F491652

General Info

Members Datasets Scaffolds Average Seq Length
1206 784 857 397

Family's Representative Sequence

Representative Sequence 3300053093|Ga0500651_0022868|Ga0500651_0022868_12_1433
Length 464
Sequence MFSSTTNRICPQARKITVIAAMNNRALTMLSANYLRARKNVSCDIPRPVGFGSSRASSTQRALMWRPEMSNFHYRWVIVAAGGLLGCVAIGGMFSLPVFLQPIARDTGWSVTGISSAMTIGFLAMAVTSMIWGTLSDRLGPLPVVLTGSVVLASSLXXXSLATSLVAFQFIFGLMVGGATAAIFAPMMATVTGWFDTHRSLAVSLVSAGMGMAPMTMSPLAAWLVSNHDWRTSMQIVALVVAAIMIPVSLLVRRAPALEGAPFAPSAEPVQAEMSRAQALRSPQFIILLLTNFFCCATHSGPIIHTVSYAISCGIPLVAAVTIYSVEGLAGMGGRIAFGLLGDRFGAKRVLVLLGFVFVRELGGFYTVAAVFGFIYAGTMPLYAVLARENFPLRMMGTVIGGTAMAGSLGMATGPLAGGLIYDAFASYAWLYIGSWIMGLGAFLIAMTFRPMPVAKAEPAPLPA

Samples

Sample ID Description Type Environment
1 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
2 2509276019 Ensifer aridi TW10 Isolate Nodule
3 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
4 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
5 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
6 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
7 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
8 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
9 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
10 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
11 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
12 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
13 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
14 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
15 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
16 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
17 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
18 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
19 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
20 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
21 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
22 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
23 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
24 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
25 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
26 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
27 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
28 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
29 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
30 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
31 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
32 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
33 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
34 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
35 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
36 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
37 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
38 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
39 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
40 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
41 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
42 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
43 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
44 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
45 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
46 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
47 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
48 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
49 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
50 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
51 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
52 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
53 2643221557 Ensifer sp. Root558 Isolate Unclassified
54 2643221585 Pelomonas sp. Root662 Isolate Unclassified
55 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
56 2643221607 Rhizobium sp. Root73 Isolate Unclassified
57 2643221610 Ensifer sp. Root74 Isolate Unclassified
58 2643221618 Ensifer sp. Root231 Isolate Unclassified
59 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
60 2643221626 Ensifer sp. Root31 Isolate Unclassified
61 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
62 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
63 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
64 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
65 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
66 2643221655 Ensifer sp. Root1252 Isolate Unclassified
67 2643221656 Pelomonas sp. Root405 Isolate Unclassified
68 2643221659 Ensifer sp. Root127 Isolate Unclassified
69 2643221668 Ensifer sp. Root423 Isolate Unclassified
70 2643221675 Ensifer sp. Root1298 Isolate Unclassified
71 2643221680 Ensifer sp. Root1312 Isolate Unclassified
72 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
73 2643221688 Rhizobium sp. Root482 Isolate Unclassified
74 2643221698 Ensifer sp. Root142 Isolate Unclassified
75 2643221712 Ensifer sp. Root258 Isolate Unclassified
76 2643221718 Rhizobium sp. Root268 Isolate Unclassified
77 2643221723 Ensifer sp. Root278 Isolate Unclassified
78 2643221726 Ensifer sp. Root954 Isolate Unclassified
79 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
80 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
81 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
82 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
83 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
84 2738541337 Pelomonas sp. BT06 Isolate Unclassified
85 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
86 2751185800 Brucella pituitosa AA2 Isolate Unclassified
87 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
88 2791355199
89 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
90 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
91 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
92 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
93 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
94 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
95 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
96 2818991452 Burkholderia cepacia 561 Isolate Unclassified
97 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
98 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
99 2841760612 Bosea sp. Tri-49 Isolate Nodule
100 2844104063 Bosea sp. Tri-39 Isolate Nodule
101 2844163670 Ensifer sp. 1H6 Isolate Unclassified
102 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
103 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
104 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
105 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
106 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
107 2851182111 Bosea sp. Tri-44 Isolate Nodule
108 2851246043 Bosea sp. Tri-54 Isolate Nodule
109 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
110 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
111 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
112 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
113 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
114 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
115 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
116 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
117 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
118 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
119 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
120 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
121 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
122 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
123 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
124 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
125 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
126 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
127 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
128 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
129 2904564687 Burkholderia sp. 571 Isolate Unclassified
130 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
131 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
132 2904699407
133 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
134 2906610324
135 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
136 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
137 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
138 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
139 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
140 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
141 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
142 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
143 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
144 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
145 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
146 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
147 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
148 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
149 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
150 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
151 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
152 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
153 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
154 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
155 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
156 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
157 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
158 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
159 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
160 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
161 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
162 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
163 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
164 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
165 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
166 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
167 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
168 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
169 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
170 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
171 2922425934
172 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
173 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
174 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
175 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
176 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
177 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
178 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
179 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
180 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
181 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
182 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
183 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
184 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
185 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
186 2928163908 Burkholderia sp. 567 Isolate Unclassified
187 2928170801 Burkholderia sp. 572 Isolate Unclassified
188 2928536128 Burkholderia sola 565 Isolate Unclassified
189 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
190 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
191 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
192 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
193 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
194 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
195 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
196 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
197 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
198 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
199 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
200 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
201 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
202 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
203 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
204 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
205 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
206 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
207 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
208 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
209 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
210 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
211 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
212 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
213 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
214 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
215 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
216 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
217 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
218 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
219 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
220 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
221 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
222 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
223 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
224 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
225 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
226 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
227 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
228 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
229 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
230 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
231 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
232 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
233 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
234 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
235 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
236 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
237 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
238 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
239 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
240 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
241 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
242 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
243 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
244 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
245 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
246 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
247 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
248 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
249 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
250 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
251 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
252 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
253 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
254 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
255 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
256 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
257 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
258 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
259 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
260 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
261 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
262 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
263 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
264 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
265 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
266 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
267 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
268 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
269 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
270 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
271 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
272 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
273 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
274 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
275 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
276 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
277 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
278 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
279 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
280 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
281 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
282 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
283 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
284 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
285 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
286 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
287 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
288 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
289 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
290 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
291 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
292 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
293 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
294 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
295 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
296 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
297 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
298 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
299 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
300 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
301 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
302 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
303 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
304 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
305 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
306 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
307 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
308 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
309 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
310 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
311 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
312 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
313 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
314 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
315 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
316 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
317 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
318 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
319 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
320 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
321 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
322 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
323 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
324 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
325 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
326 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
327 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
328 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
329 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
330 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
331 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
332 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
333 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
334 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
335 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
336 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
337 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
338 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
339 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
340 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
341 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
342 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
343 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
344 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
345 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
346 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
347 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
348 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
349 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
350 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
351 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
352 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
353 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
354 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
355 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
356 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
357 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
358 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
359 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
360 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
361 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
362 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
363 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
364 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
365 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
366 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
367 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
368 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
369 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
370 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
371 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
372 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
373 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
374 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
375 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
376 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
377 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
378 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
379 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
380 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
381 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
382 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
383 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
384 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
385 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
386 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
387 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
388 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
389 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
390 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
391 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
392 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
393 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
394 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
395 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
396 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
397 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
398 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
399 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
400 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
401 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
402 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
403 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
404 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
405 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
406 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
407 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
408 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
409 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
410 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
411 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
412 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
413 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
414 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
415 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
416 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
417 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
418 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
419 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
420 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
421 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
422 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
423 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
424 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
425 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
426 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
427 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
428 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
429 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
430 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
431 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
432 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
433 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
434 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
435 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
436 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
437 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
438 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
439 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
440 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
441 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
442 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
443 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
444 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
445 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
446 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
447 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
448 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
449 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
450 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
451 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
452 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
453 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
454 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
455 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
456 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
457 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
458 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
459 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
460 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
461 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
462 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
463 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
464 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
465 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
466 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
467 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
468 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
469 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
470 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
471 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
472 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
473 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
474 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
475 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
476 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
477 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
478 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
479 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
480 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
481 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
482 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
483 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
484 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
485 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
486 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
487 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
488 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
489 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
490 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
491 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
492 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
493 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
494 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
495 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
496 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
497 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
498 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
499 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
500 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
501 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
502 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
503 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
504 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
505 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
506 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
507 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
508 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
509 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
510 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
511 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
512 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
513 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
514 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
515 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
516 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
517 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
518 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
519 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
520 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
521 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
522 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
523 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
524 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
525 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
526 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
527 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
528 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
529 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
530 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
531 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
532 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
533 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
534 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
535 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
536 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
537 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
538 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
539 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
540 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
541 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
542 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
543 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
544 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
545 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
546 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
547 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
548 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
549 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
550 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
551 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
552 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
553 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
554 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
555 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
556 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
557 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
558 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
559 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
560 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
561 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
562 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
563 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
564 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
565 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
566 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
567 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
568 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
569 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
570 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
571 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
572 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
573 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
574 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
575 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
576 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
577 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
578 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
579 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
580 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
581 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
582 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
583 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
584 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
585 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
586 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
587 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
588 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
589 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
590 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
591 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
592 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
593 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
594 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
595 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
596 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
597 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
598 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
599 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
600 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
601 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
602 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
603 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
604 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
605 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
606 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
607 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
608 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
609 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
610 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
611 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
612 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
613 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
614 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
615 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
616 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
617 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
618 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
619 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
620 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
621 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
622 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
623 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
624 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
625 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
626 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
627 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
628 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
629 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
630 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
631 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
632 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
633 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
634 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
635 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
636 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
637 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
638 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
639 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
640 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
641 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
642 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
643 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
644 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
645 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
646 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
647 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
648 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
649 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
650 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
651 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
652 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
653 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
654 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
655 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
656 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
657 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
658 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
659 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
660 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
661 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
662 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
663 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
664 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
665 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
666 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
667 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
668 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
669 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
670 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
671 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
672 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
673 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
674 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
675 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
676 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
677 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
678 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
679 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
680 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
681 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
682 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
683 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
684 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
685 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
686 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
687 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
688 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
689 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
690 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
691 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
692 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
693 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
694 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
695 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
696 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
697 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
698 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
699 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
700 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
701 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
702 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
703 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
704 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
705 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
706 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
707 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
708 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
709 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
710 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
711 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
712 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
713 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
714 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
715 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
716 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
717 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
718 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
719 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
720 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
721 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
722 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
723 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
724 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
725 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
726 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
727 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
728 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
729 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
730 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
731 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
732 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
733 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
734 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
735 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
736 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
737 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
738 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
739 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
740 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
741 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
742 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
743 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
744 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
745 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
746 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
747 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
748 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
749 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
750 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
751 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
752 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
753 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
754 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
755 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
756 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
757 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
758 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
759 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
760 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
761 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
762 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
763 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
764 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
765 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
766 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
767 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
768 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
769 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
770 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
771 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
772 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
773 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
774 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
775 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
776 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
777 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified
778 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
779 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
780 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
781 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
782 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
783 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule
784 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 71.13
Metatranscriptomes 0.17
Isolates 28.7

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.35
Nodule 22.47
Rhizoplane 4.15
Rhizosphere 47.6
Stem 0
Stem Tuber 0
Unclassified 13.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10005337 3300001989 Bacteria 4893
2 JGI25152J39213_1001786 3300002773 Bacteria 8753
3 JGI25406J46586_10000047 3300003203 Bacteria 54770
4 JGI25406J46586_10010338 3300003203 Bacteria 4143
5 JGI25153J46596_10001087 3300003215 Bacteria 16573
6 JGI25153J46596_10004173 3300003215 Bacteria 7840
7 JGI25153J46596_10006828 3300003215 Bacteria 5710
8 rootH1_10001161 3300003316 Bacteria 9871
9 rootL2_10019891 3300003322 Bacteria 13677
10 rootL2_10034669 3300003322 Bacteria 6142
11 rootH1_10034711 3300003323 Bacteria 5777
12 rootH1_10130802 3300003323 Bacteria 3494
13 JGI25160J50197_1024513 3300003354 Bacteria 1710
14 JGI25404J52841_10009459 3300003659 Bacteria 2084
15 JGI25404J52841_10015804 3300003659 Bacteria 1637
16 JGI25404J52841_10019938 3300003659 Bacteria 1453
17 Ga0055532_1000336 3300003758 Bacteria 25720
18 Ga0055532_1000487 3300003758 Bacteria 17732
19 Ga0055532_1000625 3300003758 Bacteria 13853
20 Ga0055527_1000433 3300003760 Bacteria 16809
21 Ga0055535_1000645 3300003761 Bacteria 27787
22 Ga0055535_1001075 3300003761 Bacteria 16809
23 Ga0055542_1000667 3300003762 Bacteria 27814
24 Ga0055529_1000485 3300003763 Bacteria 37024
25 Ga0055536_1000494 3300003781 Bacteria 27289
26 Ga0055530_10006225 3300003791 Bacteria 5387
27 Ga0055531_10000007 3300003794 Bacteria 225289
28 Ga0055531_10000751 3300003794 Bacteria 27289
29 Ga0058692_1007459 3300003856 Bacteria 2900
30 Ga0065165_1001016 3300005262 Bacteria 34080
31 Ga0065165_1003660 3300005262 Bacteria 10496
32 Ga0065707_10090722 3300005295 Bacteria 4079
33 Ga0070683_100003949 3300005329 Bacteria 12137
34 Ga0070683_100008752 3300005329 Bacteria 8604
35 Ga0070670_100069354 3300005331 Bacteria 3026
36 Ga0070670_100131893 3300005331 Bacteria 2158
37 Ga0070680_100088646 3300005336 Bacteria 2560
38 Ga0068868_100089535 3300005338 Bacteria 2477
39 Ga0068868_100254042 3300005338 Bacteria 1480
40 Ga0070660_100004626 3300005339 Bacteria 9527
41 Ga0070661_100011984 3300005344 Bacteria 6057
42 Ga0070668_100049968 3300005347 Bacteria 3218
43 Ga0070669_100016208 3300005353 Bacteria 5315
44 Ga0070671_100006532 3300005355 Bacteria 9322
45 Ga0070671_100130488 3300005355 Bacteria 2117
46 Ga0070674_100037323 3300005356 Bacteria 3267
47 Ga0070673_100005015 3300005364 Bacteria 8447
48 Ga0070688_100062477 3300005365 Bacteria 2358
49 Ga0070688_100112071 3300005365 Bacteria 1815
50 Ga0070659_100000096 3300005366 Bacteria 66336
51 Ga0070659_100255603 3300005366 Bacteria 1453
52 Ga0070667_100000046 3300005367 Bacteria 162942
53 Ga0070709_10082900 3300005434 Bacteria 2096
54 Ga0070709_10121061 3300005434 Bacteria 1774
55 Ga0070714_100015299 3300005435 Bacteria 6173
56 Ga0070714_100097495 3300005435 Bacteria 2585
57 Ga0070713_100043527 3300005436 Bacteria 3671
58 Ga0070713_100047166 3300005436 Bacteria 3539
59 Ga0070710_10001502 3300005437 Bacteria 10994
60 Ga0070711_100016359 3300005439 Bacteria 4709
61 Ga0070711_100097355 3300005439 Bacteria 2133
62 Ga0070694_100061484 3300005444 Bacteria 2563
63 Ga0070663_100007285 3300005455 Bacteria 6725
64 Ga0070663_100049819 3300005455 Bacteria 2976
65 Ga0070678_100032249 3300005456 Bacteria 3624
66 Ga0070678_100064892 3300005456 Bacteria 2708
67 Ga0070681_10018623 3300005458 Bacteria 6944
68 Ga0070681_10019757 3300005458 Bacteria 6747
69 Ga0070681_10082606 3300005458 Bacteria 3167
70 Ga0070681_10092243 3300005458 Bacteria 2978
71 Ga0068867_100000114 3300005459 Bacteria 51011
72 Ga0068867_100148148 3300005459 Bacteria 1841
73 Ga0070706_100053290 3300005467 Bacteria 3733
74 Ga0070707_100192144 3300005468 Bacteria 1990
75 Ga0070679_100240777 3300005530 Bacteria 1766
76 Ga0070684_100004025 3300005535 Bacteria 11121
77 Ga0070684_100119270 3300005535 Bacteria 2372
78 Ga0068853_100006217 3300005539 Bacteria 9458
79 Ga0068853_100157379 3300005539 Bacteria 2048
80 Ga0070672_100002864 3300005543 Bacteria 11080
81 Ga0070672_100215073 3300005543 Bacteria 1611
82 Ga0070672_100253054 3300005543 Bacteria 1484
83 Ga0070696_100024364 3300005546 Bacteria 4113
84 Ga0070665_100096284 3300005548 Bacteria 2965
85 Ga0068855_100025743 3300005563 Bacteria 7035
86 Ga0068855_100030991 3300005563 Bacteria 6391
87 Ga0068855_100112346 3300005563 Bacteria 3126
88 Ga0068857_100066630 3300005577 Bacteria 3204
89 Ga0068857_100182640 3300005577 Bacteria 1909
90 Ga0068854_100049351 3300005578 Bacteria 3006
91 Ga0068854_100112613 3300005578 Bacteria 2055
92 Ga0068856_100001367 3300005614 Bacteria 25662
93 Ga0068856_100001863 3300005614 Bacteria 22015
94 Ga0068856_100092848 3300005614 Bacteria 3003
95 Ga0068852_100018555 3300005616 Bacteria 5483
96 Ga0068852_100110232 3300005616 Bacteria 2501
97 Ga0068859_100334942 3300005617 Bacteria 1607
98 Ga0068861_100044771 3300005719 Bacteria 3329
99 Ga0068861_100066781 3300005719 Bacteria 2774
100 Ga0068861_100087742 3300005719 Bacteria 2448
101 Ga0068861_100161430 3300005719 Bacteria 1849
102 Ga0068870_10006240 3300005840 Bacteria 5245
103 Ga0068863_100007146 3300005841 Bacteria 10954
104 Ga0068863_100109795 3300005841 Bacteria 2626
105 Ga0068863_100338906 3300005841 Bacteria 1463
106 Ga0068860_100081526 3300005843 Bacteria 3076
107 Ga0068860_100120072 3300005843 Bacteria 2517
108 Ga0068860_100132747 3300005843 Bacteria 2390
109 Ga0068862_100022007 3300005844 Bacteria 5332
110 Ga0081455_10001796 3300005937 Bacteria 25915
111 Ga0081455_10007694 3300005937 Bacteria 11311
112 Ga0081455_10021438 3300005937 Bacteria 6060
113 Ga0081455_10162057 3300005937 Bacteria 1713
114 Ga0081540_1000430 3300005983 Bacteria 41337
115 Ga0081540_1003122 3300005983 Bacteria 13262
116 Ga0081540_1003695 3300005983 Bacteria 11992
117 Ga0081540_1006483 3300005983 Bacteria 8514
118 Ga0081540_1010556 3300005983 Bacteria 6240
119 Ga0081540_1029244 3300005983 Bacteria 3075
120 Ga0081539_10000140 3300005985 Bacteria 166746
121 Ga0081539_10001457 3300005985 Bacteria 40268
122 Ga0081539_10055593 3300005985 Bacteria 2201
123 Ga0070717_10064914 3300006028 Bacteria 3033
124 Ga0070717_10186287 3300006028 Bacteria 1812
125 Ga0075365_10004360 3300006038 Bacteria 7480
126 Ga0075365_10058843 3300006038 Bacteria 2559
127 Ga0075365_10102264 3300006038 Bacteria 1963
128 Ga0075368_10029402 3300006042 Bacteria 2124
129 Ga0075363_100001666 3300006048 Bacteria 8590
130 Ga0075363_100163292 3300006048 Bacteria 1262
131 Ga0075364_10041422 3300006051 Bacteria 2991
132 Ga0075364_10047344 3300006051 Bacteria 2800
133 Ga0070715_10001855 3300006163 Bacteria 6321
134 Ga0070716_100004571 3300006173 Bacteria 6629
135 Ga0070712_100143062 3300006175 Bacteria 1827
136 Ga0075367_10011824 3300006178 Bacteria 4635
137 Ga0075367_10012672 3300006178 Bacteria 4508
138 Ga0075367_10013751 3300006178 Bacteria 4363
139 Ga0075367_10051022 3300006178 Bacteria 2444
140 Ga0075367_10057130 3300006178 Bacteria 2320
141 Ga0075369_10022854 3300006186 Bacteria 2582
142 Ga0075366_10005924 3300006195 Bacteria 6646
143 Ga0075366_10012466 3300006195 Bacteria 4823
144 Ga0075366_10019567 3300006195 Bacteria 3920
145 Ga0075366_10060384 3300006195 Bacteria 2252
146 Ga0075370_10000054 3300006353 Bacteria 34222
147 Ga0075370_10003024 3300006353 Bacteria 7927
148 Ga0075370_10005197 3300006353 Bacteria 6437
149 Ga0075370_10008336 3300006353 Bacteria 5329
150 Ga0075370_10023284 3300006353 Bacteria 3410
151 Ga0075370_10074949 3300006353 Bacteria 1939
152 Ga0068871_100034578 3300006358 Bacteria 4011
153 Ga0075428_100144634 3300006844 Bacteria 2585
154 Ga0075428_100251449 3300006844 Bacteria 1905
155 Ga0075433_10005585 3300006852 Bacteria 9883
156 Ga0075434_100006322 3300006871 Bacteria 10859
157 Ga0068865_100048816 3300006881 Bacteria 2914
158 Ga0097620_100334959 3300006931 Bacteria 1607
159 Ga0099822_1006420 3300006943 Bacteria 15307
160 Ga0099823_1022490 3300006944 Bacteria 5831
161 Ga0079104_1002719 3300006946 Bacteria 9048
162 Ga0075435_100131190 3300007076 Bacteria 2097
163 Ga0105240_10002728 3300009093 Bacteria 28006
164 Ga0105240_10015349 3300009093 Bacteria 10417
165 Ga0105240_10039788 3300009093 Bacteria 6018
166 Ga0105240_10060516 3300009093 Bacteria 4721
167 Ga0105240_10082573 3300009093 Bacteria 3946
168 Ga0105240_10232942 3300009093 Bacteria 2139
169 Ga0111539_10001545 3300009094 Bacteria 30641
170 Ga0111539_10024722 3300009094 Bacteria 7368
171 Ga0111539_10283371 3300009094 Bacteria 1928
172 Ga0105245_10009601 3300009098 Bacteria 8438
173 Ga0105245_10079039 3300009098 Bacteria 3002
174 Ga0105247_10015519 3300009101 Bacteria 4561
175 Ga0105247_10078735 3300009101 Bacteria 2074
176 Ga0114129_10005987 3300009147 Bacteria 17229
177 Ga0114129_10030992 3300009147 Bacteria 7564
178 Ga0114129_10086742 3300009147 Bacteria 4341
179 Ga0114129_10132303 3300009147 Bacteria 3425
180 Ga0105243_10010808 3300009148 Bacteria 6908
181 Ga0105243_10107602 3300009148 Bacteria 2326
182 Ga0105241_10014736 3300009174 Bacteria 5723
183 Ga0105241_10023623 3300009174 Bacteria 4560
184 Ga0105241_10137847 3300009174 Bacteria 1983
185 Ga0105242_10011167 3300009176 Bacteria 6901
186 Ga0105248_10037249 3300009177 Bacteria 5441
187 Ga0105248_10040535 3300009177 Bacteria 5221
188 Ga0105248_10050503 3300009177 Bacteria 4665
189 Ga0105237_10005346 3300009545 Bacteria 14530
190 Ga0105237_10036635 3300009545 Bacteria 4964
191 Ga0105237_10037912 3300009545 Bacteria 4869
192 Ga0105237_10242019 3300009545 Bacteria 1805
193 Ga0105238_10006144 3300009551 Bacteria 11923
194 Ga0105238_10034527 3300009551 Bacteria 5144
195 Ga0105238_10078501 3300009551 Bacteria 3291
196 Ga0105238_10254919 3300009551 Bacteria 1733
197 Ga0105238_10374994 3300009551 Bacteria 1414
198 Ga0105249_10011337 3300009553 Bacteria 7827
199 Ga0105249_10017301 3300009553 Bacteria 6400
200 Ga0105249_10064400 3300009553 Bacteria 3370
201 Ga0105239_10008694 3300010375 Bacteria 11496
202 Ga0105239_10014915 3300010375 Bacteria 8614
203 Ga0105239_10024305 3300010375 Bacteria 6674
204 Ga0105239_10027738 3300010375 Bacteria 6230
205 Ga0105239_10078805 3300010375 Bacteria 3625
206 Ga0105239_10223788 3300010375 Bacteria 2110
207 Ga0105239_10389100 3300010375 Bacteria 1577
208 Ga0105239_10443021 3300010375 Bacteria 1473
209 Ga0105246_10006065 3300011119 Bacteria 7375
210 Ga0105246_10216145 3300011119 Bacteria 1499
211 Ga0157370_10256064 3300013104 Bacteria 1618
212 Ga0157369_10006104 3300013105 Bacteria 13985
213 Ga0157369_10018323 3300013105 Bacteria 7851
214 Ga0157369_10067796 3300013105 Bacteria 3835
215 Ga0157374_10154340 3300013296 Bacteria 2233
216 Ga0157378_10140977 3300013297 Bacteria 2238
217 Ga0163162_10037622 3300013306 Bacteria 4829
218 Ga0163162_10105133 3300013306 Bacteria 2918
219 Ga0163162_10193308 3300013306 Bacteria 2163
220 Ga0163162_10288935 3300013306 Bacteria 1772
221 Ga0163162_10344808 3300013306 Bacteria 1622
222 Ga0157375_10042147 3300013308 Bacteria 4416
223 Ga0157375_10187874 3300013308 Bacteria 2220
224 Ga0157380_10003721 3300014326 Bacteria 10487
225 Ga0157380_10078449 3300014326 Bacteria 2694
226 Ga0182008_10012706 3300014497 Bacteria 4441
227 Ga0157377_10000016 3300014745 Bacteria 190613
228 Ga0157377_10073055 3300014745 Bacteria 1986
229 Ga0157379_10085734 3300014968 Bacteria 2823
230 Ga0214544_1000130 3300021320 Bacteria 108844
231 Ga0214542_1000014 3300021321 Bacteria 233825
232 Ga0214543_1000056 3300021327 Bacteria 134292
233 Ga0213876_10001505 3300021384 Bacteria 14427
234 Ga0213876_10088101 3300021384 Bacteria 1644
235 Ga0213875_10018065 3300021388 Bacteria 3402
236 Ga0213871_10027702 3300021441 Bacteria 1457
237 Ga0213871_10028365 3300021441 Bacteria 1444
238 Ga0228711_1000005 3300022739 Bacteria 215594
239 Ga0228710_1000141 3300022740 Bacteria 66299
240 Ga0209566_100744 3300025225 Bacteria 17997
241 Ga0209672_100014 3300025228 Bacteria 546252
242 Ga0209672_100023 3300025228 Bacteria 371758
243 Ga0209147_100094 3300025229 Bacteria 167145
244 Ga0209147_100104 3300025229 Bacteria 158375
245 Ga0209147_100246 3300025229 Bacteria 52692
246 Ga0209258_100040 3300025242 Bacteria 385401
247 Ga0209258_100142 3300025242 Bacteria 165865
248 Ga0207425_1000292 3300025245 Bacteria 36526
249 Ga0209148_1000035 3300025254 Bacteria 548413
250 Ga0209148_1000420 3300025254 Bacteria 47555
251 Ga0209148_1001163 3300025254 Bacteria 15301
252 Ga0209148_1002212 3300025254 Bacteria 7158
253 Ga0209129_1000025 3300025258 Bacteria 413639
254 Ga0209233_1008977 3300025261 Bacteria 3059
255 Ga0209455_1000072 3300025272 Bacteria 293074
256 Ga0209455_1000290 3300025272 Bacteria 53526
257 Ga0209455_1000724 3300025272 Bacteria 19116
258 Ga0209673_1000030 3300025273 Bacteria 351933
259 Ga0209673_1008534 3300025273 Bacteria 4550
260 Ga0209676_1001218 3300025292 Bacteria 27313
261 Ga0209564_1000039 3300025295 Bacteria 413604
262 Ga0209564_1019094 3300025295 Bacteria 2579
263 Ga0209758_1000163 3300025297 Bacteria 151988
264 Ga0209758_1001092 3300025297 Bacteria 35145
265 Ga0209758_1008732 3300025297 Bacteria 6475
266 Ga0209758_1014674 3300025297 Bacteria 4143
267 Ga0209050_1002131 3300025298 Bacteria 18032
268 Ga0207426_1000822 3300025302 Bacteria 33249
269 Ga0209051_1002753 3300025303 Bacteria 12174
270 Ga0209257_1000021 3300025304 Bacteria 771986
271 Ga0209257_1000282 3300025304 Bacteria 113789
272 Ga0207692_10004784 3300025898 Bacteria 5382
273 Ga0207710_10015256 3300025900 Bacteria 3244
274 Ga0207688_10099259 3300025901 Bacteria 1680
275 Ga0207647_10003764 3300025904 Bacteria 11341
276 Ga0207699_10024636 3300025906 Bacteria 3293
277 Ga0207699_10046650 3300025906 Bacteria 2536
278 Ga0207699_10100166 3300025906 Bacteria 1837
279 Ga0207645_10137230 3300025907 Bacteria 1593
280 Ga0207643_10009590 3300025908 Bacteria 5200
281 Ga0207643_10019696 3300025908 Bacteria 3699
282 Ga0207705_10095723 3300025909 Bacteria 2179
283 Ga0207705_10125201 3300025909 Bacteria 1909
284 Ga0207684_10039118 3300025910 Bacteria 4025
285 Ga0207684_10193404 3300025910 Bacteria 1755
286 Ga0207707_10002222 3300025912 Bacteria 17546
287 Ga0207707_10033012 3300025912 Bacteria 4531
288 Ga0207707_10094516 3300025912 Bacteria 2612
289 Ga0207695_10000910 3300025913 Bacteria 53286
290 Ga0207695_10002575 3300025913 Bacteria 26635
291 Ga0207695_10027361 3300025913 Bacteria 6351
292 Ga0207695_10052282 3300025913 Bacteria 4281
293 Ga0207695_10107737 3300025913 Bacteria 2772
294 Ga0207695_10243577 3300025913 Bacteria 1699
295 Ga0207695_10287245 3300025913 Bacteria 1538
296 Ga0207671_10055232 3300025914 Bacteria 2942
297 Ga0207693_10007521 3300025915 Bacteria 8946
298 Ga0207693_10147646 3300025915 Bacteria 1849
299 Ga0207663_10001619 3300025916 Bacteria 10601
300 Ga0207663_10175850 3300025916 Bacteria 1524
301 Ga0207657_10000004 3300025919 Bacteria 247179
302 Ga0207652_10047896 3300025921 Bacteria 3652
303 Ga0207652_10083224 3300025921 Bacteria 2802
304 Ga0207681_10001545 3300025923 Bacteria 14838
305 Ga0207681_10215298 3300025923 Bacteria 1483
306 Ga0207694_10245725 3300025924 Bacteria 1463
307 Ga0207650_10033523 3300025925 Bacteria 3720
308 Ga0207650_10188508 3300025925 Bacteria 1647
309 Ga0207659_10052620 3300025926 Bacteria 2901
310 Ga0207700_10040248 3300025928 Bacteria 3410
311 Ga0207700_10062918 3300025928 Bacteria 2820
312 Ga0207664_10084044 3300025929 Bacteria 2596
313 Ga0207644_10028183 3300025931 Bacteria 3885
314 Ga0207644_10122094 3300025931 Bacteria 1984
315 Ga0207690_10000015 3300025932 Bacteria 257457
316 Ga0207706_10018459 3300025933 Bacteria 6275
317 Ga0207706_10068405 3300025933 Bacteria 3124
318 Ga0207709_10007776 3300025935 Bacteria 5940
319 Ga0207709_10109719 3300025935 Bacteria 1842
320 Ga0207704_10088455 3300025938 Bacteria 2026
321 Ga0207665_10003514 3300025939 Bacteria 10466
322 Ga0207691_10110334 3300025940 Bacteria 2447
323 Ga0207691_10132839 3300025940 Bacteria 2197
324 Ga0207711_10038488 3300025941 Bacteria 4068
325 Ga0207711_10123071 3300025941 Bacteria 2318
326 Ga0207689_10020193 3300025942 Bacteria 5611
327 Ga0207661_10003202 3300025944 Bacteria 11342
328 Ga0207667_10072260 3300025949 Bacteria 3586
329 Ga0207667_10213867 3300025949 Bacteria 1976
330 Ga0207712_10002593 3300025961 Bacteria 11609
331 Ga0207712_10008695 3300025961 Bacteria 6422
332 Ga0207712_10191700 3300025961 Bacteria 1614
333 Ga0207668_10085779 3300025972 Bacteria 2298
334 Ga0207668_10137508 3300025972 Bacteria 1874
335 Ga0207668_10172403 3300025972 Bacteria 1698
336 Ga0207640_10038292 3300025981 Bacteria 3024
337 Ga0207640_10081019 3300025981 Bacteria 2218
338 Ga0207658_10000058 3300025986 Bacteria 122331
339 Ga0207658_10150217 3300025986 Bacteria 1897
340 Ga0207677_10033178 3300026023 Bacteria 3327
341 Ga0207677_10126221 3300026023 Bacteria 1934
342 Ga0207677_10200032 3300026023 Bacteria 1587
343 Ga0207703_10025822 3300026035 Bacteria 4623
344 Ga0207639_10048147 3300026041 Bacteria 3225
345 Ga0207639_10145366 3300026041 Bacteria 1980
346 Ga0207678_10004789 3300026067 Bacteria 12146
347 Ga0207678_10012877 3300026067 Bacteria 7341
348 Ga0207678_10016652 3300026067 Bacteria 6457
349 Ga0207678_10042320 3300026067 Bacteria 3947
350 Ga0207678_10142331 3300026067 Bacteria 2047
351 Ga0207708_10148399 3300026075 Bacteria 1844
352 Ga0207702_10000106 3300026078 Bacteria 97204
353 Ga0207702_10000761 3300026078 Bacteria 34283
354 Ga0207641_10000557 3300026088 Bacteria 41685
355 Ga0207641_10202459 3300026088 Bacteria 1831
356 Ga0207648_10000343 3300026089 Bacteria 51081
357 Ga0207648_10004572 3300026089 Bacteria 14186
358 Ga0207648_10145222 3300026089 Bacteria 2092
359 Ga0207676_10042731 3300026095 Bacteria 3486
360 Ga0207676_10241343 3300026095 Bacteria 1621
361 Ga0207674_10078198 3300026116 Bacteria 3313
362 Ga0207674_10083238 3300026116 Bacteria 3199
363 Ga0207674_10083292 3300026116 Bacteria 3198
364 Ga0207675_100037251 3300026118 Bacteria 4538
365 Ga0207675_100151390 3300026118 Bacteria 2208
366 Ga0207683_10088182 3300026121 Bacteria 2760
367 Ga0207683_10100833 3300026121 Bacteria 2577
368 Ga0207683_10253213 3300026121 Bacteria 1607
369 Ga0207683_10288810 3300026121 Bacteria 1499
370 Ga0207698_10014336 3300026142 Bacteria 5266
371 Ga0207698_10089502 3300026142 Bacteria 2514
372 Ga0207698_10188439 3300026142 Bacteria 1835
373 Ga0207698_10250772 3300026142 Bacteria 1619
374 Ga0209281_1000111 3300027111 Bacteria 215615
375 Ga0209281_1000185 3300027111 Bacteria 144489
376 Ga0209389_1000201 3300027296 Bacteria 42938
377 Ga0209371_1000079 3300027312 Bacteria 187621
378 Ga0209589_1000001 3300027357 Bacteria 794224
379 Ga0209489_100001 3300027361 Bacteria 794224
380 Ga0209489_100035 3300027361 Bacteria 168255
381 Ga0209700_100001 3300027363 Bacteria 794224
382 Ga0209700_100005 3300027363 Bacteria 573969
383 Ga0209282_1000012 3300027666 Bacteria 215614
384 Ga0209998_10006506 3300027717 Bacteria 2428
385 Ga0209974_10007537 3300027876 Bacteria 3745
386 Ga0207428_10006944 3300027907 Bacteria 10375
387 Ga0268266_10001162 3300028379 Bacteria 32576
388 Ga0268266_10026905 3300028379 Bacteria 4893
389 Ga0268266_10030473 3300028379 Bacteria 4583
390 Ga0268266_10053037 3300028379 Bacteria 3483
391 Ga0268266_10232940 3300028379 Bacteria 1697
392 Ga0268265_10002240 3300028380 Bacteria 14837
393 Ga0268265_10022190 3300028380 Bacteria 4457
394 Ga0268265_10063058 3300028380 Bacteria 2850
395 Ga0268265_10364830 3300028380 Bacteria 1323
396 Ga0268264_10000149 3300028381 Bacteria 163972
397 Ga0268264_10320483 3300028381 Bacteria 1465
398 Ga0268264_10391601 3300028381 Bacteria 1333
399 Ga0307517_10000249 3300028786 Bacteria 91911
400 Ga0307515_10000112 3300028794 Bacteria 195015
401 Ga0307515_10000305 3300028794 Bacteria 121634
402 Ga0307515_10025474 3300028794 Bacteria 10232
403 Ga0307515_10033784 3300028794 Bacteria 8406
404 Ga0307515_10082891 3300028794 Bacteria 4140
405 Ga0307515_10132804 3300028794 Bacteria 2728
406 Ga0307515_10154087 3300028794 Bacteria 2384
407 Ga0265338_10005146 3300028800 Bacteria 17218
408 Ga0268256_1000090 3300030500 Bacteria 153976
409 Ga0307511_10000499 3300030521 Bacteria 42317
410 Ga0307511_10026995 3300030521 Bacteria 5253
411 Ga0307512_10043165 3300030522 Bacteria 3722
412 Ga0265770_1000176 3300030878 Bacteria 8371
413 Ga0265760_10014223 3300031090 Bacteria 2278
414 Ga0265330_10005426 3300031235 Bacteria 6358
415 Ga0265330_10095064 3300031235 Bacteria 1277
416 Ga0265332_10029936 3300031238 Bacteria 2378
417 Ga0265332_10081475 3300031238 Bacteria 1372
418 Ga0265340_10000710 3300031247 Bacteria 18813
419 Ga0265340_10015636 3300031247 Bacteria 3941
420 Ga0265340_10051469 3300031247 Bacteria 1994
421 Ga0265327_10092159 3300031251 Bacteria 1475
422 Ga0265316_10083710 3300031344 Bacteria 2444
423 Ga0307513_10016740 3300031456 Bacteria 8823
424 Ga0307513_10113846 3300031456 Bacteria 2692
425 Ga0307513_10133705 3300031456 Bacteria 2420
426 Ga0307509_10001175 3300031507 Bacteria 44735
427 Ga0307509_10001769 3300031507 Bacteria 35880
428 Ga0307509_10002906 3300031507 Bacteria 27071
429 Ga0307509_10004311 3300031507 Bacteria 20669
430 Ga0307509_10031909 3300031507 Bacteria 5809
431 Ga0307509_10077533 3300031507 Bacteria 3446
432 Ga0307509_10151997 3300031507 Bacteria 2228
433 Ga0307509_10239140 3300031507 Bacteria 1610
434 Ga0307408_100000056 3300031548 Bacteria 140709
435 Ga0307408_100001506 3300031548 Bacteria 17302
436 Ga0307508_10000072 3300031616 Bacteria 118449
437 Ga0307508_10000430 3300031616 Bacteria 49980
438 Ga0307508_10002376 3300031616 Bacteria 19911
439 Ga0307508_10122475 3300031616 Bacteria 2203
440 Ga0307514_10028882 3300031649 Bacteria 4468
441 Ga0307514_10041387 3300031649 Bacteria 3629
442 Ga0265314_10008385 3300031711 Bacteria 8856
443 Ga0265314_10011610 3300031711 Bacteria 7251
444 Ga0265314_10019075 3300031711 Bacteria 5321
445 Ga0265342_10054655 3300031712 Bacteria 2372
446 Ga0307516_10015162 3300031730 Bacteria 8117
447 Ga0307516_10061104 3300031730 Bacteria 3657
448 Ga0307516_10064210 3300031730 Bacteria 3552
449 Ga0307516_10077272 3300031730 Bacteria 3178
450 Ga0307516_10082010 3300031730 Bacteria 3067
451 Ga0307516_10082809 3300031730 Bacteria 3050
452 Ga0307405_10003030 3300031731 Bacteria 7609
453 Ga0307405_10056976 3300031731 Bacteria 2453
454 Ga0307405_10087039 3300031731 Bacteria 2058
455 Ga0307413_10050405 3300031824 Bacteria 2501
456 Ga0307410_10007285 3300031852 Bacteria 6045
457 Ga0307410_10048850 3300031852 Bacteria 2837
458 Ga0307406_10027612 3300031901 Bacteria 3422
459 Ga0307406_10049264 3300031901 Bacteria 2665
460 Ga0315914_1000007 3300031967 Bacteria 215597
461 Ga0307409_100025031 3300031995 Bacteria 4177
462 Ga0307416_100033232 3300032002 Bacteria 3908
463 Ga0307416_100058427 3300032002 Bacteria 3127
464 Ga0307411_10000184 3300032005 Bacteria 20004
465 Ga0307415_100100709 3300032126 Bacteria 2118
466 Ga0307415_100168688 3300032126 Bacteria 1705
467 Ga0307507_10013480 3300033179 Bacteria 9918
468 Ga0307510_10002529 3300033180 Bacteria 20856
469 Ga0307510_10012250 3300033180 Bacteria 10166
470 Ga0307510_10012673 3300033180 Bacteria 10003
471 Ga0307510_10086716 3300033180 Bacteria 3001
472 Ga0315913_1000003 3300033430 Bacteria 215608
473 Ga0315911_1000006 3300033442 Bacteria 414563
474 Ga0315915_1000011 3300033464 Bacteria 215597
475 Ga0373958_0020001 3300034819 Bacteria 1229
476 Ga0373934_0004161 3300035086 Bacteria 5335
477 Ga0373940_0012551 3300035088 Bacteria 2031
478 Ga0373923_0000671 3300035111 Bacteria 8698
479 Ga0373923_0010258 3300035111 Bacteria 3403
480 Ga0373936_0027462 3300035113 Bacteria 2232
481 Ga0373936_0028913 3300035113 Bacteria 2181
482 Ga0373939_0000105 3300035114 Bacteria 25682
483 Ga0373939_0020896 3300035114 Bacteria 1785
484 Ga0373954_0000658 3300035118 Bacteria 13209
485 Ga0373956_0003745 3300035119 Bacteria 6128
486 Ga0373957_0009633 3300035120 Bacteria 3166
487 Ga0373957_0051578 3300035120 Bacteria 1574
488 Ga0373960_0003723 3300035121 Bacteria 3465
489 Ga0373943_0010364 3300035170 Bacteria 4179
490 Ga0373924_0003932 3300035410 Bacteria 5154
491 Ga0373931_0004715 3300035691 Bacteria 6247
492 Ga0373931_0037889 3300035691 Bacteria 2519
493 Ga0373935_0084706 3300035692 Bacteria 2065
494 Ga0373927_0029189 3300035695 Bacteria 3594
495 Ga0373927_0029952 3300035695 Bacteria 3551
496 Ga0373927_0063702 3300035695 Bacteria 2385
497 Ga0373933_0000445 3300035724 Bacteria 25820
498 Ga0373933_0033552 3300035724 Bacteria 2986
499 Ga0373933_0046371 3300035724 Plasmid 2581
500 Ga0373947_0027904 3300035725 Bacteria 3306
501 Ga0373947_0094310 3300035725 Bacteria 1871
502 Ga0373937_0022764 3300036401 Bacteria 5636
503 Ga0373925_0034849 3300037068 Bacteria 3711
504 Ga0373925_0091397 3300037068 Bacteria 2327
505 Ga0395900_0021186 3300037418 Bacteria 6645
506 Ga0395900_0137440 3300037418 Bacteria 2504
507 Ga0395900_0204267 3300037418 Bacteria 1997
508 Ga0395898_0011538 3300037466 Bacteria 9179
509 Ga0395898_0023551 3300037466 Bacteria 6220
510 Ga0395898_0033644 3300037466 Bacteria 5113
511 Ga0395898_0063125 3300037466 Bacteria 3595
512 Ga0395898_0076260 3300037466 Bacteria 3238
513 Ga0395898_0096379 3300037466 Bacteria 2842
514 Ga0395898_0177440 3300037466 Bacteria 2036
515 Ga0395905_0000016 3300037471 Bacteria 382308
516 Ga0395905_0000374 3300037471 Bacteria 63889
517 Ga0395905_0000697 3300037471 Bacteria 44516
518 Ga0395905_0002583 3300037471 Bacteria 19936
519 Ga0395905_0003009 3300037471 Bacteria 18259
520 Ga0395905_0026559 3300037471 Bacteria 5458
521 Ga0395905_0028159 3300037471 Bacteria 5296
522 Ga0395905_0097858 3300037471 Bacteria 2755
523 Ga0395905_0105527 3300037471 Bacteria 2646
524 Ga0436364_0541406 3300037853 Bacteria 8515
525 Ga0436364_0552267 3300037853 Bacteria 1331
526 Ga0436364_1234034 3300037853 Bacteria 3332
527 Ga0395901_0021993 3300038443 Bacteria 6537
528 Ga0395901_0168521 3300038443 Bacteria 2298
529 Ga0395901_0270621 3300038443 Bacteria 1767
530 Ga0436365_0063749 3300039437 Bacteria 4703
531 Ga0436365_0244982 3300039437 Bacteria 68861
532 Ga0436365_0465598 3300039437 Bacteria 1861
533 Ga0436365_0894462 3300039437 Bacteria 1908
534 Ga0436365_1765855 3300039437 Bacteria 3829
535 Ga0436365_1808909 3300039437 Bacteria 4123
536 Ga0436360_0207100 3300039438 Bacteria 2316
537 Ga0436360_0924956 3300039438 Bacteria 3958
538 Ga0436361_0505806 3300039447 Bacteria 4778
539 Ga0436361_1206490 3300039447 Bacteria 2413
540 Ga0436363_1091027 3300039450 Bacteria 2325
541 Ga0436362_0338861 3300039453 Bacteria 16043
542 Ga0451793_1434285 3300041452 Bacteria 1667
543 Ga0439433_0014692 3300041999 Bacteria 1725
544 Ga0450920_013347 3300042122 Bacteria 1547
545 Ga0439446_0000150 3300042156 Bacteria 12148
546 Ga0439434_0000316 3300042435 Bacteria 13750
547 Ga0439435_0000897 3300042436 Bacteria 5126
548 Ga0450893_0002178 3300042532 Bacteria 3052
549 Ga0466961_0004454 3300044693 Bacteria 8773
550 Ga0466961_0074107 3300044693 Bacteria 2158
551 Ga0466971_0004450 3300044719 Bacteria 6049
552 Ga0466968_0030638 3300044735 Bacteria 2229
553 Ga0466970_0001623 3300044765 Bacteria 10834
554 Ga0466957_0059415 3300044842 Bacteria 2343
555 Ga0466957_0138351 3300044842 Bacteria 1567
556 Ga0466960_0081901 3300044901 Bacteria 1628
557 Ga0466959_0059990 3300045049 Bacteria 2769
558 Ga0466959_0117709 3300045049 Bacteria 1891
559 Ga0451576_0120588 3300045051 Bacteria 2730
560 Ga0466958_0005689 3300045836 Bacteria 6732
561 Ga0466967_0006585 3300045976 Bacteria 8248
562 Ga0466967_0021602 3300045976 Bacteria 5232
563 Ga0466967_0058613 3300045976 Bacteria 3404
564 Ga0495592_0000322 3300046454 Bacteria 40072
565 Ga0495592_0016498 3300046454 Bacteria 5604
566 Ga0495592_0102968 3300046454 Bacteria 2032
567 Ga0495603_0010741 3300046455 Bacteria 5554
568 Ga0495603_0036333 3300046455 Bacteria 2958
569 Ga0495603_0075863 3300046455 Bacteria 1973
570 Ga0495590_0053025 3300046457 Bacteria 1416
571 Ga0495629_0121590 3300046459 Bacteria 1819
572 Ga0495638_0025665 3300046460 Bacteria 3827
573 Ga0495638_0040056 3300046460 Bacteria 2970
574 Ga0495638_0074296 3300046460 Bacteria 2073
575 Ga0495638_0132377 3300046460 Bacteria 1464
576 Ga0495651_0114037 3300046462 Bacteria 1995
577 Ga0495653_0000358 3300046463 Bacteria 36893
578 Ga0495653_0264615 3300046463 Bacteria 1135
579 Ga0495580_0009429 3300046472 Bacteria 7679
580 Ga0495582_0025546 3300046473 Bacteria 3235
581 Ga0495639_0011249 3300046475 Bacteria 3855
582 Ga0495639_0088521 3300046475 Bacteria 1450
583 Ga0495664_0003614 3300046477 Bacteria 8427
584 Ga0495664_0017108 3300046477 Bacteria 4142
585 Ga0495594_0118300 3300046499 Bacteria 1497
586 Ga0495607_0061847 3300046501 Bacteria 2126
587 Ga0495610_0002018 3300046512 Bacteria 17370
588 Ga0495610_0073817 3300046512 Bacteria 1584
589 Ga0495618_0052656 3300046514 Bacteria 2573
590 Ga0495628_0028749 3300046516 Bacteria 4515
591 Ga0495631_0056940 3300046518 Bacteria 1702
592 Ga0495632_0001413 3300046519 Bacteria 20041
593 Ga0495632_0004544 3300046519 Bacteria 9402
594 Ga0495644_0024072 3300046523 Bacteria 2316
595 Ga0495644_0033741 3300046523 Bacteria 1933
596 Ga0495648_0072804 3300046524 Bacteria 1987
597 Ga0495652_0025038 3300046529 Bacteria 5280
598 Ga0495652_0106723 3300046529 Unclassified 2261
599 Ga0495640_0045777 3300046533 Bacteria 3035
600 Ga0495640_0058499 3300046533 Bacteria 2628
601 Ga0495586_0048581 3300046535 Bacteria 2293
602 Ga0495587_0010166 3300046536 Bacteria 6002
603 Ga0495645_0028522 3300046543 Bacteria 4057
604 Ga0495622_0097391 3300046557 Bacteria 1349
605 Ga0495633_0028261 3300046558 Bacteria 2735
606 Ga0495633_0108569 3300046558 Bacteria 1287
607 Ga0495667_0030252 3300046559 Bacteria 3641
608 Ga0495656_0003759 3300046615 Bacteria 5156
609 Ga0495656_0028162 3300046615 Bacteria 2252
610 Ga0495668_0066881 3300046616 Bacteria 1977
611 Ga0495668_0088265 3300046616 Bacteria 1700
612 Ga0495634_0002891 3300046642 Bacteria 14092
613 Ga0495634_0024961 3300046642 Bacteria 4189
614 Ga0495625_0006941 3300046660 Bacteria 9989
615 Ga0495635_0000466 3300046663 Bacteria 25585
616 Ga0495659_0050390 3300046664 Bacteria 1514
617 Ga0495588_0013610 3300046674 Bacteria 3878
618 Ga0495588_0097857 3300046674 Bacteria 1540
619 Ga0495599_0002741 3300046678 Bacteria 10274
620 Ga0495646_0007558 3300046680 Bacteria 6907
621 Ga0495624_0016010 3300046690 Bacteria 5047
622 Ga0495624_0027650 3300046690 Bacteria 3712
623 Ga0495670_0072209 3300046691 Bacteria 1748
624 Ga0495600_0001173 3300046809 Bacteria 14303
625 Ga0495660_0028118 3300046810 Bacteria 3178
626 Ga0495581_0007629 3300047315 Bacteria 6259
627 Ga0495604_0031510 3300047317 Bacteria 4205
628 Ga0495636_0039860 3300047318 Bacteria 1946
629 Ga0495674_0032928 3300047319 Bacteria 4698
630 Ga0495674_0038270 3300047319 Bacteria 4306
631 Ga0495672_0009646 3300047320 Bacteria 6967
632 Ga0495680_0006795 3300047322 Bacteria 10567
633 Ga0495687_000248 3300047443 Bacteria 72947
634 Ga0495687_007648 3300047443 Bacteria 6326
635 Ga0495673_0021977 3300047469 Bacteria 3135
636 Ga0495684_0000357 3300047471 Bacteria 36963
637 Ga0495686_0053930 3300047472 Bacteria 2518
638 Ga0495686_0068321 3300047472 Bacteria 2192
639 Ga0495686_0109400 3300047472 Bacteria 1659
640 Ga0495593_0005202 3300047673 Bacteria 7689
641 Ga0495593_0040169 3300047673 Bacteria 2520
642 Ga0495593_0124683 3300047673 Bacteria 1309
643 Ga0495615_0007287 3300048090 Bacteria 2093
644 Ga0496100_0037558 3300048903 Bacteria 3063
645 Ga0496100_0053476 3300048903 Bacteria 2630
646 Ga0496101_0090063 3300048904 Bacteria 2281
647 Ga0496101_0098815 3300048904 Bacteria 2181
648 Ga0496102_0003487 3300048905 Bacteria 13334
649 Ga0496102_0139192 3300048905 Bacteria 2275
650 Ga0496104_0000277 3300048907 Bacteria 45742
651 Ga0496104_0031694 3300048907 Bacteria 4917
652 Ga0496104_0258515 3300048907 Bacteria 1654
653 Ga0496105_0010743 3300048908 Bacteria 7208
654 Ga0496105_0054856 3300048908 Bacteria 3290
655 Ga0496105_0266548 3300048908 Bacteria 1384
656 Ga0496106_0053866 3300048909 Bacteria 3039
657 Ga0496106_0072635 3300048909 Bacteria 2631
658 Ga0496106_0074522 3300048909 Bacteria 2599
659 Ga0496106_0108946 3300048909 Bacteria 2155
660 Ga0496107_0009774 3300048910 Bacteria 6653
661 Ga0496108_0005114 3300048911 Bacteria 10600
662 Ga0496108_0045123 3300048911 Bacteria 3680
663 Ga0496108_0051741 3300048911 Bacteria 3441
664 Ga0496108_0208262 3300048911 Bacteria 1697
665 Ga0496109_0009447 3300048912 Bacteria 8314
666 Ga0496109_0122570 3300048912 Bacteria 2422
667 Ga0496110_0034834 3300048913 Bacteria 4364
668 Ga0496110_0205904 3300048913 Bacteria 1788
669 Ga0496110_0209820 3300048913 Bacteria 1770
670 Ga0496110_0269069 3300048913 Bacteria 1551
671 Ga0496110_0321376 3300048913 Bacteria 1410
672 Ga0496111_0009657 3300048914 Bacteria 6447
673 Ga0496111_0065631 3300048914 Bacteria 2635
674 Ga0496112_0000004 3300048915 Bacteria 553294
675 Ga0496112_0003582 3300048915 Bacteria 12913
676 Ga0496112_0037196 3300048915 Bacteria 4751
677 Ga0496112_0037747 3300048915 Bacteria 4716
678 Ga0496112_0158815 3300048915 Bacteria 2227
679 Ga0496112_0195894 3300048915 Bacteria 1981
680 Ga0496113_0003658 3300048916 Bacteria 9251
681 Ga0496113_0068406 3300048916 Bacteria 2695
682 Ga0496114_0102995 3300048917 Bacteria 2439
683 Ga0496115_0001987 3300048918 Bacteria 14603
684 Ga0496115_0037006 3300048918 Bacteria 3866
685 Ga0496115_0291620 3300048918 Bacteria 1338
686 Ga0496116_0001246 3300048919 Bacteria 29566
687 Ga0496117_0016248 3300048920 Bacteria 6290
688 Ga0496117_0033732 3300048920 Bacteria 3866
689 Ga0496117_0078953 3300048920 Bacteria 2170
690 Ga0496117_0109159 3300048920 Bacteria 1728
691 Ga0496118_0012336 3300048921 Bacteria 8221
692 Ga0496118_0088173 3300048921 Bacteria 2147
693 Ga0496118_0110427 3300048921 Bacteria 1826
694 Ga0496121_0000667 3300048924 Bacteria 64115
695 Ga0496121_0001254 3300048924 Bacteria 43970
696 Ga0496121_0001728 3300048924 Bacteria 35654
697 Ga0496121_0116985 3300048924 Bacteria 2020
698 Ga0496121_0117977 3300048924 Bacteria 2010
699 Ga0496122_0010121 3300048925 Bacteria 9782
700 Ga0496122_0025770 3300048925 Bacteria 5094
701 Ga0496124_0030053 3300048927 Bacteria 4830
702 Ga0496125_0001227 3300048928 Bacteria 38397
703 Ga0496125_0108472 3300048928 Bacteria 2019
704 Ga0496126_0005037 3300048929 Bacteria 15358
705 Ga0496126_0007721 3300048929 Bacteria 11736
706 Ga0496126_0008802 3300048929 Bacteria 10828
707 Ga0496126_0015170 3300048929 Bacteria 7759
708 Ga0496126_0054514 3300048929 Bacteria 3621
709 Ga0496126_0060043 3300048929 Bacteria 3422
710 Ga0496126_0075712 3300048929 Bacteria 2987
711 Ga0496126_0136764 3300048929 Bacteria 2113
712 Ga0496126_0156271 3300048929 Bacteria 1951
713 Ga0496126_0210219 3300048929 Bacteria 1638
714 Ga0501031_0000013 3300049568 Bacteria 129659
715 Ga0501032_0000061 3300049569 Bacteria 94724
716 Ga0501033_0000044 3300049570 Bacteria 129614
717 Ga0501033_0121719 3300049570 Bacteria 1893
718 Ga0501033_0166728 3300049570 Bacteria 1583
719 Ga0501034_0000155 3300049571 Bacteria 129711
720 Ga0501034_0099144 3300049571 Bacteria 2908
721 Ga0501034_0115571 3300049571 Bacteria 2672
722 Ga0501034_0153118 3300049571 Bacteria 2281
723 Ga0501034_0227900 3300049571 Bacteria 1813
724 Ga0501036_0000016 3300049572 Bacteria 129660
725 Ga0501037_0000033 3300049573 Bacteria 129768
726 Ga0501037_0093882 3300049573 Bacteria 2169
727 Ga0501038_0000290 3300049574 Bacteria 42746
728 Ga0501038_0022383 3300049574 Bacteria 5665
729 Ga0501038_0077055 3300049574 Bacteria 2815
730 Ga0501038_0101096 3300049574 Bacteria 2400
731 Ga0501038_0122620 3300049574 Bacteria 2141
732 Ga0501039_0000007 3300049575 Bacteria 277831
733 Ga0501039_0023581 3300049575 Bacteria 4722
734 Ga0501040_0054481 3300049576 Bacteria 2742
735 Ga0501040_0077618 3300049576 Bacteria 2298
736 Ga0501043_0000439 3300049579 Bacteria 37482
737 Ga0501043_0003008 3300049579 Bacteria 14030
738 Ga0501046_0001371 3300049580 Bacteria 23462
739 Ga0501046_0026043 3300049580 Bacteria 4779
740 Ga0501046_0084959 3300049580 Bacteria 2440
741 Ga0501047_0000069 3300049581 Bacteria 129231
742 Ga0501047_0000791 3300049581 Bacteria 33098
743 Ga0501047_0016182 3300049581 Bacteria 7116
744 Ga0501047_0072670 3300049581 Bacteria 3310
745 Ga0501047_0169296 3300049581 Bacteria 2054
746 Ga0501048_0001073 3300049582 Bacteria 20497
747 Ga0501068_0059104 3300049584 Bacteria 2327
748 Ga0501069_0031087 3300049585 Bacteria 2935
749 Ga0501070_0003738 3300049586 Bacteria 13142
750 Ga0501070_0038271 3300049586 Bacteria 4002
751 Ga0501072_0231556 3300049588 Bacteria 1472
752 Ga0501073_0028200 3300049589 Bacteria 4012
753 Ga0501074_0061935 3300049590 Bacteria 2695
754 Ga0501222_003521 3300049662 Bacteria 2136
755 Ga0501080_0046026 3300049742 Bacteria 4063
756 Ga0501080_0099386 3300049742 Bacteria 2700
757 Ga0501081_0233660 3300049743 Bacteria 1340
758 Ga0501083_0040764 3300049744 Bacteria 3151
759 Ga0501265_000947 3300049762 Bacteria 3256
760 Ga0501035_0000397 3300049822 Bacteria 49863
761 Ga0501035_0030269 3300049822 Bacteria 4936
762 Ga0501035_0227770 3300049822 Bacteria 1589
763 Ga0501044_0000001 3300049823 Bacteria 418087
764 Ga0501044_0004750 3300049823 Bacteria 15189
765 Ga0501044_0048718 3300049823 Bacteria 4375
766 Ga0501044_0078543 3300049823 Bacteria 3344
767 Ga0501044_0230145 3300049823 Bacteria 1801
768 Ga0501044_0235107 3300049823 Bacteria 1778
769 Ga0501045_0011250 3300049824 Bacteria 6280
770 nmdc:mga03n38_34483_c1 3300050490 Bacteria 2162
771 nmdc:mga03n38_63424_c1 3300050490 Bacteria 1689
772 nmdc:mga03n38_72078_c1 3300050490 Bacteria 1601
773 nmdc:mga03n38_73019_c1 3300050490 Bacteria 1592
774 nmdc:mga00v17_115752_c1 3300050491 Bacteria 1704
775 nmdc:mga0yw44_100474_c1 3300050492 Bacteria 1842
776 nmdc:mga0yw44_31484_c1 3300050492 Bacteria 3085
777 nmdc:mga0k408_566_c1 3300050493 Bacteria 6669
778 nmdc:mga06z11_41649_c1 3300050494 Bacteria 2299
779 nmdc:mga04h51_8429_c1 3300050495 Bacteria 2757
780 nmdc:mga07m45_10166_c1 3300050496 Bacteria 4908
781 nmdc:mga07m45_105885_c1 3300050496 Bacteria 1618
782 nmdc:mga07m45_2835_c1 3300050496 Bacteria 8202
783 nmdc:mga07m45_29113_c1 3300050496 Bacteria 3052
784 nmdc:mga07m45_6102_c1 3300050496 Bacteria 6073
785 nmdc:mga07m45_61884_c1 3300050496 Bacteria 2120
786 nmdc:mga07m45_8137_c1 3300050496 Bacteria 5375
787 nmdc:mga07m45_9498_c1 3300050496 Bacteria 5048
788 nmdc:mga08y16_100803_c1 3300050511 Bacteria 3006
789 nmdc:mga08y16_173490_c1 3300050511 Bacteria 2239
790 nmdc:mga08y16_34344_c1 3300050511 Bacteria 5328
791 nmdc:mga08y16_60391_c1 3300050511 Bacteria 3960
792 nmdc:mga0n895_9230_c1 3300050512 Bacteria 8618
793 nmdc:mga0rr50_28637_c1 3300050513 Bacteria 3918
794 nmdc:mga0a205_7893_c1 3300050515 Bacteria 9664
795 nmdc:mga0sz30_3001_c1 3300050516 Bacteria 6055
796 Ga0495612_0019088 3300053078 Bacteria 2746
797 Ga0500635_0014548 3300053080 Bacteria 2308
798 Ga0495595_0042851 3300053084 Unclassified 2074
799 Ga0495619_0000176 3300053085 Bacteria 47128
800 Ga0495619_0028237 3300053085 Bacteria 3619
801 Ga0500578_0000263 3300053086 Bacteria 65524
802 Ga0500578_0046520 3300053086 Bacteria 2784
803 Ga0500643_000014 3300053087 Bacteria 318249
804 Ga0500644_0002707 3300053088 Bacteria 4426
805 Ga0500644_0020983 3300053088 Bacteria 1950
806 Ga0500646_0022036 3300053090 Bacteria 1701
807 Ga0500583_0010304 3300053092 Bacteria 3462
808 Ga0500651_0022868 3300053093 Bacteria 3909
809 Ga0500566_0000009 3300053094 Bacteria 131668
810 Ga0500566_0000463 3300053094 Bacteria 22603
811 Ga0500640_000013 3300053095 Bacteria 31437
812 Ga0500641_0005568 3300053096 Bacteria 4460
813 Ga0500650_0000464 3300053098 Bacteria 10143
814 Ga0500556_0018243 3300053104 Bacteria 2211
815 Ga0500572_000248 3300053111 Bacteria 19379
816 Ga0500591_036935 3300053115 Bacteria 2341
817 Ga0500593_037431 3300053117 Bacteria 2173
818 Ga0500595_000075 3300053119 Bacteria 69432
819 Ga0500595_001300 3300053119 Bacteria 13578
820 Ga0500595_001390 3300053119 Bacteria 12967
821 Ga0500595_001530 3300053119 Bacteria 12274
822 Ga0500608_017051 3300053122 Bacteria 3293
823 Ga0500618_008124 3300053125 Bacteria 2949
824 Ga0500628_000977 3300053129 Bacteria 5022
825 Ga0500642_0014027 3300053130 Bacteria 2968
826 Ga0500652_000423 3300053131 Bacteria 15081
827 Ga0500652_000513 3300053131 Bacteria 13653
828 Ga0500658_0006825 3300053134 Bacteria 4223
829 Ga0500559_0001229 3300053136 Bacteria 15171
830 Ga0500568_0000500 3300053139 Bacteria 28859
831 Ga0500568_0003726 3300053139 Bacteria 8350
832 Ga0500568_0006128 3300053139 Bacteria 6092
833 Ga0500568_0006214 3300053139 Bacteria 6032
834 Ga0500568_0012099 3300053139 Bacteria 3978
835 Ga0500568_0023660 3300053139 Bacteria 2612
836 Ga0500590_010398 3300053148 Bacteria 4701
837 Ga0500590_057115 3300053148 Bacteria 1970
838 Ga0500603_000016 3300053150 Bacteria 56563
839 Ga0500604_0001474 3300053151 Bacteria 6572
840 Ga0500604_0048138 3300053151 Bacteria 1308
841 Ga0500616_0000150 3300053153 Bacteria 117918
842 Ga0500616_0019168 3300053153 Bacteria 3858
843 Ga0500622_0000447 3300053156 Bacteria 39298
844 Ga0500622_0000502 3300053156 Bacteria 36464
845 Ga0500622_0000973 3300053156 Bacteria 24257
846 Ga0500634_0068707 3300053161 Bacteria 1860
847 Ga0500639_000017 3300053163 Bacteria 114464
848 Ga0500636_0000824 3300053177 Bacteria 16693
849 Ga0500637_0000483 3300053178 Bacteria 15404
850 Ga0500637_0015162 3300053178 Bacteria 4079
851 Ga0500645_009170 3300053730 Bacteria 3337
852 Ga0500645_016506 3300053730 Bacteria 2324
853 Ga0500596_000051 3300053735 Bacteria 15770
854 Ga0500596_012146 3300053735 Bacteria 1310
855 Ga0501082_0083193 3300060353 Bacteria 2761
856 Ga0501082_0340848 3300060353 Bacteria 1306
857 Ga0466962_0000117 3300061719 Bacteria 32210

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049581 Ga0501047_0169296 Ga0501047_0169296_56_1033 285
2 3300046463 Ga0495653_0264615 Ga0495653_0264615_124_1122 310
3 3300048929 Ga0496126_0136764 Ga0496126_0136764_29_1123 312
4 3300034819 Ga0373958_0020001 Ga0373958_0020001_143_1207 320
5 3300037466 Ga0395898_0096379 Ga0395898_0096379_13_1068 320
6 3300050494 nmdc:mga06z11_41649_c1 nmdc:mga06z11_41649_c1_215_1243 320
7 3300053115 Ga0500591_036935 Ga0500591_036935_1292_2329 320
8 3300047472 Ga0495686_0109400 Ga0495686_0109400_11_1066 325
9 3300006195 Ga0075366_10012466 Ga0075366_100124662 327
10 3300006353 Ga0075370_10008336 Ga0075370_100083364 327
11 3300050496 nmdc:mga07m45_10166_c1 nmdc:mga07m45_10166_c1_2391_3623 327
12 3300047673 Ga0495593_0124683 Ga0495593_0124683_187_1254 328
13 iso_pu_bacteria 2920760137 2920761788 328
14 3300031507 Ga0307509_10001175 Ga0307509_1000117516 329
15 3300050490 nmdc:mga03n38_72078_c1 nmdc:mga03n38_72078_c1_18_1097 329
16 3300046499 Ga0495594_0118300 Ga0495594_0118300_421_1485 331
17 3300048903 Ga0496100_0053476 Ga0496100_0053476_29_1102 332
18 iso_pu_bacteria 2957443900 2957445850 333
19 iso_pu_bacteria 2960660292 2960663850 333
20 3300028794 Ga0307515_10033784 Ga0307515_100337848 335
21 3300031507 Ga0307509_10077533 Ga0307509_100775332 341
22 3300049568 Ga0501031_0000013 Ga0501031_0000013_31903_33156 346
23 3300049569 Ga0501032_0000061 Ga0501032_0000061_61487_62740 346
24 3300049570 Ga0501033_0000044 Ga0501033_0000044_96504_97757 346
25 3300049571 Ga0501034_0000155 Ga0501034_0000155_96504_97757 346
26 3300049572 Ga0501036_0000016 Ga0501036_0000016_96504_97757 346
27 3300049573 Ga0501037_0000033 Ga0501037_0000033_32012_33265 346
28 3300049574 Ga0501038_0000290 Ga0501038_0000290_24064_25317 346
29 3300049575 Ga0501039_0000007 Ga0501039_0000007_96504_97757 346
30 3300049576 Ga0501040_0077618 Ga0501040_0077618_994_2247 346
31 3300049579 Ga0501043_0003008 Ga0501043_0003008_8159_9412 346
32 3300049581 Ga0501047_0000791 Ga0501047_0000791_29009_30262 346
33 3300049586 Ga0501070_0003738 Ga0501070_0003738_371_1624 346
34 3300049822 Ga0501035_0000397 Ga0501035_0000397_31844_33097 346
35 3300049823 Ga0501044_0000001 Ga0501044_0000001_17417_18670 346
36 3300053139 Ga0500568_0003726 Ga0500568_0003726_2680_3957 346
37 3300005985 Ga0081539_10055593 Ga0081539_100555932 347
38 3300006946 Ga0079104_1002719 Ga0079104_100271911 349
39 3300026118 Ga0207675_100151390 Ga0207675_1001513902 349
40 3300027111 Ga0209281_1000185 Ga0209281_100018555 349
41 3300042122 Ga0450920_013347 Ga0450920_013347_380_1522 349
42 iso_pu_bacteria 2551306092 2551736305 349
43 3300049570 Ga0501033_0166728 Ga0501033_0166728_43_1299 350
44 3300049574 Ga0501038_0122620 Ga0501038_0122620_755_1969 350
45 3300049743 Ga0501081_0233660 Ga0501081_0233660_15_1229 350
46 3300049822 Ga0501035_0030269 Ga0501035_0030269_2401_3657 350
47 3300049823 Ga0501044_0078543 Ga0501044_0078543_606_1862 350
48 3300060353 Ga0501082_0083193 Ga0501082_0083193_1048_2262 350
49 3300005439 Ga0070711_100097355 Ga0070711_1000973552 351
50 3300006175 Ga0070712_100143062 Ga0070712_1001430622 351
51 3300009551 Ga0105238_10078501 Ga0105238_100785013 351
52 3300025915 Ga0207693_10147646 Ga0207693_101476462 351
53 3300025916 Ga0207663_10175850 Ga0207663_101758501 351
54 3300025942 Ga0207689_10020193 Ga0207689_100201932 351
55 3300048907 Ga0496104_0000277 Ga0496104_0000277_41152_42399 351
56 3300048908 Ga0496105_0010743 Ga0496105_0010743_5733_6947 351
57 3300048911 Ga0496108_0045123 Ga0496108_0045123_13_1260 351
58 3300048912 Ga0496109_0009447 Ga0496109_0009447_4389_5636 351
59 3300048913 Ga0496110_0209820 Ga0496110_0209820_34_1248 351
60 3300048914 Ga0496111_0009657 Ga0496111_0009657_2594_3841 351
61 3300048915 Ga0496112_0195894 Ga0496112_0195894_138_1385 351
62 3300048916 Ga0496113_0003658 Ga0496113_0003658_5337_6584 351
63 3300048927 Ga0496124_0030053 Ga0496124_0030053_1019_2251 351
64 3300003659 JGI25404J52841_10019938 JGI25404J52841_100199381 352
65 3300005262 Ga0065165_1003660 Ga0065165_10036605 352
66 3300005983 Ga0081540_1003122 Ga0081540_10031226 352
67 3300009551 Ga0105238_10006144 Ga0105238_1000614410 352
68 3300025273 Ga0209673_1008534 Ga0209673_10085345 352
69 3300025906 Ga0207699_10024636 Ga0207699_100246362 352
70 3300037466 Ga0395898_0063125 Ga0395898_0063125_270_1496 352
71 3300042532 Ga0450893_0002178 Ga0450893_0002178_1617_2837 352
72 3300046460 Ga0495638_0040056 Ga0495638_0040056_1249_2469 352
73 3300050513 nmdc:mga0rr50_28637_c1 nmdc:mga0rr50_28637_c1_1783_3030 352
74 3300053151 Ga0500604_0048138 Ga0500604_0048138_15_1235 352
75 3300006195 Ga0075366_10019567 Ga0075366_100195674 353
76 3300031730 Ga0307516_10082010 Ga0307516_100820105 353
77 3300037471 Ga0395905_0000374 Ga0395905_0000374_12544_13845 353
78 3300048929 Ga0496126_0156271 Ga0496126_0156271_47_1276 353
79 3300050496 nmdc:mga07m45_61884_c1 nmdc:mga07m45_61884_c1_629_1846 353
80 3300053090 Ga0500646_0022036 Ga0500646_0022036_469_1674 353
81 3300053092 Ga0500583_0010304 Ga0500583_0010304_2134_3348 353
82 3300053139 Ga0500568_0023660 Ga0500568_0023660_300_1514 353
83 3300025254 Ga0209148_1000420 Ga0209148_100042032 354
84 3300025272 Ga0209455_1000290 Ga0209455_100029024 354
85 3300028794 Ga0307515_10132804 Ga0307515_101328041 354
86 3300031730 Ga0307516_10061104 Ga0307516_100611042 354
87 3300046460 Ga0495638_0025665 Ga0495638_0025665_2248_3468 354
88 3300047443 Ga0495687_000248 Ga0495687_000248_41317_42552 354
89 3300049823 Ga0501044_0230145 Ga0501044_0230145_145_1350 354
90 3300028794 Ga0307515_10000112 Ga0307515_1000011226 355
91 3300037471 Ga0395905_0003009 Ga0395905_0003009_10475_11701 355
92 3300045976 Ga0466967_0006585 Ga0466967_0006585_1865_3109 355
93 3300046512 Ga0495610_0073817 Ga0495610_0073817_274_1530 355
94 3300046519 Ga0495632_0001413 Ga0495632_0001413_8670_9926 355
95 3300046660 Ga0495625_0006941 Ga0495625_0006941_428_1660 355
96 3300046810 Ga0495660_0028118 Ga0495660_0028118_1565_2821 355
97 3300047443 Ga0495687_007648 Ga0495687_007648_4399_5655 355
98 3300049570 Ga0501033_0121719 Ga0501033_0121719_586_1797 355
99 3300049573 Ga0501037_0093882 Ga0501037_0093882_276_1493 355
100 3300049574 Ga0501038_0077055 Ga0501038_0077055_1156_2475 355
101 3300049574 Ga0501038_0101096 Ga0501038_0101096_805_2022 355
102 3300049575 Ga0501039_0023581 Ga0501039_0023581_3373_4590 355
103 3300049576 Ga0501040_0054481 Ga0501040_0054481_1518_2732 355
104 3300049580 Ga0501046_0084959 Ga0501046_0084959_936_2150 355
105 3300049581 Ga0501047_0072670 Ga0501047_0072670_1648_2862 355
106 3300049584 Ga0501068_0059104 Ga0501068_0059104_745_1962 355
107 3300049588 Ga0501072_0231556 Ga0501072_0231556_231_1451 355
108 3300049590 Ga0501074_0061935 Ga0501074_0061935_1112_2329 355
109 3300049742 Ga0501080_0046026 Ga0501080_0046026_1700_2914 355
110 3300049823 Ga0501044_0048718 Ga0501044_0048718_97_1314 355
111 3300049823 Ga0501044_0235107 Ga0501044_0235107_305_1519 355
112 3300053086 Ga0500578_0046520 Ga0500578_0046520_717_1973 355
113 3300053134 Ga0500658_0006825 Ga0500658_0006825_926_2182 355
114 3300053161 Ga0500634_0068707 Ga0500634_0068707_282_1496 355
115 3300005841 Ga0068863_100007146 Ga0068863_1000071468 356
116 3300026088 Ga0207641_10000557 Ga0207641_100005577 356
117 3300031507 Ga0307509_10151997 Ga0307509_101519971 356
118 3300032126 Ga0307415_100168688 Ga0307415_1001686882 356
119 3300041999 Ga0439433_0014692 Ga0439433_0014692_27_1241 356
120 3300042156 Ga0439446_0000150 Ga0439446_0000150_10353_11567 356
121 3300042435 Ga0439434_0000316 Ga0439434_0000316_5138_6352 356
122 3300048907 Ga0496104_0031694 Ga0496104_0031694_3452_4609 356
123 3300048908 Ga0496105_0266548 Ga0496105_0266548_48_1262 356
124 3300048912 Ga0496109_0122570 Ga0496109_0122570_332_1489 356
125 3300048913 Ga0496110_0269069 Ga0496110_0269069_60_1217 356
126 3300048918 Ga0496115_0291620 Ga0496115_0291620_154_1311 356
127 3300009098 Ga0105245_10009601 Ga0105245_100096017 357
128 3300009147 Ga0114129_10030992 Ga0114129_100309924 357
129 3300014497 Ga0182008_10012706 Ga0182008_100127065 357
130 3300026023 Ga0207677_10126221 Ga0207677_101262213 357
131 3300028786 Ga0307517_10000249 Ga0307517_1000024984 357
132 3300031730 Ga0307516_10064210 Ga0307516_100642103 357
133 3300041452 Ga0451793_1434285 Ga0451793_1434285_163_1446 357
134 3300044693 Ga0466961_0074107 Ga0466961_0074107_350_1567 357
135 3300048915 Ga0496112_0000004 Ga0496112_0000004_246197_247408 357
136 3300053088 Ga0500644_0002707 Ga0500644_0002707_104_1387 357
137 3300053129 Ga0500628_000977 Ga0500628_000977_3270_4553 357
138 3300053130 Ga0500642_0014027 Ga0500642_0014027_1368_2651 357
139 3300053131 Ga0500652_000423 Ga0500652_000423_8699_9982 357
140 3300053156 Ga0500622_0000447 Ga0500622_0000447_4725_6008 357
141 3300030521 Ga0307511_10000499 Ga0307511_100004995 358
142 3300031251 Ga0265327_10092159 Ga0265327_100921592 358
143 3300035113 Ga0373936_0028913 Ga0373936_0028913_800_2062 358
144 3300048921 Ga0496118_0088173 Ga0496118_0088173_859_2076 358
145 3300050495 nmdc:mga04h51_8429_c1 nmdc:mga04h51_8429_c1_237_1484 358
146 3300050516 nmdc:mga0sz30_3001_c1 nmdc:mga0sz30_3001_c1_2926_4173 358
147 3300014968 Ga0157379_10085734 Ga0157379_100857343 359
148 3300021441 Ga0213871_10027702 Ga0213871_100277021 359
149 3300039438 Ga0436360_0924956 Ga0436360_0924956_2526_3746 359
150 3300039447 Ga0436361_0505806 Ga0436361_0505806_636_1856 359
151 3300045049 Ga0466959_0059990 Ga0466959_0059990_281_1507 359
152 3300046518 Ga0495631_0056940 Ga0495631_0056940_317_1534 359
153 3300005468 Ga0070707_100192144 Ga0070707_1001921441 360
154 3300005841 Ga0068863_100338906 Ga0068863_1003389062 360
155 3300009093 Ga0105240_10060516 Ga0105240_100605163 360
156 3300009545 Ga0105237_10242019 Ga0105237_102420191 360
157 3300025913 Ga0207695_10052282 Ga0207695_100522823 360
158 3300048907 Ga0496104_0258515 Ga0496104_0258515_356_1567 360
159 3300048913 Ga0496110_0205904 Ga0496110_0205904_18_1229 360
160 3300048928 Ga0496125_0001227 Ga0496125_0001227_35779_36996 360
161 3300005937 Ga0081455_10007694 Ga0081455_1000769412 361
162 3300010375 Ga0105239_10024305 Ga0105239_100243054 361
163 3300026067 Ga0207678_10042320 Ga0207678_100423203 361
164 3300028794 Ga0307515_10154087 Ga0307515_101540872 361
165 3300031616 Ga0307508_10000072 Ga0307508_1000007225 361
166 3300035724 Ga0373933_0046371 Ga0373933_0046371_726_1877 361
167 3300046616 Ga0495668_0088265 Ga0495668_0088265_36_1271 361
168 3300046674 Ga0495588_0097857 Ga0495588_0097857_95_1312 361
169 3300047472 Ga0495686_0068321 Ga0495686_0068321_121_1338 361
170 3300048913 Ga0496110_0321376 Ga0496110_0321376_47_1258 361
171 3300048920 Ga0496117_0033732 Ga0496117_0033732_1289_2506 361
172 3300048920 Ga0496117_0109159 Ga0496117_0109159_308_1525 361
173 3300048925 Ga0496122_0025770 Ga0496122_0025770_201_1418 361
174 3300050492 nmdc:mga0yw44_31484_c1 nmdc:mga0yw44_31484_c1_1053_2270 361
175 3300053085 Ga0495619_0028237 Ga0495619_0028237_1829_2980 361
176 3300053088 Ga0500644_0020983 Ga0500644_0020983_613_1830 361
177 3300053096 Ga0500641_0005568 Ga0500641_0005568_31_1245 361
178 3300053098 Ga0500650_0000464 Ga0500650_0000464_4540_5757 361
179 3300053104 Ga0500556_0018243 Ga0500556_0018243_155_1372 361
180 3300053117 Ga0500593_037431 Ga0500593_037431_902_2119 361
181 3300053131 Ga0500652_000513 Ga0500652_000513_4122_5339 361
182 3300053139 Ga0500568_0006128 Ga0500568_0006128_4596_5813 361
183 3300053151 Ga0500604_0001474 Ga0500604_0001474_2720_3937 361
184 3300053156 Ga0500622_0000502 Ga0500622_0000502_20438_21655 361
185 3300031649 Ga0307514_10041387 Ga0307514_100413873 362
186 3300037471 Ga0395905_0105527 Ga0395905_0105527_1202_2410 362
187 3300053178 Ga0500637_0015162 Ga0500637_0015162_1708_2913 362
188 3300005616 Ga0068852_100110232 Ga0068852_1001102323 363
189 3300005617 Ga0068859_100334942 Ga0068859_1003349421 363
190 3300006931 Ga0097620_100334959 Ga0097620_1003349591 363
191 3300026142 Ga0207698_10089502 Ga0207698_100895023 363
192 3300028794 Ga0307515_10000305 Ga0307515_10000305120 363
193 3300028794 Ga0307515_10082891 Ga0307515_100828913 363
194 3300031649 Ga0307514_10028882 Ga0307514_100288823 363
195 3300037471 Ga0395905_0000697 Ga0395905_0000697_11830_13050 363
196 3300039437 Ga0436365_1765855 Ga0436365_1765855_777_1982 363
197 3300048919 Ga0496116_0001246 Ga0496116_0001246_10253_11470 363
198 3300048929 Ga0496126_0060043 Ga0496126_0060043_1938_3152 363
199 3300049571 Ga0501034_0227900 Ga0501034_0227900_523_1734 363
200 3300025273 Ga0209673_1000030 Ga0209673_1000030140 364
201 3300031616 Ga0307508_10002376 Ga0307508_1000237615 364
202 3300045049 Ga0466959_0117709 Ga0466959_0117709_24_1256 364
203 3300053139 Ga0500568_0012099 Ga0500568_0012099_2144_3376 364
204 3300005548 Ga0070665_100096284 Ga0070665_1000962844 365
205 3300005937 Ga0081455_10162057 Ga0081455_101620571 365
206 3300006353 Ga0075370_10003024 Ga0075370_100030246 365
207 3300006844 Ga0075428_100251449 Ga0075428_1002514492 365
208 3300006943 Ga0099822_1006420 Ga0099822_10064205 365
209 3300026095 Ga0207676_10042731 Ga0207676_100427314 365
210 3300027357 Ga0209589_1000001 Ga0209589_1000001102 365
211 3300027361 Ga0209489_100001 Ga0209489_100001102 365
212 3300027363 Ga0209700_100001 Ga0209700_100001102 365
213 3300028379 Ga0268266_10232940 Ga0268266_102329402 365
214 3300031901 Ga0307406_10027612 Ga0307406_100276123 365
215 3300035114 Ga0373939_0000105 Ga0373939_0000105_16761_17987 365
216 3300035121 Ga0373960_0003723 Ga0373960_0003723_274_1500 365
217 3300035691 Ga0373931_0004715 Ga0373931_0004715_4806_6032 365
218 3300044693 Ga0466961_0004454 Ga0466961_0004454_392_1669 365
219 3300045836 Ga0466958_0005689 Ga0466958_0005689_2403_3680 365
220 3300046616 Ga0495668_0066881 Ga0495668_0066881_122_1372 365
221 3300048929 Ga0496126_0075712 Ga0496126_0075712_1671_2891 365
222 3300050496 nmdc:mga07m45_9498_c1 nmdc:mga07m45_9498_c1_1149_2420 365
223 3300005434 Ga0070709_10121061 Ga0070709_101210612 366
224 3300005435 Ga0070714_100097495 Ga0070714_1000974952 366
225 3300005546 Ga0070696_100024364 Ga0070696_1000243643 366
226 3300031507 Ga0307509_10004311 Ga0307509_100043118 366
227 3300031730 Ga0307516_10015162 Ga0307516_100151629 366
228 3300037471 Ga0395905_0026559 Ga0395905_0026559_4152_5387 366
229 3300037853 Ga0436364_1234034 Ga0436364_1234034_284_1516 366
230 3300053139 Ga0500568_0006214 Ga0500568_0006214_1420_2631 366
231 3300003215 JGI25153J46596_10004173 JGI25153J46596_100041736 367
232 3300003758 Ga0055532_1000487 Ga0055532_10004871 367
233 3300003761 Ga0055535_1000645 Ga0055535_100064514 367
234 3300003762 Ga0055542_1000667 Ga0055542_100066714 367
235 3300003763 Ga0055529_1000485 Ga0055529_100048514 367
236 3300003856 Ga0058692_1007459 Ga0058692_10074593 367
237 3300005338 Ga0068868_100089535 Ga0068868_1000895353 367
238 3300005344 Ga0070661_100011984 Ga0070661_1000119841 367
239 3300005366 Ga0070659_100255603 Ga0070659_1002556032 367
240 3300005455 Ga0070663_100049819 Ga0070663_1000498192 367
241 3300005539 Ga0068853_100006217 Ga0068853_1000062176 367
242 3300005539 Ga0068853_100157379 Ga0068853_1001573792 367
243 3300005563 Ga0068855_100112346 Ga0068855_1001123462 367
244 3300005614 Ga0068856_100092848 Ga0068856_1000928482 367
245 3300005937 Ga0081455_10021438 Ga0081455_100214385 367
246 3300005983 Ga0081540_1000430 Ga0081540_10004304 367
247 3300005983 Ga0081540_1003695 Ga0081540_10036958 367
248 3300006042 Ga0075368_10029402 Ga0075368_100294022 367
249 3300006051 Ga0075364_10047344 Ga0075364_100473443 367
250 3300006178 Ga0075367_10011824 Ga0075367_100118245 367
251 3300006178 Ga0075367_10057130 Ga0075367_100571302 367
252 3300006195 Ga0075366_10060384 Ga0075366_100603842 367
253 3300009093 Ga0105240_10015349 Ga0105240_100153493 367
254 3300009098 Ga0105245_10079039 Ga0105245_100790392 367
255 3300009174 Ga0105241_10023623 Ga0105241_100236232 367
256 3300009177 Ga0105248_10037249 Ga0105248_100372493 367
257 3300009545 Ga0105237_10005346 Ga0105237_1000534610 367
258 3300010375 Ga0105239_10027738 Ga0105239_100277385 367
259 3300022739 Ga0228711_1000005 Ga0228711_1000005144 367
260 3300022740 Ga0228710_1000141 Ga0228710_10001414 367
261 3300025225 Ga0209566_100744 Ga0209566_10074417 367
262 3300025228 Ga0209672_100014 Ga0209672_100014229 367
263 3300025229 Ga0209147_100104 Ga0209147_10010452 367
264 3300025242 Ga0209258_100040 Ga0209258_100040276 367
265 3300025254 Ga0209148_1000035 Ga0209148_1000035276 367
266 3300025254 Ga0209148_1002212 Ga0209148_10022128 367
267 3300025261 Ga0209233_1008977 Ga0209233_10089772 367
268 3300025272 Ga0209455_1000072 Ga0209455_1000072176 367
269 3300025297 Ga0209758_1008732 Ga0209758_10087324 367
270 3300025941 Ga0207711_10038488 Ga0207711_100384882 367
271 3300025949 Ga0207667_10213867 Ga0207667_102138671 367
272 3300026041 Ga0207639_10048147 Ga0207639_100481474 367
273 3300026041 Ga0207639_10145366 Ga0207639_101453662 367
274 3300026067 Ga0207678_10004789 Ga0207678_100047897 367
275 3300026095 Ga0207676_10241343 Ga0207676_102413431 367
276 3300026121 Ga0207683_10288810 Ga0207683_102888101 367
277 3300027111 Ga0209281_1000111 Ga0209281_1000111144 367
278 3300027312 Ga0209371_1000079 Ga0209371_100007925 367
279 3300027666 Ga0209282_1000012 Ga0209282_1000012144 367
280 3300028379 Ga0268266_10026905 Ga0268266_100269051 367
281 3300028380 Ga0268265_10063058 Ga0268265_100630582 367
282 3300028381 Ga0268264_10000149 Ga0268264_1000014925 367
283 3300030500 Ga0268256_1000090 Ga0268256_100009028 367
284 3300031711 Ga0265314_10019075 Ga0265314_100190759 367
285 3300031967 Ga0315914_1000007 Ga0315914_100000770 367
286 3300033430 Ga0315913_1000003 Ga0315913_1000003144 367
287 3300033464 Ga0315915_1000011 Ga0315915_100001170 367
288 3300046475 Ga0495639_0088521 Ga0495639_0088521_200_1414 367
289 3300046674 Ga0495588_0013610 Ga0495588_0013610_1162_2376 367
290 3300048905 Ga0496102_0139192 Ga0496102_0139192_633_1844 367
291 3300048915 Ga0496112_0158815 Ga0496112_0158815_293_1504 367
292 3300048924 Ga0496121_0001728 Ga0496121_0001728_1689_2900 367
293 3300049571 Ga0501034_0099144 Ga0501034_0099144_550_1758 367
294 3300049574 Ga0501038_0022383 Ga0501038_0022383_4185_5393 367
295 3300049580 Ga0501046_0026043 Ga0501046_0026043_1219_2421 367
296 3300049585 Ga0501069_0031087 Ga0501069_0031087_1269_2480 367
297 3300049822 Ga0501035_0227770 Ga0501035_0227770_65_1273 367
298 3300049823 Ga0501044_0004750 Ga0501044_0004750_4924_6132 367
299 3300050490 nmdc:mga03n38_34483_c1 nmdc:mga03n38_34483_c1_508_1719 367
300 3300050491 nmdc:mga00v17_115752_c1 nmdc:mga00v17_115752_c1_32_1243 367
301 3300050496 nmdc:mga07m45_105885_c1 nmdc:mga07m45_105885_c1_22_1233 367
302 3300053153 Ga0500616_0019168 Ga0500616_0019168_2093_3331 367
303 3300053730 Ga0500645_009170 Ga0500645_009170_1032_2246 367
304 3300003323 rootH1_10034711 rootH1_100347114 368
305 3300005355 Ga0070671_100130488 Ga0070671_1001304881 368
306 3300005456 Ga0070678_100032249 Ga0070678_1000322491 368
307 3300006048 Ga0075363_100001666 Ga0075363_1000016665 368
308 3300006048 Ga0075363_100163292 Ga0075363_1001632921 368
309 3300006178 Ga0075367_10012672 Ga0075367_100126721 368
310 3300006178 Ga0075367_10013751 Ga0075367_100137512 368
311 3300006353 Ga0075370_10023284 Ga0075370_100232841 368
312 3300006353 Ga0075370_10074949 Ga0075370_100749492 368
313 3300009101 Ga0105247_10078735 Ga0105247_100787352 368
314 3300009174 Ga0105241_10014736 Ga0105241_100147363 368
315 3300010375 Ga0105239_10078805 Ga0105239_100788054 368
316 3300011119 Ga0105246_10006065 Ga0105246_100060657 368
317 3300013306 Ga0163162_10105133 Ga0163162_101051333 368
318 3300025901 Ga0207688_10099259 Ga0207688_100992592 368
319 3300025907 Ga0207645_10137230 Ga0207645_101372301 368
320 3300025908 Ga0207643_10009590 Ga0207643_100095903 368
321 3300025913 Ga0207695_10000910 Ga0207695_1000091048 368
322 3300025972 Ga0207668_10137508 Ga0207668_101375081 368
323 3300026023 Ga0207677_10033178 Ga0207677_100331782 368
324 3300026023 Ga0207677_10200032 Ga0207677_102000322 368
325 3300026067 Ga0207678_10016652 Ga0207678_100166526 368
326 3300026075 Ga0207708_10148399 Ga0207708_101483992 368
327 3300028379 Ga0268266_10001162 Ga0268266_1000116214 368
328 3300028380 Ga0268265_10364830 Ga0268265_103648301 368
329 3300031507 Ga0307509_10031909 Ga0307509_100319097 368
330 3300031731 Ga0307405_10056976 Ga0307405_100569762 368
331 3300033180 Ga0307510_10002529 Ga0307510_100025293 368
332 3300037418 Ga0395900_0021186 Ga0395900_0021186_3133_4338 368
333 3300037466 Ga0395898_0011538 Ga0395898_0011538_6990_8195 368
334 3300037471 Ga0395905_0000016 Ga0395905_0000016_161896_163128 368
335 3300038443 Ga0395901_0021993 Ga0395901_0021993_5226_6431 368
336 3300046457 Ga0495590_0053025 Ga0495590_0053025_42_1256 368
337 3300046460 Ga0495638_0074296 Ga0495638_0074296_344_1558 368
338 3300046501 Ga0495607_0061847 Ga0495607_0061847_407_1621 368
339 3300046519 Ga0495632_0004544 Ga0495632_0004544_1378_2655 368
340 3300046523 Ga0495644_0024072 Ga0495644_0024072_492_1706 368
341 3300046524 Ga0495648_0072804 Ga0495648_0072804_749_1963 368
342 3300046558 Ga0495633_0028261 Ga0495633_0028261_988_2202 368
343 3300046615 Ga0495656_0003759 Ga0495656_0003759_3702_4916 368
344 3300047318 Ga0495636_0039860 Ga0495636_0039860_159_1373 368
345 3300047469 Ga0495673_0021977 Ga0495673_0021977_1412_2623 368
346 3300048909 Ga0496106_0072635 Ga0496106_0072635_1343_2554 368
347 3300048911 Ga0496108_0005114 Ga0496108_0005114_2477_3688 368
348 3300048913 Ga0496110_0034834 Ga0496110_0034834_1522_2733 368
349 3300048914 Ga0496111_0065631 Ga0496111_0065631_1275_2486 368
350 3300048918 Ga0496115_0001987 Ga0496115_0001987_3555_4766 368
351 3300048929 Ga0496126_0005037 Ga0496126_0005037_5656_6870 368
352 3300050490 nmdc:mga03n38_63424_c1 nmdc:mga03n38_63424_c1_185_1399 368
353 3300050490 nmdc:mga03n38_73019_c1 nmdc:mga03n38_73019_c1_183_1400 368
354 3300050496 nmdc:mga07m45_8137_c1 nmdc:mga07m45_8137_c1_185_1399 368
355 3300005458 Ga0070681_10018623 Ga0070681_100186237 369
356 3300005614 Ga0068856_100001367 Ga0068856_10000136724 369
357 3300021320 Ga0214544_1000130 Ga0214544_1000130108 369
358 3300025912 Ga0207707_10002222 Ga0207707_1000222219 369
359 3300025921 Ga0207652_10047896 Ga0207652_100478963 369
360 3300025940 Ga0207691_10110334 Ga0207691_101103342 369
361 3300026078 Ga0207702_10000761 Ga0207702_1000076122 369
362 3300037466 Ga0395898_0076260 Ga0395898_0076260_1701_2924 369
363 3300039437 Ga0436365_1808909 Ga0436365_1808909_1886_3280 369
364 3300044719 Ga0466971_0004450 Ga0466971_0004450_1163_2458 369
365 3300044765 Ga0466970_0001623 Ga0466970_0001623_4169_5455 369
366 3300044901 Ga0466960_0081901 Ga0466960_0081901_117_1454 369
367 3300061719 Ga0466962_0000117 Ga0466962_0000117_27997_29292 369
368 3300005436 Ga0070713_100043527 Ga0070713_1000435271 370
369 3300005614 Ga0068856_100001863 Ga0068856_10000186311 370
370 3300011119 Ga0105246_10216145 Ga0105246_102161451 370
371 3300025295 Ga0209564_1019094 Ga0209564_10190942 370
372 3300025297 Ga0209758_1014674 Ga0209758_10146743 370
373 3300025928 Ga0207700_10040248 Ga0207700_100402482 370
374 3300026078 Ga0207702_10000106 Ga0207702_1000010670 370
375 3300027717 Ga0209998_10006506 Ga0209998_100065063 370
376 3300030521 Ga0307511_10026995 Ga0307511_100269953 370
377 3300031235 Ga0265330_10005426 Ga0265330_100054262 370
378 3300031238 Ga0265332_10029936 Ga0265332_100299361 370
379 3300031247 Ga0265340_10000710 Ga0265340_100007101 370
380 3300031507 Ga0307509_10239140 Ga0307509_102391401 370
381 3300031711 Ga0265314_10011610 Ga0265314_100116105 370
382 3300032002 Ga0307416_100033232 Ga0307416_1000332323 370
383 3300033179 Ga0307507_10013480 Ga0307507_100134807 370
384 3300033442 Ga0315911_1000006 Ga0315911_100000648 370
385 3300035692 Ga0373935_0084706 Ga0373935_0084706_656_1867 370
386 3300046454 Ga0495592_0000322 Ga0495592_0000322_12697_13932 370
387 3300047320 Ga0495672_0009646 Ga0495672_0009646_1779_3008 370
388 3300048924 Ga0496121_0001254 Ga0496121_0001254_21599_22810 370
389 3300048925 Ga0496122_0010121 Ga0496122_0010121_4616_5836 370
390 3300048929 Ga0496126_0007721 Ga0496126_0007721_9547_10767 370
391 3300049762 Ga0501265_000947 Ga0501265_000947_1360_2592 370
392 3300053080 Ga0500635_0014548 Ga0500635_0014548_900_2114 370
393 3300053119 Ga0500595_001300 Ga0500595_001300_9217_10428 370
394 3300053119 Ga0500595_001390 Ga0500595_001390_5416_6627 370
395 3300053153 Ga0500616_0000150 Ga0500616_0000150_48236_49453 370
396 3300053178 Ga0500637_0000483 Ga0500637_0000483_10291_11502 370
397 3300005347 Ga0070668_100049968 Ga0070668_1000499683 371
398 3300005356 Ga0070674_100037323 Ga0070674_1000373233 371
399 3300005365 Ga0070688_100062477 Ga0070688_1000624772 371
400 3300005365 Ga0070688_100112071 Ga0070688_1001120712 371
401 3300005456 Ga0070678_100064892 Ga0070678_1000648923 371
402 3300005458 Ga0070681_10082606 Ga0070681_100826062 371
403 3300005535 Ga0070684_100119270 Ga0070684_1001192702 371
404 3300005563 Ga0068855_100025743 Ga0068855_1000257436 371
405 3300005578 Ga0068854_100049351 Ga0068854_1000493511 371
406 3300005578 Ga0068854_100112613 Ga0068854_1001126132 371
407 3300005719 Ga0068861_100087742 Ga0068861_1000877422 371
408 3300005843 Ga0068860_100120072 Ga0068860_1001200722 371
409 3300006881 Ga0068865_100048816 Ga0068865_1000488163 371
410 3300009093 Ga0105240_10082573 Ga0105240_100825732 371
411 3300009553 Ga0105249_10064400 Ga0105249_100644002 371
412 3300010375 Ga0105239_10443021 Ga0105239_104430212 371
413 3300013306 Ga0163162_10288935 Ga0163162_102889352 371
414 3300013308 Ga0157375_10042147 Ga0157375_100421474 371
415 3300014326 Ga0157380_10078449 Ga0157380_100784492 371
416 3300025909 Ga0207705_10095723 Ga0207705_100957233 371
417 3300025912 Ga0207707_10094516 Ga0207707_100945163 371
418 3300025913 Ga0207695_10243577 Ga0207695_102435771 371
419 3300025923 Ga0207681_10215298 Ga0207681_102152981 371
420 3300025928 Ga0207700_10062918 Ga0207700_100629183 371
421 3300025929 Ga0207664_10084044 Ga0207664_100840442 371
422 3300025933 Ga0207706_10018459 Ga0207706_100184596 371
423 3300025940 Ga0207691_10132839 Ga0207691_101328392 371
424 3300025972 Ga0207668_10085779 Ga0207668_100857793 371
425 3300025981 Ga0207640_10038292 Ga0207640_100382921 371
426 3300026089 Ga0207648_10145222 Ga0207648_101452221 371
427 3300026118 Ga0207675_100037251 Ga0207675_1000372513 371
428 3300026121 Ga0207683_10088182 Ga0207683_100881821 371
429 3300028379 Ga0268266_10030473 Ga0268266_100304733 371
430 3300028381 Ga0268264_10320483 Ga0268264_103204832 371
431 3300028381 Ga0268264_10391601 Ga0268264_103916011 371
432 3300031456 Ga0307513_10113846 Ga0307513_101138462 371
433 3300031712 Ga0265342_10054655 Ga0265342_100546552 371
434 3300032002 Ga0307416_100058427 Ga0307416_1000584274 371
435 3300032126 Ga0307415_100100709 Ga0307415_1001007091 371
436 3300033180 Ga0307510_10086716 Ga0307510_100867163 371
437 3300046459 Ga0495629_0121590 Ga0495629_0121590_107_1321 371
438 3300046523 Ga0495644_0033741 Ga0495644_0033741_625_1836 371
439 3300046558 Ga0495633_0108569 Ga0495633_0108569_45_1256 371
440 3300046615 Ga0495656_0028162 Ga0495656_0028162_248_1459 371
441 3300046664 Ga0495659_0050390 Ga0495659_0050390_68_1279 371
442 3300046691 Ga0495670_0072209 Ga0495670_0072209_258_1469 371
443 3300048090 Ga0495615_0007287 Ga0495615_0007287_218_1429 371
444 3300048929 Ga0496126_0015170 Ga0496126_0015170_1696_2919 371
445 3300050511 nmdc:mga08y16_173490_c1 nmdc:mga08y16_173490_c1_561_1772 371
446 3300050512 nmdc:mga0n895_9230_c1 nmdc:mga0n895_9230_c1_4577_5761 371
447 3300050515 nmdc:mga0a205_7893_c1 nmdc:mga0a205_7893_c1_3958_5142 371
448 3300053139 Ga0500568_0000500 Ga0500568_0000500_1877_3088 371
449 3300006195 Ga0075366_10005924 Ga0075366_100059247 372
450 3300006353 Ga0075370_10000054 Ga0075370_1000005422 372
451 3300025297 Ga0209758_1001092 Ga0209758_10010924 372
452 3300025912 Ga0207707_10033012 Ga0207707_100330125 372
453 3300025913 Ga0207695_10287245 Ga0207695_102872451 372
454 3300025933 Ga0207706_10068405 Ga0207706_100684053 372
455 3300026067 Ga0207678_10142331 Ga0207678_101423312 372
456 3300026116 Ga0207674_10078198 Ga0207674_100781984 372
457 3300031731 Ga0307405_10087039 Ga0307405_100870392 372
458 3300031824 Ga0307413_10050405 Ga0307413_100504053 372
459 3300031852 Ga0307410_10007285 Ga0307410_100072854 372
460 3300031995 Ga0307409_100025031 Ga0307409_1000250313 372
461 3300045976 Ga0466967_0058613 Ga0466967_0058613_1890_3125 372
462 3300046557 Ga0495622_0097391 Ga0495622_0097391_31_1248 372
463 3300048905 Ga0496102_0003487 Ga0496102_0003487_147_1379 372
464 3300048918 Ga0496115_0037006 Ga0496115_0037006_1680_2900 372
465 3300048928 Ga0496125_0108472 Ga0496125_0108472_612_1829 372
466 3300049571 Ga0501034_0115571 Ga0501034_0115571_362_1600 372
467 3300050493 nmdc:mga0k408_566_c1 nmdc:mga0k408_566_c1_287_1519 372
468 3300050496 nmdc:mga07m45_2835_c1 nmdc:mga07m45_2835_c1_4723_5955 372
469 3300053093 Ga0500651_0022868 Ga0500651_0022868_12_1433 372
470 3300053094 Ga0500566_0000463 Ga0500566_0000463_6398_7615 372
471 3300053119 Ga0500595_001530 Ga0500595_001530_9412_10623 372
472 3300053122 Ga0500608_017051 Ga0500608_017051_350_1567 372
473 3300053125 Ga0500618_008124 Ga0500618_008124_866_2083 372
474 3300053136 Ga0500559_0001229 Ga0500559_0001229_3934_5151 372
475 3300053177 Ga0500636_0000824 Ga0500636_0000824_5283_6500 372
476 3300053735 Ga0500596_012146 Ga0500596_012146_82_1299 372
477 iso_pu_bacteria 2512875026 2512968871 372
478 iso_pu_bacteria 8003999396 8004004848 372
479 3300003203 JGI25406J46586_10000047 JGI25406J46586_1000004730 373
480 3300005338 Ga0068868_100254042 Ga0068868_1002540422 373
481 3300005985 Ga0081539_10000140 Ga0081539_1000014083 373
482 3300006038 Ga0075365_10102264 Ga0075365_101022642 373
483 3300030522 Ga0307512_10043165 Ga0307512_100431654 373
484 3300031507 Ga0307509_10002906 Ga0307509_1000290624 373
485 3300031852 Ga0307410_10048850 Ga0307410_100488503 373
486 3300031901 Ga0307406_10049264 Ga0307406_100492642 373
487 3300042436 Ga0439435_0000897 Ga0439435_0000897_3757_4971 373
488 3300045976 Ga0466967_0021602 Ga0466967_0021602_625_1851 373
489 3300046512 Ga0495610_0002018 Ga0495610_0002018_11146_12396 373
490 3300048909 Ga0496106_0074522 Ga0496106_0074522_469_1656 373
491 3300048929 Ga0496126_0008802 Ga0496126_0008802_4466_5710 373
492 3300048929 Ga0496126_0210219 Ga0496126_0210219_360_1589 373
493 3300005329 Ga0070683_100008752 Ga0070683_1000087523 374
494 3300005459 Ga0068867_100148148 Ga0068867_1001481482 374
495 3300005535 Ga0070684_100004025 Ga0070684_1000040258 374
496 3300025906 Ga0207699_10046650 Ga0207699_100466503 374
497 3300025944 Ga0207661_10003202 Ga0207661_100032024 374
498 3300027876 Ga0209974_10007537 Ga0209974_100075374 374
499 3300037466 Ga0395898_0177440 Ga0395898_0177440_169_1383 374
500 iso_pu_bacteria 2516653046 2516895670 374
501 iso_pu_bacteria 2599185239 2599736624 374
502 iso_pu_bacteria 2643221550 2643770476 374
503 iso_pu_bacteria 2921257292 2921259298 374
504 iso_pu_bacteria 2937023124 2937025324 374
505 iso_pu_bacteria 2957395598 2957400103 374
506 iso_pu_bacteria 2964615318 2964620222 374
507 iso_pu_bacteria 2967755722 2967755818 374
508 iso_pu_bacteria 2970102677 2970102773 374
509 iso_pu_bacteria 2981990288 2981994762 374
510 3300005530 Ga0070679_100240777 Ga0070679_1002407771 375
511 3300005563 Ga0068855_100030991 Ga0068855_1000309917 375
512 3300013297 Ga0157378_10140977 Ga0157378_101409772 375
513 3300025921 Ga0207652_10083224 Ga0207652_100832243 375
514 3300025961 Ga0207712_10008695 Ga0207712_100086958 375
515 3300046462 Ga0495651_0114037 Ga0495651_0114037_298_1494 375
516 3300046529 Ga0495652_0106723 Ga0495652_0106723_680_1876 375
517 3300053084 Ga0495595_0042851 Ga0495595_0042851_367_1563 375
518 iso_pu_bacteria 2508501122 2509110609 375
519 iso_pu_bacteria 2509276019 2509377428 375
520 iso_pu_bacteria 2510065057 2510303102 375
521 iso_pu_bacteria 2511231052 2511497100 375
522 iso_pu_bacteria 2512047086 2512529572 375
523 iso_pu_bacteria 2513237086 2513582729 375
524 iso_pu_bacteria 2513237089 2513606480 375
525 iso_pu_bacteria 2513237091 2513614783 375
526 iso_pu_bacteria 2513237140 2513882299 375
527 iso_pu_bacteria 2513237143 2513901764 375
528 iso_pu_bacteria 2513237160 2514006078 375
529 iso_pu_bacteria 2513237351 2514589098 375
530 iso_pu_bacteria 2515154107 2515611694 375
531 iso_pu_bacteria 2517487022 2517566377 375
532 iso_pu_bacteria 2524023207 2524449352 375
533 iso_pu_bacteria 2551306084 2551678859 375
534 iso_pu_bacteria 2551306084 2551682097 375
535 iso_pu_bacteria 2551306085 2551683411 375
536 iso_pu_bacteria 2551306086 2551692962 375
537 iso_pu_bacteria 2551306087 2551697879 375
538 iso_pu_bacteria 2551306089 2551712438 375
539 iso_pu_bacteria 2551306090 2551719234 375
540 iso_pu_bacteria 2551306091 2551726087 375
541 iso_pu_bacteria 2551306093 2551743864 375
542 iso_pu_bacteria 2558860100 2558864961 375
543 iso_pu_bacteria 2721755755 2723844851 375
544 iso_pu_bacteria 2802428858 2802719717 375
545 iso_pu_bacteria 2802428859 2802728337 375
546 iso_pu_bacteria 2802428860 2802733547 375
547 iso_pu_bacteria 2802428861 2802738777 375
548 iso_pu_bacteria 2802428862 2802745623 375
549 iso_pu_bacteria 2802428863 2802751388 375
550 iso_pu_bacteria 2850079185 2850084680 375
551 iso_pu_bacteria 2855825444 2855829514 375
552 iso_pu_bacteria 2855839649 2855844613 375
553 iso_pu_bacteria 2857509624 2857514105 375
554 iso_pu_bacteria 2858800743 2858805926 375
555 iso_pu_bacteria 2915980308 2915982127 375
556 iso_pu_bacteria 2915986958 2915988367 375
557 iso_pu_bacteria 2915993759 2916000488 375
558 iso_pu_bacteria 2916000859 2916003404 375
559 iso_pu_bacteria 2916007675 2916007771 375
560 iso_pu_bacteria 2916014648 2916015979 375
561 iso_pu_bacteria 2916021584 2916021823 375
562 iso_pu_bacteria 2916028427 2916030979 375
563 iso_pu_bacteria 2916035215 2916037370 375
564 iso_pu_bacteria 2916041962 2916042174 375
565 iso_pu_bacteria 2916048683 2916048946 375
566 iso_pu_bacteria 2916055098 2916057252 375
567 iso_pu_bacteria 2916061851 2916066916 375
568 iso_pu_bacteria 2916076590 2916079291 375
569 iso_pu_bacteria 2921201388 2921202356 375
570 iso_pu_bacteria 2921208531 2921213815 375
571 iso_pu_bacteria 2921237296 2921242155 375
572 iso_pu_bacteria 2921244191 2921246332 375
573 iso_pu_bacteria 2921250672 2921256713 375
574 iso_pu_bacteria 2921263974 2921269771 375
575 iso_pu_bacteria 2921282425 2921286680 375
576 iso_pu_bacteria 2921289301 2921293623 375
577 iso_pu_bacteria 2921296804 2921304632 375
578 iso_pu_bacteria 2924144063 2924147987 375
579 iso_pu_bacteria 2924150972 2924152872 375
580 iso_pu_bacteria 2924158325 2924161863 375
581 iso_pu_bacteria 2924165586 2924165699 375
582 iso_pu_bacteria 2924172951 2924173966 375
583 iso_pu_bacteria 2924179722 2924184280 375
584 iso_pu_bacteria 2924186466 2924186657 375
585 iso_pu_bacteria 2924193448 2924197905 375
586 iso_pu_bacteria 2924200457 2924200692 375
587 iso_pu_bacteria 2924207177 2924207315 375
588 iso_pu_bacteria 2924214083 2924214161 375
589 iso_pu_bacteria 2924221636 2924222464 375
590 iso_pu_bacteria 2924228884 2924229032 375
591 iso_pu_bacteria 2936996657 2936997153 375
592 iso_pu_bacteria 2937002841 2937003156 375
593 iso_pu_bacteria 2937009748 2937010004 375
594 iso_pu_bacteria 2937016420 2937020442 375
595 iso_pu_bacteria 2937029754 2937033714 375
596 iso_pu_bacteria 2937036028 2937037570 375
597 iso_pu_bacteria 2937042894 2937046146 375
598 iso_pu_bacteria 2937049772 2937050598 375
599 iso_pu_bacteria 2937056579 2937060379 375
600 iso_pu_bacteria 2937063883 2937064082 375
601 iso_pu_bacteria 2937071275 2937071817 375
602 iso_pu_bacteria 2937078374 2937084590 375
603 iso_pu_bacteria 2937084907 2937091556 375
604 iso_pu_bacteria 2937091812 2937095794 375
605 iso_pu_bacteria 2937098957 2937100936 375
606 iso_pu_bacteria 2937106411 2937113189 375
607 iso_pu_bacteria 2937113482 2937115586 375
608 iso_pu_bacteria 2937119839 2937119934 375
609 iso_pu_bacteria 2937126314 2937132466 375
610 iso_pu_bacteria 2957375807 2957381162 375
611 iso_pu_bacteria 2957382221 2957382431 375
612 iso_pu_bacteria 2957388812 2957395363 375
613 iso_pu_bacteria 2957402308 2957404123 375
614 iso_pu_bacteria 2957408893 2957411509 375
615 iso_pu_bacteria 2957415311 2957416374 375
616 iso_pu_bacteria 2957422303 2957424183 375
617 iso_pu_bacteria 2957430029 2957432796 375
618 iso_pu_bacteria 2957437181 2957441841 375
619 iso_pu_bacteria 2957450854 2957450952 375
620 iso_pu_bacteria 2957457609 2957462823 375
621 iso_pu_bacteria 2957464669 2957465368 375
622 iso_pu_bacteria 2957471148 2957474937 375
623 iso_pu_bacteria 2957478035 2957478804 375
624 iso_pu_bacteria 2957484790 2957487512 375
625 iso_pu_bacteria 2957491536 2957493345 375
626 iso_pu_bacteria 2957498199 2957498564 375
627 iso_pu_bacteria 2957505466 2957507733 375
628 iso_pu_bacteria 2960584000 2960590294 375
629 iso_pu_bacteria 2960591022 2960597002 375
630 iso_pu_bacteria 2960597568 2960600124 375
631 iso_pu_bacteria 2960603979 2960604002 375
632 iso_pu_bacteria 2960610863 2960611104 375
633 iso_pu_bacteria 2960617483 2960622464 375
634 iso_pu_bacteria 2960624210 2960625269 375
635 iso_pu_bacteria 2960637947 2960644305 375
636 iso_pu_bacteria 2960645483 2960647294 375
637 iso_pu_bacteria 2960652885 2960657778 375
638 iso_pu_bacteria 2960667422 2960667663 375
639 iso_pu_bacteria 2960674078 2960679229 375
640 iso_pu_bacteria 2960680706 2960682206 375
641 iso_pu_bacteria 2960687367 2960691886 375
642 iso_pu_bacteria 2960693952 2960697992 375
643 iso_pu_bacteria 2964607997 2964615019 375
644 iso_pu_bacteria 2964621998 2964626732 375
645 iso_pu_bacteria 2964628898 2964629115 375
646 iso_pu_bacteria 2964636051 2964636226 375
647 iso_pu_bacteria 2964643177 2964643272 375
648 iso_pu_bacteria 2964649959 2964653815 375
649 iso_pu_bacteria 2964656573 2964662080 375
650 iso_pu_bacteria 2964663802 2964663898 375
651 iso_pu_bacteria 2964670856 2964674319 375
652 iso_pu_bacteria 2964678106 2964678195 375
653 iso_pu_bacteria 2964685014 2964685224 375
654 iso_pu_bacteria 2964691889 2964694173 375
655 iso_pu_bacteria 2964698721 2964699016 375
656 iso_pu_bacteria 2964705432 2964710825 375
657 iso_pu_bacteria 2964712639 2964716654 375
658 iso_pu_bacteria 2964719344 2964723448 375
659 iso_pu_bacteria 2967664464 2967666122 375
660 iso_pu_bacteria 2967671571 2967671667 375
661 iso_pu_bacteria 2967678726 2967681532 375
662 iso_pu_bacteria 2967686174 2967689512 375
663 iso_pu_bacteria 2967693043 2967698415 375
664 iso_pu_bacteria 2967699805 2967699907 375
665 iso_pu_bacteria 2967706974 2967708151 375
666 iso_pu_bacteria 2967714385 2967718487 375
667 iso_pu_bacteria 2967721400 2967721513 375
668 iso_pu_bacteria 2967728569 2967730282 375
669 iso_pu_bacteria 2967735183 2967737303 375
670 iso_pu_bacteria 2967742019 2967745128 375
671 iso_pu_bacteria 2967748971 2967749068 375
672 iso_pu_bacteria 2967762386 2967764254 375
673 iso_pu_bacteria 2967769361 2967769556 375
674 iso_pu_bacteria 2967775926 2967781714 375
675 iso_pu_bacteria 2970026789 2970028970 375
676 iso_pu_bacteria 2970033650 2970033746 375
677 iso_pu_bacteria 2970040964 2970043932 375
678 iso_pu_bacteria 2970047711 2970050144 375
679 iso_pu_bacteria 2970054988 2970055716 375
680 iso_pu_bacteria 2970061556 2970064432 375
681 iso_pu_bacteria 2970068827 2970068922 375
682 iso_pu_bacteria 2970076120 2970078120 375
683 iso_pu_bacteria 2970082768 2970084355 375
684 iso_pu_bacteria 2970088815 2970092009 375
685 iso_pu_bacteria 2970095765 2970095862 375
686 iso_pu_bacteria 2970109326 2970111235 375
687 iso_pu_bacteria 2970116247 2970119160 375
688 iso_pu_bacteria 2970122695 2970125676 375
689 iso_pu_bacteria 2970129317 2970135226 375
690 iso_pu_bacteria 2970136068 2970136162 375
691 iso_pu_bacteria 2970143518 2970149459 375
692 iso_pu_bacteria 2970149975 2970152023 375
693 iso_pu_bacteria 2970156795 2970162473 375
694 iso_pu_bacteria 2970164137 2970168958 375
695 iso_pu_bacteria 2970170962 2970171058 375
696 iso_pu_bacteria 2970177841 2970180128 375
697 iso_pu_bacteria 2970184632 2970189556 375
698 iso_pu_bacteria 2970191845 2970191963 375
699 iso_pu_bacteria 2977516862 2977518414 375
700 iso_pu_bacteria 2977523885 2977526425 375
701 iso_pu_bacteria 2977530762 2977534591 375
702 iso_pu_bacteria 2977537788 2977539727 375
703 iso_pu_bacteria 2977544691 2977548900 375
704 iso_pu_bacteria 2977551784 2977556047 375
705 iso_pu_bacteria 2977558990 2977560573 375
706 iso_pu_bacteria 2977565890 2977566189 375
707 iso_pu_bacteria 2977572785 2977573652 375
708 iso_pu_bacteria 2977579622 2977585133 375
709 iso_pu_bacteria 648276728 648735624 375
710 iso_pu_bacteria 8003992118 8003997138 375
711 iso_pu_bacteria 8006926726 8006931358 375
712 iso_pu_bacteria 8056875544 8056876797 375
713 3300009093 Ga0105240_10002728 Ga0105240_1000272828 376
714 3300025913 Ga0207695_10002575 Ga0207695_100025756 376
715 3300053730 Ga0500645_016506 Ga0500645_016506_489_1727 376
716 iso_pu_bacteria 2582581283 2585168712 376
717 iso_pu_bacteria 2582581306 2585269958 376
718 iso_pu_bacteria 2582581865 2585390640 376
719 iso_pu_bacteria 2599185352 2600197303 376
720 iso_pu_bacteria 2643221544 2643746033 376
721 iso_pu_bacteria 2643221607 2644048704 376
722 iso_pu_bacteria 2643221618 2644107366 376
723 iso_pu_bacteria 2643221626 2644150933 376
724 iso_pu_bacteria 2643221636 2644201977 376
725 iso_pu_bacteria 2643221637 2644209160 376
726 iso_pu_bacteria 2643221655 2644308761 376
727 iso_pu_bacteria 2643221659 2644335578 376
728 iso_pu_bacteria 2643221686 2644481506 376
729 iso_pu_bacteria 2643221688 2644495276 376
730 iso_pu_bacteria 2643221698 2644539984 376
731 iso_pu_bacteria 2643221712 2644614702 376
732 iso_pu_bacteria 2643221718 2644652634 376
733 iso_pu_bacteria 2728368998 2728749555 376
734 iso_pu_bacteria 2738541317 2738948814 376
735 iso_pu_bacteria 2751185800 2753361548 376
736 iso_pu_bacteria 2791355199 2793082273 376
737 iso_pu_bacteria 2841760612 2841765866 376
738 iso_pu_bacteria 2844104063 2844107476 376
739 iso_pu_bacteria 2844163670 2844166647 376
740 iso_pu_bacteria 2851182111 2851187736 376
741 iso_pu_bacteria 2851246043 2851249516 376
742 iso_pu_bacteria 2874604998 2874605430 376
743 iso_pu_bacteria 2889033259 2889039619 376
744 iso_pu_bacteria 2913308742 2913313775 376
745 iso_pu_bacteria 2922361189 2922365572 376
746 iso_pu_bacteria 2941499720 2941502214 376
747 iso_pu_bacteria 8006964411 8006967107 376
748 iso_pu_bacteria 8057529695 8057531893 376
749 3300003316 rootH1_10001161 rootH1_100011616 377
750 3300003322 rootL2_10019891 rootL2_100198917 377
751 3300003323 rootH1_10130802 rootH1_101308023 377
752 3300005295 Ga0065707_10090722 Ga0065707_100907224 377
753 3300005331 Ga0070670_100069354 Ga0070670_1000693543 377
754 3300005353 Ga0070669_100016208 Ga0070669_1000162082 377
755 3300005444 Ga0070694_100061484 Ga0070694_1000614844 377
756 3300005577 Ga0068857_100066630 Ga0068857_1000666304 377
757 3300005719 Ga0068861_100066781 Ga0068861_1000667815 377
758 3300005840 Ga0068870_10006240 Ga0068870_100062403 377
759 3300005844 Ga0068862_100022007 Ga0068862_1000220072 377
760 3300009093 Ga0105240_10232942 Ga0105240_102329422 377
761 3300009094 Ga0111539_10283371 Ga0111539_102833711 377
762 3300009553 Ga0105249_10011337 Ga0105249_100113375 377
763 3300013306 Ga0163162_10037622 Ga0163162_100376222 377
764 3300014326 Ga0157380_10003721 Ga0157380_100037213 377
765 3300021384 Ga0213876_10001505 Ga0213876_100015055 377
766 3300021388 Ga0213875_10018065 Ga0213875_100180652 377
767 3300025908 Ga0207643_10019696 Ga0207643_100196964 377
768 3300025913 Ga0207695_10027361 Ga0207695_100273612 377
769 3300025923 Ga0207681_10001545 Ga0207681_100015452 377
770 3300025961 Ga0207712_10002593 Ga0207712_100025932 377
771 3300025972 Ga0207668_10172403 Ga0207668_101724031 377
772 3300026116 Ga0207674_10083292 Ga0207674_100832924 377
773 3300028380 Ga0268265_10002240 Ga0268265_100022406 377
774 3300031548 Ga0307408_100000056 Ga0307408_100000056122 377
775 3300037853 Ga0436364_0541406 Ga0436364_0541406_1784_3007 377
776 3300039437 Ga0436365_0244982 Ga0436365_0244982_59341_60564 377
777 3300039450 Ga0436363_1091027 Ga0436363_1091027_578_1801 377
778 3300039453 Ga0436362_0338861 Ga0436362_0338861_5176_6399 377
779 3300045051 Ga0451576_0120588 Ga0451576_0120588_1328_2563 377
780 3300046690 Ga0495624_0027650 Ga0495624_0027650_1887_3119 377
781 3300048903 Ga0496100_0037558 Ga0496100_0037558_565_1773 377
782 3300049571 Ga0501034_0153118 Ga0501034_0153118_261_1466 377
783 3300049589 Ga0501073_0028200 Ga0501073_0028200_956_2194 377
784 3300050511 nmdc:mga08y16_100803_c1 nmdc:mga08y16_100803_c1_1439_2692 377
785 iso_pu_bacteria 2513237096 2513657970 377
786 iso_pu_bacteria 2513237098 2513676056 377
787 iso_pu_bacteria 2513237101 2513692770 377
788 iso_pu_bacteria 2513237137 2513855671 377
789 iso_pu_bacteria 2513237139 2513872969 377
790 iso_pu_bacteria 2513237141 2513894730 377
791 iso_pu_bacteria 2513237145 2513919937 377
792 iso_pu_bacteria 2517572143 2517892208 377
793 iso_pu_bacteria 2524023205 2524437555 377
794 iso_pu_bacteria 2524023210 2524465718 377
795 iso_pu_bacteria 2524023228 2524534300 377
796 iso_pu_bacteria 2585427633 2585997940 377
797 iso_pu_bacteria 2585428058 2587736923 377
798 iso_pu_bacteria 2588253510 2588295465 377
799 iso_pu_bacteria 2599185240 2599744681 377
800 iso_pu_bacteria 2599185355 2600205958 377
801 iso_pu_bacteria 2602042107 2603862365 377
802 iso_pu_bacteria 2643221557 2643804956 377
803 iso_pu_bacteria 2643221585 2643936998 377
804 iso_pu_bacteria 2643221592 2643971911 377
805 iso_pu_bacteria 2643221610 2644065800 377
806 iso_pu_bacteria 2643221625 2644139405 377
807 iso_pu_bacteria 2643221639 2644218080 377
808 iso_pu_bacteria 2643221646 2644260900 377
809 iso_pu_bacteria 2643221648 2644275015 377
810 iso_pu_bacteria 2643221656 2644318163 377
811 iso_pu_bacteria 2643221668 2644376907 377
812 iso_pu_bacteria 2643221675 2644417692 377
813 iso_pu_bacteria 2643221680 2644453796 377
814 iso_pu_bacteria 2643221723 2644677684 377
815 iso_pu_bacteria 2643221726 2644688431 377
816 iso_pu_bacteria 2667528175 2671120541 377
817 iso_pu_bacteria 2675903129 2676742807 377
818 iso_pu_bacteria 2738541337 2739056389 377
819 iso_pu_bacteria 2744054633 2745079662 377
820 iso_pu_bacteria 2791355197 2793068721 377
821 iso_pu_bacteria 2802429603 2805915133 377
822 iso_pu_bacteria 2818991452 2819631108 377
823 iso_pu_bacteria 2824679649 2824685864 377
824 iso_pu_bacteria 2824696289 2824702479 377
825 iso_pu_bacteria 2844315083 2844319262 377
826 iso_pu_bacteria 2847930680 2847936417 377
827 iso_pu_bacteria 2847939898 2847946770 377
828 iso_pu_bacteria 2849076700 2849079122 377
829 iso_pu_bacteria 2857524615 2857525745 377
830 iso_pu_bacteria 2870068957 2870071054 377
831 iso_pu_bacteria 2876761206 2876764728 377
832 iso_pu_bacteria 2876808645 2876810996 377
833 iso_pu_bacteria 2879083081 2879090199 377
834 iso_pu_bacteria 2879110137 2879115719 377
835 iso_pu_bacteria 2883291878 2883295185 377
836 iso_pu_bacteria 2885383462 2885389263 377
837 iso_pu_bacteria 2888388044 2888393614 377
838 iso_pu_bacteria 2893066018 2893067961 377
839 iso_pu_bacteria 2903727486 2903731104 377
840 iso_pu_bacteria 2903748898 2903751578 377
841 iso_pu_bacteria 2903768456 2903772461 377
842 iso_pu_bacteria 2904690495 2904694654 377
843 iso_pu_bacteria 2904699407 2904702353 377
844 iso_pu_bacteria 2906602504 2906607389 377
845 iso_pu_bacteria 2906610324 2906617331 377
846 iso_pu_bacteria 2906635258 2906642644 377
847 iso_pu_bacteria 2906660503 2906666178 377
848 iso_pu_bacteria 2908739725 2908742486 377
849 iso_pu_bacteria 2908756301 2908760204 377
850 iso_pu_bacteria 2919073203 2919074391 377
851 iso_pu_bacteria 2920822456 2920826866 377
852 iso_pu_bacteria 2922386360 2922391190 377
853 iso_pu_bacteria 2922393267 2922400595 377
854 iso_pu_bacteria 2922425934 2922430493 377
855 iso_pu_bacteria 2928157003 2928160084 377
856 iso_pu_bacteria 2928163908 2928168524 377
857 iso_pu_bacteria 2928170801 2928171776 377
858 iso_pu_bacteria 2935630451 2935631470 377
859 iso_pu_bacteria 2935959822 2935960613 377
860 iso_pu_bacteria 2941507105 2941510212 377
861 iso_pu_bacteria 2941515067 2941518702 377
862 iso_pu_bacteria 2941523033 2941525611 377
863 iso_pu_bacteria 2960631154 2960631497 377
864 iso_pu_bacteria 2989349275 2989349800 377
865 iso_pu_bacteria 3005474847 3005480403 377
866 iso_pu_bacteria 3005506211 3005510520 377
867 iso_pu_bacteria 3005718088 3005722506 377
868 iso_pu_bacteria 8006933436 8006940472 377
869 iso_pu_bacteria 8006973647 8006980161 377
870 iso_pu_bacteria 8006984368 8006986618 377
871 iso_pu_bacteria 8018845410 8018851415 377
872 iso_pu_bacteria 8019555841 8019556544 377
873 iso_pu_bacteria 8019565922 8019568765 377
874 iso_pu_bacteria 8021120328 8021122251 377
875 iso_pu_bacteria 8039098773 8039102503 377
876 iso_pu_bacteria 8054558443 8054559342 377
877 iso_pu_bacteria 8056673599 8056673641 377
878 iso_pu_bacteria 8056681323 8056686831 377
879 iso_pu_bacteria 8056689827 8056691328 377
880 iso_pu_bacteria 8056967851 8056968233 377
881 3300002773 JGI25152J39213_1001786 JGI25152J39213_10017867 378
882 3300005329 Ga0070683_100003949 Ga0070683_10000394911 378
883 3300005336 Ga0070680_100088646 Ga0070680_1000886463 378
884 3300006038 Ga0075365_10058843 Ga0075365_100588432 378
885 3300006051 Ga0075364_10041422 Ga0075364_100414223 378
886 3300006186 Ga0075369_10022854 Ga0075369_100228542 378
887 3300006353 Ga0075370_10005197 Ga0075370_100051975 378
888 3300006358 Ga0068871_100034578 Ga0068871_1000345782 378
889 3300013105 Ga0157369_10067796 Ga0157369_100677965 378
890 3300025245 Ga0207425_1000292 Ga0207425_100029220 378
891 3300025258 Ga0209129_1000025 Ga0209129_1000025339 378
892 3300025295 Ga0209564_1000039 Ga0209564_1000039339 378
893 3300025297 Ga0209758_1000163 Ga0209758_100016399 378
894 3300026116 Ga0207674_10083238 Ga0207674_100832384 378
895 3300028800 Ga0265338_10005146 Ga0265338_100051464 378
896 3300031238 Ga0265332_10081475 Ga0265332_100814751 378
897 3300031247 Ga0265340_10015636 Ga0265340_100156363 378
898 3300031247 Ga0265340_10051469 Ga0265340_100514692 378
899 3300031344 Ga0265316_10083710 Ga0265316_100837103 378
900 3300031711 Ga0265314_10008385 Ga0265314_1000838511 378
901 3300037418 Ga0395900_0204267 Ga0395900_0204267_549_1763 378
902 3300037466 Ga0395898_0023551 Ga0395898_0023551_403_1617 378
903 3300037471 Ga0395905_0002583 Ga0395905_0002583_11407_12633 378
904 3300038443 Ga0395901_0168521 Ga0395901_0168521_1062_2273 378
905 3300038443 Ga0395901_0270621 Ga0395901_0270621_234_1448 378
906 3300046477 Ga0495664_0003614 Ga0495664_0003614_4613_5827 378
907 3300046543 Ga0495645_0028522 Ga0495645_0028522_1958_3172 378
908 3300050496 nmdc:mga07m45_6102_c1 nmdc:mga07m45_6102_c1_3618_4838 378
909 iso_pu_bacteria 2585428057 2587726774 378
910 3300003322 rootL2_10034669 rootL2_100346696 379
911 3300003659 JGI25404J52841_10009459 JGI25404J52841_100094593 379
912 3300003659 JGI25404J52841_10015804 JGI25404J52841_100158041 379
913 3300003781 Ga0055536_1000494 Ga0055536_100049417 379
914 3300003791 Ga0055530_10006225 Ga0055530_100062253 379
915 3300003794 Ga0055531_10000007 Ga0055531_1000000754 379
916 3300003794 Ga0055531_10000751 Ga0055531_100007514 379
917 3300005459 Ga0068867_100000114 Ga0068867_1000001149 379
918 3300005467 Ga0070706_100053290 Ga0070706_1000532904 379
919 3300005543 Ga0070672_100002864 Ga0070672_1000028643 379
920 3300005719 Ga0068861_100044771 Ga0068861_1000447714 379
921 3300005843 Ga0068860_100081526 Ga0068860_1000815262 379
922 3300005843 Ga0068860_100132747 Ga0068860_1001327472 379
923 3300005937 Ga0081455_10001796 Ga0081455_1000179621 379
924 3300005983 Ga0081540_1006483 Ga0081540_10064832 379
925 3300005983 Ga0081540_1010556 Ga0081540_10105561 379
926 3300006178 Ga0075367_10051022 Ga0075367_100510223 379
927 3300009148 Ga0105243_10010808 Ga0105243_100108084 379
928 3300009148 Ga0105243_10107602 Ga0105243_101076022 379
929 3300009174 Ga0105241_10137847 Ga0105241_101378471 379
930 3300009176 Ga0105242_10011167 Ga0105242_1001116710 379
931 3300010375 Ga0105239_10223788 Ga0105239_102237882 379
932 3300014745 Ga0157377_10000016 Ga0157377_1000001690 379
933 3300021384 Ga0213876_10088101 Ga0213876_100881012 379
934 3300025292 Ga0209676_1001218 Ga0209676_100121817 379
935 3300025298 Ga0209050_1002131 Ga0209050_100213110 379
936 3300025303 Ga0209051_1002753 Ga0209051_100275313 379
937 3300025304 Ga0209257_1000021 Ga0209257_1000021174 379
938 3300025304 Ga0209257_1000282 Ga0209257_100028217 379
939 3300025910 Ga0207684_10039118 Ga0207684_100391182 379
940 3300025931 Ga0207644_10122094 Ga0207644_101220942 379
941 3300025935 Ga0207709_10007776 Ga0207709_100077764 379
942 3300025935 Ga0207709_10109719 Ga0207709_101097192 379
943 3300025938 Ga0207704_10088455 Ga0207704_100884552 379
944 3300025961 Ga0207712_10191700 Ga0207712_101917002 379
945 3300025981 Ga0207640_10081019 Ga0207640_100810192 379
946 3300025986 Ga0207658_10150217 Ga0207658_101502172 379
947 3300026089 Ga0207648_10000343 Ga0207648_100003439 379
948 3300026089 Ga0207648_10004572 Ga0207648_100045725 379
949 3300028380 Ga0268265_10022190 Ga0268265_100221904 379
950 3300031235 Ga0265330_10095064 Ga0265330_100950641 379
951 3300031456 Ga0307513_10133705 Ga0307513_101337051 379
952 3300031507 Ga0307509_10001769 Ga0307509_1000176925 379
953 3300031616 Ga0307508_10000430 Ga0307508_1000043017 379
954 3300031616 Ga0307508_10122475 Ga0307508_101224752 379
955 3300031731 Ga0307405_10003030 Ga0307405_100030306 379
956 3300032005 Ga0307411_10000184 Ga0307411_100001842 379
957 3300033180 Ga0307510_10012673 Ga0307510_100126732 379
958 3300035695 Ga0373927_0029952 Ga0373927_0029952_169_1416 379
959 3300035695 Ga0373927_0063702 Ga0373927_0063702_108_1328 379
960 3300037068 Ga0373925_0091397 Ga0373925_0091397_500_1747 379
961 3300039437 Ga0436365_0465598 Ga0436365_0465598_204_1469 379
962 3300046535 Ga0495586_0048581 Ga0495586_0048581_1005_2234 379
963 3300048924 Ga0496121_0117977 Ga0496121_0117977_334_1566 379
964 3300049579 Ga0501043_0000439 Ga0501043_0000439_28561_29793 379
965 3300049580 Ga0501046_0001371 Ga0501046_0001371_14448_15680 379
966 3300049581 Ga0501047_0000069 Ga0501047_0000069_61353_62585 379
967 3300049582 Ga0501048_0001073 Ga0501048_0001073_5295_6527 379
968 3300049662 Ga0501222_003521 Ga0501222_003521_708_1940 379
969 3300049744 Ga0501083_0040764 Ga0501083_0040764_391_1617 379
970 3300049824 Ga0501045_0011250 Ga0501045_0011250_2594_3826 379
971 3300050496 nmdc:mga07m45_29113_c1 nmdc:mga07m45_29113_c1_1149_2381 379
972 3300053086 Ga0500578_0000263 Ga0500578_0000263_16063_17304 379
973 3300053148 Ga0500590_010398 Ga0500590_010398_1686_2918 379
974 3300060353 Ga0501082_0340848 Ga0501082_0340848_20_1240 379
975 iso_pu_bacteria 2996336353 2996338418 379
976 3300003203 JGI25406J46586_10010338 JGI25406J46586_100103385 380
977 3300005331 Ga0070670_100131893 Ga0070670_1001318932 380
978 3300005339 Ga0070660_100004626 Ga0070660_1000046263 380
979 3300005366 Ga0070659_100000096 Ga0070659_10000009626 380
980 3300005543 Ga0070672_100215073 Ga0070672_1002150731 380
981 3300005719 Ga0068861_100161430 Ga0068861_1001614302 380
982 3300005841 Ga0068863_100109795 Ga0068863_1001097952 380
983 3300005983 Ga0081540_1029244 Ga0081540_10292442 380
984 3300005985 Ga0081539_10001457 Ga0081539_100014574 380
985 3300009177 Ga0105248_10040535 Ga0105248_100405355 380
986 3300009177 Ga0105248_10050503 Ga0105248_100505032 380
987 3300009545 Ga0105237_10036635 Ga0105237_100366354 380
988 3300009551 Ga0105238_10254919 Ga0105238_102549193 380
989 3300009551 Ga0105238_10374994 Ga0105238_103749941 380
990 3300009553 Ga0105249_10017301 Ga0105249_100173014 380
991 3300010375 Ga0105239_10014915 Ga0105239_100149153 380
992 3300013306 Ga0163162_10193308 Ga0163162_101933082 380
993 3300013308 Ga0157375_10187874 Ga0157375_101878742 380
994 3300025914 Ga0207671_10055232 Ga0207671_100552324 380
995 3300025919 Ga0207657_10000004 Ga0207657_10000004102 380
996 3300025925 Ga0207650_10188508 Ga0207650_101885081 380
997 3300025932 Ga0207690_10000015 Ga0207690_10000015191 380
998 3300025941 Ga0207711_10123071 Ga0207711_101230712 380
999 3300026035 Ga0207703_10025822 Ga0207703_100258222 380
1000 3300026088 Ga0207641_10202459 Ga0207641_102024592 380
1001 3300026121 Ga0207683_10100833 Ga0207683_101008333 380
1002 3300026121 Ga0207683_10253213 Ga0207683_102532132 380
1003 3300026142 Ga0207698_10250772 Ga0207698_102507722 380
1004 3300028379 Ga0268266_10053037 Ga0268266_100530371 380
1005 3300028794 Ga0307515_10025474 Ga0307515_100254746 380
1006 3300030878 Ga0265770_1000176 Ga0265770_10001766 380
1007 3300031090 Ga0265760_10014223 Ga0265760_100142232 380
1008 3300035695 Ga0373927_0029189 Ga0373927_0029189_1902_3113 380
1009 3300035725 Ga0373947_0027904 Ga0373947_0027904_746_1957 380
1010 3300037471 Ga0395905_0028159 Ga0395905_0028159_679_1896 380
1011 3300037471 Ga0395905_0097858 Ga0395905_0097858_754_1965 380
1012 3300037853 Ga0436364_0552267 Ga0436364_0552267_19_1242 380
1013 3300039437 Ga0436365_0894462 Ga0436365_0894462_112_1338 380
1014 3300046455 Ga0495603_0036333 Ga0495603_0036333_1629_2840 380
1015 3300046455 Ga0495603_0075863 Ga0495603_0075863_721_1938 380
1016 3300047472 Ga0495686_0053930 Ga0495686_0053930_1230_2480 380
1017 3300048904 Ga0496101_0098815 Ga0496101_0098815_867_2096 380
1018 3300048908 Ga0496105_0054856 Ga0496105_0054856_960_2189 380
1019 3300048909 Ga0496106_0053866 Ga0496106_0053866_919_2148 380
1020 3300048910 Ga0496107_0009774 Ga0496107_0009774_650_1879 380
1021 3300048911 Ga0496108_0051741 Ga0496108_0051741_1411_2640 380
1022 3300048917 Ga0496114_0102995 Ga0496114_0102995_1076_2305 380
1023 3300050492 nmdc:mga0yw44_100474_c1 nmdc:mga0yw44_100474_c1_611_1831 380
1024 3300053119 Ga0500595_000075 Ga0500595_000075_31776_33002 380
1025 3300001989 JGI24739J22299_10005337 JGI24739J22299_100053372 381
1026 3300003215 JGI25153J46596_10001087 JGI25153J46596_1000108718 381
1027 3300003215 JGI25153J46596_10006828 JGI25153J46596_100068282 381
1028 3300003354 JGI25160J50197_1024513 JGI25160J50197_10245132 381
1029 3300003758 Ga0055532_1000336 Ga0055532_10003361 381
1030 3300003758 Ga0055532_1000625 Ga0055532_10006259 381
1031 3300003760 Ga0055527_1000433 Ga0055527_100043313 381
1032 3300003761 Ga0055535_1001075 Ga0055535_100107513 381
1033 3300005262 Ga0065165_1001016 Ga0065165_100101621 381
1034 3300005355 Ga0070671_100006532 Ga0070671_1000065322 381
1035 3300005364 Ga0070673_100005015 Ga0070673_1000050159 381
1036 3300005367 Ga0070667_100000046 Ga0070667_10000004698 381
1037 3300005434 Ga0070709_10082900 Ga0070709_100829002 381
1038 3300005435 Ga0070714_100015299 Ga0070714_1000152997 381
1039 3300005436 Ga0070713_100047166 Ga0070713_1000471663 381
1040 3300005437 Ga0070710_10001502 Ga0070710_1000150211 381
1041 3300005439 Ga0070711_100016359 Ga0070711_1000163594 381
1042 3300005455 Ga0070663_100007285 Ga0070663_1000072853 381
1043 3300005458 Ga0070681_10019757 Ga0070681_100197572 381
1044 3300005458 Ga0070681_10092243 Ga0070681_100922432 381
1045 3300005543 Ga0070672_100253054 Ga0070672_1002530541 381
1046 3300005577 Ga0068857_100182640 Ga0068857_1001826401 381
1047 3300005616 Ga0068852_100018555 Ga0068852_1000185556 381
1048 3300006028 Ga0070717_10064914 Ga0070717_100649142 381
1049 3300006028 Ga0070717_10186287 Ga0070717_101862871 381
1050 3300006038 Ga0075365_10004360 Ga0075365_100043609 381
1051 3300006163 Ga0070715_10001855 Ga0070715_100018552 381
1052 3300006173 Ga0070716_100004571 Ga0070716_1000045713 381
1053 3300006844 Ga0075428_100144634 Ga0075428_1001446342 381
1054 3300006852 Ga0075433_10005585 Ga0075433_100055856 381
1055 3300006871 Ga0075434_100006322 Ga0075434_1000063228 381
1056 3300006944 Ga0099823_1022490 Ga0099823_10224903 381
1057 3300007076 Ga0075435_100131190 Ga0075435_1001311903 381
1058 3300009093 Ga0105240_10039788 Ga0105240_100397886 381
1059 3300009094 Ga0111539_10001545 Ga0111539_1000154527 381
1060 3300009094 Ga0111539_10024722 Ga0111539_100247223 381
1061 3300009101 Ga0105247_10015519 Ga0105247_100155193 381
1062 3300009147 Ga0114129_10005987 Ga0114129_100059872 381
1063 3300009147 Ga0114129_10086742 Ga0114129_100867423 381
1064 3300009147 Ga0114129_10132303 Ga0114129_101323032 381
1065 3300009545 Ga0105237_10037912 Ga0105237_100379123 381
1066 3300009551 Ga0105238_10034527 Ga0105238_100345275 381
1067 3300010375 Ga0105239_10008694 Ga0105239_1000869410 381
1068 3300010375 Ga0105239_10389100 Ga0105239_103891001 381
1069 3300013104 Ga0157370_10256064 Ga0157370_102560642 381
1070 3300013105 Ga0157369_10006104 Ga0157369_1000610415 381
1071 3300013105 Ga0157369_10018323 Ga0157369_100183237 381
1072 3300013296 Ga0157374_10154340 Ga0157374_101543403 381
1073 3300013306 Ga0163162_10344808 Ga0163162_103448081 381
1074 3300014745 Ga0157377_10073055 Ga0157377_100730552 381
1075 3300021321 Ga0214542_1000014 Ga0214542_1000014120 381
1076 3300021327 Ga0214543_1000056 Ga0214543_100005698 381
1077 3300021441 Ga0213871_10028365 Ga0213871_100283651 381
1078 3300025228 Ga0209672_100023 Ga0209672_100023251 381
1079 3300025229 Ga0209147_100094 Ga0209147_10009491 381
1080 3300025229 Ga0209147_100246 Ga0209147_10024618 381
1081 3300025242 Ga0209258_100142 Ga0209258_10014280 381
1082 3300025254 Ga0209148_1001163 Ga0209148_100116315 381
1083 3300025272 Ga0209455_1000724 Ga0209455_10007248 381
1084 3300025302 Ga0207426_1000822 Ga0207426_100082212 381
1085 3300025898 Ga0207692_10004784 Ga0207692_100047841 381
1086 3300025900 Ga0207710_10015256 Ga0207710_100152562 381
1087 3300025904 Ga0207647_10003764 Ga0207647_100037646 381
1088 3300025906 Ga0207699_10100166 Ga0207699_101001661 381
1089 3300025909 Ga0207705_10125201 Ga0207705_101252011 381
1090 3300025910 Ga0207684_10193404 Ga0207684_101934042 381
1091 3300025913 Ga0207695_10107737 Ga0207695_101077373 381
1092 3300025915 Ga0207693_10007521 Ga0207693_1000752110 381
1093 3300025916 Ga0207663_10001619 Ga0207663_1000161911 381
1094 3300025924 Ga0207694_10245725 Ga0207694_102457251 381
1095 3300025925 Ga0207650_10033523 Ga0207650_100335232 381
1096 3300025926 Ga0207659_10052620 Ga0207659_100526203 381
1097 3300025931 Ga0207644_10028183 Ga0207644_100281832 381
1098 3300025939 Ga0207665_10003514 Ga0207665_1000351411 381
1099 3300025949 Ga0207667_10072260 Ga0207667_100722603 381
1100 3300025986 Ga0207658_10000058 Ga0207658_1000005848 381
1101 3300026067 Ga0207678_10012877 Ga0207678_100128777 381
1102 3300026142 Ga0207698_10014336 Ga0207698_100143362 381
1103 3300026142 Ga0207698_10188439 Ga0207698_101884392 381
1104 3300027296 Ga0209389_1000201 Ga0209389_100020119 381
1105 3300027361 Ga0209489_100035 Ga0209489_10003532 381
1106 3300027363 Ga0209700_100005 Ga0209700_10000534 381
1107 3300027907 Ga0207428_10006944 Ga0207428_1000694410 381
1108 3300031456 Ga0307513_10016740 Ga0307513_100167402 381
1109 3300031548 Ga0307408_100001506 Ga0307408_1000015064 381
1110 3300031730 Ga0307516_10077272 Ga0307516_100772721 381
1111 3300031730 Ga0307516_10082809 Ga0307516_100828093 381
1112 3300033180 Ga0307510_10012250 Ga0307510_100122508 381
1113 3300035086 Ga0373934_0004161 Ga0373934_0004161_3610_4857 381
1114 3300035088 Ga0373940_0012551 Ga0373940_0012551_275_1522 381
1115 3300035111 Ga0373923_0000671 Ga0373923_0000671_232_1479 381
1116 3300035111 Ga0373923_0010258 Ga0373923_0010258_643_1875 381
1117 3300035113 Ga0373936_0027462 Ga0373936_0027462_13_1233 381
1118 3300035114 Ga0373939_0020896 Ga0373939_0020896_14_1261 381
1119 3300035118 Ga0373954_0000658 Ga0373954_0000658_2760_4007 381
1120 3300035119 Ga0373956_0003745 Ga0373956_0003745_2472_3719 381
1121 3300035120 Ga0373957_0009633 Ga0373957_0009633_25_1272 381
1122 3300035120 Ga0373957_0051578 Ga0373957_0051578_197_1429 381
1123 3300035170 Ga0373943_0010364 Ga0373943_0010364_1668_2900 381
1124 3300035410 Ga0373924_0003932 Ga0373924_0003932_821_2053 381
1125 3300035691 Ga0373931_0037889 Ga0373931_0037889_763_2010 381
1126 3300035724 Ga0373933_0000445 Ga0373933_0000445_22933_24159 381
1127 3300035724 Ga0373933_0033552 Ga0373933_0033552_1055_2287 381
1128 3300035725 Ga0373947_0094310 Ga0373947_0094310_309_1541 381
1129 3300036401 Ga0373937_0022764 Ga0373937_0022764_613_1860 381
1130 3300037068 Ga0373925_0034849 Ga0373925_0034849_2089_3321 381
1131 3300037418 Ga0395900_0137440 Ga0395900_0137440_84_1316 381
1132 3300037466 Ga0395898_0033644 Ga0395898_0033644_1172_2404 381
1133 3300039437 Ga0436365_0063749 Ga0436365_0063749_2954_4171 381
1134 3300039438 Ga0436360_0207100 Ga0436360_0207100_974_2206 381
1135 3300039447 Ga0436361_1206490 Ga0436361_1206490_993_2213 381
1136 3300044735 Ga0466968_0030638 Ga0466968_0030638_955_2172 381
1137 3300044842 Ga0466957_0059415 Ga0466957_0059415_525_1754 381
1138 3300044842 Ga0466957_0138351 Ga0466957_0138351_123_1349 381
1139 3300046454 Ga0495592_0016498 Ga0495592_0016498_708_1955 381
1140 3300046454 Ga0495592_0102968 Ga0495592_0102968_400_1632 381
1141 3300046455 Ga0495603_0010741 Ga0495603_0010741_4060_5292 381
1142 3300046460 Ga0495638_0132377 Ga0495638_0132377_64_1296 381
1143 3300046463 Ga0495653_0000358 Ga0495653_0000358_10675_11922 381
1144 3300046472 Ga0495580_0009429 Ga0495580_0009429_6059_7291 381
1145 3300046473 Ga0495582_0025546 Ga0495582_0025546_446_1678 381
1146 3300046475 Ga0495639_0011249 Ga0495639_0011249_643_1875 381
1147 3300046477 Ga0495664_0017108 Ga0495664_0017108_1090_2322 381
1148 3300046514 Ga0495618_0052656 Ga0495618_0052656_760_1992 381
1149 3300046516 Ga0495628_0028749 Ga0495628_0028749_1368_2600 381
1150 3300046529 Ga0495652_0025038 Ga0495652_0025038_1143_2390 381
1151 3300046533 Ga0495640_0045777 Ga0495640_0045777_1363_2595 381
1152 3300046533 Ga0495640_0058499 Ga0495640_0058499_642_1889 381
1153 3300046536 Ga0495587_0010166 Ga0495587_0010166_2172_3419 381
1154 3300046559 Ga0495667_0030252 Ga0495667_0030252_281_1513 381
1155 3300046642 Ga0495634_0002891 Ga0495634_0002891_9393_10640 381
1156 3300046642 Ga0495634_0024961 Ga0495634_0024961_756_1988 381
1157 3300046663 Ga0495635_0000466 Ga0495635_0000466_23603_24850 381
1158 3300046678 Ga0495599_0002741 Ga0495599_0002741_1054_2301 381
1159 3300046680 Ga0495646_0007558 Ga0495646_0007558_5223_6470 381
1160 3300046690 Ga0495624_0016010 Ga0495624_0016010_559_1791 381
1161 3300046809 Ga0495600_0001173 Ga0495600_0001173_11845_13092 381
1162 3300047315 Ga0495581_0007629 Ga0495581_0007629_210_1442 381
1163 3300047317 Ga0495604_0031510 Ga0495604_0031510_449_1681 381
1164 3300047319 Ga0495674_0032928 Ga0495674_0032928_2314_3561 381
1165 3300047319 Ga0495674_0038270 Ga0495674_0038270_1309_2541 381
1166 3300047322 Ga0495680_0006795 Ga0495680_0006795_1668_2915 381
1167 3300047471 Ga0495684_0000357 Ga0495684_0000357_24089_25336 381
1168 3300047673 Ga0495593_0005202 Ga0495593_0005202_2510_3757 381
1169 3300047673 Ga0495593_0040169 Ga0495593_0040169_898_2130 381
1170 3300048904 Ga0496101_0090063 Ga0496101_0090063_818_2038 381
1171 3300048909 Ga0496106_0108946 Ga0496106_0108946_736_1956 381
1172 3300048911 Ga0496108_0208262 Ga0496108_0208262_296_1534 381
1173 3300048915 Ga0496112_0003582 Ga0496112_0003582_4937_6157 381
1174 3300048915 Ga0496112_0037196 Ga0496112_0037196_3500_4738 381
1175 3300048915 Ga0496112_0037747 Ga0496112_0037747_1177_2397 381
1176 3300048916 Ga0496113_0068406 Ga0496113_0068406_944_2182 381
1177 3300048920 Ga0496117_0016248 Ga0496117_0016248_171_1382 381
1178 3300048920 Ga0496117_0078953 Ga0496117_0078953_554_1771 381
1179 3300048921 Ga0496118_0012336 Ga0496118_0012336_834_2045 381
1180 3300048921 Ga0496118_0110427 Ga0496118_0110427_392_1609 381
1181 3300048924 Ga0496121_0000667 Ga0496121_0000667_3745_4956 381
1182 3300048924 Ga0496121_0116985 Ga0496121_0116985_420_1637 381
1183 3300048929 Ga0496126_0054514 Ga0496126_0054514_87_1298 381
1184 3300049581 Ga0501047_0016182 Ga0501047_0016182_2448_3674 381
1185 3300049586 Ga0501070_0038271 Ga0501070_0038271_1992_3218 381
1186 3300049742 Ga0501080_0099386 Ga0501080_0099386_254_1480 381
1187 3300050511 nmdc:mga08y16_34344_c1 nmdc:mga08y16_34344_c1_2524_3738 381
1188 3300050511 nmdc:mga08y16_60391_c1 nmdc:mga08y16_60391_c1_2213_3451 381
1189 3300053078 Ga0495612_0019088 Ga0495612_0019088_1228_2460 381
1190 3300053085 Ga0495619_0000176 Ga0495619_0000176_41704_42951 381
1191 3300053087 Ga0500643_000014 Ga0500643_000014_120048_121277 381
1192 3300053094 Ga0500566_0000009 Ga0500566_0000009_121896_123116 381
1193 3300053095 Ga0500640_000013 Ga0500640_000013_6329_7549 381
1194 3300053111 Ga0500572_000248 Ga0500572_000248_9162_10382 381
1195 3300053148 Ga0500590_057115 Ga0500590_057115_479_1699 381
1196 3300053150 Ga0500603_000016 Ga0500603_000016_9016_10236 381
1197 3300053156 Ga0500622_0000973 Ga0500622_0000973_676_1896 381
1198 3300053163 Ga0500639_000017 Ga0500639_000017_74417_75637 381
1199 3300053735 Ga0500596_000051 Ga0500596_000051_6545_7765 381
1200 iso_pu_bacteria 2863421361 2863424791 381
1201 iso_pu_bacteria 2904564687 2904571018 381
1202 iso_pu_bacteria 2904571731 2904575932 381
1203 iso_pu_bacteria 2913295892 2913296848 381
1204 iso_pu_bacteria 2928536128 2928539930 381
1205 iso_pu_bacteria 8020938398 8020945070 381
1206 iso_pu_bacteria 8020953355 8020956893 381

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07690

MFS_1

Major Facilitator Superfamily

82

360

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
6hcl-assembly2.cif.gz_B crystal structure of a mfs transporter with ligand at 2.69 angstroem resolution 0.8757 8 370
6zgr-assembly2.cif.gz_B crystal structure of a mfs transporter with bound 1-hydroxynaphthalene-2-carboxylic acid at 2.67 angstroem resolution 0.8756 8 370
6zgu-assembly2.cif.gz_B crystal structure of a mfs transporter with bound 3-(2-methylphenyl)propanoic acid at 2.41 angstroem resolution 0.8738 14 370
8hpj-assembly1.cif.gz_A crystal structure of the bacterial oxalate transporter oxlt in a ligand-free outward-facing form 0.8731 7 374
6zgs-assembly1.cif.gz_A crystal structure of a mfs transporter with bound 3-phenylpropanoic acid at 2.39 angstroem resolution 0.8716 7 370
ID Description Score Start End Superfamily
af_A0A0R4IK09_14_317_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9592 7 185 1.20.1250.20
af_Q5NC32_11_193_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9581 6 185 1.20.1250.20
af_Q7JWI7_52_243_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9503 6 185 1.20.1250.20
af_E7FGJ9_71_276_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9476 8 185 1.20.1250.20
af_Q5U154_230_448_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9431 7 185 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A6L3NAE6-F1-model_v4 MFS transporter 0.9864 1 195 GO:0016020
GO:0022857
AF-A0A6L3NAE6-F1-model_v4 MFS transporter 0.9814 1 195 GO:0016020
GO:0022857
AF-F0GI69-F1-model_v4 Major facilitator transporter 0.9522 1 259 GO:0016020
GO:0022857
AF-A0A812CRN7-F1-model_v4 Monocarboxylate transporter 14 0.9513 6 185 GO:0008028
GO:0016020
AF-A0A2V6PH11-F1-model_v4 MFS transporter 0.9396 1 224 GO:0016020
GO:0022857

Feature Viewer

pLDDT pTM Quality
85.3 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map