F491563

General Info

Members Datasets Scaffolds Average Seq Length
1198 558 1061 315

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2548876994|2550693993
Length 353
Sequence RTEGTDRTETETAAEPAKPSLTRTGMASGARAWRERIKGFGPVFGLAALCIAGTLLNGDFATVDNMMNVLTRTAFIGIIAVGMSFVIISGGIDLSVGSMAALIAGCMIFLMNRLMTGVEGVTLAPITIVVLGIAMALVLGAVFGLIHGLLITKGNIEPFIVTLGTLGIFRAFLTYLADGGALTLDGTLSDLYGPVYYTSLLGVPVPIWVFLLVAAAGALILNRTAFGRHVQAIGSNEQVARYAAIQVVRVKIITYMLVGICVGIATVLYVPRLGSATPSTGLLWELEAIAAVVVGGTALKGGEGRIIGTVIGAILLSVISNILNLTSIISVYLNAAVQGMVIIAVAFLQRGRK

Samples

Sample ID Description Type Environment
1 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
2 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
3 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
4 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
5 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
6 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
7 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
8 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
9 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
10 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
11 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
12 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
13 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
14 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
15 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
16 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
17 2515154123 Trinickia symbiotica JPY347 Isolate Nodule
18 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
19 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
20 2547132374 Acidovorax radicis N35 Isolate Unclassified
21 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
22 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
23 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
24 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
25 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
26 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
27 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
28 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
29 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
30 2643221570 Acidovorax sp. Root568 Isolate Unclassified
31 2643221596 Acidovorax sp. Root70 Isolate Unclassified
32 2643221609 Acidovorax sp. Root217 Isolate Unclassified
33 2643221611 Acidovorax sp. Root219 Isolate Unclassified
34 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
35 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
36 2643221652 Acidovorax sp. Root402 Isolate Unclassified
37 2643221658 Variovorax sp. Root411 Isolate Unclassified
38 2643221672 Variovorax sp. Root434 Isolate Unclassified
39 2643221683 Variovorax sp. Root473 Isolate Unclassified
40 2643221717 Acidovorax sp. Root267 Isolate Unclassified
41 2643221733 Bosea sp. Root381 Isolate Unclassified
42 2643221734 Bosea sp. Root670 Isolate Unclassified
43 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
44 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
45 2738541277 Variovorax sp. GV051 Isolate Unclassified
46 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
47 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
48 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
49 2738541307 Variovorax sp. GV008 Isolate Unclassified
50 2738541337 Pelomonas sp. BT06 Isolate Unclassified
51 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
52 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
53 2738543012 Acidovorax sp. CF301 Isolate Unclassified
54 2738543013 Variovorax sp. BT01 Isolate Unclassified
55 2738543019 Variovorax sp. GV040 Isolate Unclassified
56 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
57 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
58 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
59 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
60 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
61 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
62 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
63 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
64 2816332133 Acidovorax radicis 2721A Isolate Unclassified
65 2818991436 Collimonas arenae 515 Isolate Unclassified
66 2818991446 Variovorax sp. 1180 Isolate Unclassified
67 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
68 2818991450 Burkholderia sp. 604 Isolate Unclassified
69 2821131069 Duganella sp. 1224 Isolate Unclassified
70 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
71 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
72 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
73 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
74 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
75 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
76 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
77 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
78 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
79 2842677519 Variovorax sp. R-72495 Isolate Unclassified
80 2842747753 Variovorax sp. R-72060 Isolate Unclassified
81 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
82 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
83 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
84 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
85 2857558681 Duganella sp. R-74565 Isolate Unclassified
86 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
87 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
88 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
89 2885198086 Variovorax sp. 679 Isolate Unclassified
90 2885211737 Variovorax sp. 553 Isolate Unclassified
91 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
92 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
93 2897803580 Azospirillum doebereinerae GSF71 Isolate Unclassified
94 2899924645 Variovorax sp. 369 Isolate Unclassified
95 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
96 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
97 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
98 2904456579 Variovorax sp. 2002 Isolate Unclassified
99 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
100 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
101 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
102 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
103 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
104 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
105 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
106 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
107 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
108 2928037797 Variovorax sp. 1126 Isolate Unclassified
109 2928044640 Variovorax sp. 1128 Isolate Unclassified
110 2928051484 Variovorax sp. 1133 Isolate Unclassified
111 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
112 2928070936 Variovorax gossypii 1167 Isolate Unclassified
113 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
114 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
115 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
116 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
117 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
118 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
119 2929520902 Variovorax beijingensis 502 Isolate Unclassified
120 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
121 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
122 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
123 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
124 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
125 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
126 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
127 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
128 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
129 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
130 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
131 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
132 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
133 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
134 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
135 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
136 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
137 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
138 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
139 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
140 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
141 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
142 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
143 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
144 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
145 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
146 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
147 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
148 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
149 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
150 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
151 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
152 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
153 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
154 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
155 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
156 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
157 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
158 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
159 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
160 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
161 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
162 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
163 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
164 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
165 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
166 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
167 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
168 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
169 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
170 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
171 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
172 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
173 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
174 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
175 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
176 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
177 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
178 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
179 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
180 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
181 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
182 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
183 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
184 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
185 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
186 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
187 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
188 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
189 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
190 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
191 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
192 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
193 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
194 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
195 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
196 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
197 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
198 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
199 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
200 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
201 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
202 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
203 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
204 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
205 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
206 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
207 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
208 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
209 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
210 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
211 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
212 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
213 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
214 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
215 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
216 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
217 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
218 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
219 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
220 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
221 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
222 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
223 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
224 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
225 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
226 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
227 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
228 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
229 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
230 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
231 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
232 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
233 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
234 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
235 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
236 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
237 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
238 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
239 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
240 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
241 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
242 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
243 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
244 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
245 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
246 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
247 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
248 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
249 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
250 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
251 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
252 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
253 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
254 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
255 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
256 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
257 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
258 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
259 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
260 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
261 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
262 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
263 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
264 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
265 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
266 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
267 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
268 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
269 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
270 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
271 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
272 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
273 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
274 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
275 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
276 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
277 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
278 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
279 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
280 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
281 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
282 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
283 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
284 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
285 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
286 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
287 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
288 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
289 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
290 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
291 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
292 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
293 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
294 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
295 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
296 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
297 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
298 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
299 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
300 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
301 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
302 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
303 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
304 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
305 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
306 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
307 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
308 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
309 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
310 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
311 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
312 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
313 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
314 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
315 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
316 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
317 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
318 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
319 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
320 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
321 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
322 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
323 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
324 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
325 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
326 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
327 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
328 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
329 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
330 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
331 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
332 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
333 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
334 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
335 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
336 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
337 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
338 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
339 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
340 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
341 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
342 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
343 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
344 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
345 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
346 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
347 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
348 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
349 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
350 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
351 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
352 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
353 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
354 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
355 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
356 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
357 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
358 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
359 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
360 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
361 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
362 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
363 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
364 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
365 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
366 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
367 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
368 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
369 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
370 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
371 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
372 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
373 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
374 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
375 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
376 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
377 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
378 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
379 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
380 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
381 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
382 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
383 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
384 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
385 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
386 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
387 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
388 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
389 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
390 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
391 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
392 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
393 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
394 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
395 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
396 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
397 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
398 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
399 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
400 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
401 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
402 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
403 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
404 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
405 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
406 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
407 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
408 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
409 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
410 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
411 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
412 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
413 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
414 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
415 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
416 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
417 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
418 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
419 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
420 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
421 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
422 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
423 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
424 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
425 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
426 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
427 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
428 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
429 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
430 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
431 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
432 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
433 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
434 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
435 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
436 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
437 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
438 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
439 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
440 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
441 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
442 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
443 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
444 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
445 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
446 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
447 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
448 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
449 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
450 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
451 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
452 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
453 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
454 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
455 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
456 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
457 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
458 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
459 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
460 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
461 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
462 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
463 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
464 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
465 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
466 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
467 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
468 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
469 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
470 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
471 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
472 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
473 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
474 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
475 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
476 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
477 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
478 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
479 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
480 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
481 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
482 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
483 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
484 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
485 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
486 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
487 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
488 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
489 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
490 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
491 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
492 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
493 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
494 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
495 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
496 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
497 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
498 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
499 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
500 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
501 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
502 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
503 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
504 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
505 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
506 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
507 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
508 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
509 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
510 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
511 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
512 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
513 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
514 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
515 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
516 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
517 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
518 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
519 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
520 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
521 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
522 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
523 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
524 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
525 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
526 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
527 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
528 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
529 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
530 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
531 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
532 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
533 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
534 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
535 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
536 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
537 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
538 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
539 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
540 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
541 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
542 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
543 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
544 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
545 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
546 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
547 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
548 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
549 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
550 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
551 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
552 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
553 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
554 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere
555 8054002106 Azospirillum lipoferum 59b Isolate Unclassified
556 8055087960 Silvania hatchlandensis H19S6 Isolate Rhizosphere
557 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
558 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 88.4
Metatranscriptomes 0.08
Isolates 11.52

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 23.54
Nodule 2.34
Rhizoplane 3.92
Rhizosphere 53.84
Stem 0
Stem Tuber 0
Unclassified 16.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10016743 3300001979 Bacteria 2640
2 JGI24739J22299_10001637 3300001989 Bacteria 8502
3 JGI24739J22299_10014446 3300001989 Bacteria 2873
4 JGI24735J21928_10022052 3300002067 Bacteria 1941
5 JGI25155J39150_1000033 3300002704 Bacteria 105391
6 JGI25156J39149_1000016 3300002705 Bacteria 178691
7 JGI25156J39149_1000043 3300002705 Bacteria 105452
8 JGI25156J39149_1000061 3300002705 Bacteria 84583
9 JGI25156J39149_1000882 3300002705 Bacteria 14856
10 JGI25156J39149_1001290 3300002705 Bacteria 10880
11 JGI25156J39149_1003392 3300002705 Bacteria 5239
12 JGI25162J39368_1000015 3300002737 Bacteria 316381
13 JGI25154J39366_1000062 3300002738 Bacteria 105525
14 JGI25154J39366_1002417 3300002738 Bacteria 4863
15 JGI25158J39367_1008974 3300002739 Bacteria 1378
16 JGI25157J39369_1000035 3300002741 Bacteria 136011
17 JGI25157J39369_1000060 3300002741 Bacteria 105525
18 JGI25163J39215_1002258 3300002771 Bacteria 2121
19 JGI25150J39212_1002533 3300002774 Bacteria 4510
20 JGI25150J39212_1004666 3300002774 Bacteria 3017
21 JGI25151J46595_10000122 3300003187 Bacteria 106087
22 JGI25151J46595_10003086 3300003187 Bacteria 9389
23 JGI25151J46595_10008314 3300003187 Bacteria 4999
24 JGI25151J46595_10009274 3300003187 Bacteria 4673
25 JGI25165J46597_1000001 3300003214 Bacteria 1111887
26 JGI25165J46597_1001015 3300003214 Bacteria 18509
27 JGI25153J46596_10011532 3300003215 Bacteria 3897
28 rootH1_10147247 3300003316 Bacteria 1351
29 rootH1_10147247 3300003323 Bacteria 7226
30 rootH2_10013344 3300003320 Bacteria 2769
31 rootL2_10098720 3300003322 Bacteria 2886
32 rootH1_10025674 3300003323 Bacteria 3695
33 JGI25160J50197_1000174 3300003354 Bacteria 54817
34 JGI25160J50197_1000197 3300003354 Bacteria 50744
35 JGI25160J50197_1000647 3300003354 Bacteria 19376
36 JGI25161J50226_1000057 3300003374 Bacteria 102462
37 Ga0006562J51391_1213428 3300003578 Bacteria 2097
38 Ga0055538_1000001 3300003751 Bacteria 1111887
39 Ga0055539_1000001 3300003752 Bacteria 1111887
40 Ga0055533_1000003 3300003756 Bacteria 1111887
41 Ga0055533_1000489 3300003756 Bacteria 14653
42 Ga0055533_1000969 3300003756 Bacteria 8429
43 Ga0055532_1000001 3300003758 Bacteria 1119836
44 Ga0055525_1000013 3300003759 Bacteria 440870
45 Ga0055525_1000087 3300003759 Bacteria 149803
46 Ga0055527_1000002 3300003760 Bacteria 830488
47 Ga0055535_1000001 3300003761 Bacteria 1119836
48 Ga0055535_1001051 3300003761 Bacteria 17246
49 Ga0055542_1000001 3300003762 Bacteria 1119836
50 Ga0055542_1000058 3300003762 Bacteria 162781
51 Ga0055529_1000001 3300003763 Bacteria 826680
52 Ga0055526_1000151 3300003771 Bacteria 61441
53 Ga0055526_1000495 3300003771 Bacteria 31316
54 Ga0055526_1005767 3300003771 Bacteria 6982
55 Ga0055537_1000319 3300003773 Bacteria 32834
56 Ga0055537_1000817 3300003773 Bacteria 15354
57 Ga0055537_1014032 3300003773 Bacteria 1472
58 Ga0055524_1000136 3300003775 Bacteria 87249
59 Ga0055524_1000357 3300003775 Bacteria 41402
60 Ga0055536_1006712 3300003781 Bacteria 5289
61 Ga0055536_1023046 3300003781 Bacteria 1841
62 Ga0055534_1000242 3300003784 Bacteria 38891
63 Ga0055534_1003074 3300003784 Bacteria 5443
64 Ga0055534_1014713 3300003784 Bacteria 1456
65 Ga0055528_1001087 3300003790 Bacteria 17883
66 Ga0055528_1004884 3300003790 Bacteria 6345
67 Ga0055530_10000826 3300003791 Bacteria 25589
68 Ga0055530_10001026 3300003791 Bacteria 22224
69 Ga0055530_10009983 3300003791 Bacteria 3571
70 Ga0055530_10018699 3300003791 Bacteria 2126
71 Ga0055540_1000028 3300003792 Bacteria 184864
72 Ga0055540_1000470 3300003792 Bacteria 31110
73 Ga0055540_1005520 3300003792 Bacteria 5289
74 Ga0055540_1008149 3300003792 Bacteria 3817
75 Ga0055540_1019275 3300003792 Bacteria 1841
76 Ga0055531_10000064 3300003794 Bacteria 117923
77 Ga0055531_10000205 3300003794 Bacteria 65042
78 Ga0055531_10002661 3300003794 Bacteria 11777
79 Ga0055531_10029657 3300003794 Bacteria 1858
80 Ga0055541_1000001 3300003841 Bacteria 1111887
81 Ga0055543_1000498 3300004625 Bacteria 22690
82 Ga0055543_1002109 3300004625 Bacteria 6902
83 Ga0065165_1000791 3300005262 Bacteria 42372
84 Ga0065165_1004071 3300005262 Bacteria 9481
85 Ga0065165_1010720 3300005262 Bacteria 3920
86 Ga0065165_1020630 3300005262 Bacteria 2313
87 Ga0065165_1020632 3300005262 Bacteria 2313
88 Ga0065165_1022702 3300005262 Bacteria 2143
89 Ga0065704_10088182 3300005289 Bacteria 2960
90 Ga0070658_10093830 3300005327 Bacteria 2475
91 Ga0070683_100057127 3300005329 Bacteria 3625
92 Ga0068869_100036273 3300005334 Bacteria 3501
93 Ga0070666_10050880 3300005335 Bacteria 2788
94 Ga0068868_100100780 3300005338 Bacteria 2337
95 Ga0068868_100240973 3300005338 Bacteria 1519
96 Ga0070660_100012288 3300005339 Bacteria 6111
97 Ga0070660_100092840 3300005339 Bacteria 2382
98 Ga0070660_100292691 3300005339 Bacteria 1334
99 Ga0070675_100005423 3300005354 Bacteria 9751
100 Ga0070674_100019489 3300005356 Bacteria 4309
101 Ga0070673_100011126 3300005364 Bacteria 6135
102 Ga0070673_100255491 3300005364 Bacteria 1529
103 Ga0070659_100206341 3300005366 Bacteria 1619
104 Ga0070667_100042983 3300005367 Bacteria 3791
105 Ga0070667_100148601 3300005367 Bacteria 2057
106 Ga0070667_100149683 3300005367 Bacteria 2049
107 Ga0070667_100204052 3300005367 Bacteria 1755
108 Ga0070663_100204492 3300005455 Bacteria 1543
109 Ga0070663_100247658 3300005455 Bacteria 1409
110 Ga0070678_100026622 3300005456 Bacteria 3913
111 Ga0070678_100210011 3300005456 Bacteria 1612
112 Ga0068867_100000091 3300005459 Bacteria 57689
113 Ga0068867_100002311 3300005459 Bacteria 13412
114 Ga0068867_100026632 3300005459 Bacteria 4152
115 Ga0068867_100241004 3300005459 Bacteria 1466
116 Ga0070706_100004768 3300005467 Bacteria 13003
117 Ga0070707_100221038 3300005468 Bacteria 1845
118 Ga0070697_100035168 3300005536 Bacteria 4040
119 Ga0068853_100028550 3300005539 Bacteria 4693
120 Ga0070672_100277279 3300005543 Bacteria 1417
121 Ga0068855_100115801 3300005563 Bacteria 3072
122 Ga0068857_100000256 3300005577 Bacteria 35821
123 Ga0068857_100004760 3300005577 Bacteria 11491
124 Ga0068857_100107797 3300005577 Bacteria 2502
125 Ga0068857_100226260 3300005577 Bacteria 1710
126 Ga0068854_100016612 3300005578 Bacteria 4911
127 Ga0068856_100001897 3300005614 Bacteria 21785
128 Ga0068856_100090668 3300005614 Bacteria 3041
129 Ga0068852_100007764 3300005616 Bacteria 7853
130 Ga0068852_100068777 3300005616 Bacteria 3101
131 Ga0068859_100086026 3300005617 Bacteria 3190
132 Ga0068851_10025724 3300005834 Bacteria 2888
133 Ga0068863_100080378 3300005841 Bacteria 3087
134 Ga0068860_100463612 3300005843 Bacteria 1261
135 Ga0068862_100079112 3300005844 Bacteria 2849
136 Ga0081538_10047708 3300005981 Bacteria 2623
137 Ga0075365_10081106 3300006038 Bacteria 2197
138 Ga0075365_10173598 3300006038 Bacteria 1505
139 Ga0075368_10030283 3300006042 Bacteria 2095
140 Ga0075368_10054919 3300006042 Bacteria 1588
141 Ga0075364_10014350 3300006051 Bacteria 4895
142 Ga0075362_10031180 3300006177 Bacteria 2306
143 Ga0075362_10054016 3300006177 Bacteria 1804
144 Ga0075362_10069152 3300006177 Bacteria 1609
145 Ga0075362_10103174 3300006177 Bacteria 1335
146 Ga0075367_10010462 3300006178 Bacteria 4874
147 Ga0075367_10039570 3300006178 Bacteria 2749
148 Ga0075367_10161888 3300006178 Bacteria 1392
149 Ga0075366_10006347 3300006195 Bacteria 6474
150 Ga0075366_10009989 3300006195 Bacteria 5317
151 Ga0075366_10017601 3300006195 Bacteria 4115
152 Ga0075366_10032100 3300006195 Bacteria 3091
153 Ga0075366_10078359 3300006195 Bacteria 1972
154 Ga0075366_10105277 3300006195 Bacteria 1695
155 Ga0075366_10173047 3300006195 Bacteria 1310
156 Ga0097621_100199414 3300006237 Bacteria 1737
157 Ga0075370_10002879 3300006353 Bacteria 8076
158 Ga0075370_10003685 3300006353 Bacteria 7335
159 Ga0075370_10023293 3300006353 Bacteria 3408
160 Ga0075370_10026605 3300006353 Bacteria 3205
161 Ga0075370_10027536 3300006353 Bacteria 3154
162 Ga0075370_10072776 3300006353 Bacteria 1967
163 Ga0075370_10073758 3300006353 Bacteria 1955
164 Ga0097620_100086025 3300006931 Bacteria 3190
165 Ga0079104_1000092 3300006946 Bacteria 130657
166 Ga0079104_1011351 3300006946 Bacteria 2869
167 Ga0105251_10000617 3300009011 Bacteria 32661
168 Ga0105251_10001178 3300009011 Bacteria 22690
169 Ga0105244_10156003 3300009036 Bacteria 1092
170 Ga0105240_10014030 3300009093 Bacteria 10960
171 Ga0105240_10118017 3300009093 Bacteria 3198
172 Ga0105240_10218080 3300009093 Bacteria 2224
173 Ga0105240_10222295 3300009093 Bacteria 2199
174 Ga0105245_10014457 3300009098 Bacteria 6875
175 Ga0105245_10016331 3300009098 Bacteria 6473
176 Ga0105245_10438790 3300009098 Bacteria 1312
177 Ga0105243_10000498 3300009148 Bacteria 40115
178 Ga0105243_10000959 3300009148 Bacteria 26971
179 Ga0105243_10020522 3300009148 Bacteria 5009
180 Ga0105243_10058998 3300009148 Bacteria 3060
181 Ga0105241_10005426 3300009174 Bacteria 9429
182 Ga0105248_10030408 3300009177 Bacteria 6029
183 Ga0105237_10005096 3300009545 Bacteria 14914
184 Ga0105237_10006019 3300009545 Bacteria 13573
185 Ga0105237_10063207 3300009545 Bacteria 3699
186 Ga0105237_10358218 3300009545 Bacteria 1463
187 Ga0105237_10422911 3300009545 Bacteria 1338
188 Ga0105239_10012755 3300010375 Bacteria 9350
189 Ga0105239_10098272 3300010375 Bacteria 3236
190 Ga0105246_10214561 3300011119 Bacteria 1504
191 Ga0157347_1003135 3300012502 Bacteria 1463
192 Ga0157371_10037093 3300013102 Bacteria 3490
193 Ga0157369_10007721 3300013105 Bacteria 12373
194 Ga0157369_10013980 3300013105 Bacteria 9071
195 Ga0157369_10060390 3300013105 Bacteria 4088
196 Ga0171462_1011 3300013250 Bacteria 229282
197 Ga0163162_10011338 3300013306 Bacteria 8691
198 Ga0163162_10012831 3300013306 Bacteria 8184
199 Ga0157372_10046561 3300013307 Bacteria 4815
200 Ga0157375_10017976 3300013308 Bacteria 6401
201 Ga0157375_10071844 3300013308 Bacteria 3475
202 Ga0157375_10084577 3300013308 Bacteria 3221
203 Ga0182008_10000041 3300014497 Bacteria 118254
204 Ga0182008_10001609 3300014497 Bacteria 14989
205 Ga0182008_10001649 3300014497 Bacteria 14746
206 Ga0182008_10001984 3300014497 Bacteria 13141
207 Ga0182008_10013213 3300014497 Bacteria 4342
208 Ga0182008_10018088 3300014497 Bacteria 3651
209 Ga0157377_10000107 3300014745 Bacteria 57351
210 Ga0157379_10015233 3300014968 Bacteria 6743
211 Ga0157376_10027690 3300014969 Bacteria 4496
212 Ga0182006_1000007 3300015261 Bacteria 452190
213 Ga0182006_1049829 3300015261 Bacteria 1615
214 Ga0182007_10000120 3300015262 Bacteria 54341
215 Ga0182007_10000498 3300015262 Bacteria 23393
216 Ga0182007_10000887 3300015262 Bacteria 16604
217 Ga0182007_10005885 3300015262 Bacteria 5327
218 Ga0182007_10011720 3300015262 Bacteria 3402
219 Ga0182007_10013984 3300015262 Bacteria 3041
220 Ga0182005_1000010 3300015265 Bacteria 434103
221 Ga0182005_1002485 3300015265 Bacteria 6558
222 Ga0183362_10007 3300015683 Bacteria 240101
223 Ga0183361_10018 3300016635 Bacteria 133279
224 Ga0163161_10041696 3300017792 Bacteria 3299
225 Ga0163161_10117077 3300017792 Bacteria 1998
226 Ga0163161_10122710 3300017792 Bacteria 1954
227 Ga0213872_10000085 3300021361 Bacteria 85496
228 Ga0213872_10078626 3300021361 Bacteria 1482
229 Ga0213876_10020395 3300021384 Bacteria 3503
230 Ga0209435_100041 3300025206 Bacteria 105577
231 Ga0209760_101328 3300025207 Bacteria 2673
232 Ga0209436_105057 3300025208 Bacteria 3114
233 Ga0209784_100004 3300025224 Bacteria 1378156
234 Ga0209566_100004 3300025225 Bacteria 1531866
235 Ga0209674_100005 3300025226 Bacteria 1708125
236 Ga0209674_100006 3300025226 Bacteria 1531866
237 Ga0209674_100130 3300025226 Bacteria 119638
238 Ga0209672_100001 3300025228 Bacteria 2828210
239 Ga0209672_101203 3300025228 Bacteria 10493
240 Ga0209147_100001 3300025229 Bacteria 2384371
241 Ga0209147_100602 3300025229 Bacteria 19757
242 Ga0209563_100009 3300025230 Bacteria 1378156
243 Ga0209563_100025 3300025230 Bacteria 596456
244 Ga0209563_101174 3300025230 Bacteria 7358
245 Ga0207427_100973 3300025231 Bacteria 12148
246 Ga0207427_103818 3300025231 Bacteria 2887
247 Ga0209437_100004 3300025233 Bacteria 1378156
248 Ga0209258_100001 3300025242 Bacteria 2384269
249 Ga0209258_100147 3300025242 Bacteria 162823
250 Ga0209258_100740 3300025242 Bacteria 21151
251 Ga0207425_1000231 3300025245 Bacteria 43311
252 Ga0207425_1000519 3300025245 Bacteria 23496
253 Ga0207425_1003429 3300025245 Bacteria 5079
254 Ga0209646_1000056 3300025246 Bacteria 269860
255 Ga0209646_1000144 3300025246 Bacteria 105691
256 Ga0209026_1000009 3300025250 Bacteria 531812
257 Ga0209026_1000159 3300025250 Bacteria 105691
258 Ga0209677_100005 3300025253 Bacteria 1378156
259 Ga0209677_100198 3300025253 Bacteria 48090
260 Ga0209677_101314 3300025253 Bacteria 10984
261 Ga0209677_101436 3300025253 Bacteria 10295
262 Ga0209148_1000003 3300025254 Bacteria 2384288
263 Ga0209148_1000122 3300025254 Bacteria 186071
264 Ga0209759_1000001 3300025256 Bacteria 2799452
265 Ga0209759_1000033 3300025256 Bacteria 276117
266 Ga0209759_1000035 3300025256 Bacteria 264254
267 Ga0209759_1000228 3300025256 Bacteria 84202
268 Ga0209759_1000465 3300025256 Bacteria 45798
269 Ga0209129_1000075 3300025258 Bacteria 201273
270 Ga0209129_1000177 3300025258 Bacteria 93081
271 Ga0209129_1002205 3300025258 Bacteria 9789
272 Ga0209233_1000005 3300025261 Bacteria 1531866
273 Ga0209233_1000016 3300025261 Bacteria 907830
274 Ga0209233_1001484 3300025261 Bacteria 9239
275 Ga0209565_1000101 3300025263 Bacteria 129092
276 Ga0209565_1000129 3300025263 Bacteria 108787
277 Ga0209565_1001622 3300025263 Bacteria 9495
278 Ga0209565_1002873 3300025263 Bacteria 5918
279 Ga0209455_1000001 3300025272 Bacteria 2384278
280 Ga0209455_1001975 3300025272 Bacteria 8429
281 Ga0209673_1000247 3300025273 Bacteria 102817
282 Ga0209673_1000377 3300025273 Bacteria 80360
283 Ga0209673_1000507 3300025273 Bacteria 64168
284 Ga0209673_1000687 3300025273 Bacteria 48530
285 Ga0209673_1008927 3300025273 Bacteria 4405
286 Ga0209673_1026034 3300025273 Bacteria 1931
287 Ga0209130_1000146 3300025284 Bacteria 111777
288 Ga0209130_1000397 3300025284 Bacteria 47584
289 Ga0209130_1000420 3300025284 Bacteria 45713
290 Ga0209130_1002393 3300025284 Bacteria 9489
291 Ga0209130_1004368 3300025284 Bacteria 5405
292 Ga0209130_1007554 3300025284 Bacteria 3334
293 Ga0209675_1000093 3300025291 Bacteria 140158
294 Ga0209675_1000121 3300025291 Bacteria 107684
295 Ga0209675_1000571 3300025291 Bacteria 26587
296 Ga0209675_1000738 3300025291 Bacteria 22132
297 Ga0209675_1001181 3300025291 Bacteria 15851
298 Ga0209675_1005679 3300025291 Bacteria 5154
299 Ga0209676_1000073 3300025292 Bacteria 305947
300 Ga0209676_1000202 3300025292 Bacteria 133078
301 Ga0209676_1000375 3300025292 Bacteria 82420
302 Ga0209676_1004539 3300025292 Bacteria 7694
303 Ga0209676_1005554 3300025292 Bacteria 6531
304 Ga0209676_1022953 3300025292 Bacteria 2052
305 Ga0209025_1000014 3300025294 Bacteria 865448
306 Ga0209025_1000285 3300025294 Bacteria 114575
307 Ga0209025_1000322 3300025294 Bacteria 106667
308 Ga0209025_1000359 3300025294 Bacteria 97475
309 Ga0209025_1003535 3300025294 Bacteria 14655
310 Ga0209025_1003575 3300025294 Bacteria 14532
311 Ga0209025_1009702 3300025294 Bacteria 6654
312 Ga0209025_1019113 3300025294 Bacteria 3829
313 Ga0209025_1065955 3300025294 Bacteria 1318
314 Ga0209564_1000046 3300025295 Bacteria 373787
315 Ga0209564_1000074 3300025295 Bacteria 286043
316 Ga0209564_1000077 3300025295 Bacteria 281592
317 Ga0209564_1000223 3300025295 Bacteria 128117
318 Ga0209564_1000226 3300025295 Bacteria 125693
319 Ga0209564_1000798 3300025295 Bacteria 43280
320 Ga0209564_1001300 3300025295 Bacteria 26937
321 Ga0209564_1008950 3300025295 Bacteria 4850
322 Ga0209564_1013325 3300025295 Bacteria 3505
323 Ga0209564_1030788 3300025295 Bacteria 1655
324 Ga0209758_1000052 3300025297 Bacteria 338962
325 Ga0209758_1000142 3300025297 Bacteria 171779
326 Ga0209758_1003916 3300025297 Bacteria 12991
327 Ga0209758_1008904 3300025297 Bacteria 6371
328 Ga0209758_1022630 3300025297 Bacteria 2872
329 Ga0209050_1000008 3300025298 Bacteria 1144179
330 Ga0209050_1000224 3300025298 Bacteria 125433
331 Ga0209050_1000282 3300025298 Bacteria 108629
332 Ga0209050_1001483 3300025298 Bacteria 24977
333 Ga0209050_1006558 3300025298 Bacteria 6839
334 Ga0209050_1007070 3300025298 Bacteria 6432
335 Ga0209050_1009234 3300025298 Bacteria 5087
336 Ga0209256_1000015 3300025299 Bacteria 622953
337 Ga0209256_1000057 3300025299 Bacteria 281592
338 Ga0209256_1000109 3300025299 Bacteria 184928
339 Ga0209256_1000114 3300025299 Bacteria 173999
340 Ga0209256_1000168 3300025299 Bacteria 132040
341 Ga0209256_1000174 3300025299 Bacteria 128117
342 Ga0209256_1026192 3300025299 Bacteria 1685
343 Ga0207426_1000162 3300025302 Bacteria 172643
344 Ga0207426_1000232 3300025302 Bacteria 128117
345 Ga0207426_1000291 3300025302 Bacteria 99437
346 Ga0207426_1000305 3300025302 Bacteria 96172
347 Ga0207426_1001322 3300025302 Bacteria 21125
348 Ga0207426_1009659 3300025302 Bacteria 3798
349 Ga0209051_1000005 3300025303 Bacteria 1142353
350 Ga0209051_1000022 3300025303 Bacteria 474879
351 Ga0209051_1000112 3300025303 Bacteria 152667
352 Ga0209051_1000313 3300025303 Bacteria 75138
353 Ga0209051_1000530 3300025303 Bacteria 47308
354 Ga0209051_1000825 3300025303 Bacteria 32073
355 Ga0209051_1008706 3300025303 Bacteria 5339
356 Ga0209051_1008992 3300025303 Bacteria 5202
357 Ga0209051_1019490 3300025303 Bacteria 2957
358 Ga0209051_1024449 3300025303 Bacteria 2484
359 Ga0209257_1000030 3300025304 Bacteria 689812
360 Ga0209257_1000031 3300025304 Bacteria 688770
361 Ga0209257_1000094 3300025304 Bacteria 262243
362 Ga0209257_1000163 3300025304 Bacteria 175355
363 Ga0209257_1000165 3300025304 Bacteria 172773
364 Ga0209257_1001005 3300025304 Bacteria 38141
365 Ga0209257_1007081 3300025304 Bacteria 6923
366 Ga0209257_1009911 3300025304 Bacteria 4964
367 Ga0209257_1010885 3300025304 Bacteria 4498
368 Ga0209257_1030880 3300025304 Bacteria 1722
369 Ga0207656_10009374 3300025321 Bacteria 3636
370 Ga0207655_1005293 3300025728 Bacteria 8840
371 Ga0207713_1000657 3300025735 Bacteria 32973
372 Ga0207713_1002163 3300025735 Bacteria 14589
373 Ga0207680_10042760 3300025903 Bacteria 2653
374 Ga0207647_10042957 3300025904 Bacteria 2832
375 Ga0207645_10003304 3300025907 Bacteria 12301
376 Ga0207705_10211929 3300025909 Bacteria 1469
377 Ga0207684_10003169 3300025910 Bacteria 16179
378 Ga0207654_10007306 3300025911 Bacteria 5567
379 Ga0207695_10003858 3300025913 Bacteria 20746
380 Ga0207695_10008374 3300025913 Bacteria 12954
381 Ga0207695_10149896 3300025913 Bacteria 2272
382 Ga0207695_10175061 3300025913 Bacteria 2068
383 Ga0207671_10008167 3300025914 Bacteria 8928
384 Ga0207671_10014342 3300025914 Bacteria 6269
385 Ga0207662_10029543 3300025918 Bacteria 3177
386 Ga0207657_10049644 3300025919 Bacteria 3654
387 Ga0207659_10013438 3300025926 Bacteria 5244
388 Ga0207687_10015088 3300025927 Bacteria 5060
389 Ga0207687_10345362 3300025927 Bacteria 1211
390 Ga0207644_10041883 3300025931 Bacteria 3242
391 Ga0207690_10032557 3300025932 Bacteria 3346
392 Ga0207706_10028752 3300025933 Bacteria 4962
393 Ga0207706_10153984 3300025933 Bacteria 2022
394 Ga0207709_10001027 3300025935 Bacteria 20640
395 Ga0207709_10001062 3300025935 Bacteria 20280
396 Ga0207709_10001119 3300025935 Bacteria 19668
397 Ga0207709_10031238 3300025935 Bacteria 3109
398 Ga0207709_10032806 3300025935 Bacteria 3044
399 Ga0207709_10038894 3300025935 Bacteria 2837
400 Ga0207669_10025763 3300025937 Bacteria 3185
401 Ga0207691_10013517 3300025940 Bacteria 7808
402 Ga0207691_10081100 3300025940 Bacteria 2917
403 Ga0207689_10008815 3300025942 Bacteria 8767
404 Ga0207689_10029679 3300025942 Bacteria 4564
405 Ga0207689_10100722 3300025942 Bacteria 2373
406 Ga0207679_10009037 3300025945 Bacteria 6367
407 Ga0207679_10036113 3300025945 Bacteria 3502
408 Ga0207667_10008701 3300025949 Bacteria 12031
409 Ga0207667_10220285 3300025949 Bacteria 1944
410 Ga0207651_10000994 3300025960 Bacteria 12521
411 Ga0207640_10049897 3300025981 Bacteria 2712
412 Ga0207658_10188793 3300025986 Bacteria 1711
413 Ga0207677_10021197 3300026023 Bacteria 3965
414 Ga0207677_10021712 3300026023 Bacteria 3928
415 Ga0207677_10034528 3300026023 Bacteria 3275
416 Ga0207639_10014825 3300026041 Bacteria 5490
417 Ga0207639_10029823 3300026041 Bacteria 3998
418 Ga0207639_10155731 3300026041 Bacteria 1919
419 Ga0207678_10075790 3300026067 Bacteria 2881
420 Ga0207678_10236650 3300026067 Bacteria 1564
421 Ga0207678_10368978 3300026067 Bacteria 1240
422 Ga0207702_10003989 3300026078 Bacteria 13252
423 Ga0207702_10050981 3300026078 Bacteria 3495
424 Ga0207641_10143644 3300026088 Bacteria 2156
425 Ga0207648_10000227 3300026089 Bacteria 60175
426 Ga0207648_10004518 3300026089 Bacteria 14261
427 Ga0207648_10105529 3300026089 Bacteria 2472
428 Ga0207674_10000776 3300026116 Bacteria 41629
429 Ga0207674_10013402 3300026116 Bacteria 9100
430 Ga0207674_10053815 3300026116 Bacteria 4101
431 Ga0207674_10157864 3300026116 Bacteria 2223
432 Ga0207675_100367024 3300026118 Bacteria 1413
433 Ga0207683_10025776 3300026121 Bacteria 5072
434 Ga0207683_10041319 3300026121 Bacteria 4026
435 Ga0207683_10289375 3300026121 Bacteria 1498
436 Ga0207683_10326069 3300026121 Bacteria 1407
437 Ga0207698_10005288 3300026142 Bacteria 7947
438 Ga0207698_10057110 3300026142 Bacteria 3017
439 Ga0209281_1000083 3300027111 Bacteria 255034
440 Ga0209970_1000086 3300027614 Bacteria 12889
441 Ga0209970_1000943 3300027614 Bacteria 5148
442 Ga0209813_10030952 3300027866 Bacteria 1576
443 Ga0209974_10000862 3300027876 Bacteria 10457
444 Ga0209974_10016630 3300027876 Bacteria 2442
445 Ga0268266_10195356 3300028379 Bacteria 1849
446 Ga0268265_10361858 3300028380 Bacteria 1328
447 Ga0268264_10014275 3300028381 Bacteria 6530
448 Ga0268264_10373114 3300028381 Bacteria 1364
449 Ga0307517_10001409 3300028786 Bacteria 40436
450 Ga0307517_10065455 3300028786 Bacteria 3362
451 Ga0307515_10000011 3300028794 Bacteria 633903
452 Ga0307515_10001329 3300028794 Bacteria 56020
453 Ga0307515_10009575 3300028794 Bacteria 18715
454 Ga0307515_10041055 3300028794 Bacteria 7291
455 Ga0307515_10275226 3300028794 Bacteria 1398
456 Ga0307512_10091691 3300030522 Bacteria 2112
457 Ga0316182_1075645 3300030745 Bacteria 3133
458 Ga0265331_10000857 3300031250 Bacteria 24739
459 Ga0265327_10001107 3300031251 Bacteria 37348
460 Ga0265327_10019215 3300031251 Bacteria 4209
461 Ga0307513_10000028 3300031456 Bacteria 193264
462 Ga0307513_10000266 3300031456 Bacteria 75947
463 Ga0307513_10004550 3300031456 Bacteria 18498
464 Ga0307513_10015242 3300031456 Bacteria 9329
465 Ga0307513_10104602 3300031456 Bacteria 2843
466 Ga0307513_10150807 3300031456 Bacteria 2234
467 Ga0307513_10368732 3300031456 Bacteria 1179
468 Ga0307509_10000139 3300031507 Bacteria 108589
469 Ga0307509_10029387 3300031507 Bacteria 6100
470 Ga0307509_10037712 3300031507 Bacteria 5281
471 Ga0307509_10267153 3300031507 Bacteria 1481
472 Ga0307408_100000599 3300031548 Bacteria 30998
473 Ga0307408_100003558 3300031548 Bacteria 10619
474 Ga0307408_100006968 3300031548 Bacteria 7479
475 Ga0307408_100007085 3300031548 Bacteria 7419
476 Ga0307408_100054610 3300031548 Bacteria 2888
477 Ga0307408_100095846 3300031548 Bacteria 2249
478 Ga0307408_100104914 3300031548 Bacteria 2160
479 Ga0307508_10000134 3300031616 Bacteria 87501
480 Ga0307508_10001986 3300031616 Bacteria 22354
481 Ga0307508_10060334 3300031616 Bacteria 3354
482 Ga0307508_10197624 3300031616 Bacteria 1612
483 Ga0307514_10000591 3300031649 Bacteria 68125
484 Ga0307514_10004921 3300031649 Bacteria 12144
485 Ga0307514_10046896 3300031649 Bacteria 3375
486 Ga0307516_10000286 3300031730 Bacteria 65447
487 Ga0307516_10001755 3300031730 Bacteria 29838
488 Ga0307516_10002748 3300031730 Bacteria 23188
489 Ga0307516_10018416 3300031730 Bacteria 7257
490 Ga0307516_10037428 3300031730 Bacteria 4851
491 Ga0307516_10166065 3300031730 Bacteria 1952
492 Ga0307516_10186649 3300031730 Bacteria 1803
493 Ga0307516_10227182 3300031730 Bacteria 1572
494 Ga0307405_10018954 3300031731 Bacteria 3810
495 Ga0307410_10020608 3300031852 Bacteria 4037
496 Ga0307406_10000237 3300031901 Bacteria 33519
497 Ga0307406_10000353 3300031901 Bacteria 26800
498 Ga0307406_10002450 3300031901 Bacteria 10106
499 Ga0307407_10123889 3300031903 Bacteria 1643
500 Ga0307412_10000005 3300031911 Bacteria 526194
501 Ga0307412_10010644 3300031911 Bacteria 5301
502 Ga0307412_10061461 3300031911 Bacteria 2525
503 Ga0307412_10081851 3300031911 Bacteria 2234
504 Ga0307412_10161221 3300031911 Bacteria 1666
505 Ga0307409_100325294 3300031995 Bacteria 1441
506 Ga0307416_100039228 3300032002 Bacteria 3664
507 Ga0307414_10106341 3300032004 Bacteria 2124
508 Ga0307414_10229291 3300032004 Bacteria 1530
509 Ga0307411_10036705 3300032005 Bacteria 3073
510 Ga0307510_10022476 3300033180 Bacteria 7325
511 Ga0373937_0287320 3300036401 Bacteria 1554
512 Ga0395899_0005957 3300037312 Bacteria 9468
513 Ga0395900_0046473 3300037418 Bacteria 4470
514 Ga0395900_0048413 3300037418 Bacteria 4378
515 Ga0395900_0335921 3300037418 Bacteria 1487
516 Ga0395898_0037327 3300037466 Bacteria 4821
517 Ga0395898_0104090 3300037466 Bacteria 2722
518 Ga0395898_0160706 3300037466 Bacteria 2148
519 Ga0395905_0000012 3300037471 Bacteria 420861
520 Ga0395905_0026258 3300037471 Bacteria 5491
521 Ga0395905_0204297 3300037471 Bacteria 1852
522 Ga0395905_0290996 3300037471 Bacteria 1520
523 Ga0395901_0002457 3300038443 Bacteria 18789
524 Ga0395901_0143198 3300038443 Bacteria 2512
525 Ga0395901_0239084 3300038443 Bacteria 1894
526 Ga0436365_0180902 3300039437 Bacteria 2332
527 Ga0436365_0310708 3300039437 Bacteria 3569
528 Ga0436361_0019641 3300039447 Bacteria 127735
529 Ga0436361_1151691 3300039447 Bacteria 5239
530 Ga0436363_1102872 3300039450 Bacteria 1225
531 Ga0439436_0001754 3300041404 Bacteria 6363
532 Ga0439436_0004464 3300041404 Bacteria 4289
533 Ga0439436_0030141 3300041404 Bacteria 1577
534 Ga0439447_011372 3300041407 Bacteria 2600
535 Ga0439461_0009786 3300041410 Bacteria 1746
536 Ga0439461_0010908 3300041410 Bacteria 1677
537 Ga0439466_0011171 3300041411 Bacteria 3324
538 Ga0439466_0014803 3300041411 Bacteria 2837
539 Ga0439465_0001267 3300041413 Bacteria 8123
540 Ga0451853_3071570 3300041512 Bacteria 2829
541 Ga0439431_0001384 3300041997 Bacteria 5348
542 Ga0439433_0008066 3300041999 Bacteria 2280
543 Ga0439433_0021258 3300041999 Bacteria 1451
544 Ga0439445_0000386 3300042004 Bacteria 8882
545 Ga0439432_000780 3300042006 Bacteria 11939
546 Ga0439432_004509 3300042006 Bacteria 5085
547 Ga0439432_034554 3300042006 Bacteria 1623
548 Ga0439449_0000299 3300042007 Bacteria 17855
549 Ga0439449_0000656 3300042007 Bacteria 13055
550 Ga0439449_0001289 3300042007 Bacteria 9818
551 Ga0439449_0001818 3300042007 Bacteria 8394
552 Ga0439449_0021282 3300042007 Bacteria 2428
553 Ga0439452_000743 3300042010 Bacteria 15661
554 Ga0439452_045941 3300042010 Bacteria 1014
555 Ga0439454_003384 3300042011 Bacteria 1771
556 Ga0439454_005892 3300042011 Bacteria 1484
557 Ga0439462_0008014 3300042015 Bacteria 2658
558 Ga0439462_0008822 3300042015 Bacteria 2548
559 Ga0450919_000867 3300042121 Bacteria 3912
560 Ga0450919_005133 3300042121 Bacteria 1579
561 Ga0450920_003190 3300042122 Bacteria 2834
562 Ga0450923_002487 3300042125 Bacteria 2651
563 Ga0450896_007427 3300042133 Bacteria 1512
564 Ga0450906_002465 3300042145 Bacteria 4048
565 Ga0450906_002490 3300042145 Bacteria 4030
566 Ga0450909_004798 3300042185 Bacteria 1935
567 Ga0439434_0003938 3300042435 Bacteria 4336
568 Ga0439434_0013660 3300042435 Bacteria 2411
569 Ga0450918_000421 3300042531 Bacteria 9198
570 Ga0450918_002009 3300042531 Bacteria 3897
571 Ga0450893_0003086 3300042532 Bacteria 2619
572 Ga0450893_0011463 3300042532 Bacteria 1464
573 Ga0466969_0004555 3300044656 Bacteria 7380
574 Ga0466969_0013993 3300044656 Bacteria 4222
575 Ga0466965_0002377 3300044683 Bacteria 7974
576 Ga0466965_0023134 3300044683 Bacteria 2999
577 Ga0466965_0023627 3300044683 Bacteria 2969
578 Ga0466965_0059410 3300044683 Bacteria 1908
579 Ga0466966_0005697 3300044684 Bacteria 8196
580 Ga0466966_0023958 3300044684 Bacteria 3994
581 Ga0466961_0011599 3300044693 Bacteria 5633
582 Ga0466961_0016382 3300044693 Bacteria 4761
583 Ga0466961_0022604 3300044693 Bacteria 4046
584 Ga0466961_0034008 3300044693 Bacteria 3274
585 Ga0466964_0016967 3300044706 Bacteria 2784
586 Ga0453684_0007265 3300044712 Bacteria 20503
587 Ga0466971_0057562 3300044719 Bacteria 1753
588 Ga0466970_0060226 3300044765 Bacteria 2033
589 Ga0466957_0022012 3300044842 Bacteria 3758
590 Ga0466957_0037720 3300044842 Bacteria 2910
591 Ga0466960_0144371 3300044901 Bacteria 1266
592 Ga0466959_0009449 3300045049 Bacteria 6937
593 Ga0466959_0016699 3300045049 Bacteria 5369
594 Ga0466958_0052245 3300045836 Bacteria 2476
595 Ga0466967_0061269 3300045976 Bacteria 3337
596 Ga0466967_0143633 3300045976 Bacteria 2225
597 Ga0495592_0000412 3300046454 Bacteria 32712
598 Ga0495592_0024918 3300046454 Bacteria 4546
599 Ga0495592_0040044 3300046454 Bacteria 3517
600 Ga0495592_0042101 3300046454 Bacteria 3421
601 Ga0495592_0069043 3300046454 Bacteria 2577
602 Ga0495603_0000540 3300046455 Bacteria 21072
603 Ga0495603_0009718 3300046455 Bacteria 5818
604 Ga0495590_0003281 3300046457 Bacteria 6621
605 Ga0495591_004275 3300046458 Bacteria 7061
606 Ga0495629_0000099 3300046459 Bacteria 75956
607 Ga0495629_0001758 3300046459 Bacteria 16997
608 Ga0495629_0002528 3300046459 Bacteria 14027
609 Ga0495629_0003118 3300046459 Bacteria 12563
610 Ga0495629_0010153 3300046459 Bacteria 6863
611 Ga0495638_0001238 3300046460 Bacteria 24055
612 Ga0495638_0029257 3300046460 Bacteria 3553
613 Ga0495641_0011284 3300046461 Bacteria 5105
614 Ga0495653_0000004 3300046463 Bacteria 376003
615 Ga0495653_0002956 3300046463 Bacteria 13608
616 Ga0495653_0005080 3300046463 Bacteria 10677
617 Ga0495653_0005509 3300046463 Bacteria 10312
618 Ga0495653_0008515 3300046463 Bacteria 8411
619 Ga0495650_0000819 3300046471 Bacteria 37873
620 Ga0495650_0001787 3300046471 Bacteria 19462
621 Ga0495650_0004415 3300046471 Bacteria 9654
622 Ga0495650_0034631 3300046471 Bacteria 2232
623 Ga0495650_0066924 3300046471 Bacteria 1420
624 Ga0495580_0003604 3300046472 Bacteria 13130
625 Ga0495580_0004007 3300046472 Bacteria 12434
626 Ga0495580_0007967 3300046472 Bacteria 8470
627 Ga0495580_0010070 3300046472 Bacteria 7387
628 Ga0495580_0040424 3300046472 Bacteria 3330
629 Ga0495580_0052402 3300046472 Bacteria 2881
630 Ga0495580_0061900 3300046472 Bacteria 2626
631 Ga0495582_0001861 3300046473 Bacteria 11898
632 Ga0495582_0003786 3300046473 Bacteria 8522
633 Ga0495582_0006286 3300046473 Bacteria 6618
634 Ga0495582_0010898 3300046473 Bacteria 5004
635 Ga0495605_0002109 3300046474 Bacteria 12468
636 Ga0495605_0004698 3300046474 Bacteria 7983
637 Ga0495605_0008474 3300046474 Bacteria 5812
638 Ga0495605_0042529 3300046474 Bacteria 2258
639 Ga0495662_0011561 3300046476 Bacteria 4315
640 Ga0495662_0087993 3300046476 Bacteria 1513
641 Ga0495664_0003299 3300046477 Bacteria 8781
642 Ga0495664_0016605 3300046477 Bacteria 4196
643 Ga0495584_0003452 3300046491 Bacteria 8696
644 Ga0495584_0018765 3300046491 Bacteria 3515
645 Ga0495585_0064522 3300046492 Bacteria 2007
646 Ga0495594_0015701 3300046499 Bacteria 3981
647 Ga0495596_0004032 3300046500 Bacteria 7234
648 Ga0495596_0004483 3300046500 Bacteria 6788
649 Ga0495596_0072965 3300046500 Bacteria 1333
650 Ga0495607_0012564 3300046501 Bacteria 5584
651 Ga0495607_0014623 3300046501 Bacteria 5103
652 Ga0495583_0003302 3300046506 Bacteria 12498
653 Ga0495583_0003383 3300046506 Bacteria 12229
654 Ga0495583_0011936 3300046506 Bacteria 4954
655 Ga0495583_0059121 3300046506 Bacteria 1719
656 Ga0495606_0000376 3300046507 Bacteria 75612
657 Ga0495606_0000673 3300046507 Bacteria 53474
658 Ga0495606_0079480 3300046507 Bacteria 2042
659 Ga0495608_0008462 3300046511 Bacteria 7207
660 Ga0495608_0020592 3300046511 Bacteria 4533
661 Ga0495610_0007456 3300046512 Bacteria 7273
662 Ga0495610_0009449 3300046512 Bacteria 6165
663 Ga0495610_0061212 3300046512 Bacteria 1789
664 Ga0495616_0009986 3300046513 Bacteria 5518
665 Ga0495616_0037817 3300046513 Bacteria 2480
666 Ga0495618_0023135 3300046514 Bacteria 3839
667 Ga0495618_0040507 3300046514 Bacteria 2932
668 Ga0495620_0018682 3300046515 Bacteria 3429
669 Ga0495620_0033588 3300046515 Bacteria 2328
670 Ga0495628_0003458 3300046516 Bacteria 14143
671 Ga0495628_0005830 3300046516 Bacteria 10790
672 Ga0495628_0007042 3300046516 Bacteria 9742
673 Ga0495628_0009864 3300046516 Bacteria 8135
674 Ga0495628_0023031 3300046516 Bacteria 5112
675 Ga0495628_0069657 3300046516 Bacteria 2743
676 Ga0495628_0178402 3300046516 Bacteria 1608
677 Ga0495630_0012146 3300046517 Bacteria 6244
678 Ga0495630_0013472 3300046517 Bacteria 5947
679 Ga0495630_0014368 3300046517 Bacteria 5768
680 Ga0495630_0017839 3300046517 Bacteria 5206
681 Ga0495630_0031175 3300046517 Bacteria 3968
682 Ga0495631_0000158 3300046518 Bacteria 45721
683 Ga0495631_0013363 3300046518 Bacteria 3986
684 Ga0495631_0033760 3300046518 Bacteria 2297
685 Ga0495632_0001877 3300046519 Bacteria 16855
686 Ga0495632_0003377 3300046519 Bacteria 11372
687 Ga0495632_0004457 3300046519 Bacteria 9512
688 Ga0495632_0005771 3300046519 Bacteria 8123
689 Ga0495632_0016607 3300046519 Bacteria 4088
690 Ga0495637_0001672 3300046520 Bacteria 12813
691 Ga0495643_0047480 3300046522 Bacteria 2325
692 Ga0495644_0011509 3300046523 Bacteria 3405
693 Ga0495648_0000225 3300046524 Bacteria 64644
694 Ga0495648_0009869 3300046524 Bacteria 7336
695 Ga0495648_0037575 3300046524 Bacteria 3109
696 Ga0495648_0040334 3300046524 Bacteria 2961
697 Ga0495666_0001463 3300046526 Bacteria 11514
698 Ga0495666_0003339 3300046526 Bacteria 8104
699 Ga0495666_0003934 3300046526 Bacteria 7509
700 Ga0495666_0017613 3300046526 Bacteria 3557
701 Ga0495666_0036525 3300046526 Bacteria 2393
702 Ga0495642_0010823 3300046528 Bacteria 3495
703 Ga0495642_0012624 3300046528 Bacteria 3257
704 Ga0495642_0033393 3300046528 Bacteria 2069
705 Ga0495642_0073994 3300046528 Bacteria 1428
706 Ga0495652_0004360 3300046529 Bacteria 13541
707 Ga0495652_0021791 3300046529 Bacteria 5696
708 Ga0495652_0069512 3300046529 Bacteria 2947
709 Ga0495652_0115577 3300046529 Bacteria 2149
710 Ga0495654_0005366 3300046530 Bacteria 7464
711 Ga0495654_0038409 3300046530 Bacteria 2394
712 Ga0495665_0000098 3300046531 Bacteria 40308
713 Ga0495665_0008381 3300046531 Bacteria 5607
714 Ga0495665_0010898 3300046531 Bacteria 4918
715 Ga0495665_0015627 3300046531 Bacteria 4085
716 Ga0495640_0003844 3300046533 Bacteria 12046
717 Ga0495640_0049081 3300046533 Bacteria 2912
718 Ga0495586_0062105 3300046535 Bacteria 2033
719 Ga0495586_0094097 3300046535 Bacteria 1657
720 Ga0495586_0109831 3300046535 Bacteria 1534
721 Ga0495586_0157526 3300046535 Bacteria 1279
722 Ga0495587_0022073 3300046536 Bacteria 3921
723 Ga0495609_0000593 3300046538 Bacteria 28388
724 Ga0495609_0017715 3300046538 Bacteria 3305
725 Ga0495621_0002556 3300046539 Bacteria 4907
726 Ga0495597_0077868 3300046542 Bacteria 1421
727 Ga0495645_0000309 3300046543 Bacteria 35183
728 Ga0495645_0002132 3300046543 Bacteria 13428
729 Ga0495645_0020020 3300046543 Bacteria 4824
730 Ga0495645_0092280 3300046543 Bacteria 2162
731 Ga0495645_0094129 3300046543 Bacteria 2137
732 Ga0495645_0114657 3300046543 Bacteria 1904
733 Ga0495622_0000002 3300046557 Bacteria 321742
734 Ga0495622_0000228 3300046557 Bacteria 44226
735 Ga0495622_0055969 3300046557 Bacteria 1829
736 Ga0495622_0087670 3300046557 Bacteria 1431
737 Ga0495633_0000443 3300046558 Bacteria 42796
738 Ga0495633_0002933 3300046558 Bacteria 11676
739 Ga0495633_0018895 3300046558 Bacteria 3490
740 Ga0495656_0000268 3300046615 Bacteria 18431
741 Ga0495634_0006106 3300046642 Bacteria 9176
742 Ga0495634_0023179 3300046642 Bacteria 4365
743 Ga0495634_0058243 3300046642 Bacteria 2575
744 Ga0495625_0002685 3300046660 Bacteria 18912
745 Ga0495625_0006546 3300046660 Bacteria 10346
746 Ga0495625_0015168 3300046660 Bacteria 6115
747 Ga0495625_0020191 3300046660 Bacteria 5148
748 Ga0495625_0055991 3300046660 Bacteria 2809
749 Ga0495625_0170741 3300046660 Bacteria 1452
750 Ga0495635_0002474 3300046663 Bacteria 12610
751 Ga0495635_0007994 3300046663 Bacteria 7392
752 Ga0495635_0014303 3300046663 Bacteria 5552
753 Ga0495635_0019736 3300046663 Bacteria 4695
754 Ga0495635_0052007 3300046663 Bacteria 2822
755 Ga0495661_0012914 3300046665 Bacteria 5626
756 Ga0495661_0028693 3300046665 Bacteria 3559
757 Ga0495661_0045740 3300046665 Bacteria 2675
758 Ga0495661_0112101 3300046665 Bacteria 1518
759 Ga0495588_0012344 3300046674 Bacteria 4036
760 Ga0495588_0037080 3300046674 Bacteria 2476
761 Ga0495657_0021227 3300046675 Bacteria 4661
762 Ga0495599_0053546 3300046678 Bacteria 2527
763 Ga0495599_0160552 3300046678 Bacteria 1389
764 Ga0495623_0003030 3300046679 Bacteria 11060
765 Ga0495623_0008843 3300046679 Bacteria 6535
766 Ga0495623_0011666 3300046679 Bacteria 5692
767 Ga0495623_0020684 3300046679 Bacteria 4253
768 Ga0495623_0026960 3300046679 Bacteria 3696
769 Ga0495623_0078147 3300046679 Bacteria 2051
770 Ga0495646_0003844 3300046680 Bacteria 9384
771 Ga0495646_0004809 3300046680 Bacteria 8529
772 Ga0495646_0005873 3300046680 Bacteria 7782
773 Ga0495646_0006138 3300046680 Bacteria 7619
774 Ga0495646_0074793 3300046680 Bacteria 1987
775 Ga0495669_0002518 3300046684 Bacteria 7482
776 Ga0495669_0057846 3300046684 Bacteria 1749
777 Ga0495613_0009381 3300046689 Bacteria 7261
778 Ga0495613_0036974 3300046689 Bacteria 3620
779 Ga0495613_0060671 3300046689 Bacteria 2769
780 Ga0495624_0000537 3300046690 Bacteria 29672
781 Ga0495624_0001198 3300046690 Bacteria 20511
782 Ga0495624_0004966 3300046690 Bacteria 9637
783 Ga0495624_0010748 3300046690 Bacteria 6308
784 Ga0495624_0032896 3300046690 Bacteria 3360
785 Ga0495624_0034679 3300046690 Bacteria 3262
786 Ga0495624_0117286 3300046690 Bacteria 1635
787 Ga0495624_0169053 3300046690 Bacteria 1334
788 Ga0495670_0004905 3300046691 Bacteria 6573
789 Ga0495671_0003077 3300046692 Bacteria 10361
790 Ga0495671_0109804 3300046692 Bacteria 1347
791 Ga0495649_0002383 3300046694 Bacteria 13300
792 Ga0495649_0002662 3300046694 Bacteria 12440
793 Ga0495649_0007356 3300046694 Bacteria 6728
794 Ga0495589_0003673 3300046794 Bacteria 8289
795 Ga0495589_0004245 3300046794 Bacteria 7662
796 Ga0495589_0006289 3300046794 Bacteria 6271
797 Ga0495600_0001264 3300046809 Bacteria 13941
798 Ga0495600_0004299 3300046809 Bacteria 8519
799 Ga0495600_0129048 3300046809 Bacteria 1644
800 Ga0495660_0003850 3300046810 Bacteria 9180
801 Ga0495660_0004843 3300046810 Bacteria 8115
802 Ga0495660_0007025 3300046810 Bacteria 6639
803 Ga0495581_0006644 3300047315 Bacteria 6700
804 Ga0495581_0008637 3300047315 Bacteria 5900
805 Ga0495581_0017586 3300047315 Bacteria 4153
806 Ga0495604_0004075 3300047317 Bacteria 11617
807 Ga0495604_0013843 3300047317 Bacteria 6435
808 Ga0495604_0015206 3300047317 Bacteria 6143
809 Ga0495604_0085582 3300047317 Bacteria 2352
810 Ga0495674_0011367 3300047319 Bacteria 8402
811 Ga0495674_0014546 3300047319 Bacteria 7362
812 Ga0495674_0037487 3300047319 Bacteria 4356
813 Ga0495674_0063731 3300047319 Bacteria 3205
814 Ga0495674_0313037 3300047319 Bacteria 1280
815 Ga0495672_0000188 3300047320 Bacteria 89538
816 Ga0495672_0001537 3300047320 Bacteria 22567
817 Ga0495672_0002476 3300047320 Bacteria 16960
818 Ga0495672_0004497 3300047320 Bacteria 11399
819 Ga0495672_0052639 3300047320 Bacteria 2390
820 Ga0495672_0154188 3300047320 Bacteria 1188
821 Ga0495676_0002802 3300047321 Bacteria 15698
822 Ga0495676_0122407 3300047321 Bacteria 1890
823 Ga0495680_0003380 3300047322 Bacteria 15775
824 Ga0495680_0016398 3300047322 Bacteria 6366
825 Ga0495680_0057508 3300047322 Bacteria 3007
826 Ga0495683_0001235 3300047323 Bacteria 17383
827 Ga0495683_0007948 3300047323 Bacteria 5692
828 Ga0495683_0010075 3300047323 Bacteria 5010
829 Ga0495683_0017625 3300047323 Bacteria 3700
830 Ga0495683_0037246 3300047323 Bacteria 2466
831 Ga0495683_0087577 3300047323 Bacteria 1512
832 Ga0495687_000021 3300047443 Bacteria 334681
833 Ga0495687_019258 3300047443 Bacteria 3354
834 Ga0495687_020609 3300047443 Bacteria 3209
835 Ga0495687_030412 3300047443 Bacteria 2486
836 Ga0495675_0010686 3300047444 Bacteria 5742
837 Ga0495675_0028506 3300047444 Bacteria 3558
838 Ga0495677_0000839 3300047445 Bacteria 12430
839 Ga0495679_000062 3300047446 Bacteria 107181
840 Ga0495679_002752 3300047446 Bacteria 8752
841 Ga0495679_037355 3300047446 Bacteria 1528
842 Ga0495673_0011656 3300047469 Bacteria 4715
843 Ga0495673_0012472 3300047469 Bacteria 4504
844 Ga0495681_0006237 3300047470 Bacteria 7858
845 Ga0495684_0105977 3300047471 Bacteria 2124
846 Ga0495686_0000143 3300047472 Bacteria 143037
847 Ga0495686_0008230 3300047472 Bacteria 7688
848 Ga0495686_0030579 3300047472 Bacteria 3497
849 Ga0495686_0055746 3300047472 Bacteria 2470
850 Ga0495593_0007772 3300047673 Bacteria 6250
851 Ga0495593_0008291 3300047673 Bacteria 6045
852 Ga0495593_0013358 3300047673 Bacteria 4686
853 Ga0495593_0049527 3300047673 Bacteria 2228
854 Ga0495602_0000482 3300048088 Bacteria 36956
855 Ga0495602_0004982 3300048088 Bacteria 13919
856 Ga0495602_0034290 3300048088 Bacteria 4750
857 Ga0495602_0051633 3300048088 Bacteria 3660
858 Ga0495602_0076453 3300048088 Bacteria 2836
859 Ga0495602_0095446 3300048088 Bacteria 2454
860 Ga0495602_0121724 3300048088 Bacteria 2098
861 Ga0495614_0037838 3300048089 Bacteria 2070
862 Ga0495615_0003679 3300048090 Bacteria 2595
863 Ga0495626_0002351 3300048091 Bacteria 13316
864 Ga0495626_0020354 3300048091 Bacteria 3308
865 Ga0495626_0035637 3300048091 Bacteria 2374
866 Ga0495626_0057430 3300048091 Bacteria 1780
867 Ga0495626_0058933 3300048091 Bacteria 1753
868 Ga0495626_0100771 3300048091 Bacteria 1259
869 Ga0496100_0001569 3300048903 Bacteria 11247
870 Ga0496100_0007718 3300048903 Bacteria 5956
871 Ga0496100_0012714 3300048903 Bacteria 4836
872 Ga0496100_0047716 3300048903 Bacteria 2761
873 Ga0496101_0002922 3300048904 Bacteria 10507
874 Ga0496101_0023195 3300048904 Bacteria 4283
875 Ga0496101_0091525 3300048904 Bacteria 2264
876 Ga0496101_0103559 3300048904 Bacteria 2133
877 Ga0496101_0213177 3300048904 Bacteria 1496
878 Ga0496102_0002615 3300048905 Bacteria 15311
879 Ga0496102_0005300 3300048905 Bacteria 10945
880 Ga0496102_0014433 3300048905 Bacteria 6863
881 Ga0496102_0061567 3300048905 Bacteria 3435
882 Ga0496102_0069585 3300048905 Bacteria 3230
883 Ga0496103_0004527 3300048906 Bacteria 8421
884 Ga0496103_0030130 3300048906 Bacteria 3300
885 Ga0496103_0173064 3300048906 Bacteria 1387
886 Ga0496104_0009035 3300048907 Bacteria 8861
887 Ga0496104_0044029 3300048907 Bacteria 4194
888 Ga0496104_0093353 3300048907 Bacteria 2878
889 Ga0496104_0345561 3300048907 Bacteria 1400
890 Ga0496104_0417896 3300048907 Bacteria 1253
891 Ga0496105_0003210 3300048908 Bacteria 12039
892 Ga0496105_0021980 3300048908 Bacteria 5165
893 Ga0496105_0110198 3300048908 Bacteria 2272
894 Ga0496106_0000074 3300048909 Bacteria 80191
895 Ga0496106_0018813 3300048909 Bacteria 5117
896 Ga0496106_0022436 3300048909 Bacteria 4689
897 Ga0496109_0089561 3300048912 Bacteria 2845
898 Ga0496109_0199794 3300048912 Bacteria 1879
899 Ga0496109_0212332 3300048912 Bacteria 1820
900 Ga0496110_0035483 3300048913 Bacteria 4326
901 Ga0496110_0432203 3300048913 Bacteria 1200
902 Ga0496111_0002649 3300048914 Bacteria 10852
903 Ga0496111_0027651 3300048914 Bacteria 4015
904 Ga0496112_0053004 3300048915 Bacteria 3983
905 Ga0496112_0227737 3300048915 Bacteria 1819
906 Ga0496113_0005907 3300048916 Bacteria 7688
907 Ga0496113_0194229 3300048916 Bacteria 1612
908 Ga0496114_0003644 3300048917 Bacteria 11845
909 Ga0496114_0020776 3300048917 Bacteria 5330
910 Ga0496115_0136744 3300048918 Bacteria 2020
911 Ga0496116_0002045 3300048919 Bacteria 21613
912 Ga0496116_0018215 3300048919 Bacteria 5422
913 Ga0496116_0019299 3300048919 Bacteria 5222
914 Ga0496116_0026797 3300048919 Bacteria 4206
915 Ga0496116_0118351 3300048919 Bacteria 1539
916 Ga0496117_0000005 3300048920 Bacteria 777468
917 Ga0496117_0003643 3300048920 Bacteria 17745
918 Ga0496117_0009137 3300048920 Bacteria 9296
919 Ga0496117_0035727 3300048920 Bacteria 3726
920 Ga0496117_0041867 3300048920 Bacteria 3349
921 Ga0496117_0045532 3300048920 Bacteria 3167
922 Ga0496117_0052876 3300048920 Bacteria 2858
923 Ga0496117_0082953 3300048920 Bacteria 2097
924 Ga0496117_0151906 3300048920 Bacteria 1369
925 Ga0496118_0000022 3300048921 Bacteria 438602
926 Ga0496118_0003224 3300048921 Bacteria 20822
927 Ga0496118_0004058 3300048921 Bacteria 17754
928 Ga0496118_0006911 3300048921 Bacteria 12277
929 Ga0496118_0007095 3300048921 Bacteria 12026
930 Ga0496118_0022682 3300048921 Bacteria 5477
931 Ga0496118_0025881 3300048921 Bacteria 5016
932 Ga0496118_0038671 3300048921 Bacteria 3820
933 Ga0496118_0053862 3300048921 Bacteria 3052
934 Ga0496118_0056709 3300048921 Bacteria 2942
935 Ga0496118_0196785 3300048921 Bacteria 1199
936 Ga0496120_0063245 3300048923 Bacteria 2060
937 Ga0496121_0000729 3300048924 Bacteria 60664
938 Ga0496121_0000941 3300048924 Bacteria 52704
939 Ga0496121_0001997 3300048924 Bacteria 32409
940 Ga0496121_0004898 3300048924 Bacteria 17571
941 Ga0496121_0015030 3300048924 Bacteria 8149
942 Ga0496121_0026906 3300048924 Bacteria 5399
943 Ga0496121_0033332 3300048924 Bacteria 4662
944 Ga0496121_0047731 3300048924 Bacteria 3650
945 Ga0496121_0053127 3300048924 Bacteria 3396
946 Ga0496121_0056484 3300048924 Bacteria 3260
947 Ga0496121_0061868 3300048924 Bacteria 3069
948 Ga0496122_0000317 3300048925 Bacteria 105883
949 Ga0496122_0001727 3300048925 Bacteria 33871
950 Ga0496122_0026189 3300048925 Bacteria 5038
951 Ga0496122_0035577 3300048925 Bacteria 4047
952 Ga0496122_0041748 3300048925 Bacteria 3620
953 Ga0496122_0058200 3300048925 Bacteria 2863
954 Ga0496123_0001385 3300048926 Bacteria 33978
955 Ga0496123_0001487 3300048926 Bacteria 32545
956 Ga0496123_0115811 3300048926 Bacteria 1520
957 Ga0496124_0013498 3300048927 Bacteria 7972
958 Ga0496124_0054919 3300048927 Bacteria 3369
959 Ga0496124_0183265 3300048927 Bacteria 1609
960 Ga0496125_0024632 3300048928 Bacteria 5528
961 Ga0496125_0057269 3300048928 Bacteria 3158
962 Ga0496125_0105295 3300048928 Bacteria 2062
963 Ga0496125_0212614 3300048928 Bacteria 1254
964 Ga0496126_0000232 3300048929 Bacteria 120250
965 Ga0496126_0001112 3300048929 Bacteria 45021
966 Ga0496126_0001997 3300048929 Bacteria 28856
967 Ga0496126_0003802 3300048929 Bacteria 18745
968 Ga0496126_0031392 3300048929 Bacteria 5020
969 Ga0496126_0041149 3300048929 Bacteria 4279
970 Ga0496126_0110273 3300048929 Bacteria 2397
971 Ga0496126_0149468 3300048929 Bacteria 2003
972 Ga0495678_001700 3300049459 Bacteria 16606
973 Ga0495678_006101 3300049459 Bacteria 6482
974 Ga0495678_011291 3300049459 Bacteria 4285
975 Ga0495678_016813 3300049459 Bacteria 3332
976 Ga0495678_074672 3300049459 Bacteria 1233
977 Ga0495682_0001697 3300049460 Bacteria 11205
978 Ga0495682_0008266 3300049460 Bacteria 4107
979 Ga0495682_0026688 3300049460 Bacteria 2143
980 Ga0501032_0072742 3300049569 Bacteria 2291
981 Ga0501033_0081786 3300049570 Bacteria 2369
982 Ga0501033_0155584 3300049570 Bacteria 1647
983 Ga0501037_0135287 3300049573 Bacteria 1765
984 Ga0501043_0000020 3300049579 Bacteria 155270
985 Ga0501043_0296286 3300049579 Bacteria 1237
986 Ga0501046_0000039 3300049580 Bacteria 155237
987 Ga0501047_0000028 3300049581 Bacteria 220279
988 Ga0501048_0000543 3300049582 Bacteria 26541
989 Ga0501223_014403 3300049663 Bacteria 1568
990 Ga0501249_012646 3300049679 Bacteria 1786
991 Ga0501225_0002289 3300049705 Bacteria 5924
992 Ga0501262_006028 3300049759 Bacteria 1442
993 Ga0501282_000012 3300049778 Bacteria 30044
994 Ga0501035_0050220 3300049822 Bacteria 3738
995 Ga0501035_0066710 3300049822 Bacteria 3193
996 Ga0501044_0025828 3300049823 Bacteria 6226
997 Ga0501044_0123173 3300049823 Bacteria 2592
998 Ga0501044_0125757 3300049823 Bacteria 2561
999 Ga0501226_000197 3300049853 Bacteria 9476
1000 nmdc:mga03683_2605_c1 3300050489 Bacteria 5632
1001 nmdc:mga03683_40451_c1 3300050489 Bacteria 1912
1002 nmdc:mga03683_82830_c1 3300050489 Bacteria 1388
1003 nmdc:mga00v17_26408_c1 3300050491 Bacteria 3384
1004 nmdc:mga0yw44_145781_c1 3300050492 Bacteria 1541
1005 nmdc:mga0k408_142379_c1 3300050493 Bacteria 1427
1006 nmdc:mga0k408_14954_c1 3300050493 Bacteria 3719
1007 nmdc:mga0k408_16706_c1 3300050493 Bacteria 4078
1008 nmdc:mga0k408_26519_c1 3300050493 Bacteria 3285
1009 nmdc:mga0k408_33819_c2 3300050493 Bacteria 2340
1010 nmdc:mga0k408_34324_c1 3300050493 Bacteria 2904
1011 nmdc:mga0k408_8433_c1 3300050493 Bacteria 5532
1012 nmdc:mga0k408_86830_c1 3300050493 Bacteria 1837
1013 nmdc:mga06z11_51270_c1 3300050494 Bacteria 2113
1014 nmdc:mga06z11_55826_c1 3300050494 Bacteria 2041
1015 nmdc:mga06z11_6573_c1 3300050494 Bacteria 4744
1016 nmdc:mga04h51_68239_c1 3300050495 Bacteria 1235
1017 nmdc:mga07m45_12691_c2 3300050496 Bacteria 3357
1018 nmdc:mga07m45_173967_c1 3300050496 Bacteria 1252
1019 nmdc:mga07m45_32514_c1 3300050496 Bacteria 2893
1020 nmdc:mga07m45_3298_c1 3300050496 Bacteria 7769
1021 nmdc:mga07m45_36466_c1 3300050496 Bacteria 2739
1022 nmdc:mga07m45_4681_c1 3300050496 Bacteria 6717
1023 nmdc:mga07m45_55191_c1 3300050496 Bacteria 2246
1024 nmdc:mga07m45_8498_c1 3300050496 Bacteria 5282
1025 Ga0495601_0004880 3300053077 Bacteria 7785
1026 Ga0500610_0027176 3300053079 Bacteria 2871
1027 Ga0500610_0027784 3300053079 Bacteria 2844
1028 Ga0500635_0000041 3300053080 Bacteria 90865
1029 Ga0495655_0045427 3300053083 Bacteria 1141
1030 Ga0500643_006257 3300053087 Bacteria 4998
1031 Ga0500644_0003585 3300053088 Bacteria 3853
1032 Ga0500644_0022184 3300053088 Bacteria 1912
1033 Ga0500651_0000076 3300053093 Bacteria 63637
1034 Ga0500562_000722 3300053108 Bacteria 8006
1035 Ga0500562_013692 3300053108 Bacteria 2073
1036 Ga0500571_006299 3300053110 Bacteria 6398
1037 Ga0500572_064986 3300053111 Bacteria 1116
1038 Ga0500593_000987 3300053117 Bacteria 10381
1039 Ga0500593_017715 3300053117 Bacteria 3097
1040 Ga0500607_011089 3300053121 Bacteria 5337
1041 Ga0500608_020168 3300053122 Bacteria 3062
1042 Ga0500626_020011 3300053128 Bacteria 2974
1043 Ga0500655_000823 3300053133 Bacteria 6087
1044 Ga0500658_0003589 3300053134 Bacteria 5852
1045 Ga0500559_0000114 3300053136 Bacteria 63472
1046 Ga0500559_0004890 3300053136 Bacteria 6251
1047 Ga0500568_0006116 3300053139 Bacteria 6097
1048 Ga0500574_013535 3300053141 Bacteria 1899
1049 Ga0500586_000268 3300053145 Bacteria 10430
1050 Ga0500586_056301 3300053145 Bacteria 1363
1051 Ga0500616_0052996 3300053153 Bacteria 2131
1052 Ga0500616_0080046 3300053153 Bacteria 1643
1053 Ga0500619_000678 3300053154 Bacteria 5808
1054 Ga0500622_0002845 3300053156 Bacteria 12127
1055 Ga0500627_0000093 3300053158 Bacteria 29716
1056 Ga0500636_0134342 3300053177 Bacteria 1375
1057 Ga0500625_037120 3300053729 Bacteria 2306
1058 Ga0500645_021441 3300053730 Bacteria 1994
1059 Ga0500587_000164 3300053739 Bacteria 6551
1060 Ga0466962_0002958 3300061719 Bacteria 8108
1061 Ga0466962_0016966 3300061719 Bacteria 3507

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009098 Ga0105245_10014457 Ga0105245_100144573 234
2 3300053080 Ga0500635_0000041 Ga0500635_0000041_52969_53892 247
3 3300046660 Ga0495625_0055991 Ga0495625_0055991_688_1644 252
4 3300044683 Ga0466965_0023627 Ga0466965_0023627_2107_2958 253
5 3300005616 Ga0068852_100068777 Ga0068852_1000687772 259
6 3300049570 Ga0501033_0081786 Ga0501033_0081786_607_1602 261
7 3300031730 Ga0307516_10002748 Ga0307516_1000274812 262
8 iso_pu_bacteria 2921643360 2921653939 263
9 3300047320 Ga0495672_0002476 Ga0495672_0002476_4485_5507 267
10 3300047469 Ga0495673_0012472 Ga0495673_0012472_1422_2444 267
11 3300005334 Ga0068869_100036273 Ga0068869_1000362732 268
12 3300025927 Ga0207687_10015088 Ga0207687_100150883 268
13 3300025942 Ga0207689_10100722 Ga0207689_101007222 268
14 3300047319 Ga0495674_0014546 Ga0495674_0014546_3656_4678 268
15 3300031616 Ga0307508_10000134 Ga0307508_1000013454 270
16 3300044684 Ga0466966_0005697 Ga0466966_0005697_1265_2278 271
17 3300031730 Ga0307516_10018416 Ga0307516_100184163 272
18 3300039450 Ga0436363_1102872 Ga0436363_1102872_10_960 272
19 3300046471 Ga0495650_0001787 Ga0495650_0001787_11805_12794 272
20 3300048905 Ga0496102_0002615 Ga0496102_0002615_10745_11749 272
21 3300049569 Ga0501032_0072742 Ga0501032_0072742_811_1839 272
22 3300049822 Ga0501035_0050220 Ga0501035_0050220_2171_3199 272
23 3300049823 Ga0501044_0125757 Ga0501044_0125757_371_1399 272
24 3300006178 Ga0075367_10039570 Ga0075367_100395702 273
25 3300025986 Ga0207658_10188793 Ga0207658_101887932 273
26 3300041512 Ga0451853_3071570 Ga0451853_3071570_1313_2326 273
27 3300041999 Ga0439433_0008066 Ga0439433_0008066_990_1937 273
28 3300042007 Ga0439449_0021282 Ga0439449_0021282_780_1727 273
29 3300042015 Ga0439462_0008014 Ga0439462_0008014_407_1354 273
30 3300046474 Ga0495605_0042529 Ga0495605_0042529_630_1643 273
31 3300046506 Ga0495583_0059121 Ga0495583_0059121_578_1594 273
32 3300046519 Ga0495632_0005771 Ga0495632_0005771_46_1059 273
33 3300046810 Ga0495660_0007025 Ga0495660_0007025_2425_3438 273
34 3300048091 Ga0495626_0100771 Ga0495626_0100771_189_1202 273
35 3300048925 Ga0496122_0035577 Ga0496122_0035577_2231_3205 273
36 3300050489 nmdc:mga03683_40451_c1 nmdc:mga03683_40451_c1_202_1215 273
37 3300050493 nmdc:mga0k408_86830_c1 nmdc:mga0k408_86830_c1_346_1359 273
38 3300050494 nmdc:mga06z11_55826_c1 nmdc:mga06z11_55826_c1_124_1137 273
39 3300046455 Ga0495603_0000540 Ga0495603_0000540_4117_5133 274
40 3300046459 Ga0495629_0001758 Ga0495629_0001758_6797_7813 274
41 3300046471 Ga0495650_0000819 Ga0495650_0000819_32391_33407 274
42 3300046472 Ga0495580_0004007 Ga0495580_0004007_29_1045 274
43 3300046473 Ga0495582_0010898 Ga0495582_0010898_3303_4319 274
44 3300046515 Ga0495620_0033588 Ga0495620_0033588_30_1043 274
45 3300046535 Ga0495586_0094097 Ga0495586_0094097_18_1034 274
46 3300046543 Ga0495645_0000309 Ga0495645_0000309_12052_13068 274
47 3300046660 Ga0495625_0006546 Ga0495625_0006546_5385_6398 274
48 3300046689 Ga0495613_0036974 Ga0495613_0036974_1298_2314 274
49 3300046692 Ga0495671_0109804 Ga0495671_0109804_13_1029 274
50 3300047315 Ga0495581_0008637 Ga0495581_0008637_505_1521 274
51 3300048903 Ga0496100_0012714 Ga0496100_0012714_1471_2487 274
52 3300048907 Ga0496104_0044029 Ga0496104_0044029_2421_3437 274
53 3300048917 Ga0496114_0003644 Ga0496114_0003644_5747_6763 274
54 3300048918 Ga0496115_0136744 Ga0496115_0136744_166_1182 274
55 3300053739 Ga0500587_000164 Ga0500587_000164_3506_4519 274
56 3300025299 Ga0209256_1000015 Ga0209256_1000015156 275
57 3300030522 Ga0307512_10091691 Ga0307512_100916912 275
58 3300048905 Ga0496102_0061567 Ga0496102_0061567_1848_2801 275
59 3300048917 Ga0496114_0020776 Ga0496114_0020776_2425_3438 275
60 3300006946 Ga0079104_1000092 Ga0079104_1000092117 276
61 3300027111 Ga0209281_1000083 Ga0209281_1000083159 276
62 3300027876 Ga0209974_10016630 Ga0209974_100166302 276
63 3300045976 Ga0466967_0143633 Ga0466967_0143633_386_1345 276
64 3300047472 Ga0495686_0030579 Ga0495686_0030579_242_1264 276
65 3300002705 JGI25156J39149_1000016 JGI25156J39149_1000016103 277
66 3300002705 JGI25156J39149_1000061 JGI25156J39149_10000612 277
67 3300002738 JGI25154J39366_1002417 JGI25154J39366_10024172 277
68 3300002741 JGI25157J39369_1000035 JGI25157J39369_100003535 277
69 3300005329 Ga0070683_100057127 Ga0070683_1000571272 277
70 3300005339 Ga0070660_100012288 Ga0070660_1000122886 277
71 3300005563 Ga0068855_100115801 Ga0068855_1001158012 277
72 3300005577 Ga0068857_100000256 Ga0068857_10000025630 277
73 3300005578 Ga0068854_100016612 Ga0068854_1000166122 277
74 3300005614 Ga0068856_100001897 Ga0068856_10000189717 277
75 3300009174 Ga0105241_10005426 Ga0105241_100054266 277
76 3300009545 Ga0105237_10006019 Ga0105237_100060198 277
77 3300013105 Ga0157369_10007721 Ga0157369_100077218 277
78 3300025246 Ga0209646_1000056 Ga0209646_1000056171 277
79 3300025250 Ga0209026_1000009 Ga0209026_1000009371 277
80 3300025253 Ga0209677_100198 Ga0209677_1001988 277
81 3300025256 Ga0209759_1000035 Ga0209759_100003592 277
82 3300025911 Ga0207654_10007306 Ga0207654_100073066 277
83 3300025949 Ga0207667_10008701 Ga0207667_100087013 277
84 3300025981 Ga0207640_10049897 Ga0207640_100498972 277
85 3300026078 Ga0207702_10003989 Ga0207702_100039895 277
86 3300026116 Ga0207674_10000776 Ga0207674_1000077615 277
87 3300028794 Ga0307515_10041055 Ga0307515_100410558 277
88 3300031456 Ga0307513_10368732 Ga0307513_103687321 277
89 3300037312 Ga0395899_0005957 Ga0395899_0005957_5640_6635 277
90 3300037418 Ga0395900_0046473 Ga0395900_0046473_1692_2687 277
91 3300038443 Ga0395901_0239084 Ga0395901_0239084_358_1353 277
92 3300044693 Ga0466961_0034008 Ga0466961_0034008_1794_2834 277
93 3300005367 Ga0070667_100149683 Ga0070667_1001496832 278
94 3300005577 Ga0068857_100107797 Ga0068857_1001077972 278
95 3300005577 Ga0068857_100226260 Ga0068857_1002262602 278
96 3300009545 Ga0105237_10063207 Ga0105237_100632072 278
97 3300025253 Ga0209677_101436 Ga0209677_1014366 278
98 3300025914 Ga0207671_10008167 Ga0207671_100081677 278
99 3300025919 Ga0207657_10049644 Ga0207657_100496442 278
100 3300026116 Ga0207674_10053815 Ga0207674_100538154 278
101 3300026116 Ga0207674_10157864 Ga0207674_101578642 278
102 3300050494 nmdc:mga06z11_51270_c1 nmdc:mga06z11_51270_c1_78_1079 278
103 3300050496 nmdc:mga07m45_36466_c1 nmdc:mga07m45_36466_c1_1314_2315 278
104 3300053088 Ga0500644_0022184 Ga0500644_0022184_338_1342 278
105 3300006353 Ga0075370_10003685 Ga0075370_100036853 279
106 3300025913 Ga0207695_10149896 Ga0207695_101498962 279
107 3300031456 Ga0307513_10015242 Ga0307513_100152425 279
108 3300037471 Ga0395905_0204297 Ga0395905_0204297_154_1191 279
109 3300042532 Ga0450893_0003086 Ga0450893_0003086_120_1100 279
110 3300044656 Ga0466969_0013993 Ga0466969_0013993_1526_2566 279
111 3300044765 Ga0466970_0060226 Ga0466970_0060226_442_1482 279
112 3300048088 Ga0495602_0051633 Ga0495602_0051633_1839_2852 279
113 3300050491 nmdc:mga00v17_26408_c1 nmdc:mga00v17_26408_c1_2191_3192 279
114 3300050496 nmdc:mga07m45_8498_c1 nmdc:mga07m45_8498_c1_914_1951 279
115 3300053153 Ga0500616_0052996 Ga0500616_0052996_532_1530 279
116 3300026023 Ga0207677_10021197 Ga0207677_100211972 280
117 3300044683 Ga0466965_0023134 Ga0466965_0023134_902_1912 280
118 3300006195 Ga0075366_10105277 Ga0075366_101052772 281
119 3300006353 Ga0075370_10023293 Ga0075370_100232932 281
120 3300006353 Ga0075370_10027536 Ga0075370_100275361 281
121 3300025298 Ga0209050_1001483 Ga0209050_100148316 281
122 3300031649 Ga0307514_10046896 Ga0307514_100468962 281
123 3300033180 Ga0307510_10022476 Ga0307510_100224762 281
124 3300046454 Ga0495592_0000412 Ga0495592_0000412_21655_22653 281
125 3300050496 nmdc:mga07m45_12691_c2 nmdc:mga07m45_12691_c2_1860_2876 281
126 3300050496 nmdc:mga07m45_32514_c1 nmdc:mga07m45_32514_c1_1779_2783 281
127 3300053136 Ga0500559_0000114 Ga0500559_0000114_23852_24850 281
128 3300053156 Ga0500622_0002845 Ga0500622_0002845_5159_6157 281
129 3300005467 Ga0070706_100004768 Ga0070706_10000476810 282
130 3300006178 Ga0075367_10010462 Ga0075367_100104622 282
131 3300006195 Ga0075366_10173047 Ga0075366_101730472 282
132 3300025909 Ga0207705_10211929 Ga0207705_102119292 282
133 3300031507 Ga0307509_10000139 Ga0307509_1000013924 282
134 3300031548 Ga0307408_100000599 Ga0307408_10000059919 282
135 3300031901 Ga0307406_10000353 Ga0307406_1000035312 282
136 3300046519 Ga0495632_0016607 Ga0495632_0016607_2196_3212 282
137 3300053111 Ga0500572_064986 Ga0500572_064986_17_925 282
138 3300005459 Ga0068867_100026632 Ga0068867_1000266323 283
139 3300025910 Ga0207684_10003169 Ga0207684_100031695 283
140 3300025935 Ga0207709_10031238 Ga0207709_100312382 283
141 3300026089 Ga0207648_10105529 Ga0207648_101055292 283
142 3300044656 Ga0466969_0004555 Ga0466969_0004555_4208_5221 283
143 3300044683 Ga0466965_0002377 Ga0466965_0002377_4858_5871 283
144 3300044693 Ga0466961_0016382 Ga0466961_0016382_3150_4163 283
145 3300044706 Ga0466964_0016967 Ga0466964_0016967_222_1235 283
146 3300044719 Ga0466971_0057562 Ga0466971_0057562_553_1566 283
147 3300045049 Ga0466959_0016699 Ga0466959_0016699_3375_4388 283
148 3300045836 Ga0466958_0052245 Ga0466958_0052245_745_1758 283
149 3300046660 Ga0495625_0015168 Ga0495625_0015168_929_1942 283
150 3300050493 nmdc:mga0k408_34324_c1 nmdc:mga0k408_34324_c1_168_1184 283
151 3300050494 nmdc:mga06z11_6573_c1 nmdc:mga06z11_6573_c1_2599_3615 283
152 3300061719 Ga0466962_0002958 Ga0466962_0002958_4526_5539 283
153 3300005338 Ga0068868_100100780 Ga0068868_1001007802 284
154 3300005338 Ga0068868_100240973 Ga0068868_1002409732 284
155 3300005614 Ga0068856_100090668 Ga0068856_1000906682 284
156 3300009093 Ga0105240_10118017 Ga0105240_101180172 284
157 3300025273 Ga0209673_1026034 Ga0209673_10260341 284
158 3300025933 Ga0207706_10028752 Ga0207706_100287524 284
159 3300025942 Ga0207689_10029679 Ga0207689_100296795 284
160 3300026078 Ga0207702_10050981 Ga0207702_100509812 284
161 3300028794 Ga0307515_10275226 Ga0307515_102752262 284
162 3300031730 Ga0307516_10001755 Ga0307516_1000175516 284
163 3300046476 Ga0495662_0011561 Ga0495662_0011561_2415_3335 284
164 3300046516 Ga0495628_0005830 Ga0495628_0005830_3927_4940 284
165 3300046680 Ga0495646_0006138 Ga0495646_0006138_4260_5273 284
166 3300005339 Ga0070660_100292691 Ga0070660_1002926912 285
167 3300006038 Ga0075365_10173598 Ga0075365_101735982 285
168 3300025242 Ga0209258_100740 Ga0209258_10074011 285
169 3300025913 Ga0207695_10003858 Ga0207695_100038582 285
170 3300026121 Ga0207683_10025776 Ga0207683_100257765 285
171 3300027876 Ga0209974_10000862 Ga0209974_100008627 285
172 3300036401 Ga0373937_0287320 Ga0373937_0287320_444_1493 285
173 3300037466 Ga0395898_0037327 Ga0395898_0037327_1931_2971 285
174 3300038443 Ga0395901_0002457 Ga0395901_0002457_12042_13082 285
175 3300047443 Ga0495687_020609 Ga0495687_020609_1261_2274 285
176 3300049663 Ga0501223_014403 Ga0501223_014403_426_1481 285
177 3300050493 nmdc:mga0k408_16706_c1 nmdc:mga0k408_16706_c1_96_1112 285
178 3300053134 Ga0500658_0003589 Ga0500658_0003589_50_1063 285
179 3300003792 Ga0055540_1008149 Ga0055540_10081494 286
180 3300003794 Ga0055531_10000205 Ga0055531_1000020545 286
181 3300025303 Ga0209051_1000825 Ga0209051_100082527 286
182 3300025304 Ga0209257_1000165 Ga0209257_1000165113 286
183 3300032004 Ga0307414_10229291 Ga0307414_102292912 286
184 3300048921 Ga0496118_0038671 Ga0496118_0038671_1105_2076 286
185 3300048924 Ga0496121_0053127 Ga0496121_0053127_336_1313 286
186 3300048929 Ga0496126_0001997 Ga0496126_0001997_17264_18235 286
187 3300005364 Ga0070673_100255491 Ga0070673_1002554912 287
188 3300005456 Ga0070678_100026622 Ga0070678_1000266222 287
189 3300025304 Ga0209257_1030880 Ga0209257_10308801 287
190 3300028379 Ga0268266_10195356 Ga0268266_101953562 287
191 3300037471 Ga0395905_0000012 Ga0395905_0000012_312162_313133 287
192 3300037471 Ga0395905_0290996 Ga0395905_0290996_71_1042 287
193 3300046459 Ga0495629_0003118 Ga0495629_0003118_10768_11784 287
194 3300046463 Ga0495653_0002956 Ga0495653_0002956_9628_10644 287
195 3300046472 Ga0495580_0052402 Ga0495580_0052402_1019_1990 287
196 3300046472 Ga0495580_0061900 Ga0495580_0061900_764_1735 287
197 3300046476 Ga0495662_0087993 Ga0495662_0087993_451_1467 287
198 3300046506 Ga0495583_0011936 Ga0495583_0011936_2874_3845 287
199 3300046516 Ga0495628_0009864 Ga0495628_0009864_3451_4467 287
200 3300046517 Ga0495630_0017839 Ga0495630_0017839_208_1224 287
201 3300046524 Ga0495648_0040334 Ga0495648_0040334_1793_2764 287
202 3300046531 Ga0495665_0000098 Ga0495665_0000098_21852_22868 287
203 3300046543 Ga0495645_0092280 Ga0495645_0092280_431_1447 287
204 3300046557 Ga0495622_0055969 Ga0495622_0055969_821_1792 287
205 3300046663 Ga0495635_0007994 Ga0495635_0007994_3400_4416 287
206 3300046679 Ga0495623_0020684 Ga0495623_0020684_2029_3045 287
207 3300046680 Ga0495646_0074793 Ga0495646_0074793_823_1839 287
208 3300046690 Ga0495624_0000537 Ga0495624_0000537_23604_24620 287
209 3300047319 Ga0495674_0037487 Ga0495674_0037487_1069_2085 287
210 3300047320 Ga0495672_0052639 Ga0495672_0052639_11_982 287
211 3300047322 Ga0495680_0003380 Ga0495680_0003380_3327_4343 287
212 3300047323 Ga0495683_0037246 Ga0495683_0037246_1129_2100 287
213 3300047323 Ga0495683_0087577 Ga0495683_0087577_367_1338 287
214 3300047443 Ga0495687_030412 Ga0495687_030412_972_1943 287
215 3300047469 Ga0495673_0011656 Ga0495673_0011656_32_1003 287
216 3300048088 Ga0495602_0000482 Ga0495602_0000482_33826_34842 287
217 3300048904 Ga0496101_0103559 Ga0496101_0103559_465_1481 287
218 3300048907 Ga0496104_0093353 Ga0496104_0093353_567_1583 287
219 3300048907 Ga0496104_0345561 Ga0496104_0345561_417_1388 287
220 3300048908 Ga0496105_0110198 Ga0496105_0110198_253_1224 287
221 3300048912 Ga0496109_0089561 Ga0496109_0089561_450_1466 287
222 3300048915 Ga0496112_0227737 Ga0496112_0227737_370_1341 287
223 3300048916 Ga0496113_0194229 Ga0496113_0194229_141_1112 287
224 3300048923 Ga0496120_0063245 Ga0496120_0063245_331_1347 287
225 3300048924 Ga0496121_0061868 Ga0496121_0061868_120_1091 287
226 3300048929 Ga0496126_0149468 Ga0496126_0149468_39_1055 287
227 3300049460 Ga0495682_0026688 Ga0495682_0026688_286_1257 287
228 3300031456 Ga0307513_10104602 Ga0307513_101046022 288
229 3300031507 Ga0307509_10029387 Ga0307509_100293873 288
230 3300031616 Ga0307508_10001986 Ga0307508_1000198610 288
231 3300031616 Ga0307508_10060334 Ga0307508_100603342 288
232 3300031730 Ga0307516_10166065 Ga0307516_101660651 288
233 3300031730 Ga0307516_10186649 Ga0307516_101866492 288
234 3300039437 Ga0436365_0180902 Ga0436365_0180902_167_1150 288
235 3300046471 Ga0495650_0066924 Ga0495650_0066924_238_1239 288
236 3300046491 Ga0495584_0003452 Ga0495584_0003452_654_1655 288
237 3300046501 Ga0495607_0014623 Ga0495607_0014623_1814_2815 288
238 3300046513 Ga0495616_0037817 Ga0495616_0037817_410_1411 288
239 3300046518 Ga0495631_0013363 Ga0495631_0013363_410_1411 288
240 3300046523 Ga0495644_0011509 Ga0495644_0011509_597_1598 288
241 3300046528 Ga0495642_0010823 Ga0495642_0010823_1274_2275 288
242 3300046538 Ga0495609_0017715 Ga0495609_0017715_1896_2897 288
243 3300046558 Ga0495633_0018895 Ga0495633_0018895_1217_2218 288
244 3300046665 Ga0495661_0012914 Ga0495661_0012914_647_1648 288
245 3300046684 Ga0495669_0057846 Ga0495669_0057846_605_1606 288
246 3300046794 Ga0495589_0004245 Ga0495589_0004245_1788_2789 288
247 3300046810 Ga0495660_0003850 Ga0495660_0003850_7049_8050 288
248 3300047320 Ga0495672_0004497 Ga0495672_0004497_6999_8000 288
249 3300047323 Ga0495683_0010075 Ga0495683_0010075_1434_2435 288
250 3300047470 Ga0495681_0006237 Ga0495681_0006237_6030_7031 288
251 3300047472 Ga0495686_0055746 Ga0495686_0055746_1339_2340 288
252 3300049459 Ga0495678_006101 Ga0495678_006101_3279_4280 288
253 3300049459 Ga0495678_074672 Ga0495678_074672_256_1191 288
254 iso_pu_bacteria 8047673197 8047673384 288
255 3300002774 JGI25150J39212_1004666 JGI25150J39212_10046662 289
256 3300003187 JGI25151J46595_10009274 JGI25151J46595_100092743 289
257 3300003354 JGI25160J50197_1000174 JGI25160J50197_100017425 289
258 3300003354 JGI25160J50197_1000197 JGI25160J50197_100019734 289
259 3300003374 JGI25161J50226_1000057 JGI25161J50226_100005770 289
260 3300003773 Ga0055537_1014032 Ga0055537_10140322 289
261 3300004625 Ga0055543_1000498 Ga0055543_100049820 289
262 3300005262 Ga0065165_1020630 Ga0065165_10206302 289
263 3300005262 Ga0065165_1020632 Ga0065165_10206322 289
264 3300006051 Ga0075364_10014350 Ga0075364_100143503 289
265 3300006177 Ga0075362_10031180 Ga0075362_100311802 289
266 3300006353 Ga0075370_10026605 Ga0075370_100266052 289
267 3300025263 Ga0209565_1002873 Ga0209565_10028732 289
268 3300025284 Ga0209130_1000146 Ga0209130_100014634 289
269 3300025291 Ga0209675_1000738 Ga0209675_10007387 289
270 3300025294 Ga0209025_1009702 Ga0209025_10097023 289
271 3300025297 Ga0209758_1003916 Ga0209758_10039162 289
272 3300025299 Ga0209256_1026192 Ga0209256_10261921 289
273 3300025302 Ga0207426_1000291 Ga0207426_100029170 289
274 3300028786 Ga0307517_10065455 Ga0307517_100654552 289
275 3300046507 Ga0495606_0079480 Ga0495606_0079480_360_1412 289
276 3300046519 Ga0495632_0003377 Ga0495632_0003377_7000_8001 289
277 3300046665 Ga0495661_0028693 Ga0495661_0028693_813_1814 289
278 3300049778 Ga0501282_000012 Ga0501282_000012_4978_6039 289
279 3300049853 Ga0501226_000197 Ga0501226_000197_905_1966 289
280 3300050489 nmdc:mga03683_82830_c1 nmdc:mga03683_82830_c1_272_1237 289
281 3300031456 Ga0307513_10000266 Ga0307513_1000026638 290
282 3300046660 Ga0495625_0170741 Ga0495625_0170741_21_1046 290
283 3300048091 Ga0495626_0002351 Ga0495626_0002351_5434_6444 290
284 3300053145 Ga0500586_056301 Ga0500586_056301_299_1321 290
285 3300053730 Ga0500645_021441 Ga0500645_021441_722_1726 290
286 3300003215 JGI25153J46596_10011532 JGI25153J46596_100115323 291
287 3300003771 Ga0055526_1005767 Ga0055526_10057675 291
288 3300025245 Ga0207425_1000519 Ga0207425_10005195 291
289 3300025258 Ga0209129_1000075 Ga0209129_100007528 291
290 3300025295 Ga0209564_1000046 Ga0209564_1000046192 291
291 3300025297 Ga0209758_1000052 Ga0209758_1000052271 291
292 3300028786 Ga0307517_10001409 Ga0307517_1000140919 291
293 3300002739 JGI25158J39367_1008974 JGI25158J39367_10089742 292
294 3300002774 JGI25150J39212_1002533 JGI25150J39212_10025332 292
295 3300004625 Ga0055543_1002109 Ga0055543_10021094 292
296 3300005262 Ga0065165_1004071 Ga0065165_10040717 292
297 3300010375 Ga0105239_10098272 Ga0105239_100982722 292
298 3300015683 Ga0183362_10007 Ga0183362_10007187 292
299 3300025245 Ga0207425_1000231 Ga0207425_100023132 292
300 3300025258 Ga0209129_1000177 Ga0209129_100017767 292
301 3300025263 Ga0209565_1001622 Ga0209565_10016227 292
302 3300025273 Ga0209673_1000507 Ga0209673_100050761 292
303 3300025284 Ga0209130_1000397 Ga0209130_10003978 292
304 3300025294 Ga0209025_1000322 Ga0209025_100032267 292
305 3300025295 Ga0209564_1000226 Ga0209564_100022686 292
306 3300025297 Ga0209758_1000142 Ga0209758_1000142124 292
307 3300025299 Ga0209256_1000114 Ga0209256_1000114124 292
308 3300025302 Ga0207426_1000162 Ga0207426_1000162123 292
309 3300025303 Ga0209051_1008992 Ga0209051_10089922 292
310 3300025304 Ga0209257_1010885 Ga0209257_10108852 292
311 3300046471 Ga0495650_0034631 Ga0495650_0034631_1151_2164 292
312 3300046474 Ga0495605_0004698 Ga0495605_0004698_4672_5685 292
313 3300046506 Ga0495583_0003302 Ga0495583_0003302_7823_8836 292
314 3300046515 Ga0495620_0018682 Ga0495620_0018682_543_1556 292
315 3300046526 Ga0495666_0036525 Ga0495666_0036525_666_1679 292
316 3300046528 Ga0495642_0033393 Ga0495642_0033393_236_1249 292
317 3300046665 Ga0495661_0045740 Ga0495661_0045740_1040_2053 292
318 3300046679 Ga0495623_0011666 Ga0495623_0011666_1781_2824 292
319 3300047319 Ga0495674_0011367 Ga0495674_0011367_1543_2556 292
320 3300047321 Ga0495676_0122407 Ga0495676_0122407_238_1251 292
321 3300047323 Ga0495683_0017625 Ga0495683_0017625_1682_2695 292
322 3300047446 Ga0495679_000062 Ga0495679_000062_12673_13686 292
323 3300048903 Ga0496100_0001569 Ga0496100_0001569_1630_2601 292
324 3300048904 Ga0496101_0023195 Ga0496101_0023195_2939_3910 292
325 3300048905 Ga0496102_0069585 Ga0496102_0069585_2110_3081 292
326 3300048906 Ga0496103_0030130 Ga0496103_0030130_143_1114 292
327 3300048908 Ga0496105_0021980 Ga0496105_0021980_1994_2965 292
328 3300048920 Ga0496117_0045532 Ga0496117_0045532_969_1982 292
329 3300048920 Ga0496117_0082953 Ga0496117_0082953_456_1427 292
330 3300048921 Ga0496118_0003224 Ga0496118_0003224_6415_7386 292
331 3300048921 Ga0496118_0056709 Ga0496118_0056709_1601_2614 292
332 3300048924 Ga0496121_0047731 Ga0496121_0047731_467_1480 292
333 3300048926 Ga0496123_0115811 Ga0496123_0115811_398_1369 292
334 3300049459 Ga0495678_016813 Ga0495678_016813_2276_3289 292
335 3300049460 Ga0495682_0008266 Ga0495682_0008266_2555_3568 292
336 3300006042 Ga0075368_10054919 Ga0075368_100549192 293
337 3300006353 Ga0075370_10072776 Ga0075370_100727762 293
338 3300021384 Ga0213876_10020395 Ga0213876_100203953 293
339 3300039437 Ga0436365_0310708 Ga0436365_0310708_1217_2245 293
340 3300046492 Ga0495585_0064522 Ga0495585_0064522_410_1411 293
341 3300046506 Ga0495583_0003383 Ga0495583_0003383_4232_5233 293
342 3300048929 Ga0496126_0041149 Ga0496126_0041149_612_1619 293
343 3300005468 Ga0070707_100221038 Ga0070707_1002210382 294
344 3300009011 Ga0105251_10001178 Ga0105251_1000117816 294
345 3300009545 Ga0105237_10422911 Ga0105237_104229112 294
346 3300011119 Ga0105246_10214561 Ga0105246_102145612 294
347 3300013306 Ga0163162_10012831 Ga0163162_100128317 294
348 3300025302 Ga0207426_1009659 Ga0207426_10096594 294
349 3300025735 Ga0207713_1002163 Ga0207713_100216314 294
350 3300025935 Ga0207709_10038894 Ga0207709_100388943 294
351 3300027614 Ga0209970_1000943 Ga0209970_10009433 294
352 3300031649 Ga0307514_10000591 Ga0307514_1000059126 294
353 3300037471 Ga0395905_0026258 Ga0395905_0026258_3865_4881 294
354 3300046491 Ga0495584_0018765 Ga0495584_0018765_1612_2628 294
355 3300046500 Ga0495596_0072965 Ga0495596_0072965_212_1228 294
356 3300046516 Ga0495628_0003458 Ga0495628_0003458_5011_6033 294
357 3300046519 Ga0495632_0004457 Ga0495632_0004457_4237_5238 294
358 3300046809 Ga0495600_0129048 Ga0495600_0129048_467_1489 294
359 3300047317 Ga0495604_0085582 Ga0495604_0085582_945_1961 294
360 3300047443 Ga0495687_000021 Ga0495687_000021_250889_251905 294
361 3300047472 Ga0495686_0000143 Ga0495686_0000143_24627_25649 294
362 3300048903 Ga0496100_0007718 Ga0496100_0007718_2895_3911 294
363 3300048904 Ga0496101_0002922 Ga0496101_0002922_5028_6044 294
364 3300048905 Ga0496102_0005300 Ga0496102_0005300_5460_6476 294
365 3300048906 Ga0496103_0004527 Ga0496103_0004527_793_1809 294
366 3300048913 Ga0496110_0035483 Ga0496110_0035483_1660_2676 294
367 3300048914 Ga0496111_0002649 Ga0496111_0002649_3823_4839 294
368 3300048915 Ga0496112_0053004 Ga0496112_0053004_2674_3690 294
369 3300048916 Ga0496113_0005907 Ga0496113_0005907_3125_4141 294
370 3300048919 Ga0496116_0002045 Ga0496116_0002045_14487_15503 294
371 3300048920 Ga0496117_0003643 Ga0496117_0003643_5995_7011 294
372 3300048921 Ga0496118_0006911 Ga0496118_0006911_6112_7128 294
373 3300048924 Ga0496121_0000729 Ga0496121_0000729_31057_32046 294
374 3300048924 Ga0496121_0001997 Ga0496121_0001997_18197_19213 294
375 3300048925 Ga0496122_0026189 Ga0496122_0026189_3420_4436 294
376 3300048928 Ga0496125_0024632 Ga0496125_0024632_4475_5491 294
377 3300003187 JGI25151J46595_10003086 JGI25151J46595_100030865 295
378 3300005262 Ga0065165_1010720 Ga0065165_10107203 295
379 3300006195 Ga0075366_10032100 Ga0075366_100321002 295
380 3300006353 Ga0075370_10002879 Ga0075370_100028792 295
381 3300028381 Ga0268264_10373114 Ga0268264_103731142 295
382 3300042121 Ga0450919_000867 Ga0450919_000867_1621_2613 295
383 3300042531 Ga0450918_000421 Ga0450918_000421_3175_4167 295
384 3300046459 Ga0495629_0000099 Ga0495629_0000099_68514_69527 295
385 3300046463 Ga0495653_0005509 Ga0495653_0005509_2944_3957 295
386 3300046690 Ga0495624_0004966 Ga0495624_0004966_6524_7537 295
387 3300047320 Ga0495672_0154188 Ga0495672_0154188_122_1123 295
388 3300047673 Ga0495593_0049527 Ga0495593_0049527_637_1650 295
389 3300050493 nmdc:mga0k408_8433_c1 nmdc:mga0k408_8433_c1_1554_2555 295
390 3300025253 Ga0209677_101314 Ga0209677_1013145 296
391 3300026067 Ga0207678_10236650 Ga0207678_102366502 296
392 3300028794 Ga0307515_10000011 Ga0307515_10000011194 296
393 3300044683 Ga0466965_0059410 Ga0466965_0059410_674_1690 296
394 3300044693 Ga0466961_0022604 Ga0466961_0022604_1117_2133 296
395 3300045976 Ga0466967_0061269 Ga0466967_0061269_24_1037 296
396 3300047443 Ga0495687_019258 Ga0495687_019258_2342_3331 296
397 3300048921 Ga0496118_0053862 Ga0496118_0053862_759_1760 296
398 3300048924 Ga0496121_0015030 Ga0496121_0015030_3426_4427 296
399 3300053088 Ga0500644_0003585 Ga0500644_0003585_1863_2852 296
400 3300053117 Ga0500593_017715 Ga0500593_017715_1912_2901 296
401 3300006195 Ga0075366_10017601 Ga0075366_100176012 297
402 3300028794 Ga0307515_10009575 Ga0307515_1000957512 297
403 3300031456 Ga0307513_10000028 Ga0307513_1000002875 297
404 3300031456 Ga0307513_10150807 Ga0307513_101508072 297
405 3300031730 Ga0307516_10037428 Ga0307516_100374284 297
406 3300041404 Ga0439436_0004464 Ga0439436_0004464_311_1291 297
407 3300041410 Ga0439461_0009786 Ga0439461_0009786_376_1356 297
408 3300041411 Ga0439466_0011171 Ga0439466_0011171_1545_2525 297
409 3300042010 Ga0439452_045941 Ga0439452_045941_20_1000 297
410 3300046454 Ga0495592_0024918 Ga0495592_0024918_1401_2405 297
411 3300046463 Ga0495653_0005080 Ga0495653_0005080_4950_5954 297
412 3300046511 Ga0495608_0008462 Ga0495608_0008462_3506_4510 297
413 3300046519 Ga0495632_0001877 Ga0495632_0001877_8622_9623 297
414 3300046663 Ga0495635_0052007 Ga0495635_0052007_534_1538 297
415 3300046675 Ga0495657_0021227 Ga0495657_0021227_2061_3065 297
416 3300046680 Ga0495646_0005873 Ga0495646_0005873_4176_5180 297
417 3300046690 Ga0495624_0010748 Ga0495624_0010748_4400_5404 297
418 3300046810 Ga0495660_0004843 Ga0495660_0004843_7089_8090 297
419 3300048088 Ga0495602_0095446 Ga0495602_0095446_222_1226 297
420 3300049459 Ga0495678_001700 Ga0495678_001700_8621_9622 297
421 3300050493 nmdc:mga0k408_26519_c1 nmdc:mga0k408_26519_c1_1983_2990 297
422 3300053077 Ga0495601_0004880 Ga0495601_0004880_2798_3802 297
423 3300005367 Ga0070667_100042983 Ga0070667_1000429834 298
424 3300005536 Ga0070697_100035168 Ga0070697_1000351684 298
425 3300009177 Ga0105248_10030408 Ga0105248_100304085 298
426 3300014968 Ga0157379_10015233 Ga0157379_100152335 298
427 3300017792 Ga0163161_10117077 Ga0163161_101170772 298
428 3300025918 Ga0207662_10029543 Ga0207662_100295433 298
429 3300025926 Ga0207659_10013438 Ga0207659_100134383 298
430 3300025940 Ga0207691_10013517 Ga0207691_100135174 298
431 3300026041 Ga0207639_10029823 Ga0207639_100298233 298
432 3300026142 Ga0207698_10057110 Ga0207698_100571102 298
433 3300028381 Ga0268264_10014275 Ga0268264_100142754 298
434 3300031548 Ga0307408_100003558 Ga0307408_1000035587 298
435 3300046454 Ga0495592_0069043 Ga0495592_0069043_1250_2263 298
436 3300046458 Ga0495591_004275 Ga0495591_004275_782_1795 298
437 3300046459 Ga0495629_0010153 Ga0495629_0010153_2268_3281 298
438 3300046471 Ga0495650_0004415 Ga0495650_0004415_8607_9599 298
439 3300046472 Ga0495580_0040424 Ga0495580_0040424_2113_3126 298
440 3300046500 Ga0495596_0004032 Ga0495596_0004032_5960_6973 298
441 3300046511 Ga0495608_0020592 Ga0495608_0020592_962_1975 298
442 3300046524 Ga0495648_0037575 Ga0495648_0037575_1551_2564 298
443 3300046526 Ga0495666_0003934 Ga0495666_0003934_1250_2263 298
444 3300046529 Ga0495652_0069512 Ga0495652_0069512_1035_2048 298
445 3300046531 Ga0495665_0015627 Ga0495665_0015627_2865_3878 298
446 3300046533 Ga0495640_0049081 Ga0495640_0049081_389_1402 298
447 3300046535 Ga0495586_0109831 Ga0495586_0109831_453_1466 298
448 3300046557 Ga0495622_0000228 Ga0495622_0000228_24364_25377 298
449 3300046642 Ga0495634_0058243 Ga0495634_0058243_1251_2264 298
450 3300046663 Ga0495635_0019736 Ga0495635_0019736_1270_2283 298
451 3300046679 Ga0495623_0008843 Ga0495623_0008843_5292_6305 298
452 3300046680 Ga0495646_0003844 Ga0495646_0003844_6155_7168 298
453 3300046689 Ga0495613_0060671 Ga0495613_0060671_1491_2504 298
454 3300046690 Ga0495624_0117286 Ga0495624_0117286_418_1431 298
455 3300046794 Ga0495589_0006289 Ga0495589_0006289_4776_5789 298
456 3300047446 Ga0495679_002752 Ga0495679_002752_3255_4268 298
457 3300047673 Ga0495593_0013358 Ga0495593_0013358_3356_4369 298
458 3300048088 Ga0495602_0034290 Ga0495602_0034290_3472_4485 298
459 3300049459 Ga0495678_011291 Ga0495678_011291_81_1097 298
460 3300049570 Ga0501033_0155584 Ga0501033_0155584_92_1102 298
461 3300049573 Ga0501037_0135287 Ga0501037_0135287_118_1128 298
462 3300049579 Ga0501043_0296286 Ga0501043_0296286_24_1034 298
463 3300049822 Ga0501035_0066710 Ga0501035_0066710_14_1024 298
464 3300049823 Ga0501044_0025828 Ga0501044_0025828_5028_6038 298
465 3300003316 rootH1_10147247 rootH1_101472472 299
466 3300003322 rootL2_10098720 rootL2_100987204 299
467 3300005335 Ga0070666_10050880 Ga0070666_100508803 299
468 3300005367 Ga0070667_100148601 Ga0070667_1001486012 299
469 3300005455 Ga0070663_100204492 Ga0070663_1002044922 299
470 3300005539 Ga0068853_100028550 Ga0068853_1000285502 299
471 3300009011 Ga0105251_10000617 Ga0105251_1000061713 299
472 3300009093 Ga0105240_10014030 Ga0105240_100140305 299
473 3300009545 Ga0105237_10005096 Ga0105237_100050965 299
474 3300010375 Ga0105239_10012755 Ga0105239_100127558 299
475 3300013306 Ga0163162_10011338 Ga0163162_100113387 299
476 3300013308 Ga0157375_10017976 Ga0157375_100179765 299
477 3300025295 Ga0209564_1008950 Ga0209564_10089504 299
478 3300025735 Ga0207713_1000657 Ga0207713_100065715 299
479 3300025903 Ga0207680_10042760 Ga0207680_100427602 299
480 3300025904 Ga0207647_10042957 Ga0207647_100429573 299
481 3300025913 Ga0207695_10008374 Ga0207695_100083748 299
482 3300025914 Ga0207671_10014342 Ga0207671_100143425 299
483 3300025945 Ga0207679_10036113 Ga0207679_100361133 299
484 3300026041 Ga0207639_10014825 Ga0207639_100148253 299
485 3300031507 Ga0307509_10267153 Ga0307509_102671532 299
486 3300031852 Ga0307410_10020608 Ga0307410_100206084 299
487 3300031911 Ga0307412_10081851 Ga0307412_100818512 299
488 3300031995 Ga0307409_100325294 Ga0307409_1003252942 299
489 3300032002 Ga0307416_100039228 Ga0307416_1000392282 299
490 3300041999 Ga0439433_0021258 Ga0439433_0021258_121_1125 299
491 3300042007 Ga0439449_0000299 Ga0439449_0000299_13979_14983 299
492 3300044712 Ga0453684_0007265 Ga0453684_0007265_5228_6229 299
493 3300046460 Ga0495638_0001238 Ga0495638_0001238_19936_20952 299
494 3300046474 Ga0495605_0002109 Ga0495605_0002109_3259_4275 299
495 3300046501 Ga0495607_0012564 Ga0495607_0012564_2298_3314 299
496 3300046518 Ga0495631_0033760 Ga0495631_0033760_31_1047 299
497 3300046528 Ga0495642_0073994 Ga0495642_0073994_160_1176 299
498 3300046684 Ga0495669_0002518 Ga0495669_0002518_3302_4318 299
499 3300046691 Ga0495670_0004905 Ga0495670_0004905_3157_4173 299
500 3300046694 Ga0495649_0002383 Ga0495649_0002383_5996_7012 299
501 3300046794 Ga0495589_0003673 Ga0495589_0003673_4160_5176 299
502 3300048088 Ga0495602_0004982 Ga0495602_0004982_2815_3855 299
503 3300048904 Ga0496101_0213177 Ga0496101_0213177_266_1282 299
504 3300048907 Ga0496104_0417896 Ga0496104_0417896_95_1111 299
505 3300048909 Ga0496106_0022436 Ga0496106_0022436_758_1774 299
506 3300048913 Ga0496110_0432203 Ga0496110_0432203_161_1177 299
507 3300048920 Ga0496117_0035727 Ga0496117_0035727_1944_2957 299
508 3300053108 Ga0500562_000722 Ga0500562_000722_5178_6128 299
509 3300015262 Ga0182007_10000498 Ga0182007_100004988 300
510 3300031903 Ga0307407_10123889 Ga0307407_101238892 300
511 3300046454 Ga0495592_0042101 Ga0495592_0042101_1638_2651 300
512 3300046455 Ga0495603_0009718 Ga0495603_0009718_653_1666 300
513 3300046459 Ga0495629_0002528 Ga0495629_0002528_8353_9366 300
514 3300046461 Ga0495641_0011284 Ga0495641_0011284_2903_3916 300
515 3300046472 Ga0495580_0010070 Ga0495580_0010070_205_1218 300
516 3300046473 Ga0495582_0001861 Ga0495582_0001861_3952_4965 300
517 3300046477 Ga0495664_0003299 Ga0495664_0003299_675_1688 300
518 3300046514 Ga0495618_0040507 Ga0495618_0040507_980_1993 300
519 3300046516 Ga0495628_0023031 Ga0495628_0023031_3948_4961 300
520 3300046517 Ga0495630_0031175 Ga0495630_0031175_1875_2888 300
521 3300046524 Ga0495648_0009869 Ga0495648_0009869_770_1783 300
522 3300046526 Ga0495666_0003339 Ga0495666_0003339_383_1396 300
523 3300046529 Ga0495652_0021791 Ga0495652_0021791_608_1621 300
524 3300046531 Ga0495665_0010898 Ga0495665_0010898_2045_3058 300
525 3300046535 Ga0495586_0062105 Ga0495586_0062105_66_1079 300
526 3300046536 Ga0495587_0022073 Ga0495587_0022073_147_1160 300
527 3300046543 Ga0495645_0002132 Ga0495645_0002132_5771_6784 300
528 3300046543 Ga0495645_0020020 Ga0495645_0020020_3289_4293 300
529 3300046642 Ga0495634_0006106 Ga0495634_0006106_4512_5525 300
530 3300046663 Ga0495635_0014303 Ga0495635_0014303_1596_2609 300
531 3300046665 Ga0495661_0112101 Ga0495661_0112101_304_1317 300
532 3300046680 Ga0495646_0004809 Ga0495646_0004809_6270_7283 300
533 3300046689 Ga0495613_0009381 Ga0495613_0009381_643_1656 300
534 3300046690 Ga0495624_0034679 Ga0495624_0034679_205_1218 300
535 3300047315 Ga0495581_0017586 Ga0495581_0017586_3128_4141 300
536 3300047317 Ga0495604_0015206 Ga0495604_0015206_770_1783 300
537 3300047319 Ga0495674_0313037 Ga0495674_0313037_66_1079 300
538 3300047321 Ga0495676_0002802 Ga0495676_0002802_6142_7155 300
539 3300047322 Ga0495680_0016398 Ga0495680_0016398_4727_5740 300
540 3300047446 Ga0495679_037355 Ga0495679_037355_212_1225 300
541 3300048088 Ga0495602_0076453 Ga0495602_0076453_918_1931 300
542 3300048089 Ga0495614_0037838 Ga0495614_0037838_846_1859 300
543 3300048921 Ga0496118_0196785 Ga0496118_0196785_88_1104 300
544 3300002705 JGI25156J39149_1000882 JGI25156J39149_10008824 301
545 3300002705 JGI25156J39149_1001290 JGI25156J39149_10012904 301
546 3300002705 JGI25156J39149_1003392 JGI25156J39149_10033922 301
547 3300003214 JGI25165J46597_1001015 JGI25165J46597_100101514 301
548 3300003320 rootH2_10013344 rootH2_100133442 301
549 3300003756 Ga0055533_1000489 Ga0055533_10004899 301
550 3300003756 Ga0055533_1000969 Ga0055533_10009694 301
551 3300003758 Ga0055532_1000001 Ga0055532_1000001746 301
552 3300003760 Ga0055527_1000002 Ga0055527_100000212 301
553 3300003761 Ga0055535_1000001 Ga0055535_1000001258 301
554 3300003762 Ga0055542_1000001 Ga0055542_1000001745 301
555 3300003763 Ga0055529_1000001 Ga0055529_1000001258 301
556 3300003791 Ga0055530_10009983 Ga0055530_100099832 301
557 3300003792 Ga0055540_1000028 Ga0055540_100002830 301
558 3300005339 Ga0070660_100092840 Ga0070660_1000928401 301
559 3300005356 Ga0070674_100019489 Ga0070674_1000194894 301
560 3300005459 Ga0068867_100241004 Ga0068867_1002410042 301
561 3300021361 Ga0213872_10000085 Ga0213872_1000008575 301
562 3300025226 Ga0209674_100005 Ga0209674_1000051175 301
563 3300025226 Ga0209674_100130 Ga0209674_100130111 301
564 3300025228 Ga0209672_100001 Ga0209672_1000011576 301
565 3300025229 Ga0209147_100001 Ga0209147_1000011576 301
566 3300025230 Ga0209563_101174 Ga0209563_1011744 301
567 3300025231 Ga0207427_103818 Ga0207427_1038182 301
568 3300025242 Ga0209258_100001 Ga0209258_1000011576 301
569 3300025254 Ga0209148_1000003 Ga0209148_10000031576 301
570 3300025256 Ga0209759_1000033 Ga0209759_100003317 301
571 3300025256 Ga0209759_1000228 Ga0209759_100022818 301
572 3300025256 Ga0209759_1000465 Ga0209759_100046521 301
573 3300025261 Ga0209233_1000016 Ga0209233_1000016538 301
574 3300025272 Ga0209455_1000001 Ga0209455_10000011576 301
575 3300025298 Ga0209050_1000282 Ga0209050_100028270 301
576 3300025303 Ga0209051_1000022 Ga0209051_1000022295 301
577 3300025304 Ga0209257_1000030 Ga0209257_1000030493 301
578 3300025937 Ga0207669_10025763 Ga0207669_100257632 301
579 3300026121 Ga0207683_10326069 Ga0207683_103260692 301
580 3300031730 Ga0307516_10000286 Ga0307516_1000028659 301
581 3300037418 Ga0395900_0048413 Ga0395900_0048413_2984_3979 301
582 3300037466 Ga0395898_0160706 Ga0395898_0160706_1071_2066 301
583 3300038443 Ga0395901_0143198 Ga0395901_0143198_1252_2247 301
584 3300039447 Ga0436361_0019641 Ga0436361_0019641_29273_30229 301
585 3300046454 Ga0495592_0040044 Ga0495592_0040044_2272_3285 301
586 3300046457 Ga0495590_0003281 Ga0495590_0003281_2668_3681 301
587 3300046463 Ga0495653_0008515 Ga0495653_0008515_160_1200 301
588 3300046472 Ga0495580_0003604 Ga0495580_0003604_6743_7756 301
589 3300046473 Ga0495582_0003786 Ga0495582_0003786_2709_3722 301
590 3300046473 Ga0495582_0006286 Ga0495582_0006286_3260_4300 301
591 3300046474 Ga0495605_0008474 Ga0495605_0008474_3113_4114 301
592 3300046499 Ga0495594_0015701 Ga0495594_0015701_480_1520 301
593 3300046516 Ga0495628_0069657 Ga0495628_0069657_1000_2013 301
594 3300046517 Ga0495630_0012146 Ga0495630_0012146_2101_3114 301
595 3300046517 Ga0495630_0013472 Ga0495630_0013472_4899_5912 301
596 3300046517 Ga0495630_0014368 Ga0495630_0014368_3227_4267 301
597 3300046526 Ga0495666_0001463 Ga0495666_0001463_6607_7620 301
598 3300046526 Ga0495666_0017613 Ga0495666_0017613_1924_2964 301
599 3300046529 Ga0495652_0004360 Ga0495652_0004360_2298_3311 301
600 3300046531 Ga0495665_0008381 Ga0495665_0008381_2863_3903 301
601 3300046533 Ga0495640_0003844 Ga0495640_0003844_36_1049 301
602 3300046535 Ga0495586_0157526 Ga0495586_0157526_218_1258 301
603 3300046543 Ga0495645_0114657 Ga0495645_0114657_151_1164 301
604 3300046642 Ga0495634_0023179 Ga0495634_0023179_95_1135 301
605 3300046663 Ga0495635_0002474 Ga0495635_0002474_11074_12087 301
606 3300046674 Ga0495588_0012344 Ga0495588_0012344_1287_2327 301
607 3300046678 Ga0495599_0053546 Ga0495599_0053546_176_1189 301
608 3300046679 Ga0495623_0003030 Ga0495623_0003030_5165_6178 301
609 3300046679 Ga0495623_0026960 Ga0495623_0026960_1239_2279 301
610 3300046679 Ga0495623_0078147 Ga0495623_0078147_835_1848 301
611 3300046690 Ga0495624_0001198 Ga0495624_0001198_11931_12944 301
612 3300046690 Ga0495624_0032896 Ga0495624_0032896_1986_2999 301
613 3300046694 Ga0495649_0007356 Ga0495649_0007356_492_1505 301
614 3300046809 Ga0495600_0001264 Ga0495600_0001264_10664_11677 301
615 3300047315 Ga0495581_0006644 Ga0495581_0006644_4935_5948 301
616 3300047317 Ga0495604_0013843 Ga0495604_0013843_1696_2736 301
617 3300047319 Ga0495674_0063731 Ga0495674_0063731_1253_2266 301
618 3300047322 Ga0495680_0057508 Ga0495680_0057508_636_1649 301
619 3300047323 Ga0495683_0001235 Ga0495683_0001235_2170_3183 301
620 3300047444 Ga0495675_0010686 Ga0495675_0010686_2563_3576 301
621 3300047444 Ga0495675_0028506 Ga0495675_0028506_458_1498 301
622 3300047445 Ga0495677_0000839 Ga0495677_0000839_7185_8186 301
623 3300047471 Ga0495684_0105977 Ga0495684_0105977_359_1372 301
624 3300047673 Ga0495593_0007772 Ga0495593_0007772_2359_3372 301
625 3300048091 Ga0495626_0020354 Ga0495626_0020354_1822_2835 301
626 3300048091 Ga0495626_0057430 Ga0495626_0057430_48_1049 301
627 3300048920 Ga0496117_0009137 Ga0496117_0009137_5290_6303 301
628 3300048921 Ga0496118_0004058 Ga0496118_0004058_10095_11108 301
629 3300048929 Ga0496126_0003802 Ga0496126_0003802_6414_7427 301
630 3300005981 Ga0081538_10047708 Ga0081538_100477082 302
631 3300025303 Ga0209051_1024449 Ga0209051_10244492 302
632 3300044684 Ga0466966_0023958 Ga0466966_0023958_2907_3929 302
633 3300044693 Ga0466961_0011599 Ga0466961_0011599_2939_3961 302
634 3300044901 Ga0466960_0144371 Ga0466960_0144371_35_1042 302
635 3300045049 Ga0466959_0009449 Ga0466959_0009449_974_1996 302
636 3300046477 Ga0495664_0016605 Ga0495664_0016605_141_1157 302
637 3300046542 Ga0495597_0077868 Ga0495597_0077868_114_1151 302
638 3300046543 Ga0495645_0094129 Ga0495645_0094129_947_1963 302
639 3300046674 Ga0495588_0037080 Ga0495588_0037080_383_1399 302
640 3300046678 Ga0495599_0160552 Ga0495599_0160552_170_1186 302
641 3300048909 Ga0496106_0000074 Ga0496106_0000074_6888_7904 302
642 3300048924 Ga0496121_0000941 Ga0496121_0000941_6796_7812 302
643 3300048929 Ga0496126_0001112 Ga0496126_0001112_28633_29646 302
644 iso_pu_bacteria 2738541337 2739056357 302
645 3300003773 Ga0055537_1000319 Ga0055537_100031918 303
646 3300003775 Ga0055524_1000357 Ga0055524_100035727 303
647 3300003784 Ga0055534_1003074 Ga0055534_10030744 303
648 3300003790 Ga0055528_1004884 Ga0055528_10048845 303
649 3300003791 Ga0055530_10000826 Ga0055530_100008269 303
650 3300003792 Ga0055540_1000470 Ga0055540_100047022 303
651 3300005262 Ga0065165_1022702 Ga0065165_10227022 303
652 3300006946 Ga0079104_1011351 Ga0079104_10113512 303
653 3300016635 Ga0183361_10018 Ga0183361_1001891 303
654 3300025245 Ga0207425_1003429 Ga0207425_10034292 303
655 3300025263 Ga0209565_1000101 Ga0209565_100010173 303
656 3300025273 Ga0209673_1000687 Ga0209673_100068735 303
657 3300025284 Ga0209130_1000420 Ga0209130_100042018 303
658 3300025291 Ga0209675_1000121 Ga0209675_100012135 303
659 3300025292 Ga0209676_1000073 Ga0209676_100007378 303
660 3300025292 Ga0209676_1004539 Ga0209676_10045395 303
661 3300025294 Ga0209025_1003535 Ga0209025_100353510 303
662 3300025294 Ga0209025_1003575 Ga0209025_10035757 303
663 3300025295 Ga0209564_1000798 Ga0209564_100079826 303
664 3300025295 Ga0209564_1001300 Ga0209564_100130019 303
665 3300025295 Ga0209564_1013325 Ga0209564_10133253 303
666 3300025297 Ga0209758_1022630 Ga0209758_10226303 303
667 3300025298 Ga0209050_1000008 Ga0209050_1000008985 303
668 3300025298 Ga0209050_1009234 Ga0209050_10092344 303
669 3300025299 Ga0209256_1000168 Ga0209256_100016835 303
670 3300025302 Ga0207426_1001322 Ga0207426_100132219 303
671 3300025303 Ga0209051_1000005 Ga0209051_1000005985 303
672 3300025304 Ga0209257_1000031 Ga0209257_1000031575 303
673 3300025304 Ga0209257_1009911 Ga0209257_10099114 303
674 3300031250 Ga0265331_10000857 Ga0265331_1000085716 303
675 3300031251 Ga0265327_10001107 Ga0265327_1000110716 303
676 3300031548 Ga0307408_100095846 Ga0307408_1000958462 303
677 3300041404 Ga0439436_0001754 Ga0439436_0001754_1590_2600 303
678 3300041407 Ga0439447_011372 Ga0439447_011372_347_1357 303
679 3300041410 Ga0439461_0010908 Ga0439461_0010908_132_1142 303
680 3300041413 Ga0439465_0001267 Ga0439465_0001267_2287_3297 303
681 3300041997 Ga0439431_0001384 Ga0439431_0001384_4307_5317 303
682 3300042004 Ga0439445_0000386 Ga0439445_0000386_2934_3944 303
683 3300042006 Ga0439432_000780 Ga0439432_000780_4926_5936 303
684 3300042007 Ga0439449_0001289 Ga0439449_0001289_2377_3387 303
685 3300042010 Ga0439452_000743 Ga0439452_000743_2519_3529 303
686 3300047472 Ga0495686_0008230 Ga0495686_0008230_2483_3460 303
687 3300048912 Ga0496109_0199794 Ga0496109_0199794_512_1513 303
688 3300001989 JGI24739J22299_10001637 JGI24739J22299_100016373 304
689 3300002067 JGI24735J21928_10022052 JGI24735J21928_100220522 304
690 3300002704 JGI25155J39150_1000033 JGI25155J39150_100003362 304
691 3300002705 JGI25156J39149_1000043 JGI25156J39149_100004362 304
692 3300002738 JGI25154J39366_1000062 JGI25154J39366_100006233 304
693 3300002741 JGI25157J39369_1000060 JGI25157J39369_100006062 304
694 3300003354 JGI25160J50197_1000647 JGI25160J50197_10006471 304
695 3300005262 Ga0065165_1000791 Ga0065165_100079115 304
696 3300005327 Ga0070658_10093830 Ga0070658_100938302 304
697 3300005455 Ga0070663_100247658 Ga0070663_1002476582 304
698 3300006038 Ga0075365_10081106 Ga0075365_100811063 304
699 3300013105 Ga0157369_10060390 Ga0157369_100603903 304
700 3300025206 Ga0209435_100041 Ga0209435_10004162 304
701 3300025246 Ga0209646_1000144 Ga0209646_100014462 304
702 3300025250 Ga0209026_1000159 Ga0209026_100015962 304
703 3300025256 Ga0209759_1000001 Ga0209759_10000012591 304
704 3300025284 Ga0209130_1007554 Ga0209130_10075541 304
705 3300025302 Ga0207426_1000305 Ga0207426_100030526 304
706 3300026067 Ga0207678_10075790 Ga0207678_100757902 304
707 3300026067 Ga0207678_10368978 Ga0207678_103689782 304
708 3300031911 Ga0307412_10000005 Ga0307412_1000000566 304
709 3300046472 Ga0495580_0007967 Ga0495580_0007967_6540_7553 304
710 3300046500 Ga0495596_0004483 Ga0495596_0004483_1458_2471 304
711 3300046512 Ga0495610_0009449 Ga0495610_0009449_2345_3358 304
712 3300046522 Ga0495643_0047480 Ga0495643_0047480_204_1217 304
713 3300046528 Ga0495642_0012624 Ga0495642_0012624_247_1260 304
714 3300046692 Ga0495671_0003077 Ga0495671_0003077_511_1521 304
715 3300048091 Ga0495626_0058933 Ga0495626_0058933_245_1258 304
716 3300048920 Ga0496117_0052876 Ga0496117_0052876_1176_2189 304
717 3300048921 Ga0496118_0007095 Ga0496118_0007095_9936_10949 304
718 3300048927 Ga0496124_0013498 Ga0496124_0013498_4190_5209 304
719 3300050492 nmdc:mga0yw44_145781_c1 nmdc:mga0yw44_145781_c1_150_1169 304
720 iso_pu_bacteria 8055087960 8055090379 304
721 3300006177 Ga0075362_10054016 Ga0075362_100540162 305
722 3300006178 Ga0075367_10161888 Ga0075367_101618881 305
723 3300006195 Ga0075366_10006347 Ga0075366_100063472 305
724 3300025303 Ga0209051_1019490 Ga0209051_10194902 305
725 3300042532 Ga0450893_0011463 Ga0450893_0011463_38_1054 305
726 3300044842 Ga0466957_0022012 Ga0466957_0022012_98_1144 305
727 3300046524 Ga0495648_0000225 Ga0495648_0000225_47381_48391 305
728 3300046538 Ga0495609_0000593 Ga0495609_0000593_23939_24949 305
729 3300047320 Ga0495672_0000188 Ga0495672_0000188_82951_83961 305
730 3300047323 Ga0495683_0007948 Ga0495683_0007948_4190_5200 305
731 iso_pu_bacteria 2821131069 2821133266 305
732 iso_pu_bacteria 2842333319 2842336906 305
733 iso_pu_bacteria 2857558681 2857562686 305
734 3300003794 Ga0055531_10000064 Ga0055531_1000006492 306
735 3300005459 Ga0068867_100000091 Ga0068867_10000009113 306
736 3300009036 Ga0105244_10156003 Ga0105244_101560031 306
737 3300009148 Ga0105243_10000959 Ga0105243_100009595 306
738 3300014745 Ga0157377_10000107 Ga0157377_1000010713 306
739 3300025258 Ga0209129_1002205 Ga0209129_10022053 306
740 3300025294 Ga0209025_1000285 Ga0209025_10002855 306
741 3300025298 Ga0209050_1007070 Ga0209050_10070703 306
742 3300025304 Ga0209257_1000094 Ga0209257_1000094245 306
743 3300025935 Ga0207709_10001119 Ga0207709_1000111912 306
744 3300026089 Ga0207648_10000227 Ga0207648_1000022715 306
745 3300026118 Ga0207675_100367024 Ga0207675_1003670242 306
746 3300027614 Ga0209970_1000086 Ga0209970_10000864 306
747 3300031251 Ga0265327_10019215 Ga0265327_100192153 306
748 3300050496 nmdc:mga07m45_173967_c1 nmdc:mga07m45_173967_c1_160_1185 306
749 3300061719 Ga0466962_0016966 Ga0466962_0016966_790_1830 306
750 iso_pu_bacteria 2841911363 2841915982 306
751 iso_pu_bacteria 2841917233 2841921638 306
752 3300005843 Ga0068860_100463612 Ga0068860_1004636122 307
753 3300006042 Ga0075368_10030283 Ga0075368_100302832 307
754 3300006195 Ga0075366_10078359 Ga0075366_100783592 307
755 3300006237 Ga0097621_100199414 Ga0097621_1001994142 307
756 3300009545 Ga0105237_10358218 Ga0105237_103582182 307
757 3300021361 Ga0213872_10078626 Ga0213872_100786262 307
758 3300026088 Ga0207641_10143644 Ga0207641_101436442 307
759 3300027866 Ga0209813_10030952 Ga0209813_100309521 307
760 3300031507 Ga0307509_10037712 Ga0307509_100377124 307
761 3300031616 Ga0307508_10197624 Ga0307508_101976241 307
762 3300039447 Ga0436361_1151691 Ga0436361_1151691_84_1103 307
763 3300048912 Ga0496109_0212332 Ga0496109_0212332_462_1487 307
764 3300050495 nmdc:mga04h51_68239_c1 nmdc:mga04h51_68239_c1_82_1110 307
765 iso_pu_bacteria 2600255292 2601671286 307
766 iso_pu_bacteria 2857547612 2857548874 307
767 iso_pu_bacteria 2885080285 2885085771 307
768 iso_pu_bacteria 2932410948 2932415430 307
769 iso_pu_bacteria 2932416698 2932421409 307
770 3300003759 Ga0055525_1000013 Ga0055525_1000013409 308
771 3300005844 Ga0068862_100079112 Ga0068862_1000791122 308
772 3300025230 Ga0209563_100025 Ga0209563_100025178 308
773 3300025261 Ga0209233_1001484 Ga0209233_10014843 308
774 3300025272 Ga0209455_1001975 Ga0209455_10019757 308
775 3300028380 Ga0268265_10361858 Ga0268265_103618582 308
776 3300030745 Ga0316182_1075645 Ga0316182_10756453 308
777 3300037418 Ga0395900_0335921 Ga0395900_0335921_163_1158 308
778 3300037466 Ga0395898_0104090 Ga0395898_0104090_90_1085 308
779 3300046557 Ga0495622_0000002 Ga0495622_0000002_305577_306587 308
780 3300046694 Ga0495649_0002662 Ga0495649_0002662_4413_5414 308
781 iso_pu_bacteria 2818991436 2819544980 308
782 3300003323 rootH1_10025674 rootH1_100256743 309
783 3300003791 Ga0055530_10001026 Ga0055530_100010262 309
784 3300003794 Ga0055531_10029657 Ga0055531_100296572 309
785 3300005456 Ga0070678_100210011 Ga0070678_1002100112 309
786 3300005616 Ga0068852_100007764 Ga0068852_1000077642 309
787 3300009093 Ga0105240_10222295 Ga0105240_102222952 309
788 3300013308 Ga0157375_10084577 Ga0157375_100845772 309
789 3300014497 Ga0182008_10013213 Ga0182008_100132132 309
790 3300015262 Ga0182007_10005885 Ga0182007_100058853 309
791 3300025208 Ga0209436_105057 Ga0209436_1050573 309
792 3300025273 Ga0209673_1000377 Ga0209673_100037778 309
793 3300025284 Ga0209130_1002393 Ga0209130_10023935 309
794 3300025291 Ga0209675_1005679 Ga0209675_10056792 309
795 3300025292 Ga0209676_1000202 Ga0209676_1000202116 309
796 3300025294 Ga0209025_1019113 Ga0209025_10191134 309
797 3300025295 Ga0209564_1000223 Ga0209564_100022360 309
798 3300025297 Ga0209758_1008904 Ga0209758_10089044 309
799 3300025298 Ga0209050_1000224 Ga0209050_100022474 309
800 3300025299 Ga0209256_1000174 Ga0209256_100017460 309
801 3300025302 Ga0207426_1000232 Ga0207426_100023260 309
802 3300025303 Ga0209051_1000313 Ga0209051_100031365 309
803 3300025304 Ga0209257_1000163 Ga0209257_100016358 309
804 3300026142 Ga0207698_10005288 Ga0207698_100052882 309
805 3300031731 Ga0307405_10018954 Ga0307405_100189543 309
806 3300046463 Ga0495653_0000004 Ga0495653_0000004_146923_147924 309
807 3300046507 Ga0495606_0000376 Ga0495606_0000376_33773_34774 309
808 3300046512 Ga0495610_0007456 Ga0495610_0007456_683_1684 309
809 3300046558 Ga0495633_0002933 Ga0495633_0002933_5536_6537 309
810 3300048091 Ga0495626_0035637 Ga0495626_0035637_30_1031 309
811 3300048925 Ga0496122_0041748 Ga0496122_0041748_228_1229 309
812 3300049579 Ga0501043_0000020 Ga0501043_0000020_96759_97775 309
813 3300049580 Ga0501046_0000039 Ga0501046_0000039_96797_97813 309
814 3300049581 Ga0501047_0000028 Ga0501047_0000028_96771_97787 309
815 3300049582 Ga0501048_0000543 Ga0501048_0000543_10094_11110 309
816 3300049823 Ga0501044_0123173 Ga0501044_0123173_114_1130 309
817 3300053083 Ga0495655_0045427 Ga0495655_0045427_77_1108 309
818 3300053145 Ga0500586_000268 Ga0500586_000268_979_1980 309
819 iso_pu_bacteria 2501025502 2501078615 309
820 iso_pu_bacteria 2510917013 2511089265 309
821 iso_pu_bacteria 2513237082 2513552855 309
822 iso_pu_bacteria 2513237083 2513561662 309
823 iso_pu_bacteria 8003955200 8003958518 309
824 3300005543 Ga0070672_100277279 Ga0070672_1002772792 310
825 3300009093 Ga0105240_10218080 Ga0105240_102180802 310
826 3300012502 Ga0157347_1003135 Ga0157347_10031351 310
827 3300013105 Ga0157369_10013980 Ga0157369_100139808 310
828 3300013308 Ga0157375_10071844 Ga0157375_100718442 310
829 3300017792 Ga0163161_10041696 Ga0163161_100416962 310
830 3300025913 Ga0207695_10175061 Ga0207695_101750612 310
831 3300025940 Ga0207691_10081100 Ga0207691_100811002 310
832 3300026121 Ga0207683_10041319 Ga0207683_100413194 310
833 3300031456 Ga0307513_10004550 Ga0307513_100045505 310
834 3300031730 Ga0307516_10227182 Ga0307516_102271821 310
835 3300046507 Ga0495606_0000673 Ga0495606_0000673_3850_4851 310
836 3300046516 Ga0495628_0178402 Ga0495628_0178402_420_1442 310
837 3300046539 Ga0495621_0002556 Ga0495621_0002556_2022_3044 310
838 3300046615 Ga0495656_0000268 Ga0495656_0000268_6493_7515 310
839 3300048090 Ga0495615_0003679 Ga0495615_0003679_1059_2081 310
840 3300048903 Ga0496100_0047716 Ga0496100_0047716_368_1390 310
841 3300048905 Ga0496102_0014433 Ga0496102_0014433_2872_3894 310
842 3300048906 Ga0496103_0173064 Ga0496103_0173064_111_1127 310
843 3300048907 Ga0496104_0009035 Ga0496104_0009035_3670_4692 310
844 3300048908 Ga0496105_0003210 Ga0496105_0003210_4804_5826 310
845 3300048909 Ga0496106_0018813 Ga0496106_0018813_1193_2215 310
846 3300048929 Ga0496126_0000232 Ga0496126_0000232_42389_43405 310
847 iso_pu_bacteria 2501025501 2501071322 310
848 iso_pu_bacteria 2501025504 2501414270 310
849 iso_pu_bacteria 2508501125 2509127492 310
850 iso_pu_bacteria 2510065045 2510250198 310
851 iso_pu_bacteria 2510917014 2511094475 310
852 iso_pu_bacteria 2510917015 2511104245 310
853 iso_pu_bacteria 2512047030 2512347716 310
854 iso_pu_bacteria 2513237151 2513962196 310
855 iso_pu_bacteria 2513237166 2514053851 310
856 iso_pu_bacteria 2515154122 2515679244 310
857 iso_pu_bacteria 2515154123 2515687407 310
858 iso_pu_bacteria 2515154189 2516024490 310
859 iso_pu_bacteria 2526164713 2527076860 310
860 iso_pu_bacteria 2562617112 2563062318 310
861 iso_pu_bacteria 2711768613 2713477827 310
862 iso_pu_bacteria 2718217991 2719639351 310
863 iso_pu_bacteria 2738541296 2738819893 310
864 iso_pu_bacteria 2738541298 2738832373 310
865 iso_pu_bacteria 2738541306 2738873900 310
866 iso_pu_bacteria 2738543002 2739185530 310
867 iso_pu_bacteria 2738543008 2739220498 310
868 iso_pu_bacteria 2744054900 2746088736 310
869 iso_pu_bacteria 2744054901 2746099958 310
870 iso_pu_bacteria 2751185846 2753570544 310
871 iso_pu_bacteria 2791355137 2792834908 310
872 iso_pu_bacteria 2818991450 2819621069 310
873 iso_pu_bacteria 2842324504 2842331201 310
874 iso_pu_bacteria 2842348783 2842355540 310
875 iso_pu_bacteria 2842454564 2842457860 310
876 iso_pu_bacteria 2856287931 2856291564 310
877 iso_pu_bacteria 2857357740 2857364622 310
878 iso_pu_bacteria 2883087390 2883093892 310
879 iso_pu_bacteria 2885270888 2885272103 310
880 iso_pu_bacteria 2900634093 2900635979 310
881 iso_pu_bacteria 2902682994 2902683255 310
882 iso_pu_bacteria 2904483920 2904484178 310
883 iso_pu_bacteria 2904615490 2904624638 310
884 iso_pu_bacteria 2919527303 2919530120 310
885 iso_pu_bacteria 2928108538 2928109873 310
886 iso_pu_bacteria 2928135762 2928136672 310
887 iso_pu_bacteria 2928503688 2928508948 310
888 iso_pu_bacteria 2945934425 2945935743 310
889 iso_pu_bacteria 2990703756 2990710344 310
890 iso_pu_bacteria 641736151 642422868 310
891 iso_pu_bacteria 642555112 642594034 310
892 iso_pu_bacteria 642555113 642620523 310
893 iso_pu_bacteria 8055266321 8055266503 310
894 iso_pu_bacteria 8055301274 8055305026 310
895 3300003781 Ga0055536_1006712 Ga0055536_10067122 311
896 3300003792 Ga0055540_1005520 Ga0055540_10055205 311
897 3300006195 Ga0075366_10009989 Ga0075366_100099892 311
898 3300014497 Ga0182008_10001984 Ga0182008_1000198412 311
899 3300014969 Ga0157376_10027690 Ga0157376_100276903 311
900 3300015261 Ga0182006_1000007 Ga0182006_1000007133 311
901 3300015262 Ga0182007_10000120 Ga0182007_1000012038 311
902 3300015265 Ga0182005_1000010 Ga0182005_1000010112 311
903 3300025292 Ga0209676_1000375 Ga0209676_100037516 311
904 3300025303 Ga0209051_1008706 Ga0209051_10087062 311
905 3300032004 Ga0307414_10106341 Ga0307414_101063412 311
906 3300046558 Ga0495633_0000443 Ga0495633_0000443_7267_8274 311
907 3300048914 Ga0496111_0027651 Ga0496111_0027651_2272_3279 311
908 3300048919 Ga0496116_0019299 Ga0496116_0019299_3324_4331 311
909 3300048920 Ga0496117_0000005 Ga0496117_0000005_312908_313915 311
910 3300048921 Ga0496118_0000022 Ga0496118_0000022_124688_125695 311
911 3300048924 Ga0496121_0004898 Ga0496121_0004898_13891_14898 311
912 3300048924 Ga0496121_0033332 Ga0496121_0033332_3309_4316 311
913 3300048925 Ga0496122_0001727 Ga0496122_0001727_7343_8350 311
914 3300048926 Ga0496123_0001385 Ga0496123_0001385_19058_20065 311
915 3300048927 Ga0496124_0054919 Ga0496124_0054919_1271_2278 311
916 3300048928 Ga0496125_0105295 Ga0496125_0105295_77_1084 311
917 3300048928 Ga0496125_0212614 Ga0496125_0212614_77_1084 311
918 3300048929 Ga0496126_0031392 Ga0496126_0031392_1115_2122 311
919 3300049460 Ga0495682_0001697 Ga0495682_0001697_1070_2077 311
920 3300050493 nmdc:mga0k408_142379_c1 nmdc:mga0k408_142379_c1_113_1114 311
921 3300050493 nmdc:mga0k408_33819_c2 nmdc:mga0k408_33819_c2_696_1730 311
922 3300050496 nmdc:mga07m45_55191_c1 nmdc:mga07m45_55191_c1_669_1703 311
923 3300002737 JGI25162J39368_1000015 JGI25162J39368_1000015289 312
924 3300002771 JGI25163J39215_1002258 JGI25163J39215_10022582 312
925 3300003214 JGI25165J46597_1000001 JGI25165J46597_1000001966 312
926 3300003751 Ga0055538_1000001 Ga0055538_100000168 312
927 3300003752 Ga0055539_1000001 Ga0055539_100000168 312
928 3300003756 Ga0055533_1000003 Ga0055533_1000003966 312
929 3300003759 Ga0055525_1000087 Ga0055525_100008777 312
930 3300003841 Ga0055541_1000001 Ga0055541_1000001966 312
931 3300015261 Ga0182006_1049829 Ga0182006_10498292 312
932 3300015262 Ga0182007_10011720 Ga0182007_100117203 312
933 3300015262 Ga0182007_10013984 Ga0182007_100139842 312
934 3300015265 Ga0182005_1002485 Ga0182005_10024853 312
935 3300025207 Ga0209760_101328 Ga0209760_1013283 312
936 3300025224 Ga0209784_100004 Ga0209784_100004960 312
937 3300025225 Ga0209566_100004 Ga0209566_1000041117 312
938 3300025226 Ga0209674_100006 Ga0209674_1000061117 312
939 3300025230 Ga0209563_100009 Ga0209563_100009960 312
940 3300025231 Ga0207427_100973 Ga0207427_10097310 312
941 3300025233 Ga0209437_100004 Ga0209437_100004960 312
942 3300025253 Ga0209677_100005 Ga0209677_100005960 312
943 3300025261 Ga0209233_1000005 Ga0209233_10000051117 312
944 3300031548 Ga0307408_100054610 Ga0307408_1000546102 312
945 3300031911 Ga0307412_10010644 Ga0307412_100106444 312
946 3300031911 Ga0307412_10061461 Ga0307412_100614612 312
947 3300042006 Ga0439432_004509 Ga0439432_004509_3468_4493 312
948 3300042007 Ga0439449_0001818 Ga0439449_0001818_1704_2729 312
949 3300042011 Ga0439454_003384 Ga0439454_003384_54_1079 312
950 3300042015 Ga0439462_0008822 Ga0439462_0008822_49_1074 312
951 3300042145 Ga0450906_002465 Ga0450906_002465_2451_3476 312
952 3300042185 Ga0450909_004798 Ga0450909_004798_438_1463 312
953 3300042435 Ga0439434_0013660 Ga0439434_0013660_652_1677 312
954 3300046514 Ga0495618_0023135 Ga0495618_0023135_95_1099 312
955 3300046516 Ga0495628_0007042 Ga0495628_0007042_2641_3645 312
956 3300046529 Ga0495652_0115577 Ga0495652_0115577_886_1890 312
957 3300046809 Ga0495600_0004299 Ga0495600_0004299_3396_4400 312
958 3300047317 Ga0495604_0004075 Ga0495604_0004075_7939_8943 312
959 3300049679 Ga0501249_012646 Ga0501249_012646_752_1753 312
960 3300049705 Ga0501225_0002289 Ga0501225_0002289_664_1665 312
961 3300049759 Ga0501262_006028 Ga0501262_006028_28_1029 312
962 3300050489 nmdc:mga03683_2605_c1 nmdc:mga03683_2605_c1_738_1739 312
963 3300050496 nmdc:mga07m45_4681_c1 nmdc:mga07m45_4681_c1_3685_4710 312
964 3300053154 Ga0500619_000678 Ga0500619_000678_4178_5182 312
965 iso_pu_bacteria 2585428057 2587730169 312
966 iso_pu_bacteria 2842677519 2842680657 312
967 iso_pu_bacteria 2904456579 2904459955 312
968 iso_pu_bacteria 2919462493 2919463411 312
969 iso_pu_bacteria 2929520902 2929525966 312
970 3300003771 Ga0055526_1000151 Ga0055526_10001512 313
971 3300025295 Ga0209564_1000074 Ga0209564_1000074216 313
972 iso_pu_bacteria 2842747753 2842752868 313
973 3300003187 JGI25151J46595_10008314 JGI25151J46595_100083144 314
974 3300017792 Ga0163161_10122710 Ga0163161_101227102 314
975 3300025294 Ga0209025_1000359 Ga0209025_10003598 314
976 3300046530 Ga0495654_0005366 Ga0495654_0005366_5686_6696 314
977 iso_pu_bacteria 2643221644 2644244049 314
978 iso_pu_bacteria 2643221734 2644735662 314
979 iso_pu_bacteria 2894817345 2894817851 314
980 iso_pu_bacteria 2904479285 2904481407 314
981 3300009148 Ga0105243_10000498 Ga0105243_1000049831 315
982 3300026121 Ga0207683_10289375 Ga0207683_102893752 315
983 iso_pu_bacteria 2511231002 2511243070 315
984 iso_pu_bacteria 2585428062 2587758225 315
985 iso_pu_bacteria 2818991446 2819601807 315
986 iso_pu_bacteria 2899924645 2899926553 315
987 iso_pu_bacteria 2904541872 2904549144 315
988 iso_pu_bacteria 2917699015 2917700675 315
989 iso_pu_bacteria 2919704043 2919704556 315
990 iso_pu_bacteria 2928037797 2928039889 315
991 iso_pu_bacteria 2928044640 2928047362 315
992 iso_pu_bacteria 2928051484 2928057434 315
993 iso_pu_bacteria 2928064002 2928070463 315
994 iso_pu_bacteria 2929160207 2929160772 315
995 iso_pu_bacteria 2954767861 2954769407 315
996 3300048919 Ga0496116_0118351 Ga0496116_0118351_93_1100 316
997 3300048925 Ga0496122_0000317 Ga0496122_0000317_98316_99323 316
998 3300048926 Ga0496123_0001487 Ga0496123_0001487_4224_5231 316
999 iso_pu_bacteria 2547132374 2548498567 316
1000 iso_pu_bacteria 2643221717 2644649302 316
1001 iso_pu_bacteria 2643221733 2644729735 316
1002 iso_pu_bacteria 2738543013 2739251011 316
1003 3300003187 JGI25151J46595_10000122 JGI25151J46595_1000012227 317
1004 3300003761 Ga0055535_1001051 Ga0055535_100105112 317
1005 3300003762 Ga0055542_1000058 Ga0055542_1000058132 317
1006 3300005366 Ga0070659_100206341 Ga0070659_1002063411 317
1007 3300005834 Ga0068851_10025724 Ga0068851_100257242 317
1008 3300013307 Ga0157372_10046561 Ga0157372_100465613 317
1009 3300014497 Ga0182008_10001609 Ga0182008_100016095 317
1010 3300025228 Ga0209672_101203 Ga0209672_1012035 317
1011 3300025229 Ga0209147_100602 Ga0209147_1006028 317
1012 3300025242 Ga0209258_100147 Ga0209258_10014725 317
1013 3300025254 Ga0209148_1000122 Ga0209148_1000122131 317
1014 3300025294 Ga0209025_1000014 Ga0209025_1000014408 317
1015 3300025321 Ga0207656_10009374 Ga0207656_100093742 317
1016 iso_pu_bacteria 8054002106 8054008223 317
1017 3300003771 Ga0055526_1000495 Ga0055526_100049522 318
1018 3300003775 Ga0055524_1000136 Ga0055524_100013652 318
1019 3300005617 Ga0068859_100086026 Ga0068859_1000860262 318
1020 3300005841 Ga0068863_100080378 Ga0068863_1000803782 318
1021 3300006931 Ga0097620_100086025 Ga0097620_1000860252 318
1022 3300009098 Ga0105245_10438790 Ga0105245_104387902 318
1023 3300025291 Ga0209675_1001181 Ga0209675_10011812 318
1024 3300025295 Ga0209564_1000077 Ga0209564_100007753 318
1025 3300025299 Ga0209256_1000057 Ga0209256_100005753 318
1026 3300026023 Ga0207677_10034528 Ga0207677_100345282 318
1027 3300044842 Ga0466957_0037720 Ga0466957_0037720_1188_2201 318
1028 iso_pu_bacteria 2585428062 2587757619 318
1029 iso_pu_bacteria 2643221570 2643866922 318
1030 iso_pu_bacteria 2643221609 2644063131 318
1031 iso_pu_bacteria 2643221611 2644075497 318
1032 iso_pu_bacteria 2643221628 2644163846 318
1033 iso_pu_bacteria 2643221652 2644294772 318
1034 iso_pu_bacteria 2738543012 2739246716 318
1035 iso_pu_bacteria 2765235838 2765568079 318
1036 iso_pu_bacteria 2808606386 2808983707 318
1037 iso_pu_bacteria 2808606415 2809129371 318
1038 iso_pu_bacteria 2808606419 2809149574 318
1039 iso_pu_bacteria 2816332133 2816475502 318
1040 iso_pu_bacteria 2818991449 2819614489 318
1041 iso_pu_bacteria 2831265667 2831268178 318
1042 iso_pu_bacteria 2838054893 2838061028 318
1043 iso_pu_bacteria 2839094727 2839097628 318
1044 iso_pu_bacteria 2852618963 2852619726 318
1045 iso_pu_bacteria 2897803580 2897805064 318
1046 iso_pu_bacteria 2904449895 2904453007 318
1047 iso_pu_bacteria 2945945610 2945951198 318
1048 iso_pu_bacteria 2945972063 2945974142 318
1049 3300003784 Ga0055534_1014713 Ga0055534_10147131 319
1050 3300013102 Ga0157371_10037093 Ga0157371_100370932 319
1051 3300013250 Ga0171462_1011 Ga0171462_101174 319
1052 3300025299 Ga0209256_1000109 Ga0209256_100010935 319
1053 3300031548 Ga0307408_100104914 Ga0307408_1001049142 319
1054 3300048919 Ga0496116_0018215 Ga0496116_0018215_4015_5025 319
1055 3300048920 Ga0496117_0151906 Ga0496117_0151906_253_1263 319
1056 3300048924 Ga0496121_0026906 Ga0496121_0026906_2594_3604 319
1057 3300048925 Ga0496122_0058200 Ga0496122_0058200_613_1623 319
1058 iso_pu_bacteria 2643221596 2643993650 319
1059 iso_pu_bacteria 2928115317 2928120517 319
1060 iso_pu_bacteria 2945984333 2945989908 319
1061 iso_pu_bacteria 2990710928 2990712871 319
1062 3300001989 JGI24739J22299_10014446 JGI24739J22299_100144462 320
1063 3300003773 Ga0055537_1000817 Ga0055537_10008175 320
1064 3300003784 Ga0055534_1000242 Ga0055534_100024236 320
1065 3300003790 Ga0055528_1001087 Ga0055528_100108717 320
1066 3300005289 Ga0065704_10088182 Ga0065704_100881822 320
1067 3300005354 Ga0070675_100005423 Ga0070675_1000054237 320
1068 3300005364 Ga0070673_100011126 Ga0070673_1000111265 320
1069 3300005367 Ga0070667_100204052 Ga0070667_1002040522 320
1070 3300005459 Ga0068867_100002311 Ga0068867_1000023112 320
1071 3300005577 Ga0068857_100004760 Ga0068857_1000047604 320
1072 3300006177 Ga0075362_10069152 Ga0075362_100691522 320
1073 3300006177 Ga0075362_10103174 Ga0075362_101031742 320
1074 3300009098 Ga0105245_10016331 Ga0105245_100163316 320
1075 3300009148 Ga0105243_10058998 Ga0105243_100589982 320
1076 3300025263 Ga0209565_1000129 Ga0209565_100012992 320
1077 3300025273 Ga0209673_1000247 Ga0209673_100024792 320
1078 3300025273 Ga0209673_1008927 Ga0209673_10089274 320
1079 3300025291 Ga0209675_1000093 Ga0209675_100009392 320
1080 3300025294 Ga0209025_1065955 Ga0209025_10659552 320
1081 3300025295 Ga0209564_1030788 Ga0209564_10307882 320
1082 3300025303 Ga0209051_1000530 Ga0209051_10005308 320
1083 3300025907 Ga0207645_10003304 Ga0207645_100033049 320
1084 3300025927 Ga0207687_10345362 Ga0207687_103453622 320
1085 3300025931 Ga0207644_10041883 Ga0207644_100418834 320
1086 3300025935 Ga0207709_10032806 Ga0207709_100328062 320
1087 3300025942 Ga0207689_10008815 Ga0207689_100088157 320
1088 3300025960 Ga0207651_10000994 Ga0207651_1000099410 320
1089 3300026023 Ga0207677_10021712 Ga0207677_100217124 320
1090 3300026089 Ga0207648_10004518 Ga0207648_100045182 320
1091 3300026116 Ga0207674_10013402 Ga0207674_100134022 320
1092 3300031548 Ga0307408_100006968 Ga0307408_1000069689 320
1093 3300031649 Ga0307514_10004921 Ga0307514_100049212 320
1094 3300031901 Ga0307406_10002450 Ga0307406_100024507 320
1095 3300031911 Ga0307412_10161221 Ga0307412_101612212 320
1096 3300032005 Ga0307411_10036705 Ga0307411_100367052 320
1097 3300041404 Ga0439436_0030141 Ga0439436_0030141_90_1115 320
1098 3300041411 Ga0439466_0014803 Ga0439466_0014803_1241_2266 320
1099 3300042006 Ga0439432_034554 Ga0439432_034554_355_1380 320
1100 3300042011 Ga0439454_005892 Ga0439454_005892_261_1286 320
1101 3300042121 Ga0450919_005133 Ga0450919_005133_480_1505 320
1102 3300042122 Ga0450920_003190 Ga0450920_003190_1402_2427 320
1103 3300042125 Ga0450923_002487 Ga0450923_002487_867_1892 320
1104 3300042145 Ga0450906_002490 Ga0450906_002490_2755_3780 320
1105 3300042435 Ga0439434_0003938 Ga0439434_0003938_2705_3730 320
1106 3300042531 Ga0450918_002009 Ga0450918_002009_2840_3865 320
1107 3300046660 Ga0495625_0002685 Ga0495625_0002685_13590_14615 320
1108 3300047320 Ga0495672_0001537 Ga0495672_0001537_5239_6282 320
1109 iso_pu_bacteria 2885192300 2885197615 320
1110 3300003578 Ga0006562J51391_1213428 Ga0006562J51391_12134282 321
1111 3300028794 Ga0307515_10001329 Ga0307515_1000132949 321
1112 3300042007 Ga0439449_0000656 Ga0439449_0000656_4677_5702 321
1113 3300048919 Ga0496116_0026797 Ga0496116_0026797_368_1393 321
1114 3300050493 nmdc:mga0k408_14954_c1 nmdc:mga0k408_14954_c1_210_1235 321
1115 iso_pu_bacteria 2548876994 2550693993 321
1116 iso_pu_bacteria 2643221672 2644397388 321
1117 iso_pu_bacteria 2643221683 2644466281 321
1118 3300014497 Ga0182008_10000041 Ga0182008_100000416 322
1119 iso_pu_bacteria 2513020051 2513227636 322
1120 iso_pu_bacteria 2643221658 2644325991 322
1121 iso_pu_bacteria 2738541277 2738723239 322
1122 iso_pu_bacteria 2738541307 2738885565 322
1123 iso_pu_bacteria 2738543019 2739283970 322
1124 iso_pu_bacteria 2928084124 2928085941 322
1125 3300025935 Ga0207709_10001027 Ga0207709_1000102710 323
1126 3300025935 Ga0207709_10001062 Ga0207709_100010627 323
1127 3300031548 Ga0307408_100007085 Ga0307408_1000070852 323
1128 3300031901 Ga0307406_10000237 Ga0307406_1000023710 323
1129 3300042133 Ga0450896_007427 Ga0450896_007427_186_1211 323
1130 iso_pu_bacteria 2599185214 2599626748 323
1131 iso_pu_bacteria 2599185226 2599675994 323
1132 iso_pu_bacteria 2599185227 2599684285 323
1133 iso_pu_bacteria 2599185229 2599696299 323
1134 iso_pu_bacteria 2885198086 2885199879 323
1135 iso_pu_bacteria 2885211737 2885213600 323
1136 iso_pu_bacteria 2928070936 2928072776 323
1137 3300025284 Ga0209130_1004368 Ga0209130_10043683 324
1138 3300025291 Ga0209675_1000571 Ga0209675_100057113 324
1139 3300025292 Ga0209676_1022953 Ga0209676_10229532 324
1140 3300025304 Ga0209257_1007081 Ga0209257_10070812 324
1141 3300053128 Ga0500626_020011 Ga0500626_020011_1067_2095 325
1142 3300053136 Ga0500559_0004890 Ga0500559_0004890_634_1662 325
1143 3300001979 JGI24740J21852_10016743 JGI24740J21852_100167432 326
1144 3300003781 Ga0055536_1023046 Ga0055536_10230462 326
1145 3300003791 Ga0055530_10018699 Ga0055530_100186992 326
1146 3300003792 Ga0055540_1019275 Ga0055540_10192752 326
1147 3300003794 Ga0055531_10002661 Ga0055531_100026612 326
1148 3300006353 Ga0075370_10073758 Ga0075370_100737582 326
1149 3300009148 Ga0105243_10020522 Ga0105243_100205225 326
1150 3300014497 Ga0182008_10001649 Ga0182008_100016493 326
1151 3300014497 Ga0182008_10018088 Ga0182008_100180883 326
1152 3300015262 Ga0182007_10000887 Ga0182007_1000088713 326
1153 3300025292 Ga0209676_1005554 Ga0209676_10055545 326
1154 3300025298 Ga0209050_1006558 Ga0209050_10065587 326
1155 3300025303 Ga0209051_1000112 Ga0209051_100011210 326
1156 3300025304 Ga0209257_1001005 Ga0209257_10010052 326
1157 3300025728 Ga0207655_1005293 Ga0207655_10052933 326
1158 3300025932 Ga0207690_10032557 Ga0207690_100325572 326
1159 3300025933 Ga0207706_10153984 Ga0207706_101539842 326
1160 3300025945 Ga0207679_10009037 Ga0207679_100090375 326
1161 3300025949 Ga0207667_10220285 Ga0207667_102202852 326
1162 3300026041 Ga0207639_10155731 Ga0207639_101557312 326
1163 3300046460 Ga0495638_0029257 Ga0495638_0029257_2022_3053 326
1164 3300046512 Ga0495610_0061212 Ga0495610_0061212_58_1089 326
1165 3300046513 Ga0495616_0009986 Ga0495616_0009986_19_1050 326
1166 3300046518 Ga0495631_0000158 Ga0495631_0000158_31598_32629 326
1167 3300046520 Ga0495637_0001672 Ga0495637_0001672_6803_7837 326
1168 3300046530 Ga0495654_0038409 Ga0495654_0038409_603_1634 326
1169 3300046557 Ga0495622_0087670 Ga0495622_0087670_138_1169 326
1170 3300046660 Ga0495625_0020191 Ga0495625_0020191_2076_3107 326
1171 3300046690 Ga0495624_0169053 Ga0495624_0169053_181_1212 326
1172 3300047673 Ga0495593_0008291 Ga0495593_0008291_1059_2090 326
1173 3300048088 Ga0495602_0121724 Ga0495602_0121724_443_1474 326
1174 3300048904 Ga0496101_0091525 Ga0496101_0091525_1078_2112 326
1175 3300048920 Ga0496117_0041867 Ga0496117_0041867_943_1974 326
1176 3300048921 Ga0496118_0022682 Ga0496118_0022682_4137_5168 326
1177 3300048921 Ga0496118_0025881 Ga0496118_0025881_1376_2407 326
1178 3300048924 Ga0496121_0056484 Ga0496121_0056484_2151_3182 326
1179 3300048927 Ga0496124_0183265 Ga0496124_0183265_220_1269 326
1180 3300048928 Ga0496125_0057269 Ga0496125_0057269_103_1134 326
1181 3300048929 Ga0496126_0110273 Ga0496126_0110273_1027_2058 326
1182 3300050496 nmdc:mga07m45_3298_c1 nmdc:mga07m45_3298_c1_3892_4923 326
1183 3300053079 Ga0500610_0027176 Ga0500610_0027176_1582_2616 326
1184 3300053079 Ga0500610_0027784 Ga0500610_0027784_1584_2615 326
1185 3300053087 Ga0500643_006257 Ga0500643_006257_3049_4080 326
1186 3300053093 Ga0500651_0000076 Ga0500651_0000076_4936_5967 326
1187 3300053108 Ga0500562_013692 Ga0500562_013692_87_1118 326
1188 3300053110 Ga0500571_006299 Ga0500571_006299_606_1637 326
1189 3300053117 Ga0500593_000987 Ga0500593_000987_5394_6425 326
1190 3300053121 Ga0500607_011089 Ga0500607_011089_2284_3318 326
1191 3300053122 Ga0500608_020168 Ga0500608_020168_72_1103 326
1192 3300053133 Ga0500655_000823 Ga0500655_000823_1061_2092 326
1193 3300053139 Ga0500568_0006116 Ga0500568_0006116_3967_4998 326
1194 3300053141 Ga0500574_013535 Ga0500574_013535_335_1366 326
1195 3300053153 Ga0500616_0080046 Ga0500616_0080046_392_1423 326
1196 3300053158 Ga0500627_0000093 Ga0500627_0000093_3727_4758 326
1197 3300053177 Ga0500636_0134342 Ga0500636_0134342_139_1170 326
1198 3300053729 Ga0500625_037120 Ga0500625_037120_1050_2081 326

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02653

BPD_transp_2

Branched-chain amino acid transport system / permease component

65

346

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
2nq2-assembly1.cif.gz_A an inward-facing conformation of a putative metal-chelate type abc transporter. 0.6132 30 320
2nq2-assembly1.cif.gz_B an inward-facing conformation of a putative metal-chelate type abc transporter. 0.5909 33 320
2nq2-assembly1.cif.gz_A an inward-facing conformation of a putative metal-chelate type abc transporter. 0.584 30 320
2nq2-assembly1.cif.gz_B an inward-facing conformation of a putative metal-chelate type abc transporter. 0.5705 33 320
7kyp-assembly4.cif.gz_N psabc from streptococcus pneumoniae in complex with fab 0.5604 41 318
ID Description Score Start End Superfamily
af_P0AGI1_45_314_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.8691 59 318 1.10.3470.10
af_P0AE26_50_315_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.866 59 318 1.10.3470.10
af_P39328_55_321_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.8615 61 318 1.10.3470.10
af_P77315_52_317_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.8598 59 318 1.10.3470.10
af_P32720_52_318_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.8552 59 318 1.10.3470.10
ID Description Score Start End GO Terms
AF-A0A3A9K1R6-F1-model_v4 Ribose ABC transporter permease 0.9268 35 323 GO:0005886
GO:0022857
AF-A0A511MVI8-F1-model_v4 ABC transporter permease 0.9211 31 326 GO:0005886
GO:0022857
AF-B9KPX0-F1-model_v4 deleted 0.9203 34 323
AF-A0A1F8RC40-F1-model_v4 ABC transporter permease 0.9064 35 325 GO:0005886
GO:0022857
AF-A0A537MV56-F1-model_v4 ABC transporter permease 0.9058 27 325 GO:0005886
GO:0022857

Feature Viewer

pLDDT pTM Quality
73.13 0.73 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map