3300048921 | Ga0496118_0110427 | Ga0496118_0110427_392_1609 | 381 |
| 1181 | 3300048924 | Ga0496121_0000667 | Ga0496121_0000667_3745_4956 | 381 |
| 1182 | 3300048924 | Ga0496121_0116985 | Ga0496121_0116985_420_1637 | 381 |
| 1183 | 3300048929 | Ga0496126_0054514 | Ga0496126_0054514_87_1298 | 381 |
| 1184 | 3300049581 | Ga0501047_0016182 | Ga0501047_0016182_2448_3674 | 381 |
| 1185 | 3300049586 | Ga0501070_0038271 | Ga0501070_0038271_1992_3218 | 381 |
| 1186 | 3300049742 | Ga0501080_0099386 | Ga0501080_0099386_254_1480 | 381 |
| 1187 | 3300050511 | nmdc:mga08y16_34344_c1 | nmdc:mga08y16_34344_c1_2524_3738 | 381 |
| 1188 | 3300050511 | nmdc:mga08y16_60391_c1 | nmdc:mga08y16_60391_c1_2213_3451 | 381 |
| 1189 | 3300053078 | Ga0495612_0019088 | Ga0495612_0019088_1228_2460 | 381 |
| 1190 | 3300053085 | Ga0495619_0000176 | Ga0495619_0000176_41704_42951 | 381 |
| 1191 | 3300053087 | Ga0500643_000014 | Ga0500643_000014_120048_121277 | 381 |
| 1192 | 3300053094 | Ga0500566_0000009 | Ga0500566_0000009_121896_123116 | 381 |
| 1193 | 3300053095 | Ga0500640_000013 | Ga0500640_000013_6329_7549 | 381 |
| 1194 | 3300053111 | Ga0500572_000248 | Ga0500572_000248_9162_10382 | 381 |
| 1195 | 3300053148 | Ga0500590_057115 | Ga0500590_057115_479_1699 | 381 |
| 1196 | 3300053150 | Ga0500603_000016 | Ga0500603_000016_9016_10236 | 381 |
| 1197 | 3300053156 | Ga0500622_0000973 | Ga0500622_0000973_676_1896 | 381 |
| 1198 | 3300053163 | Ga0500639_000017 | Ga0500639_000017_74417_75637 | 381 |
| 1199 | 3300053735 | Ga0500596_000051 | Ga0500596_000051_6545_7765 | 381 |
| 1200 | iso_pu_bacteria | 2863421361 | 2863424791 | 381 |
| 1201 | iso_pu_bacteria | 2904564687 | 2904571018 | 381 |
| 1202 | iso_pu_bacteria | 2904571731 | 2904575932 | 381 |
| 1203 | iso_pu_bacteria | 2913295892 | 2913296848 | 381 |
| 1204 | iso_pu_bacteria | 2928536128 | 2928539930 | 381 |
| 1205 | iso_pu_bacteria | 8020938398 | 8020945070 | 381 |
| 1206 | iso_pu_bacteria | 8020953355 | 8020956893 | 381 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6hcl-assembly2.cif.gz_B | crystal structure of a mfs transporter with ligand at 2.69 angstroem resolution | 0.8757 | 8 | 370 |
| 6zgr-assembly2.cif.gz_B | crystal structure of a mfs transporter with bound 1-hydroxynaphthalene-2-carboxylic acid at 2.67 angstroem resolution | 0.8756 | 8 | 370 |
| 6zgu-assembly2.cif.gz_B | crystal structure of a mfs transporter with bound 3-(2-methylphenyl)propanoic acid at 2.41 angstroem resolution | 0.8738 | 14 | 370 |
| 8hpj-assembly1.cif.gz_A | crystal structure of the bacterial oxalate transporter oxlt in a ligand-free outward-facing form | 0.8731 | 7 | 374 |
| 6zgs-assembly1.cif.gz_A | crystal structure of a mfs transporter with bound 3-phenylpropanoic acid at 2.39 angstroem resolution | 0.8716 | 7 | 370 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A0R4IK09_14_317_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9592 | 7 | 185 | 1.20.1250.20 |
| af_Q5NC32_11_193_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9581 | 6 | 185 | 1.20.1250.20 |
| af_Q7JWI7_52_243_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9503 | 6 | 185 | 1.20.1250.20 |
| af_E7FGJ9_71_276_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9476 | 8 | 185 | 1.20.1250.20 |
| af_Q5U154_230_448_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9431 | 7 | 185 | 1.20.1250.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6L3NAE6-F1-model_v4 | MFS transporter | 0.9864 | 1 | 195 |
GO:0016020
GO:0022857 |
| AF-A0A6L3NAE6-F1-model_v4 | MFS transporter | 0.9814 | 1 | 195 |
GO:0016020
GO:0022857 |
| AF-F0GI69-F1-model_v4 | Major facilitator transporter | 0.9522 | 1 | 259 |
GO:0016020
GO:0022857 |
| AF-A0A812CRN7-F1-model_v4 | Monocarboxylate transporter 14 | 0.9513 | 6 | 185 |
GO:0008028
GO:0016020 |
| AF-A0A2V6PH11-F1-model_v4 | MFS transporter | 0.9396 | 1 | 224 |
GO:0016020
GO:0022857 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar