F491536

General Info

Members Datasets Scaffolds Average Seq Length
1196 526 1162 96

Family's Representative Sequence

Representative Sequence 3300048924|Ga0496121_0017835|Ga0496121_0017835_6160_6507
Length 115
Sequence MTEQTGSAAPAEAEAEVAGTDAARTGADGQAAGRGFRKVREGLVVSDKMAKTVVVAVEDRVQHPLYGKTIRRTKKIKAHDENSSSGVGDRVLLMETRPLSATKRWRVVEVLEKAK

Samples

Sample ID Description Type Environment
1 2506783011 Frankia datiscae Dg1 Isolate Nodule
2 2508501039 Frankia saprophytica CN3 Isolate Nodule
3 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
4 2527291627 Frankia casuarinae Thr Isolate Nodule
5 2527291629 Frankia sp. BMG5.23 Isolate Nodule
6 2546825537 Frankia sp. CcI6 Isolate Rhizoplane
7 2576861822 Frankia sp. CeD Isolate Nodule
8 2579778521 Frankia torreyi CpI1-S Isolate Unclassified
9 2619618881 Frankia sp. ACN1ag Isolate Unclassified
10 2619619003 Frankia sp. CpI1-P Isolate Nodule
11 2626541554 Frankia sp. AvcI.1 Isolate Nodule
12 2671180195 Frankia sp. CcI49 Isolate Nodule
13 2675902999 Frankia asymbiotica NRRL B-16386 Isolate Nodule
14 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
15 2684623036 Frankia sp. CgIM4 Isolate Nodule
16 2687453737 Frankia sp. BMG5.36 Isolate Nodule
17 2687453743 Frankia colletiae Cc1.17 Isolate Nodule
18 2710264753 Frankia sp. KB5 Isolate Nodule
19 2773857921 Frankia asymbiotica NRRL B-16386 Isolate Nodule
20 2773857922 Frankia sp. CcI49 Isolate Nodule
21 2773857924 Frankia sp. CgIS1 Isolate Nodule
22 2773857933 Frankia sp. BMG5.30 Isolate Nodule
23 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
24 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
25 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
26 2891562705 Microbispora tritici MT50 Isolate Unclassified
27 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
28 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
29 3001119090 Lolliginicoccus lacisalsi G463 Isolate Rhizosphere
30 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
31 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
32 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
33 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
34 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
35 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
36 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
37 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
38 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
39 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
40 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
41 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
42 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
43 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
44 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
45 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
46 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
47 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
48 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
49 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
50 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
51 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
52 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
53 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
54 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
55 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
56 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
57 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
58 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
59 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
60 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
61 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
62 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
63 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
64 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
65 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
66 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
67 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
68 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
69 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
70 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
71 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
72 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
73 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
74 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
75 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
76 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
77 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
78 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
79 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
80 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
81 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
82 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
83 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
84 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
85 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
86 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
88 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
89 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
90 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
91 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
92 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
93 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
94 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
95 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
96 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
97 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
98 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
99 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
100 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
101 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
102 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
103 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
104 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
105 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
106 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
107 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
108 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
109 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
110 3300009829 Sorghum rhizosphere soil microbial communities under drought stress in Albany, CA - sample D Metatranscriptome Rhizosphere
111 3300009835 Sorghum rhizosphere soil microbial communities under drought stress in Albany, CA - sample B Metatranscriptome Rhizosphere
112 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
113 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
114 3300012475 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 Metagenome Rhizosphere
115 3300012487 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 Metagenome Rhizosphere
116 3300012491 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 Metagenome Rhizosphere
117 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
118 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
119 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
120 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
121 3300013045 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
122 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
123 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
124 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
125 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
126 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
127 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
128 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
129 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
130 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
131 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
132 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
133 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
134 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
135 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
136 3300019162 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
137 3300019176 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
138 3300019182 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE1 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
139 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
140 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
141 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
142 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
143 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
144 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
145 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
146 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
147 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
148 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
149 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
150 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
151 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
152 3300022730 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 Metagenome Rhizosphere
153 3300023672 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
154 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
207 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
208 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
209 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
210 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
211 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
212 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
213 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
214 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
215 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
216 3300029280 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.stcc.R1 Metatranscriptome Rhizosphere
217 3300029285 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.stno.R1 Metatranscriptome Rhizosphere
218 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
219 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
220 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
221 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
222 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
223 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
224 3300030836 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
225 3300030863 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
226 3300030889 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
227 3300030963 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
228 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
229 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
230 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
231 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
232 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
233 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
234 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
235 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
236 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
237 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
238 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
239 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
240 3300031592 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA4 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
241 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
242 3300031614 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI4 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
243 3300031615 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
244 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
245 3300031635 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA1 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
246 3300031667 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
247 3300031686 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA6 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
248 3300031690 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI1 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
249 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
250 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
251 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
252 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
253 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
254 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
255 3300031815 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Unclassified
256 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
257 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
258 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
259 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
260 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
261 3300032120 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
262 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
263 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
264 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
265 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
266 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
267 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
268 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
269 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
270 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
271 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
272 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
273 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
274 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
275 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
276 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
277 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
278 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
279 3300036534 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
280 3300036535 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU6 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
281 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
282 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
283 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
284 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
285 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
286 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
287 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
288 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
289 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
290 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
291 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
292 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
293 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
294 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
295 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
296 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
297 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
298 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
299 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
300 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
301 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
302 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
303 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
304 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
305 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
306 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
307 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
308 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
309 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
310 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
311 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
312 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
313 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
314 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
315 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
316 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
317 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
318 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
319 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
320 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
321 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
322 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
323 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
324 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
325 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
326 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
327 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
328 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
329 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
330 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
331 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
332 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
333 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
334 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
335 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
336 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
337 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
338 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
339 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
340 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
341 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
342 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
343 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
344 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
345 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
346 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
347 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
348 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
349 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
350 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
351 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
352 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
353 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
354 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
355 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
356 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
357 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
358 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
359 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
360 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
361 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
362 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
363 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
364 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
365 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
366 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
367 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
368 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
369 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
370 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
371 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
372 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
373 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
374 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
375 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
376 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
377 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
378 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
379 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
380 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
381 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
382 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
383 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
384 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
385 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
386 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
387 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
388 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
389 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
390 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
391 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
392 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
393 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
394 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
395 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
396 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
397 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
398 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
399 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
400 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
401 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
402 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
403 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
404 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
405 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
406 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
407 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
408 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
409 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
410 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
411 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
412 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
413 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
414 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
415 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
416 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
417 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
418 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
419 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
420 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
421 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
422 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
423 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
424 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
425 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
426 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
427 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
428 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
429 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
430 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
431 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
432 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
433 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
434 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
435 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
436 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
437 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
438 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
439 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
440 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
441 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
442 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
443 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
444 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
445 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
446 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
447 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
448 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
449 3300049542 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
450 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
451 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
452 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
453 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
454 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
455 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
456 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
457 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
458 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
459 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
460 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
461 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
462 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
463 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
464 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
465 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
466 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
467 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
468 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
469 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
470 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
471 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
472 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
473 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
474 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
475 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
476 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
477 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
478 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
479 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
480 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
481 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
482 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
483 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
484 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
485 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
486 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
487 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
488 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
489 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
490 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
491 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
492 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
493 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
494 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
495 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
496 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
497 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
498 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
499 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
500 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
501 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
502 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
503 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
504 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
505 3300059622 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
506 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
507 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
508 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
509 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
510 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
511 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
512 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
513 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
514 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
515 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
516 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
517 3300059653 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 145R_CW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
518 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
519 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
520 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
521 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
522 637000116 Frankia casuarinae CcI3 Isolate Nodule
523 8002775197 Frankia nepalensis CN7 Isolate Nodule
524 8054913762 Frankia gtarii Agncl-10 Isolate Nodule
525 8054920844 Frankia tisae Agncl-8 Isolate Nodule
526 8055157932 Frankia umida Ag45/Mut15 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 77.84
Metatranscriptomes 19.31
Isolates 2.84

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.67
Nodule 1.84
Rhizoplane 3.26
Rhizosphere 88.38
Stem 0
Stem Tuber 0
Unclassified 5.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1055518 3300001904 Bacteria 611
2 JGI24735J21928_10033557 3300002067 Bacteria 1516
3 JGI25406J46586_10003028 3300003203 Bacteria 7938
4 Ga0058859_11790635 3300004798 Bacteria 1353
5 Ga0058859_11834757 3300004798 Bacteria 886
6 Ga0058863_10022412 3300004799 Bacteria 4259
7 Ga0058863_11829867 3300004799 Bacteria 931
8 Ga0058863_11832389 3300004799 Bacteria 1258
9 Ga0058863_11910841 3300004799 Bacteria 4671
10 Ga0058863_11940937 3300004799 Bacteria 1345
11 Ga0058861_10050561 3300004800 Bacteria 2533
12 Ga0058861_11863394 3300004800 Bacteria 724
13 Ga0058861_11886292 3300004800 Bacteria 578
14 Ga0058861_11946098 3300004800 Bacteria 516
15 Ga0058861_11983512 3300004800 Bacteria 884
16 Ga0058861_11995215 3300004800 Bacteria 962
17 Ga0058861_12014800 3300004800 Bacteria 1756
18 Ga0058860_12163264 3300004801 Bacteria 820
19 Ga0058860_12193443 3300004801 Bacteria 1663
20 Ga0058860_12227750 3300004801 Bacteria 886
21 Ga0058862_10092749 3300004803 Bacteria 841
22 Ga0058862_10269038 3300004803 Bacteria 1265
23 Ga0058862_12767850 3300004803 Bacteria 1195
24 Ga0058862_12784181 3300004803 Bacteria 540
25 Ga0058862_12834356 3300004803 Bacteria 3386
26 Ga0070658_10001764 3300005327 Bacteria 18213
27 Ga0070658_10006748 3300005327 Bacteria 9291
28 Ga0070658_10021378 3300005327 Bacteria 5186
29 Ga0070658_10066569 3300005327 Bacteria 2943
30 Ga0070658_10088897 3300005327 Bacteria 2543
31 Ga0070658_10097709 3300005327 Bacteria 2425
32 Ga0070658_10354214 3300005327 Bacteria 1257
33 Ga0070658_10790416 3300005327 Bacteria 824
34 Ga0070683_100239458 3300005329 Bacteria 1726
35 Ga0070683_100446712 3300005329 Bacteria 1234
36 Ga0070683_100495745 3300005329 Bacteria 1167
37 Ga0070683_100752647 3300005329 Bacteria 934
38 Ga0070683_101409968 3300005329 Bacteria 670
39 Ga0070683_102029734 3300005329 Bacteria 552
40 Ga0070690_100110749 3300005330 Bacteria 1832
41 Ga0070670_101181525 3300005331 Bacteria 699
42 Ga0068869_100116541 3300005334 Bacteria 2038
43 Ga0070666_10571181 3300005335 Bacteria 824
44 Ga0070680_100003083 3300005336 Bacteria 12368
45 Ga0070680_100004398 3300005336 Bacteria 10606
46 Ga0070680_100042527 3300005336 Bacteria 3687
47 Ga0070680_100067854 3300005336 Bacteria 2926
48 Ga0070680_100155709 3300005336 Bacteria 1919
49 Ga0070680_100298977 3300005336 Bacteria 1365
50 Ga0070680_100573762 3300005336 Bacteria 967
51 Ga0070680_101234427 3300005336 Bacteria 647
52 Ga0070682_100048057 3300005337 Bacteria 2655
53 Ga0070682_101406113 3300005337 Bacteria 597
54 Ga0068868_100044857 3300005338 Bacteria 3458
55 Ga0068868_102312643 3300005338 Bacteria 513
56 Ga0070660_100070032 3300005339 Bacteria 2736
57 Ga0070660_100237252 3300005339 Bacteria 1485
58 Ga0070660_100286007 3300005339 Bacteria 1350
59 Ga0070660_100352206 3300005339 Bacteria 1213
60 Ga0070660_100404171 3300005339 Bacteria 1130
61 Ga0070660_100426356 3300005339 Bacteria 1099
62 Ga0070660_100602222 3300005339 Bacteria 919
63 Ga0070660_100620314 3300005339 Bacteria 905
64 Ga0070660_101318012 3300005339 Bacteria 613
65 Ga0070660_101468367 3300005339 Bacteria 580
66 Ga0070689_101863387 3300005340 Bacteria 549
67 Ga0070691_10948516 3300005341 Bacteria 534
68 Ga0070661_101247423 3300005344 Bacteria 623
69 Ga0070661_101766147 3300005344 Bacteria 525
70 Ga0070671_102017759 3300005355 Bacteria 513
71 Ga0070673_100177014 3300005364 Bacteria 1824
72 Ga0070659_100066750 3300005366 Bacteria 2851
73 Ga0070659_100171107 3300005366 Bacteria 1779
74 Ga0070659_100608461 3300005366 Bacteria 939
75 Ga0070659_101722669 3300005366 Bacteria 561
76 Ga0070714_100000013 3300005435 Bacteria 211756
77 Ga0070714_100293622 3300005435 Bacteria 1513
78 Ga0070714_100330017 3300005435 Bacteria 1428
79 Ga0070714_100340560 3300005435 Bacteria 1406
80 Ga0070714_100961121 3300005435 Bacteria 830
81 Ga0070714_101144325 3300005435 Bacteria 759
82 Ga0070714_101148405 3300005435 Bacteria 757
83 Ga0070714_102226935 3300005435 Bacteria 533
84 Ga0070714_102362929 3300005435 Bacteria 517
85 Ga0070713_100004669 3300005436 Bacteria 9248
86 Ga0070713_100670831 3300005436 Bacteria 988
87 Ga0070713_100681717 3300005436 Bacteria 980
88 Ga0070713_100699666 3300005436 Bacteria 967
89 Ga0070713_102457547 3300005436 Bacteria 503
90 Ga0070710_10000376 3300005437 Bacteria 20895
91 Ga0070710_10136352 3300005437 Bacteria 1501
92 Ga0070710_10220178 3300005437 Bacteria 1207
93 Ga0070711_101467789 3300005439 Bacteria 594
94 Ga0070708_100073925 3300005445 Bacteria 3073
95 Ga0070708_102214970 3300005445 Bacteria 507
96 Ga0070663_100036695 3300005455 Bacteria 3406
97 Ga0070663_100106678 3300005455 Bacteria 2099
98 Ga0070663_101121236 3300005455 Bacteria 688
99 Ga0070678_100609503 3300005456 Bacteria 975
100 Ga0070681_10004293 3300005458 Bacteria 13527
101 Ga0070681_10009160 3300005458 Bacteria 9726
102 Ga0070681_10189145 3300005458 Bacteria 1978
103 Ga0070681_11166740 3300005458 Bacteria 692
104 Ga0070681_11209480 3300005458 Bacteria 678
105 Ga0068867_102054112 3300005459 Bacteria 541
106 Ga0070706_100094440 3300005467 Bacteria 2775
107 Ga0070706_100448638 3300005467 Bacteria 1200
108 Ga0070698_100007360 3300005471 Bacteria 11918
109 Ga0070679_100003833 3300005530 Bacteria 13804
110 Ga0070679_100006878 3300005530 Bacteria 10606
111 Ga0070679_100014608 3300005530 Bacteria 7545
112 Ga0070679_100087287 3300005530 Bacteria 3106
113 Ga0070679_100169302 3300005530 Bacteria 2157
114 Ga0070679_100205787 3300005530 Bacteria 1932
115 Ga0070679_100295307 3300005530 Bacteria 1571
116 Ga0070679_100468245 3300005530 Bacteria 1205
117 Ga0070679_100506012 3300005530 Bacteria 1152
118 Ga0070679_101410735 3300005530 Bacteria 643
119 Ga0070684_100088289 3300005535 Bacteria 2754
120 Ga0070684_100337218 3300005535 Bacteria 1386
121 Ga0070684_101252820 3300005535 Bacteria 698
122 Ga0070684_101655704 3300005535 Bacteria 604
123 Ga0068853_102139212 3300005539 Bacteria 542
124 Ga0070672_100719870 3300005543 Bacteria 874
125 Ga0070665_100007009 3300005548 Bacteria 11453
126 Ga0070665_100316587 3300005548 Bacteria 1564
127 Ga0070665_100414338 3300005548 Bacteria 1356
128 Ga0070665_100666284 3300005548 Bacteria 1054
129 Ga0068855_100002777 3300005563 Bacteria 21547
130 Ga0068855_100009577 3300005563 Bacteria 11689
131 Ga0068855_100235541 3300005563 Bacteria 2047
132 Ga0068855_100305134 3300005563 Bacteria 1762
133 Ga0068855_100412912 3300005563 Bacteria 1478
134 Ga0068855_101708622 3300005563 Bacteria 642
135 Ga0068855_101907940 3300005563 Bacteria 602
136 Ga0070664_100373466 3300005564 Bacteria 1300
137 Ga0070664_100843650 3300005564 Bacteria 858
138 Ga0068857_100873274 3300005577 Bacteria 861
139 Ga0068857_101358379 3300005577 Bacteria 691
140 Ga0068854_100004690 3300005578 Bacteria 8614
141 Ga0068854_101360982 3300005578 Bacteria 641
142 Ga0068856_100256540 3300005614 Bacteria 1763
143 Ga0068856_100472684 3300005614 Bacteria 1274
144 Ga0068856_102703091 3300005614 Bacteria 501
145 Ga0070702_100456074 3300005615 Bacteria 928
146 Ga0068852_100016981 3300005616 Bacteria 5697
147 Ga0068852_100808395 3300005616 Bacteria 952
148 Ga0068852_100865204 3300005616 Bacteria 920
149 Ga0068852_101960635 3300005616 Bacteria 608
150 Ga0068864_102470557 3300005618 Bacteria 526
151 Ga0068863_100002199 3300005841 Bacteria 19365
152 Ga0068858_100399888 3300005842 Bacteria 1320
153 Ga0068858_101225703 3300005842 Bacteria 738
154 Ga0068862_100000836 3300005844 Bacteria 30459
155 Ga0081539_10000109 3300005985 Bacteria 193696
156 Ga0070717_10272125 3300006028 Bacteria 1500
157 Ga0070717_10761252 3300006028 Bacteria 880
158 Ga0070717_10988004 3300006028 Bacteria 766
159 Ga0075365_10014271 3300006038 Bacteria 4776
160 Ga0070716_100815708 3300006173 Bacteria 724
161 Ga0070716_101015384 3300006173 Bacteria 657
162 Ga0070712_100510727 3300006175 Bacteria 1008
163 Ga0097621_100345238 3300006237 Bacteria 1322
164 Ga0075428_100089494 3300006844 Bacteria 3357
165 Ga0075428_100144016 3300006844 Bacteria 2590
166 Ga0075428_100269806 3300006844 Bacteria 1831
167 Ga0075428_100868657 3300006844 Bacteria 957
168 Ga0075430_100038086 3300006846 Bacteria 4075
169 Ga0075430_100155685 3300006846 Bacteria 1903
170 Ga0075431_100119295 3300006847 Bacteria 2722
171 Ga0075431_100254409 3300006847 Bacteria 1784
172 Ga0075431_101866498 3300006847 Bacteria 557
173 Ga0075434_100760105 3300006871 Bacteria 986
174 Ga0075429_100527814 3300006880 Bacteria 1034
175 Ga0075429_101629322 3300006880 Bacteria 561
176 Ga0075429_102000322 3300006880 Bacteria 502
177 Ga0075436_100286851 3300006914 Bacteria 1178
178 Ga0075435_100514706 3300007076 Bacteria 1035
179 Ga0099794_10193717 3300007265 Bacteria 1040
180 Ga0105251_10053109 3300009011 Bacteria 1927
181 Ga0105244_10167075 3300009036 Bacteria 1048
182 Ga0105250_10329168 3300009092 Bacteria 665
183 Ga0105240_10002670 3300009093 Bacteria 28391
184 Ga0105240_10039358 3300009093 Bacteria 6055
185 Ga0105240_10311096 3300009093 Bacteria 1799
186 Ga0105240_10541121 3300009093 Bacteria 1290
187 Ga0105240_11269647 3300009093 Bacteria 778
188 Ga0111539_11165846 3300009094 Bacteria 895
189 Ga0105245_10711399 3300009098 Bacteria 1038
190 Ga0105245_10878150 3300009098 Bacteria 938
191 Ga0105245_11025418 3300009098 Bacteria 870
192 Ga0105247_10000016 3300009101 Bacteria 263389
193 Ga0105247_10000616 3300009101 Bacteria 28650
194 Ga0105247_10162144 3300009101 Bacteria 1481
195 Ga0105247_10380229 3300009101 Bacteria 1001
196 Ga0114129_10000114 3300009147 Bacteria 80730
197 Ga0114129_10132230 3300009147 Bacteria 3426
198 Ga0114129_10158563 3300009147 Bacteria 3093
199 Ga0114129_10230488 3300009147 Bacteria 2494
200 Ga0105243_12493737 3300009148 Bacteria 556
201 Ga0105241_10000758 3300009174 Bacteria 24538
202 Ga0105241_10769724 3300009174 Bacteria 884
203 Ga0105242_10876810 3300009176 Bacteria 895
204 Ga0105242_12410055 3300009176 Bacteria 574
205 Ga0105242_12716358 3300009176 Bacteria 545
206 Ga0105248_10000035 3300009177 Bacteria 187578
207 Ga0105248_10002899 3300009177 Bacteria 19028
208 Ga0105248_10243255 3300009177 Bacteria 2025
209 Ga0105248_10424628 3300009177 Bacteria 1497
210 Ga0105237_10018147 3300009545 Bacteria 7285
211 Ga0105237_11002543 3300009545 Bacteria 842
212 Ga0105237_12679199 3300009545 Bacteria 509
213 Ga0105238_10010490 3300009551 Bacteria 9300
214 Ga0105238_10360208 3300009551 Bacteria 1444
215 Ga0105238_10567265 3300009551 Bacteria 1140
216 Ga0105238_10593037 3300009551 Bacteria 1115
217 Ga0105238_10966201 3300009551 Bacteria 872
218 Ga0105238_11827189 3300009551 Bacteria 640
219 Ga0105249_10046324 3300009553 Bacteria 3957
220 Ga0105249_11128089 3300009553 Bacteria 854
221 Ga0105249_11634110 3300009553 Bacteria 717
222 Ga0130086_1047822 3300009829 Bacteria 540
223 Ga0130084_1078115 3300009835 Bacteria 540
224 Ga0105239_10226370 3300010375 Bacteria 2098
225 Ga0105239_11081109 3300010375 Bacteria 923
226 Ga0105239_11771672 3300010375 Bacteria 715
227 Ga0105246_10282256 3300011119 Bacteria 1333
228 Ga0105246_10726126 3300011119 Bacteria 873
229 Ga0157317_1001596 3300012475 Bacteria 1245
230 Ga0157321_1004051 3300012487 Bacteria 902
231 Ga0157329_1002301 3300012491 Bacteria 1074
232 Ga0157341_1003106 3300012494 Bacteria 1143
233 Ga0157347_1020817 3300012502 Bacteria 767
234 Ga0157313_1027449 3300012503 Bacteria 625
235 Ga0157342_1006396 3300012507 Bacteria 1113
236 Ga0154016_113959 3300013045 Bacteria 717
237 Ga0154016_124994 3300013045 Bacteria 585
238 Ga0157373_10510066 3300013100 Bacteria 869
239 Ga0157373_10936601 3300013100 Bacteria 644
240 Ga0157371_10017613 3300013102 Bacteria 5301
241 Ga0157371_10421555 3300013102 Bacteria 979
242 Ga0157370_10006658 3300013104 Bacteria 12691
243 Ga0157370_10007858 3300013104 Bacteria 11558
244 Ga0157370_10036228 3300013104 Bacteria 4789
245 Ga0157370_10119394 3300013104 Bacteria 2462
246 Ga0157370_11406531 3300013104 Bacteria 628
247 Ga0157369_10001467 3300013105 Bacteria 28921
248 Ga0157369_10010753 3300013105 Bacteria 10418
249 Ga0157369_10038301 3300013105 Bacteria 5243
250 Ga0157369_10089330 3300013105 Bacteria 3290
251 Ga0157369_10248956 3300013105 Bacteria 1855
252 Ga0157369_10319534 3300013105 Bacteria 1614
253 Ga0157369_10353994 3300013105 Bacteria 1525
254 Ga0157369_10430309 3300013105 Bacteria 1368
255 Ga0157369_10438090 3300013105 Bacteria 1354
256 Ga0157369_10755143 3300013105 Bacteria 1000
257 Ga0157369_11613093 3300013105 Bacteria 660
258 Ga0157369_11675608 3300013105 Bacteria 646
259 Ga0157374_10042287 3300013296 Bacteria 4203
260 Ga0157374_11105391 3300013296 Bacteria 813
261 Ga0157378_11038426 3300013297 Bacteria 855
262 Ga0157378_11112864 3300013297 Bacteria 827
263 Ga0157378_12947994 3300013297 Bacteria 528
264 Ga0163162_11422846 3300013306 Bacteria 789
265 Ga0163162_11859319 3300013306 Bacteria 689
266 Ga0163162_12455970 3300013306 Bacteria 599
267 Ga0157372_10000069 3300013307 Bacteria 110621
268 Ga0157372_10367809 3300013307 Bacteria 1675
269 Ga0157372_11165931 3300013307 Bacteria 891
270 Ga0157372_12066258 3300013307 Bacteria 655
271 Ga0157372_12512895 3300013307 Bacteria 591
272 Ga0157372_12849947 3300013307 Bacteria 554
273 Ga0157375_11231054 3300013308 Bacteria 879
274 Ga0163163_10006948 3300014325 Bacteria 9943
275 Ga0163163_10018482 3300014325 Bacteria 6527
276 Ga0163163_10130437 3300014325 Bacteria 2554
277 Ga0163163_10861787 3300014325 Bacteria 969
278 Ga0163163_11225418 3300014325 Bacteria 813
279 Ga0182008_10293522 3300014497 Bacteria 849
280 Ga0157379_10011242 3300014968 Bacteria 7798
281 Ga0157379_11552768 3300014968 Bacteria 645
282 Ga0157379_12608734 3300014968 Bacteria 506
283 Ga0157376_10232073 3300014969 Bacteria 1715
284 Ga0157376_10990920 3300014969 Bacteria 862
285 Ga0157376_12181147 3300014969 Bacteria 593
286 Ga0163161_10761909 3300017792 Bacteria 811
287 Ga0184597_102121 3300019162 Bacteria 659
288 Ga0184596_120527 3300019176 Bacteria 652
289 Ga0184598_143900 3300019182 Bacteria 1243
290 Ga0197907_10021336 3300020069 Bacteria 542
291 Ga0197907_10081451 3300020069 Bacteria 849
292 Ga0197907_10108336 3300020069 Bacteria 1203
293 Ga0197907_10168473 3300020069 Bacteria 615
294 Ga0197907_10178655 3300020069 Bacteria 624
295 Ga0197907_10191899 3300020069 Bacteria 775
296 Ga0197907_10411133 3300020069 Bacteria 1339
297 Ga0197907_10620284 3300020069 Bacteria 13642
298 Ga0197907_10639128 3300020069 Bacteria 1995
299 Ga0197907_10933733 3300020069 Bacteria 713
300 Ga0197907_11120812 3300020069 Bacteria 830
301 Ga0197907_11247002 3300020069 Bacteria 3543
302 Ga0197907_11327011 3300020069 Bacteria 1047
303 Ga0197907_11333365 3300020069 Bacteria 2527
304 Ga0197907_11336307 3300020069 Bacteria 1058
305 Ga0206356_10028506 3300020070 Bacteria 594
306 Ga0206356_10137316 3300020070 Bacteria 706
307 Ga0206356_10141090 3300020070 Bacteria 871
308 Ga0206356_10378442 3300020070 Bacteria 2144
309 Ga0206356_10627949 3300020070 Bacteria 3194
310 Ga0206356_10701291 3300020070 Bacteria 894
311 Ga0206356_10741805 3300020070 Bacteria 651
312 Ga0206356_10993217 3300020070 Bacteria 885
313 Ga0206356_11085336 3300020070 Bacteria 4824
314 Ga0206356_11190805 3300020070 Bacteria 915
315 Ga0206356_11202941 3300020070 Bacteria 896
316 Ga0206356_11262576 3300020070 Bacteria 687
317 Ga0206356_11528920 3300020070 Bacteria 1474
318 Ga0206356_11602022 3300020070 Bacteria 966
319 Ga0206349_1036328 3300020075 Bacteria 16217
320 Ga0206349_1260332 3300020075 Bacteria 5094
321 Ga0206349_1272138 3300020075 Bacteria 817
322 Ga0206349_1367676 3300020075 Bacteria 609
323 Ga0206349_1822410 3300020075 Bacteria 812
324 Ga0206355_1136018 3300020076 Bacteria 1822
325 Ga0206355_1257286 3300020076 Bacteria 3023
326 Ga0206355_1345158 3300020076 Bacteria 963
327 Ga0206355_1463886 3300020076 Bacteria 1011
328 Ga0206351_10004618 3300020077 Bacteria 5254
329 Ga0206351_10108476 3300020077 Bacteria 796
330 Ga0206351_10144766 3300020077 Bacteria 1224
331 Ga0206351_10246258 3300020077 Bacteria 943
332 Ga0206351_10420459 3300020077 Bacteria 737
333 Ga0206351_10483248 3300020077 Bacteria 585
334 Ga0206351_10864200 3300020077 Bacteria 1287
335 Ga0206351_10910345 3300020077 Bacteria 2514
336 Ga0206352_10099306 3300020078 Bacteria 532
337 Ga0206352_10361311 3300020078 Bacteria 919
338 Ga0206352_10528760 3300020078 Bacteria 762
339 Ga0206352_10681057 3300020078 Bacteria 1991
340 Ga0206352_10756477 3300020078 Bacteria 968
341 Ga0206352_10909807 3300020078 Bacteria 944
342 Ga0206352_11254737 3300020078 Bacteria 1534
343 Ga0206350_10132091 3300020080 Bacteria 782
344 Ga0206350_10210497 3300020080 Bacteria 2190
345 Ga0206350_10457115 3300020080 Bacteria 2167
346 Ga0206350_10473798 3300020080 Bacteria 610
347 Ga0206350_10562667 3300020080 Bacteria 637
348 Ga0206350_10860066 3300020080 Bacteria 672
349 Ga0206350_11039953 3300020080 Bacteria 1056
350 Ga0206350_11175937 3300020080 Bacteria 1005
351 Ga0206350_11319711 3300020080 Bacteria 844
352 Ga0206354_10066967 3300020081 Bacteria 1509
353 Ga0206354_10127370 3300020081 Bacteria 832
354 Ga0206354_10153077 3300020081 Bacteria 563
355 Ga0206354_10226284 3300020081 Bacteria 795
356 Ga0206354_10292391 3300020081 Bacteria 2798
357 Ga0206354_10396601 3300020081 Bacteria 561
358 Ga0206354_10669361 3300020081 Bacteria 1020
359 Ga0206354_10788811 3300020081 Bacteria 5159
360 Ga0206354_10812358 3300020081 Bacteria 1175
361 Ga0206354_10997721 3300020081 Bacteria 2902
362 Ga0206354_11237324 3300020081 Bacteria 1039
363 Ga0206354_11645061 3300020081 Bacteria 647
364 Ga0206353_10108410 3300020082 Bacteria 1032
365 Ga0206353_10375665 3300020082 Bacteria 532
366 Ga0206353_10380596 3300020082 Bacteria 1526
367 Ga0206353_10438480 3300020082 Bacteria 734
368 Ga0206353_10484919 3300020082 Bacteria 819
369 Ga0206353_10544706 3300020082 Bacteria 818
370 Ga0206353_10558793 3300020082 Bacteria 6343
371 Ga0206353_11286618 3300020082 Bacteria 702
372 Ga0206353_11364351 3300020082 Bacteria 3591
373 Ga0206353_11602891 3300020082 Bacteria 981
374 Ga0206353_11707872 3300020082 Bacteria 679
375 Ga0206353_12071772 3300020082 Bacteria 536
376 Ga0154015_1050976 3300020610 Bacteria 1247
377 Ga0154015_1074336 3300020610 Bacteria 1180
378 Ga0154015_1168233 3300020610 Bacteria 2253
379 Ga0213873_10067970 3300021358 Bacteria 977
380 Ga0213876_10000890 3300021384 Bacteria 19986
381 Ga0224712_10000310 3300022467 Bacteria 9101
382 Ga0224712_10002654 3300022467 Bacteria 4471
383 Ga0224712_10061639 3300022467 Bacteria 1496
384 Ga0224712_10087834 3300022467 Bacteria 1296
385 Ga0224712_10089706 3300022467 Bacteria 1286
386 Ga0224712_10119501 3300022467 Bacteria 1140
387 Ga0224712_10130000 3300022467 Bacteria 1099
388 Ga0224712_10174136 3300022467 Bacteria 966
389 Ga0224712_10309417 3300022467 Bacteria 740
390 Ga0224712_10367002 3300022467 Bacteria 682
391 Ga0224712_10446542 3300022467 Bacteria 621
392 Ga0224712_10614986 3300022467 Bacteria 531
393 Ga0224712_10641793 3300022467 Bacteria 520
394 Ga0224570_108923 3300022730 Bacteria 625
395 Ga0247553_104995 3300023672 Bacteria 682
396 Ga0207713_1012538 3300025735 Bacteria 4520
397 Ga0207692_10000368 3300025898 Bacteria 15470
398 Ga0207692_10690750 3300025898 Bacteria 662
399 Ga0207692_11212420 3300025898 Bacteria 501
400 Ga0207642_10880050 3300025899 Bacteria 573
401 Ga0207710_10000017 3300025900 Bacteria 370962
402 Ga0207710_10000048 3300025900 Bacteria 189597
403 Ga0207647_10000925 3300025904 Bacteria 22625
404 Ga0207647_10110271 3300025904 Bacteria 1627
405 Ga0207647_10138118 3300025904 Bacteria 1429
406 Ga0207647_10256926 3300025904 Bacteria 1001
407 Ga0207699_10209075 3300025906 Bacteria 1326
408 Ga0207643_11042639 3300025908 Bacteria 528
409 Ga0207705_10000671 3300025909 Bacteria 28465
410 Ga0207705_10001318 3300025909 Bacteria 19884
411 Ga0207705_10003438 3300025909 Bacteria 12045
412 Ga0207705_10024842 3300025909 Bacteria 4276
413 Ga0207705_10158625 3300025909 Bacteria 1698
414 Ga0207705_10499446 3300025909 Bacteria 945
415 Ga0207705_10578872 3300025909 Bacteria 873
416 Ga0207705_11321033 3300025909 Bacteria 550
417 Ga0207705_11518445 3300025909 Bacteria 507
418 Ga0207684_10034994 3300025910 Bacteria 4265
419 Ga0207684_10969602 3300025910 Bacteria 712
420 Ga0207654_10001876 3300025911 Bacteria 10890
421 Ga0207654_10452296 3300025911 Bacteria 901
422 Ga0207707_10001257 3300025912 Bacteria 23769
423 Ga0207707_10001820 3300025912 Bacteria 19557
424 Ga0207707_10008073 3300025912 Bacteria 9140
425 Ga0207707_10011410 3300025912 Bacteria 7738
426 Ga0207707_10247736 3300025912 Bacteria 1548
427 Ga0207707_10589153 3300025912 Bacteria 942
428 Ga0207707_10815862 3300025912 Bacteria 776
429 Ga0207707_11262091 3300025912 Bacteria 595
430 Ga0207695_10000465 3300025913 Bacteria 87928
431 Ga0207695_10038288 3300025913 Bacteria 5165
432 Ga0207695_10260408 3300025913 Bacteria 1632
433 Ga0207695_10288003 3300025913 Bacteria 1535
434 Ga0207671_10000128 3300025914 Bacteria 117836
435 Ga0207693_11437934 3300025915 Bacteria 511
436 Ga0207663_10289418 3300025916 Bacteria 1220
437 Ga0207660_10000562 3300025917 Bacteria 24961
438 Ga0207660_10012334 3300025917 Bacteria 5590
439 Ga0207660_10660016 3300025917 Bacteria 853
440 Ga0207660_10844220 3300025917 Bacteria 747
441 Ga0207660_10977196 3300025917 Bacteria 691
442 Ga0207660_11336668 3300025917 Bacteria 581
443 Ga0207657_10067642 3300025919 Bacteria 3037
444 Ga0207657_10068034 3300025919 Bacteria 3027
445 Ga0207657_10246922 3300025919 Bacteria 1424
446 Ga0207657_10268714 3300025919 Bacteria 1356
447 Ga0207657_10302551 3300025919 Bacteria 1267
448 Ga0207657_10477719 3300025919 Bacteria 977
449 Ga0207657_10632455 3300025919 Bacteria 834
450 Ga0207657_10819126 3300025919 Bacteria 719
451 Ga0207657_11297927 3300025919 Bacteria 550
452 Ga0207652_10000632 3300025921 Bacteria 34827
453 Ga0207652_10005398 3300025921 Bacteria 10371
454 Ga0207652_10093052 3300025921 Bacteria 2652
455 Ga0207652_10098495 3300025921 Bacteria 2579
456 Ga0207652_10137583 3300025921 Bacteria 2182
457 Ga0207652_10249175 3300025921 Bacteria 1602
458 Ga0207652_10354268 3300025921 Bacteria 1325
459 Ga0207652_10419946 3300025921 Bacteria 1206
460 Ga0207652_10705203 3300025921 Bacteria 900
461 Ga0207652_10711700 3300025921 Bacteria 895
462 Ga0207652_11553125 3300025921 Bacteria 566
463 Ga0207646_10159851 3300025922 Bacteria 2033
464 Ga0207694_10000973 3300025924 Bacteria 25165
465 Ga0207694_10160599 3300025924 Bacteria 1815
466 Ga0207694_10315747 3300025924 Bacteria 1289
467 Ga0207694_10603492 3300025924 Bacteria 923
468 Ga0207694_10741905 3300025924 Bacteria 829
469 Ga0207694_11258965 3300025924 Bacteria 626
470 Ga0207694_11707641 3300025924 Bacteria 530
471 Ga0207650_11268530 3300025925 Bacteria 627
472 Ga0207650_11615820 3300025925 Bacteria 550
473 Ga0207687_10213190 3300025927 Bacteria 1516
474 Ga0207687_10939029 3300025927 Bacteria 741
475 Ga0207700_10373104 3300025928 Bacteria 1246
476 Ga0207700_11137821 3300025928 Bacteria 697
477 Ga0207700_11552962 3300025928 Bacteria 586
478 Ga0207664_10000001 3300025929 Bacteria 724213
479 Ga0207664_10027344 3300025929 Bacteria 4323
480 Ga0207664_10261305 3300025929 Bacteria 1514
481 Ga0207664_10526744 3300025929 Bacteria 1059
482 Ga0207664_10609877 3300025929 Bacteria 980
483 Ga0207644_10916542 3300025931 Bacteria 735
484 Ga0207690_10007372 3300025932 Bacteria 6529
485 Ga0207690_10692724 3300025932 Bacteria 837
486 Ga0207686_10469517 3300025934 Bacteria 971
487 Ga0207686_10932443 3300025934 Bacteria 702
488 Ga0207709_10667301 3300025935 Bacteria 829
489 Ga0207670_11422169 3300025936 Bacteria 589
490 Ga0207665_10033262 3300025939 Bacteria 3416
491 Ga0207665_10190852 3300025939 Bacteria 1488
492 Ga0207665_10254816 3300025939 Bacteria 1298
493 Ga0207691_10020477 3300025940 Bacteria 6253
494 Ga0207711_10000134 3300025941 Bacteria 77843
495 Ga0207711_10002995 3300025941 Bacteria 14760
496 Ga0207711_10083902 3300025941 Bacteria 2788
497 Ga0207711_10417100 3300025941 Bacteria 1248
498 Ga0207689_11631241 3300025942 Bacteria 536
499 Ga0207661_10052310 3300025944 Bacteria 3262
500 Ga0207661_10602118 3300025944 Bacteria 1009
501 Ga0207679_10687782 3300025945 Bacteria 927
502 Ga0207679_12056165 3300025945 Bacteria 519
503 Ga0207667_10017929 3300025949 Bacteria 7956
504 Ga0207667_10023995 3300025949 Bacteria 6708
505 Ga0207667_10071618 3300025949 Bacteria 3603
506 Ga0207667_10323762 3300025949 Bacteria 1574
507 Ga0207667_10485599 3300025949 Bacteria 1254
508 Ga0207667_10823106 3300025949 Bacteria 924
509 Ga0207651_10587420 3300025960 Bacteria 972
510 Ga0207712_10015493 3300025961 Bacteria 4920
511 Ga0207640_10074941 3300025981 Bacteria 2292
512 Ga0207640_10611943 3300025981 Bacteria 924
513 Ga0207640_11786048 3300025981 Bacteria 556
514 Ga0207658_10002262 3300025986 Bacteria 14246
515 Ga0207677_10002332 3300026023 Bacteria 9960
516 Ga0207703_10019334 3300026035 Bacteria 5321
517 Ga0207703_10309913 3300026035 Bacteria 1442
518 Ga0207639_10012050 3300026041 Bacteria 6016
519 Ga0207639_10105527 3300026041 Bacteria 2286
520 Ga0207702_10160228 3300026078 Bacteria 2054
521 Ga0207702_10359869 3300026078 Bacteria 1394
522 Ga0207702_11066934 3300026078 Bacteria 802
523 Ga0207702_11606273 3300026078 Bacteria 643
524 Ga0207641_10009791 3300026088 Bacteria 7890
525 Ga0207676_10656343 3300026095 Bacteria 1013
526 Ga0207674_10736768 3300026116 Bacteria 951
527 Ga0207683_10245585 3300026121 Bacteria 1633
528 Ga0207683_10245955 3300026121 Bacteria 1632
529 Ga0207698_10047616 3300026142 Bacteria 3250
530 Ga0207698_10518860 3300026142 Bacteria 1162
531 Ga0207698_11300448 3300026142 Bacteria 742
532 Ga0207698_11360754 3300026142 Bacteria 725
533 Ga0207698_12361088 3300026142 Bacteria 543
534 Ga0268266_10036608 3300028379 Bacteria 4178
535 Ga0268266_10060046 3300028379 Bacteria 3277
536 Ga0268266_10669462 3300028379 Bacteria 999
537 Ga0268265_10000156 3300028380 Bacteria 83798
538 Ga0268265_10920323 3300028380 Bacteria 860
539 Ga0268264_12460400 3300028381 Bacteria 526
540 Ga0265337_1000049 3300028556 Bacteria 53677
541 Ga0265337_1105293 3300028556 Bacteria 767
542 Ga0265326_10000822 3300028558 Bacteria 11437
543 Ga0265319_1000220 3300028563 Bacteria 42678
544 Ga0265334_10000083 3300028573 Bacteria 67832
545 Ga0265334_10057630 3300028573 Bacteria 1472
546 Ga0265323_10050605 3300028653 Bacteria 1476
547 Ga0265322_10004536 3300028654 Bacteria 4130
548 Ga0265336_10001694 3300028666 Bacteria 9708
549 Ga0307517_10138635 3300028786 Bacteria 1718
550 Ga0307515_10465584 3300028794 Bacteria 878
551 Ga0265338_10000358 3300028800 Bacteria 82643
552 Ga0265338_10011876 3300028800 Bacteria 10003
553 Ga0265338_10256202 3300028800 Bacteria 1288
554 Ga0311011_142744 3300029280 Bacteria 606
555 Ga0310981_1036808 3300029285 Bacteria 824
556 Ga0265324_10001390 3300029957 Bacteria 13975
557 Ga0307512_10008844 3300030522 Bacteria 9767
558 Ga0316176_1099670 3300030732 Bacteria 577
559 Ga0316180_1083427 3300030736 Bacteria 625
560 Ga0265762_1049178 3300030760 Bacteria 842
561 Ga0265763_1005592 3300030763 Bacteria 1059
562 Ga0265767_119800 3300030836 Bacteria 505
563 Ga0265766_1010927 3300030863 Bacteria 654
564 Ga0265761_101567 3300030889 Bacteria 1014
565 Ga0265761_102151 3300030889 Bacteria 907
566 Ga0265761_104400 3300030889 Bacteria 716
567 Ga0265768_116295 3300030963 Bacteria 521
568 Ga0265760_10247674 3300031090 Bacteria 616
569 Ga0265332_10000675 3300031238 Bacteria 21963
570 Ga0265320_10003833 3300031240 Bacteria 9974
571 Ga0265320_10033393 3300031240 Bacteria 2627
572 Ga0265325_10005613 3300031241 Bacteria 7724
573 Ga0265325_10006148 3300031241 Bacteria 7327
574 Ga0265329_10118335 3300031242 Bacteria 849
575 Ga0265340_10000796 3300031247 Bacteria 17872
576 Ga0265340_10007408 3300031247 Bacteria 5957
577 Ga0265339_10013888 3300031249 Bacteria 4872
578 Ga0265339_10090109 3300031249 Bacteria 1608
579 Ga0265331_10244502 3300031250 Bacteria 805
580 Ga0265316_10007400 3300031344 Bacteria 10348
581 Ga0265316_10307515 3300031344 Bacteria 1154
582 Ga0307513_10022677 3300031456 Bacteria 7367
583 Ga0307513_10097294 3300031456 Bacteria 2978
584 Ga0307509_10012707 3300031507 Bacteria 10038
585 Ga0307408_100238013 3300031548 Bacteria 1495
586 Ga0310117_109253 3300031592 Bacteria 1047
587 Ga0310117_109454 3300031592 Bacteria 1035
588 Ga0265313_10017464 3300031595 Bacteria 4076
589 Ga0265313_10125043 3300031595 Bacteria 1118
590 Ga0310103_104508 3300031614 Bacteria 1813
591 Ga0310107_113542 3300031615 Bacteria 1038
592 Ga0307508_10103681 3300031616 Bacteria 2441
593 Ga0307508_10344052 3300031616 Bacteria 1083
594 Ga0307508_10506916 3300031616 Bacteria 802
595 Ga0310115_115158 3300031635 Bacteria 825
596 Ga0310111_115972 3300031667 Bacteria 940
597 Ga0310119_113302 3300031686 Bacteria 954
598 Ga0310101_123079 3300031690 Bacteria 590
599 Ga0316579_10071976 3300031691 Bacteria 1639
600 Ga0316579_10237329 3300031691 Bacteria 882
601 Ga0265314_10008203 3300031711 Bacteria 8980
602 Ga0265314_10039636 3300031711 Bacteria 3390
603 Ga0265342_10029921 3300031712 Bacteria 3378
604 Ga0265342_10048760 3300031712 Bacteria 2537
605 Ga0316576_10003193 3300031727 Bacteria 9553
606 Ga0316576_10003776 3300031727 Bacteria 8950
607 Ga0316576_10030080 3300031727 Bacteria 3842
608 Ga0316578_10010874 3300031728 Bacteria 4741
609 Ga0316578_10034392 3300031728 Bacteria 2910
610 Ga0316578_10082675 3300031728 Bacteria 1912
611 Ga0307405_10537607 3300031731 Bacteria 943
612 Ga0316045_120866 3300031815 Bacteria 626
613 Ga0307413_10758429 3300031824 Bacteria 812
614 Ga0307410_10217117 3300031852 Bacteria 1469
615 Ga0307410_10745674 3300031852 Bacteria 829
616 Ga0307406_10492953 3300031901 Bacteria 992
617 Ga0307406_11387865 3300031901 Bacteria 615
618 Ga0307406_11412873 3300031901 Bacteria 610
619 Ga0307407_11118579 3300031903 Bacteria 613
620 Ga0307409_100762549 3300031995 Bacteria 972
621 Ga0307409_101233060 3300031995 Bacteria 772
622 Ga0307409_102102266 3300031995 Bacteria 594
623 Ga0316053_119119 3300032120 Bacteria 528
624 Ga0307415_100045269 3300032126 Bacteria 2949
625 Ga0307415_100976415 3300032126 Bacteria 786
626 Ga0316585_10087974 3300032137 Bacteria 1014
627 Ga0316593_10008571 3300032168 Bacteria 2854
628 Ga0316593_10079969 3300032168 Bacteria 1140
629 Ga0307507_10185206 3300033179 Bacteria 1478
630 Ga0316596_1064193 3300033541 Bacteria 981
631 Ga0316214_1000853 3300033545 Bacteria 3335
632 Ga0316212_1007476 3300033547 Bacteria 1576
633 Ga0373938_0006655 3300034957 Bacteria 2006
634 Ga0373945_0166032 3300035116 Bacteria 902
635 Ga0373953_0015877 3300035117 Bacteria 2739
636 Ga0373954_0475062 3300035118 Bacteria 619
637 Ga0316574_0002694 3300035398 Bacteria 8979
638 Ga0316574_0021215 3300035398 Bacteria 3855
639 Ga0373935_0084381 3300035692 Bacteria 2069
640 Ga0373935_1118430 3300035692 Bacteria 586
641 Ga0373933_0057955 3300035724 Bacteria 2329
642 Ga0373933_0335038 3300035724 Bacteria 982
643 Ga0373937_1945564 3300036401 Bacteria 534
644 Ga0265778_036711 3300036457 Bacteria 646
645 Ga0372808_003049 3300036459 Bacteria 2011
646 Ga0310109_050305 3300036534 Bacteria 536
647 Ga0310110_022287 3300036535 Bacteria 867
648 Ga0316582_0022131 3300036647 Bacteria 3770
649 Ga0316584_0007224 3300036712 Bacteria 7577
650 Ga0316584_0975543 3300036712 Bacteria 567
651 Ga0373925_0000004 3300037068 Bacteria 361597
652 Ga0373925_0497909 3300037068 Bacteria 1000
653 Ga0395899_0377735 3300037312 Bacteria 942
654 Ga0395900_0201144 3300037418 Bacteria 2015
655 Ga0395900_0286842 3300037418 Bacteria 1636
656 Ga0395900_0389667 3300037418 Bacteria 1360
657 Ga0395900_0652104 3300037418 Bacteria 989
658 Ga0395898_0012144 3300037466 Bacteria 8913
659 Ga0395898_0078143 3300037466 Bacteria 3193
660 Ga0395898_0379339 3300037466 Bacteria 1348
661 Ga0436364_0010700 3300037853 Bacteria 115369
662 Ga0436364_0537875 3300037853 Bacteria 538
663 Ga0436364_0741352 3300037853 Bacteria 4163
664 Ga0395901_0068330 3300038443 Bacteria 3701
665 Ga0395901_0096897 3300038443 Bacteria 3091
666 Ga0395901_0220498 3300038443 Bacteria 1983
667 Ga0395901_1574253 3300038443 Bacteria 611
668 Ga0436365_1257400 3300039437 Bacteria 59519
669 Ga0436363_1218733 3300039450 Bacteria 1372
670 Ga0436363_1286402 3300039450 Bacteria 547
671 Ga0436362_0337635 3300039453 Bacteria 717
672 Ga0436362_0407008 3300039453 Bacteria 724
673 Ga0436362_0792414 3300039453 Bacteria 1165
674 Ga0436362_0962826 3300039453 Bacteria 530
675 Ga0436362_1251521 3300039453 Bacteria 518
676 Ga0439436_0033428 3300041404 Bacteria 1489
677 Ga0439439_0013591 3300041406 Bacteria 1974
678 Ga0439439_0022670 3300041406 Bacteria 1570
679 Ga0439466_0141534 3300041411 Bacteria 738
680 Ga0451793_0664496 3300041452 Bacteria 568
681 Ga0451835_0283475 3300041492 Bacteria 582
682 Ga0451853_2541022 3300041512 Bacteria 1303
683 Ga0439433_0001269 3300041999 Bacteria 5211
684 Ga0439449_0018354 3300042007 Bacteria 2625
685 Ga0439449_0038483 3300042007 Bacteria 1778
686 Ga0439449_0244300 3300042007 Bacteria 674
687 Ga0439457_008613 3300042014 Bacteria 2399
688 Ga0439457_020414 3300042014 Bacteria 1470
689 Ga0439462_0006125 3300042015 Bacteria 2981
690 Ga0439462_0255665 3300042015 Bacteria 504
691 Ga0450920_022811 3300042122 Bacteria 1213
692 Ga0450890_002547 3300042127 Bacteria 2497
693 Ga0450894_005718 3300042131 Bacteria 1609
694 Ga0450895_017014 3300042132 Bacteria 656
695 Ga0450896_000102 3300042133 Bacteria 6144
696 Ga0450898_008092 3300042134 Bacteria 1650
697 Ga0450899_000622 3300042135 Bacteria 4036
698 Ga0450906_008805 3300042145 Bacteria 1940
699 Ga0450908_001340 3300042184 Bacteria 4776
700 Ga0451577_0368442 3300042876 Bacteria 1303
701 Ga0466969_0097189 3300044656 Bacteria 1389
702 Ga0466969_0201131 3300044656 Bacteria 909
703 Ga0466969_0324119 3300044656 Bacteria 697
704 Ga0466969_0541224 3300044656 Bacteria 533
705 Ga0466972_0007279 3300044658 Bacteria 5557
706 Ga0466972_0154886 3300044658 Bacteria 1076
707 Ga0466972_0236239 3300044658 Bacteria 855
708 Ga0466972_0244282 3300044658 Bacteria 839
709 Ga0466972_0304699 3300044658 Bacteria 744
710 Ga0466965_0012176 3300044683 Bacteria 4042
711 Ga0466965_0033398 3300044683 Bacteria 2514
712 Ga0466965_0037716 3300044683 Bacteria 2373
713 Ga0466965_0372340 3300044683 Bacteria 785
714 Ga0466965_0419593 3300044683 Bacteria 741
715 Ga0466965_0487085 3300044683 Bacteria 690
716 Ga0466965_0616153 3300044683 Bacteria 617
717 Ga0466965_0665373 3300044683 Bacteria 595
718 Ga0466965_0946484 3300044683 Bacteria 504
719 Ga0466966_0000383 3300044684 Bacteria 28757
720 Ga0466966_0121744 3300044684 Bacteria 1602
721 Ga0466966_0171555 3300044684 Bacteria 1318
722 Ga0466966_0189226 3300044684 Bacteria 1247
723 Ga0466966_0387250 3300044684 Bacteria 840
724 Ga0466966_0597184 3300044684 Bacteria 664
725 Ga0466961_0005440 3300044693 Bacteria 8027
726 Ga0466961_0010285 3300044693 Bacteria 5963
727 Ga0466961_0041150 3300044693 Bacteria 2962
728 Ga0466961_0054451 3300044693 Bacteria 2552
729 Ga0466961_0147544 3300044693 Bacteria 1470
730 Ga0466961_0223557 3300044693 Bacteria 1160
731 Ga0466961_0282666 3300044693 Bacteria 1015
732 Ga0466961_0387733 3300044693 Bacteria 848
733 Ga0466961_0398087 3300044693 Bacteria 836
734 Ga0466961_0434621 3300044693 Bacteria 795
735 Ga0466961_0501323 3300044693 Bacteria 733
736 Ga0466961_0627642 3300044693 Bacteria 645
737 Ga0466963_0009016 3300044694 Bacteria 5991
738 Ga0466963_0016148 3300044694 Bacteria 4639
739 Ga0466963_0182357 3300044694 Bacteria 1466
740 Ga0466963_0201949 3300044694 Bacteria 1390
741 Ga0466963_0358646 3300044694 Bacteria 1027
742 Ga0466964_0011253 3300044706 Bacteria 3379
743 Ga0466964_0076112 3300044706 Bacteria 1430
744 Ga0466964_0102268 3300044706 Bacteria 1265
745 Ga0466964_0201227 3300044706 Bacteria 956
746 Ga0466964_0230707 3300044706 Bacteria 903
747 Ga0466964_0340009 3300044706 Bacteria 768
748 Ga0466964_0697825 3300044706 Bacteria 565
749 Ga0466971_0001406 3300044719 Bacteria 10109
750 Ga0466971_0009870 3300044719 Bacteria 4169
751 Ga0466971_0224100 3300044719 Bacteria 892
752 Ga0466971_0378482 3300044719 Bacteria 688
753 Ga0466968_0000486 3300044735 Bacteria 13428
754 Ga0466968_0030625 3300044735 Bacteria 2229
755 Ga0466968_0131704 3300044735 Bacteria 1138
756 Ga0466968_0249869 3300044735 Bacteria 842
757 Ga0466968_0647202 3300044735 Bacteria 536
758 Ga0466970_0003384 3300044765 Bacteria 7764
759 Ga0466970_0007149 3300044765 Bacteria 5589
760 Ga0466970_0018820 3300044765 Bacteria 3577
761 Ga0466970_0031860 3300044765 Bacteria 2785
762 Ga0466970_0107886 3300044765 Bacteria 1519
763 Ga0466970_0273099 3300044765 Bacteria 950
764 Ga0466957_0001751 3300044842 Bacteria 11414
765 Ga0466957_0008706 3300044842 Bacteria 5781
766 Ga0466957_0009243 3300044842 Bacteria 5623
767 Ga0466957_0112320 3300044842 Bacteria 1729
768 Ga0466957_0334200 3300044842 Bacteria 1025
769 Ga0466957_0554770 3300044842 Bacteria 801
770 Ga0466957_1163218 3300044842 Bacteria 557
771 Ga0466960_0003887 3300044901 Bacteria 5793
772 Ga0466960_0027272 3300044901 Bacteria 2603
773 Ga0466960_0038077 3300044901 Bacteria 2259
774 Ga0466960_0054879 3300044901 Bacteria 1936
775 Ga0466960_0166223 3300044901 Bacteria 1188
776 Ga0466960_0281435 3300044901 Bacteria 932
777 Ga0466960_0557895 3300044901 Bacteria 676
778 Ga0466960_0880029 3300044901 Bacteria 545
779 Ga0466959_0017822 3300045049 Bacteria 5209
780 Ga0466959_0045060 3300045049 Bacteria 3249
781 Ga0466959_0056983 3300045049 Bacteria 2850
782 Ga0466959_0116146 3300045049 Bacteria 1906
783 Ga0466959_0130095 3300045049 Bacteria 1784
784 Ga0466959_0172941 3300045049 Bacteria 1514
785 Ga0466959_0359411 3300045049 Bacteria 992
786 Ga0466959_0741762 3300045049 Bacteria 657
787 Ga0466958_0000206 3300045836 Bacteria 21886
788 Ga0466958_0007393 3300045836 Bacteria 6040
789 Ga0466958_0012657 3300045836 Bacteria 4782
790 Ga0466958_0182407 3300045836 Bacteria 1332
791 Ga0466967_0045336 3300045976 Bacteria 3819
792 Ga0466967_0064388 3300045976 Bacteria 3260
793 Ga0466967_0414451 3300045976 Bacteria 1312
794 Ga0466967_0479045 3300045976 Bacteria 1219
795 Ga0466967_0574241 3300045976 Bacteria 1111
796 Ga0466967_0617936 3300045976 Bacteria 1070
797 Ga0466967_0678173 3300045976 Bacteria 1020
798 Ga0466967_0863223 3300045976 Bacteria 899
799 Ga0466967_1558375 3300045976 Bacteria 658
800 Ga0466967_1762032 3300045976 Bacteria 617
801 Ga0466967_1845408 3300045976 Bacteria 601
802 Ga0495592_0007064 3300046454 Bacteria 8400
803 Ga0495592_0065762 3300046454 Bacteria 2653
804 Ga0495592_0295064 3300046454 Bacteria 1055
805 Ga0495603_0216725 3300046455 Bacteria 1104
806 Ga0495603_0307456 3300046455 Bacteria 910
807 Ga0495590_0012257 3300046457 Bacteria 3184
808 Ga0495629_0136009 3300046459 Bacteria 1711
809 Ga0495629_0856227 3300046459 Bacteria 597
810 Ga0495638_0266682 3300046460 Bacteria 936
811 Ga0495641_0046104 3300046461 Bacteria 2005
812 Ga0495641_0087695 3300046461 Bacteria 1392
813 Ga0495651_0000169 3300046462 Bacteria 48128
814 Ga0495651_0001372 3300046462 Bacteria 18867
815 Ga0495651_0015125 3300046462 Bacteria 5963
816 Ga0495651_0807383 3300046462 Bacteria 578
817 Ga0495653_0122937 3300046463 Bacteria 1846
818 Ga0495580_0007502 3300046472 Bacteria 8764
819 Ga0495582_0474268 3300046473 Bacteria 723
820 Ga0495605_0047498 3300046474 Bacteria 2105
821 Ga0495662_0000096 3300046476 Bacteria 32069
822 Ga0495662_0293132 3300046476 Bacteria 800
823 Ga0495664_0002322 3300046477 Bacteria 10191
824 Ga0495664_0122341 3300046477 Bacteria 1573
825 Ga0495585_0070600 3300046492 Bacteria 1904
826 Ga0495594_0011474 3300046499 Bacteria 4606
827 Ga0495594_0161811 3300046499 Bacteria 1273
828 Ga0495596_0003837 3300046500 Bacteria 7470
829 Ga0495607_0004843 3300046501 Bacteria 9815
830 Ga0495583_0009440 3300046506 Bacteria 5825
831 Ga0495583_0418750 3300046506 Bacteria 525
832 Ga0495606_0010501 3300046507 Bacteria 7671
833 Ga0495608_0002713 3300046511 Bacteria 12721
834 Ga0495608_0067863 3300046511 Bacteria 2332
835 Ga0495610_0074796 3300046512 Bacteria 1570
836 Ga0495618_0017866 3300046514 Bacteria 4352
837 Ga0495618_0517844 3300046514 Bacteria 717
838 Ga0495620_0068552 3300046515 Bacteria 1456
839 Ga0495628_0002207 3300046516 Bacteria 17611
840 Ga0495628_0016156 3300046516 Bacteria 6228
841 Ga0495628_0140174 3300046516 Bacteria 1845
842 Ga0495630_0002424 3300046517 Bacteria 12922
843 Ga0495630_0868987 3300046517 Bacteria 687
844 Ga0495631_0038283 3300046518 Bacteria 2132
845 Ga0495637_0103270 3300046520 Bacteria 1111
846 Ga0495643_0001180 3300046522 Bacteria 25444
847 Ga0495644_0276459 3300046523 Bacteria 655
848 Ga0495644_0379260 3300046523 Bacteria 558
849 Ga0495648_0024720 3300046524 Bacteria 4081
850 Ga0495648_0054915 3300046524 Bacteria 2403
851 Ga0495666_0000307 3300046526 Bacteria 21312
852 Ga0495652_0010757 3300046529 Bacteria 8291
853 Ga0495652_0013442 3300046529 Bacteria 7367
854 Ga0495652_0018548 3300046529 Bacteria 6202
855 Ga0495654_0003279 3300046530 Bacteria 9982
856 Ga0495665_0001543 3300046531 Bacteria 12285
857 Ga0495665_0032438 3300046531 Bacteria 2794
858 Ga0495665_0226066 3300046531 Bacteria 967
859 Ga0495640_0002906 3300046533 Bacteria 13796
860 Ga0495640_0400265 3300046533 Bacteria 843
861 Ga0495640_0743072 3300046533 Bacteria 587
862 Ga0495587_0001703 3300046536 Bacteria 14685
863 Ga0495587_0413588 3300046536 Bacteria 749
864 Ga0495598_0125405 3300046537 Bacteria 875
865 Ga0495609_0009614 3300046538 Bacteria 4672
866 Ga0495621_0147796 3300046539 Bacteria 923
867 Ga0495597_0052969 3300046542 Bacteria 1785
868 Ga0495645_0002261 3300046543 Bacteria 13098
869 Ga0495645_0020520 3300046543 Bacteria 4769
870 Ga0495622_0031757 3300046557 Bacteria 2466
871 Ga0495622_0265234 3300046557 Bacteria 753
872 Ga0495633_0014557 3300046558 Bacteria 4107
873 Ga0495667_0028951 3300046559 Bacteria 3728
874 Ga0495667_0056543 3300046559 Bacteria 2580
875 Ga0495667_0290983 3300046559 Bacteria 1036
876 Ga0495667_0667388 3300046559 Bacteria 645
877 Ga0495656_0042504 3300046615 Bacteria 1903
878 Ga0495656_0050533 3300046615 Bacteria 1776
879 Ga0495668_0001638 3300046616 Bacteria 20892
880 Ga0495634_0007090 3300046642 Bacteria 8452
881 Ga0495634_0024406 3300046642 Bacteria 4242
882 Ga0495611_0009288 3300046648 Bacteria 4151
883 Ga0495625_0006809 3300046660 Bacteria 10098
884 Ga0495625_0049329 3300046660 Bacteria 3026
885 Ga0495625_0592391 3300046660 Bacteria 666
886 Ga0495635_0005159 3300046663 Bacteria 9093
887 Ga0495635_0098521 3300046663 Bacteria 1998
888 Ga0495661_0090733 3300046665 Bacteria 1738
889 Ga0495657_0005637 3300046675 Bacteria 9879
890 Ga0495657_0047630 3300046675 Bacteria 2896
891 Ga0495657_0088733 3300046675 Bacteria 1987
892 Ga0495599_0007801 3300046678 Bacteria 6496
893 Ga0495599_0018530 3300046678 Bacteria 4337
894 Ga0495599_0221149 3300046678 Bacteria 1158
895 Ga0495599_0328383 3300046678 Bacteria 920
896 Ga0495623_0010498 3300046679 Bacteria 5994
897 Ga0495646_0088466 3300046680 Bacteria 1793
898 Ga0495646_0121733 3300046680 Bacteria 1476
899 Ga0495647_0109875 3300046681 Bacteria 1150
900 Ga0495658_0029856 3300046683 Bacteria 2955
901 Ga0495658_0073694 3300046683 Bacteria 1988
902 Ga0495613_0005309 3300046689 Bacteria 9676
903 Ga0495613_0839668 3300046689 Bacteria 597
904 Ga0495624_0042222 3300046690 Bacteria 2914
905 Ga0495649_0077694 3300046694 Bacteria 1776
906 Ga0495589_0074826 3300046794 Bacteria 1651
907 Ga0495600_0002715 3300046809 Bacteria 10238
908 Ga0495600_0011482 3300046809 Bacteria 5520
909 Ga0495600_0339868 3300046809 Bacteria 941
910 Ga0495660_0045943 3300046810 Bacteria 2395
911 Ga0495581_0015465 3300047315 Bacteria 4430
912 Ga0495581_0205410 3300047315 Bacteria 1152
913 Ga0495581_0242218 3300047315 Bacteria 1054
914 Ga0495604_0002362 3300047317 Bacteria 15139
915 Ga0495604_0198955 3300047317 Bacteria 1391
916 Ga0495636_0350808 3300047318 Bacteria 696
917 Ga0495636_0570312 3300047318 Bacteria 551
918 Ga0495674_0026033 3300047319 Bacteria 5353
919 Ga0495674_0158431 3300047319 Bacteria 1895
920 Ga0495674_0230718 3300047319 Bacteria 1528
921 Ga0495674_0458138 3300047319 Bacteria 1024
922 Ga0495674_0798347 3300047319 Bacteria 734
923 Ga0495672_0029562 3300047320 Bacteria 3449
924 Ga0495672_0493891 3300047320 Bacteria 545
925 Ga0495676_0153676 3300047321 Bacteria 1634
926 Ga0495676_0346616 3300047321 Bacteria 993
927 Ga0495676_0878541 3300047321 Bacteria 575
928 Ga0495680_0258306 3300047322 Bacteria 1232
929 Ga0495680_0314129 3300047322 Bacteria 1098
930 Ga0495683_0008496 3300047323 Bacteria 5492
931 Ga0495683_0009389 3300047323 Bacteria 5212
932 Ga0495675_0005831 3300047444 Bacteria 7524
933 Ga0495675_0048524 3300047444 Bacteria 2700
934 Ga0495677_0116537 3300047445 Bacteria 1017
935 Ga0495679_052439 3300047446 Bacteria 1220
936 Ga0495685_105446 3300047447 Bacteria 929
937 Ga0495681_0057526 3300047470 Bacteria 1805
938 Ga0495681_0341214 3300047470 Bacteria 571
939 Ga0495684_0012770 3300047471 Bacteria 6480
940 Ga0495684_0178913 3300047471 Bacteria 1573
941 Ga0495684_0239299 3300047471 Bacteria 1325
942 Ga0495686_0016607 3300047472 Bacteria 4987
943 Ga0495593_0004470 3300047673 Bacteria 8309
944 Ga0495593_0009251 3300047673 Bacteria 5715
945 Ga0495593_0494119 3300047673 Bacteria 613
946 Ga0495602_0013431 3300048088 Bacteria 8370
947 Ga0495602_0915814 3300048088 Bacteria 583
948 Ga0495614_0081925 3300048089 Bacteria 1398
949 Ga0495615_0085372 3300048090 Bacteria 872
950 Ga0495615_0150865 3300048090 Bacteria 692
951 Ga0495626_0002897 3300048091 Bacteria 11430
952 Ga0495626_0014129 3300048091 Bacteria 4129
953 Ga0496100_0434567 3300048903 Bacteria 1004
954 Ga0496100_0726312 3300048903 Bacteria 776
955 Ga0496102_0153859 3300048905 Bacteria 2162
956 Ga0496102_0251664 3300048905 Bacteria 1666
957 Ga0496103_0161226 3300048906 Bacteria 1438
958 Ga0496104_0089127 3300048907 Bacteria 2947
959 Ga0496104_0138327 3300048907 Bacteria 2340
960 Ga0496104_0215285 3300048907 Bacteria 1833
961 Ga0496104_0466077 3300048907 Bacteria 1175
962 Ga0496104_0571587 3300048907 Bacteria 1041
963 Ga0496104_1780769 3300048907 Bacteria 518
964 Ga0496105_0059980 3300048908 Bacteria 3139
965 Ga0496105_0083619 3300048908 Bacteria 2636
966 Ga0496105_0259952 3300048908 Bacteria 1404
967 Ga0496105_0664833 3300048908 Bacteria 803
968 Ga0496107_0253576 3300048910 Bacteria 1309
969 Ga0496108_0094197 3300048911 Bacteria 2549
970 Ga0496108_0352911 3300048911 Bacteria 1283
971 Ga0496109_0195452 3300048912 Bacteria 1901
972 Ga0496109_1195684 3300048912 Bacteria 697
973 Ga0496110_0001862 3300048913 Bacteria 15584
974 Ga0496110_0124579 3300048913 Bacteria 2324
975 Ga0496110_1016179 3300048913 Bacteria 737
976 Ga0496110_1276380 3300048913 Bacteria 643
977 Ga0496111_0020580 3300048914 Bacteria 4594
978 Ga0496111_0125391 3300048914 Bacteria 1898
979 Ga0496111_0201873 3300048914 Bacteria 1478
980 Ga0496112_0343000 3300048915 Bacteria 1437
981 Ga0496112_0350909 3300048915 Bacteria 1418
982 Ga0496112_0419013 3300048915 Bacteria 1278
983 Ga0496112_0556047 3300048915 Bacteria 1081
984 Ga0496113_0394154 3300048916 Bacteria 1111
985 Ga0496114_0400759 3300048917 Bacteria 1215
986 Ga0496114_0655080 3300048917 Bacteria 923
987 Ga0496114_0761891 3300048917 Bacteria 845
988 Ga0496115_0268221 3300048918 Bacteria 1403
989 Ga0496115_0892587 3300048918 Bacteria 686
990 Ga0496116_0001739 3300048919 Bacteria 23720
991 Ga0496117_0021752 3300048920 Bacteria 5175
992 Ga0496118_0011170 3300048921 Bacteria 8795
993 Ga0496118_0013367 3300048921 Bacteria 7771
994 Ga0496118_0046340 3300048921 Bacteria 3384
995 Ga0496119_0000855 3300048922 Bacteria 40135
996 Ga0496119_0009028 3300048922 Bacteria 8645
997 Ga0496119_0013889 3300048922 Bacteria 6356
998 Ga0496119_0095006 3300048922 Bacteria 1685
999 Ga0496119_0108730 3300048922 Bacteria 1543
1000 Ga0496119_0213356 3300048922 Bacteria 992
1001 Ga0496120_0000372 3300048923 Bacteria 72951
1002 Ga0496120_0192930 3300048923 Bacteria 992
1003 Ga0496120_0268798 3300048923 Bacteria 793
1004 Ga0496120_0400801 3300048923 Bacteria 606
1005 Ga0496121_0012636 3300048924 Bacteria 9173
1006 Ga0496121_0017835 3300048924 Bacteria 7209
1007 Ga0496121_0040377 3300048924 Bacteria 4095
1008 Ga0496123_0361362 3300048926 Bacteria 672
1009 Ga0496125_0258633 3300048928 Bacteria 1093
1010 Ga0496126_0046941 3300048929 Bacteria 3956
1011 Ga0496126_0186755 3300048929 Bacteria 1757
1012 Ga0496126_0563945 3300048929 Bacteria 902
1013 Ga0496126_0997735 3300048929 Bacteria 628
1014 Ga0496126_1155865 3300048929 Bacteria 572
1015 Ga0501306_002889 3300049127 Bacteria 1805
1016 Ga0501306_093857 3300049127 Bacteria 530
1017 Ga0501308_000276 3300049128 Bacteria 3066
1018 Ga0501309_025458 3300049129 Bacteria 850
1019 Ga0501310_015638 3300049130 Bacteria 902
1020 Ga0501304_005680 3300049160 Bacteria 984
1021 Ga0501305_024295 3300049161 Bacteria 912
1022 Ga0501307_000101 3300049162 Bacteria 3967
1023 Ga0495678_011561 3300049459 Bacteria 4220
1024 Ga0495682_0090884 3300049460 Bacteria 1096
1025 Ga0501311_065545 3300049527 Bacteria 594
1026 Ga0501312_048349 3300049528 Bacteria 712
1027 Ga0501316_026744 3300049532 Bacteria 756
1028 Ga0501316_073835 3300049532 Bacteria 520
1029 Ga0501317_000812 3300049533 Bacteria 2422
1030 Ga0501317_014549 3300049533 Bacteria 998
1031 Ga0501317_066142 3300049533 Bacteria 602
1032 Ga0501318_047129 3300049534 Bacteria 631
1033 Ga0501322_013198 3300049538 Bacteria 664
1034 Ga0501325_026113 3300049541 Bacteria 645
1035 Ga0501326_02682 3300049542 Bacteria 886
1036 Ga0501031_0076041 3300049568 Bacteria 2186
1037 Ga0501032_1063669 3300049569 Bacteria 507
1038 Ga0501033_0014092 3300049570 Bacteria 6079
1039 Ga0501034_0027993 3300049571 Bacteria 5731
1040 Ga0501034_0193563 3300049571 Bacteria 1995
1041 Ga0501034_1107795 3300049571 Bacteria 672
1042 Ga0501034_1352442 3300049571 Bacteria 588
1043 Ga0501036_0027287 3300049572 Bacteria 4824
1044 Ga0501036_1476200 3300049572 Bacteria 550
1045 Ga0501037_0618337 3300049573 Bacteria 726
1046 Ga0501038_0539128 3300049574 Bacteria 888
1047 Ga0501040_0006258 3300049576 Bacteria 7727
1048 Ga0501043_0023095 3300049579 Bacteria 4878
1049 Ga0501046_0522737 3300049580 Bacteria 848
1050 Ga0501047_0023199 3300049581 Bacteria 5958
1051 Ga0501047_0109201 3300049581 Bacteria 2649
1052 Ga0501047_0248456 3300049581 Bacteria 1628
1053 Ga0501047_0361296 3300049581 Bacteria 1288
1054 Ga0501067_0815538 3300049583 Bacteria 526
1055 Ga0501070_0006424 3300049586 Bacteria 10005
1056 Ga0501070_0018699 3300049586 Bacteria 5813
1057 Ga0501070_0166769 3300049586 Bacteria 1815
1058 Ga0501070_0227045 3300049586 Bacteria 1530
1059 Ga0501070_0328045 3300049586 Bacteria 1244
1060 Ga0501070_0481253 3300049586 Bacteria 998
1061 Ga0501070_0695643 3300049586 Bacteria 804
1062 Ga0501070_1510886 3300049586 Bacteria 508
1063 Ga0501073_0072398 3300049589 Bacteria 2400
1064 Ga0501074_0002630 3300049590 Bacteria 12572
1065 Ga0501243_082740 3300049675 Bacteria 627
1066 Ga0501079_0001234 3300049741 Bacteria 17906
1067 Ga0501080_0039768 3300049742 Bacteria 4388
1068 Ga0501080_0173230 3300049742 Bacteria 1989
1069 Ga0501080_0449416 3300049742 Bacteria 1155
1070 Ga0501080_1871846 3300049742 Bacteria 503
1071 Ga0501035_0045392 3300049822 Bacteria 3953
1072 Ga0501035_0341597 3300049822 Bacteria 1254
1073 Ga0501044_0038405 3300049823 Bacteria 4999
1074 Ga0501044_0088185 3300049823 Bacteria 3132
1075 Ga0501044_0618549 3300049823 Bacteria 975
1076 Ga0501045_0242225 3300049824 Bacteria 1342
1077 nmdc:mga0yw44_45501_c1 3300050492 Bacteria 2017
1078 nmdc:mga05p37_162208_c1 3300050507 Bacteria 2729
1079 nmdc:mga05p37_231129_c1 3300050507 Bacteria 2228
1080 nmdc:mga05p37_363629_c1 3300050507 Bacteria 1700
1081 nmdc:mga05p37_5679_c1 3300050507 Bacteria 14665
1082 nmdc:mga05p37_93825_c1 3300050507 Bacteria 3698
1083 nmdc:mga09592_1450919_c1 3300050508 Bacteria 560
1084 nmdc:mga09592_155694_c1 3300050508 Bacteria 1972
1085 nmdc:mga09592_334103_c1 3300050508 Bacteria 1312
1086 nmdc:mga0qj67_2506_c1 3300050509 Bacteria 13106
1087 nmdc:mga0qj67_70050_c1 3300050509 Bacteria 2797
1088 nmdc:mga06r32_1592375_c1 3300050510 Bacteria 592
1089 nmdc:mga06r32_193463_c1 3300050510 Bacteria 2021
1090 nmdc:mga0n895_316660_c1 3300050512 Bacteria 1581
1091 nmdc:mga0rr50_219225_c1 3300050513 Bacteria 1050
1092 Ga0495601_0010241 3300053077 Bacteria 5575
1093 Ga0495601_0028869 3300053077 Bacteria 3438
1094 Ga0495601_0080406 3300053077 Bacteria 2091
1095 Ga0495612_0016852 3300053078 Bacteria 2927
1096 Ga0495619_0098160 3300053085 Bacteria 1991
1097 Ga0495619_0416108 3300053085 Bacteria 927
1098 Ga0500583_0011796 3300053092 Bacteria 3309
1099 Ga0500654_115131 3300053099 Bacteria 1083
1100 Ga0500660_129288 3300053100 Bacteria 1031
1101 Ga0500628_070191 3300053129 Bacteria 876
1102 Ga0500577_0001143 3300053142 Bacteria 6808
1103 Ga0500616_0132586 3300053153 Bacteria 1175
1104 Ga0501084_0120390 3300054114 Bacteria 2207
1105 Ga0587084_066412 3300059477 Bacteria 672
1106 Ga0587093_019083 3300059478 Bacteria 900
1107 Ga0587066_089645 3300059490 Bacteria 681
1108 Ga0587070_113159 3300059491 Bacteria 640
1109 Ga0587070_129654 3300059491 Bacteria 612
1110 Ga0587073_0030599 3300059492 Bacteria 1109
1111 Ga0587073_0131699 3300059492 Bacteria 687
1112 Ga0587080_046008 3300059503 Bacteria 810
1113 Ga0587082_015336 3300059504 Bacteria 1182
1114 Ga0587082_037345 3300059504 Bacteria 875
1115 Ga0587082_082338 3300059504 Bacteria 673
1116 Ga0587082_119777 3300059504 Bacteria 593
1117 Ga0587083_0109780 3300059505 Bacteria 699
1118 Ga0587083_0213010 3300059505 Bacteria 558
1119 Ga0587085_040772 3300059506 Bacteria 808
1120 Ga0587086_025247 3300059507 Bacteria 840
1121 Ga0587088_036342 3300059508 Bacteria 907
1122 Ga0587088_180665 3300059508 Bacteria 528
1123 Ga0587090_055549 3300059510 Bacteria 737
1124 Ga0587090_107533 3300059510 Bacteria 591
1125 Ga0587091_019007 3300059511 Bacteria 1176
1126 Ga0587092_163809 3300059512 Bacteria 505
1127 Ga0587094_091932 3300059513 Bacteria 575
1128 Ga0587106_034110 3300059605 Bacteria 832
1129 Ga0587125_010667 3300059607 Bacteria 952
1130 Ga0587099_052589 3300059622 Bacteria 547
1131 Ga0587101_057370 3300059623 Bacteria 687
1132 Ga0587101_131720 3300059623 Bacteria 527
1133 Ga0587128_064370 3300059630 Bacteria 700
1134 Ga0587067_017251 3300059640 Bacteria 1196
1135 Ga0587067_081438 3300059640 Bacteria 717
1136 Ga0587067_105092 3300059640 Bacteria 659
1137 Ga0587068_059859 3300059641 Bacteria 730
1138 Ga0587068_098995 3300059641 Bacteria 610
1139 Ga0587069_040127 3300059642 Bacteria 795
1140 Ga0587072_014988 3300059643 Bacteria 1311
1141 Ga0587072_017983 3300059643 Bacteria 1224
1142 Ga0587075_017503 3300059644 Bacteria 1031
1143 Ga0587075_081417 3300059644 Bacteria 618
1144 Ga0587076_047041 3300059645 Bacteria 828
1145 Ga0587078_034841 3300059646 Bacteria 692
1146 Ga0587079_090444 3300059647 Bacteria 715
1147 Ga0587079_115115 3300059647 Bacteria 658
1148 Ga0587079_199776 3300059647 Bacteria 545
1149 Ga0587107_134990 3300059652 Bacteria 522
1150 Ga0587108_010089 3300059653 Bacteria 788
1151 Ga0587114_017298 3300059655 Bacteria 976
1152 Ga0587114_115088 3300059655 Bacteria 539
1153 Ga0587071_171532 3300060344 Bacteria 552
1154 Ga0587111_0025486 3300060346 Bacteria 1172
1155 Ga0587111_0037820 3300060346 Bacteria 1016
1156 Ga0587111_0084148 3300060346 Bacteria 765
1157 Ga0466962_0001686 3300061719 Bacteria 10365
1158 Ga0466962_0003094 3300061719 Bacteria 7915
1159 Ga0466962_0386486 3300061719 Bacteria 700
1160 Ga0466962_0394145 3300061719 Bacteria 693
1161 Ga0466962_0565371 3300061719 Bacteria 578
1162 Ga0466962_0668870 3300061719 Bacteria 531

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300039453 Ga0436362_0407008 Ga0436362_0407008_421_714 80
2 3300007265 Ga0099794_10193717 Ga0099794_101937172 88
3 3300032168 Ga0316593_10079969 Ga0316593_100799693 88
4 3300059655 Ga0587114_115088 Ga0587114_115088_108_395 88
5 3300003203 JGI25406J46586_10003028 JGI25406J46586_100030283 89
6 3300004801 Ga0058860_12227750 Ga0058860_122277501 89
7 3300005435 Ga0070714_101144325 Ga0070714_1011443252 89
8 3300005563 Ga0068855_100305134 Ga0068855_1003051343 89
9 3300005985 Ga0081539_10000109 Ga0081539_10000109112 89
10 3300006173 Ga0070716_101015384 Ga0070716_1010153842 89
11 3300006844 Ga0075428_100089494 Ga0075428_1000894944 89
12 3300006844 Ga0075428_100269806 Ga0075428_1002698062 89
13 3300006846 Ga0075430_100038086 Ga0075430_1000380867 89
14 3300006847 Ga0075431_100119295 Ga0075431_1001192954 89
15 3300006847 Ga0075431_100254409 Ga0075431_1002544094 89
16 3300006880 Ga0075429_101629322 Ga0075429_1016293222 89
17 3300006880 Ga0075429_102000322 Ga0075429_1020003221 89
18 3300009147 Ga0114129_10000114 Ga0114129_1000011456 89
19 3300009147 Ga0114129_10230488 Ga0114129_102304884 89
20 3300013307 Ga0157372_12066258 Ga0157372_120662582 89
21 3300020070 Ga0206356_10141090 Ga0206356_101410902 89
22 3300020081 Ga0206354_10997721 Ga0206354_109977217 89
23 3300025939 Ga0207665_10254816 Ga0207665_102548164 89
24 3300026095 Ga0207676_10656343 Ga0207676_106563432 89
25 3300028381 Ga0268264_12460400 Ga0268264_124604002 89
26 3300031548 Ga0307408_100238013 Ga0307408_1002380134 89
27 3300031691 Ga0316579_10237329 Ga0316579_102373291 89
28 3300031727 Ga0316576_10003193 Ga0316576_100031933 89
29 3300031727 Ga0316576_10030080 Ga0316576_100300807 89
30 3300031728 Ga0316578_10034392 Ga0316578_100343924 89
31 3300031728 Ga0316578_10082675 Ga0316578_100826753 89
32 3300031901 Ga0307406_10492953 Ga0307406_104929533 89
33 3300031995 Ga0307409_101233060 Ga0307409_1012330602 89
34 3300032126 Ga0307415_100976415 Ga0307415_1009764151 89
35 3300032137 Ga0316585_10087974 Ga0316585_100879743 89
36 3300032168 Ga0316593_10008571 Ga0316593_100085716 89
37 3300033541 Ga0316596_1064193 Ga0316596_10641933 89
38 3300035117 Ga0373953_0015877 Ga0373953_0015877_579_857 89
39 3300035118 Ga0373954_0475062 Ga0373954_0475062_157_435 89
40 3300035398 Ga0316574_0021215 Ga0316574_0021215_626_907 89
41 3300035724 Ga0373933_0057955 Ga0373933_0057955_799_1077 89
42 3300036712 Ga0316584_0975543 Ga0316584_0975543_141_422 89
43 3300037418 Ga0395900_0652104 Ga0395900_0652104_282_563 89
44 3300044656 Ga0466969_0201131 Ga0466969_0201131_120_398 89
45 3300044684 Ga0466966_0000383 Ga0466966_0000383_23987_24265 89
46 3300044693 Ga0466961_0054451 Ga0466961_0054451_613_891 89
47 3300044694 Ga0466963_0009016 Ga0466963_0009016_4469_4747 89
48 3300044706 Ga0466964_0076112 Ga0466964_0076112_316_594 89
49 3300044719 Ga0466971_0009870 Ga0466971_0009870_2358_2636 89
50 3300044735 Ga0466968_0131704 Ga0466968_0131704_28_306 89
51 3300044842 Ga0466957_0009243 Ga0466957_0009243_727_1005 89
52 3300044842 Ga0466957_0334200 Ga0466957_0334200_132_416 89
53 3300045049 Ga0466959_0017822 Ga0466959_0017822_712_990 89
54 3300045836 Ga0466958_0000206 Ga0466958_0000206_18743_19021 89
55 3300045976 Ga0466967_0479045 Ga0466967_0479045_498_776 89
56 3300045976 Ga0466967_0574241 Ga0466967_0574241_471_755 89
57 3300045976 Ga0466967_1845408 Ga0466967_1845408_269_550 89
58 3300046461 Ga0495641_0087695 Ga0495641_0087695_656_943 89
59 3300046533 Ga0495640_0400265 Ga0495640_0400265_471_749 89
60 3300046616 Ga0495668_0001638 Ga0495668_0001638_13677_13955 89
61 3300046660 Ga0495625_0006809 Ga0495625_0006809_4358_4636 89
62 3300047319 Ga0495674_0230718 Ga0495674_0230718_235_513 89
63 3300047323 Ga0495683_0008496 Ga0495683_0008496_3096_3374 89
64 3300048091 Ga0495626_0002897 Ga0495626_0002897_4345_4623 89
65 3300048922 Ga0496119_0213356 Ga0496119_0213356_216_590 89
66 3300049533 Ga0501317_014549 Ga0501317_014549_467_760 89
67 3300049576 Ga0501040_0006258 Ga0501040_0006258_637_933 89
68 3300049675 Ga0501243_082740 Ga0501243_082740_107_406 89
69 3300050507 nmdc:mga05p37_162208_c1 nmdc:mga05p37_162208_c1_382_660 89
70 3300050507 nmdc:mga05p37_363629_c1 nmdc:mga05p37_363629_c1_1052_1330 89
71 3300050507 nmdc:mga05p37_5679_c1 nmdc:mga05p37_5679_c1_2652_2930 89
72 3300050508 nmdc:mga09592_1450919_c1 nmdc:mga09592_1450919_c1_256_534 89
73 3300050508 nmdc:mga09592_155694_c1 nmdc:mga09592_155694_c1_1030_1308 89
74 3300050509 nmdc:mga0qj67_2506_c1 nmdc:mga0qj67_2506_c1_5275_5565 89
75 3300050510 nmdc:mga06r32_193463_c1 nmdc:mga06r32_193463_c1_1342_1620 89
76 3300053085 Ga0495619_0098160 Ga0495619_0098160_664_942 89
77 3300059510 Ga0587090_107533 Ga0587090_107533_197_475 89
78 3300061719 Ga0466962_0003094 Ga0466962_0003094_4780_5058 89
79 3300004799 Ga0058863_11832389 Ga0058863_118323893 90
80 3300004800 Ga0058861_11863394 Ga0058861_118633942 90
81 3300005327 Ga0070658_10001764 Ga0070658_1000176417 90
82 3300005336 Ga0070680_100004398 Ga0070680_10000439812 90
83 3300005445 Ga0070708_100073925 Ga0070708_1000739251 90
84 3300005445 Ga0070708_102214970 Ga0070708_1022149701 90
85 3300005458 Ga0070681_10004293 Ga0070681_1000429312 90
86 3300005467 Ga0070706_100094440 Ga0070706_1000944404 90
87 3300005471 Ga0070698_100007360 Ga0070698_10000736013 90
88 3300005530 Ga0070679_100006878 Ga0070679_10000687812 90
89 3300005618 Ga0068864_102470557 Ga0068864_1024705571 90
90 3300005842 Ga0068858_101225703 Ga0068858_1012257032 90
91 3300006028 Ga0070717_10272125 Ga0070717_102721252 90
92 3300006844 Ga0075428_100144016 Ga0075428_1001440164 90
93 3300009094 Ga0111539_11165846 Ga0111539_111658461 90
94 3300009147 Ga0114129_10158563 Ga0114129_101585636 90
95 3300013105 Ga0157369_10248956 Ga0157369_102489564 90
96 3300013105 Ga0157369_11675608 Ga0157369_116756082 90
97 3300020069 Ga0197907_10639128 Ga0197907_106391284 90
98 3300020081 Ga0206354_10292391 Ga0206354_102923913 90
99 3300020081 Ga0206354_10669361 Ga0206354_106693613 90
100 3300020082 Ga0206353_10558793 Ga0206353_105587934 90
101 3300020082 Ga0206353_11707872 Ga0206353_117078722 90
102 3300020610 Ga0154015_1050976 Ga0154015_10509763 90
103 3300022467 Ga0224712_10119501 Ga0224712_101195014 90
104 3300025909 Ga0207705_10000671 Ga0207705_1000067126 90
105 3300025910 Ga0207684_10034994 Ga0207684_100349947 90
106 3300025912 Ga0207707_10001820 Ga0207707_1000182029 90
107 3300025917 Ga0207660_10000562 Ga0207660_1000056227 90
108 3300025919 Ga0207657_10302551 Ga0207657_103025512 90
109 3300025921 Ga0207652_10000632 Ga0207652_1000063217 90
110 3300025922 Ga0207646_10159851 Ga0207646_101598514 90
111 3300028556 Ga0265337_1105293 Ga0265337_11052932 90
112 3300028573 Ga0265334_10057630 Ga0265334_100576303 90
113 3300028800 Ga0265338_10011876 Ga0265338_100118764 90
114 3300030963 Ga0265768_116295 Ga0265768_1162952 90
115 3300031240 Ga0265320_10033393 Ga0265320_100333935 90
116 3300031241 Ga0265325_10005613 Ga0265325_100056136 90
117 3300031247 Ga0265340_10007408 Ga0265340_1000740811 90
118 3300031249 Ga0265339_10013888 Ga0265339_100138887 90
119 3300031250 Ga0265331_10244502 Ga0265331_102445022 90
120 3300031344 Ga0265316_10307515 Ga0265316_103075151 90
121 3300031595 Ga0265313_10125043 Ga0265313_101250433 90
122 3300031686 Ga0310119_113302 Ga0310119_1133021 90
123 3300031711 Ga0265314_10039636 Ga0265314_100396362 90
124 3300031712 Ga0265342_10048760 Ga0265342_100487603 90
125 3300031901 Ga0307406_11387865 Ga0307406_113878651 90
126 3300031903 Ga0307407_11118579 Ga0307407_111185792 90
127 3300036457 Ga0265778_036711 Ga0265778_036711_47_331 90
128 3300037853 Ga0436364_0537875 Ga0436364_0537875_155_433 90
129 3300039453 Ga0436362_0337635 Ga0436362_0337635_118_429 90
130 3300044658 Ga0466972_0236239 Ga0466972_0236239_89_367 90
131 3300044683 Ga0466965_0012176 Ga0466965_0012176_2385_2663 90
132 3300044683 Ga0466965_0037716 Ga0466965_0037716_1775_2056 90
133 3300044683 Ga0466965_0487085 Ga0466965_0487085_179_457 90
134 3300044683 Ga0466965_0616153 Ga0466965_0616153_148_441 90
135 3300044693 Ga0466961_0398087 Ga0466961_0398087_124_417 90
136 3300044694 Ga0466963_0358646 Ga0466963_0358646_528_821 90
137 3300044706 Ga0466964_0102268 Ga0466964_0102268_25_303 90
138 3300044765 Ga0466970_0007149 Ga0466970_0007149_2484_2762 90
139 3300044842 Ga0466957_0112320 Ga0466957_0112320_428_706 90
140 3300044901 Ga0466960_0027272 Ga0466960_0027272_1087_1365 90
141 3300044901 Ga0466960_0054879 Ga0466960_0054879_91_372 90
142 3300044901 Ga0466960_0166223 Ga0466960_0166223_518_808 90
143 3300045976 Ga0466967_0863223 Ga0466967_0863223_193_471 90
144 3300046454 Ga0495592_0007064 Ga0495592_0007064_336_614 90
145 3300046462 Ga0495651_0015125 Ga0495651_0015125_5350_5628 90
146 3300046463 Ga0495653_0122937 Ga0495653_0122937_336_614 90
147 3300046472 Ga0495580_0007502 Ga0495580_0007502_8179_8457 90
148 3300046476 Ga0495662_0000096 Ga0495662_0000096_26670_26948 90
149 3300046477 Ga0495664_0002322 Ga0495664_0002322_9525_9803 90
150 3300046499 Ga0495594_0161811 Ga0495594_0161811_697_975 90
151 3300046511 Ga0495608_0002713 Ga0495608_0002713_4785_5063 90
152 3300046514 Ga0495618_0517844 Ga0495618_0517844_261_539 90
153 3300046516 Ga0495628_0002207 Ga0495628_0002207_4484_4762 90
154 3300046517 Ga0495630_0002424 Ga0495630_0002424_8161_8439 90
155 3300046526 Ga0495666_0000307 Ga0495666_0000307_8874_9152 90
156 3300046529 Ga0495652_0013442 Ga0495652_0013442_2606_2884 90
157 3300046531 Ga0495665_0001543 Ga0495665_0001543_6318_6596 90
158 3300046533 Ga0495640_0002906 Ga0495640_0002906_5860_6138 90
159 3300046536 Ga0495587_0001703 Ga0495587_0001703_5350_5628 90
160 3300046543 Ga0495645_0002261 Ga0495645_0002261_3296_3574 90
161 3300046559 Ga0495667_0028951 Ga0495667_0028951_47_325 90
162 3300046642 Ga0495634_0007090 Ga0495634_0007090_4332_4610 90
163 3300046663 Ga0495635_0005159 Ga0495635_0005159_4484_4762 90
164 3300046675 Ga0495657_0005637 Ga0495657_0005637_5270_5548 90
165 3300046678 Ga0495599_0007801 Ga0495599_0007801_4986_5264 90
166 3300046679 Ga0495623_0010498 Ga0495623_0010498_4484_4762 90
167 3300046680 Ga0495646_0088466 Ga0495646_0088466_1481_1759 90
168 3300046681 Ga0495647_0109875 Ga0495647_0109875_169_447 90
169 3300046683 Ga0495658_0029856 Ga0495658_0029856_2460_2738 90
170 3300046683 Ga0495658_0073694 Ga0495658_0073694_296_574 90
171 3300046689 Ga0495613_0005309 Ga0495613_0005309_5350_5628 90
172 3300046809 Ga0495600_0002715 Ga0495600_0002715_5477_5755 90
173 3300047315 Ga0495581_0015465 Ga0495581_0015465_3818_4096 90
174 3300047315 Ga0495581_0205410 Ga0495581_0205410_702_980 90
175 3300047317 Ga0495604_0002362 Ga0495604_0002362_4484_4762 90
176 3300047319 Ga0495674_0026033 Ga0495674_0026033_3843_4121 90
177 3300047321 Ga0495676_0153676 Ga0495676_0153676_834_1112 90
178 3300047444 Ga0495675_0005831 Ga0495675_0005831_3843_4121 90
179 3300047471 Ga0495684_0012770 Ga0495684_0012770_4722_5000 90
180 3300047673 Ga0495593_0009251 Ga0495593_0009251_4217_4495 90
181 3300047673 Ga0495593_0494119 Ga0495593_0494119_202_480 90
182 3300048088 Ga0495602_0013431 Ga0495602_0013431_4689_4967 90
183 3300048913 Ga0496110_1276380 Ga0496110_1276380_205_534 90
184 3300049571 Ga0501034_1107795 Ga0501034_1107795_368_646 90
185 3300049586 Ga0501070_0481253 Ga0501070_0481253_99_377 90
186 3300050507 nmdc:mga05p37_93825_c1 nmdc:mga05p37_93825_c1_2681_2962 90
187 3300053077 Ga0495601_0010241 Ga0495601_0010241_3318_3596 90
188 3300059491 Ga0587070_129654 Ga0587070_129654_289_567 90
189 3300059508 Ga0587088_036342 Ga0587088_036342_166_459 90
190 3300060346 Ga0587111_0037820 Ga0587111_0037820_140_436 90
191 iso_pu_bacteria 2506783011 2506868517 90
192 iso_pu_bacteria 2508501039 2508670631 90
193 iso_pu_bacteria 2675902999 2676199473 90
194 iso_pu_bacteria 2675903060 2676494463 90
195 iso_pu_bacteria 2687453737 2689960408 90
196 iso_pu_bacteria 2773857921 2774844051 90
197 iso_pu_bacteria 2773857933 2774902898 90
198 iso_pu_bacteria 3001119090 3001120675 90
199 iso_pu_bacteria 637000116 637877924 90
200 3300004798 Ga0058859_11790635 Ga0058859_117906352 91
201 3300004800 Ga0058861_12014800 Ga0058861_120148004 91
202 3300004801 Ga0058860_12163264 Ga0058860_121632641 91
203 3300004801 Ga0058860_12193443 Ga0058860_121934434 91
204 3300004803 Ga0058862_10092749 Ga0058862_100927491 91
205 3300005327 Ga0070658_10066569 Ga0070658_100665693 91
206 3300005329 Ga0070683_100239458 Ga0070683_1002394584 91
207 3300005329 Ga0070683_100495745 Ga0070683_1004957453 91
208 3300005335 Ga0070666_10571181 Ga0070666_105711813 91
209 3300005336 Ga0070680_100298977 Ga0070680_1002989771 91
210 3300005336 Ga0070680_100573762 Ga0070680_1005737622 91
211 3300005336 Ga0070680_101234427 Ga0070680_1012344272 91
212 3300005339 Ga0070660_100237252 Ga0070660_1002372523 91
213 3300005339 Ga0070660_100404171 Ga0070660_1004041712 91
214 3300005339 Ga0070660_101318012 Ga0070660_1013180122 91
215 3300005344 Ga0070661_101247423 Ga0070661_1012474231 91
216 3300005355 Ga0070671_102017759 Ga0070671_1020177591 91
217 3300005435 Ga0070714_100000013 Ga0070714_10000001319 91
218 3300005467 Ga0070706_100448638 Ga0070706_1004486383 91
219 3300005530 Ga0070679_100205787 Ga0070679_1002057874 91
220 3300005530 Ga0070679_100295307 Ga0070679_1002953074 91
221 3300005535 Ga0070684_100337218 Ga0070684_1003372184 91
222 3300005543 Ga0070672_100719870 Ga0070672_1007198701 91
223 3300005548 Ga0070665_100316587 Ga0070665_1003165874 91
224 3300005548 Ga0070665_100414338 Ga0070665_1004143383 91
225 3300005563 Ga0068855_100412912 Ga0068855_1004129124 91
226 3300005564 Ga0070664_100843650 Ga0070664_1008436501 91
227 3300005615 Ga0070702_100456074 Ga0070702_1004560741 91
228 3300005842 Ga0068858_100399888 Ga0068858_1003998883 91
229 3300006237 Ga0097621_100345238 Ga0097621_1003452382 91
230 3300006844 Ga0075428_100868657 Ga0075428_1008686572 91
231 3300006846 Ga0075430_100155685 Ga0075430_1001556854 91
232 3300006847 Ga0075431_101866498 Ga0075431_1018664982 91
233 3300006880 Ga0075429_100527814 Ga0075429_1005278143 91
234 3300009011 Ga0105251_10053109 Ga0105251_100531093 91
235 3300009092 Ga0105250_10329168 Ga0105250_103291681 91
236 3300009098 Ga0105245_10711399 Ga0105245_107113993 91
237 3300009098 Ga0105245_10878150 Ga0105245_108781502 91
238 3300009101 Ga0105247_10000616 Ga0105247_1000061617 91
239 3300009101 Ga0105247_10380229 Ga0105247_103802291 91
240 3300009147 Ga0114129_10132230 Ga0114129_101322303 91
241 3300009148 Ga0105243_12493737 Ga0105243_124937372 91
242 3300009177 Ga0105248_10243255 Ga0105248_102432554 91
243 3300009177 Ga0105248_10424628 Ga0105248_104246284 91
244 3300009545 Ga0105237_12679199 Ga0105237_126791991 91
245 3300009553 Ga0105249_11128089 Ga0105249_111280893 91
246 3300009553 Ga0105249_11634110 Ga0105249_116341102 91
247 3300010375 Ga0105239_11081109 Ga0105239_110811091 91
248 3300012475 Ga0157317_1001596 Ga0157317_10015963 91
249 3300012502 Ga0157347_1020817 Ga0157347_10208171 91
250 3300012503 Ga0157313_1027449 Ga0157313_10274492 91
251 3300013105 Ga0157369_10319534 Ga0157369_103195343 91
252 3300013105 Ga0157369_10438090 Ga0157369_104380904 91
253 3300013296 Ga0157374_11105391 Ga0157374_111053912 91
254 3300013307 Ga0157372_12512895 Ga0157372_125128952 91
255 3300013308 Ga0157375_11231054 Ga0157375_112310542 91
256 3300014325 Ga0163163_10130437 Ga0163163_101304376 91
257 3300014325 Ga0163163_11225418 Ga0163163_112254182 91
258 3300014497 Ga0182008_10293522 Ga0182008_102935222 91
259 3300014968 Ga0157379_12608734 Ga0157379_126087341 91
260 3300017792 Ga0163161_10761909 Ga0163161_107619091 91
261 3300020069 Ga0197907_11333365 Ga0197907_113333654 91
262 3300020070 Ga0206356_10137316 Ga0206356_101373161 91
263 3300020070 Ga0206356_10993217 Ga0206356_109932173 91
264 3300020070 Ga0206356_11202941 Ga0206356_112029412 91
265 3300020078 Ga0206352_10361311 Ga0206352_103613112 91
266 3300020080 Ga0206350_10562667 Ga0206350_105626672 91
267 3300020081 Ga0206354_10226284 Ga0206354_102262843 91
268 3300020081 Ga0206354_11237324 Ga0206354_112373243 91
269 3300020082 Ga0206353_10484919 Ga0206353_104849193 91
270 3300022467 Ga0224712_10174136 Ga0224712_101741361 91
271 3300022730 Ga0224570_108923 Ga0224570_1089232 91
272 3300025735 Ga0207713_1012538 Ga0207713_10125383 91
273 3300025900 Ga0207710_10000048 Ga0207710_1000004826 91
274 3300025904 Ga0207647_10138118 Ga0207647_101381184 91
275 3300025909 Ga0207705_10003438 Ga0207705_1000343821 91
276 3300025910 Ga0207684_10969602 Ga0207684_109696021 91
277 3300025912 Ga0207707_10247736 Ga0207707_102477362 91
278 3300025912 Ga0207707_10815862 Ga0207707_108158621 91
279 3300025915 Ga0207693_11437934 Ga0207693_114379342 91
280 3300025917 Ga0207660_10844220 Ga0207660_108442202 91
281 3300025917 Ga0207660_11336668 Ga0207660_113366681 91
282 3300025919 Ga0207657_10246922 Ga0207657_102469223 91
283 3300025919 Ga0207657_10477719 Ga0207657_104777192 91
284 3300025919 Ga0207657_10819126 Ga0207657_108191262 91
285 3300025921 Ga0207652_10249175 Ga0207652_102491754 91
286 3300025921 Ga0207652_10705203 Ga0207652_107052033 91
287 3300025924 Ga0207694_10603492 Ga0207694_106034923 91
288 3300025927 Ga0207687_10213190 Ga0207687_102131904 91
289 3300025929 Ga0207664_10000001 Ga0207664_10000001525 91
290 3300025931 Ga0207644_10916542 Ga0207644_109165422 91
291 3300025940 Ga0207691_10020477 Ga0207691_100204775 91
292 3300025941 Ga0207711_10083902 Ga0207711_100839024 91
293 3300025941 Ga0207711_10417100 Ga0207711_104171003 91
294 3300026035 Ga0207703_10309913 Ga0207703_103099133 91
295 3300026121 Ga0207683_10245955 Ga0207683_102459553 91
296 3300026142 Ga0207698_11360754 Ga0207698_113607543 91
297 3300028379 Ga0268266_10669462 Ga0268266_106694623 91
298 3300028380 Ga0268265_10920323 Ga0268265_109203233 91
299 3300031090 Ga0265760_10247674 Ga0265760_102476742 91
300 3300031824 Ga0307413_10758429 Ga0307413_107584291 91
301 3300031852 Ga0307410_10217117 Ga0307410_102171173 91
302 3300031995 Ga0307409_102102266 Ga0307409_1021022662 91
303 3300032120 Ga0316053_119119 Ga0316053_1191191 91
304 3300037068 Ga0373925_0497909 Ga0373925_0497909_127_405 91
305 3300039450 Ga0436363_1286402 Ga0436363_1286402_16_300 91
306 3300041406 Ga0439439_0013591 Ga0439439_0013591_1370_1657 91
307 3300041411 Ga0439466_0141534 Ga0439466_0141534_135_422 91
308 3300041999 Ga0439433_0001269 Ga0439433_0001269_4253_4540 91
309 3300042007 Ga0439449_0018354 Ga0439449_0018354_1288_1575 91
310 3300042014 Ga0439457_008613 Ga0439457_008613_1051_1338 91
311 3300042015 Ga0439462_0006125 Ga0439462_0006125_1289_1576 91
312 3300044683 Ga0466965_0372340 Ga0466965_0372340_410_694 91
313 3300044683 Ga0466965_0419593 Ga0466965_0419593_121_408 91
314 3300044706 Ga0466964_0201227 Ga0466964_0201227_387_677 91
315 3300044735 Ga0466968_0000486 Ga0466968_0000486_2140_2424 91
316 3300044842 Ga0466957_0008706 Ga0466957_0008706_2963_3253 91
317 3300045049 Ga0466959_0359411 Ga0466959_0359411_279_560 91
318 3300045976 Ga0466967_1558375 Ga0466967_1558375_173_454 91
319 3300046455 Ga0495603_0307456 Ga0495603_0307456_270_554 91
320 3300046473 Ga0495582_0474268 Ga0495582_0474268_309_593 91
321 3300046499 Ga0495594_0011474 Ga0495594_0011474_1066_1356 91
322 3300046506 Ga0495583_0418750 Ga0495583_0418750_38_322 91
323 3300046537 Ga0495598_0125405 Ga0495598_0125405_51_344 91
324 3300046539 Ga0495621_0147796 Ga0495621_0147796_253_552 91
325 3300046557 Ga0495622_0265234 Ga0495622_0265234_263_547 91
326 3300046615 Ga0495656_0042504 Ga0495656_0042504_903_1187 91
327 3300046615 Ga0495656_0050533 Ga0495656_0050533_187_486 91
328 3300047318 Ga0495636_0350808 Ga0495636_0350808_226_510 91
329 3300047320 Ga0495672_0493891 Ga0495672_0493891_244_525 91
330 3300047444 Ga0495675_0048524 Ga0495675_0048524_1959_2243 91
331 3300047470 Ga0495681_0341214 Ga0495681_0341214_104_388 91
332 3300048090 Ga0495615_0085372 Ga0495615_0085372_76_360 91
333 3300048903 Ga0496100_0434567 Ga0496100_0434567_81_416 91
334 3300048903 Ga0496100_0726312 Ga0496100_0726312_321_611 91
335 3300048905 Ga0496102_0251664 Ga0496102_0251664_582_872 91
336 3300048907 Ga0496104_0138327 Ga0496104_0138327_1234_1569 91
337 3300048907 Ga0496104_0215285 Ga0496104_0215285_439_729 91
338 3300048907 Ga0496104_0571587 Ga0496104_0571587_554_838 91
339 3300048907 Ga0496104_1780769 Ga0496104_1780769_43_333 91
340 3300048908 Ga0496105_0083619 Ga0496105_0083619_1258_1542 91
341 3300048908 Ga0496105_0259952 Ga0496105_0259952_544_879 91
342 3300048908 Ga0496105_0664833 Ga0496105_0664833_97_432 91
343 3300048911 Ga0496108_0352911 Ga0496108_0352911_324_608 91
344 3300048913 Ga0496110_0124579 Ga0496110_0124579_857_1147 91
345 3300048913 Ga0496110_1016179 Ga0496110_1016179_386_676 91
346 3300048914 Ga0496111_0125391 Ga0496111_0125391_609_944 91
347 3300048914 Ga0496111_0201873 Ga0496111_0201873_1087_1371 91
348 3300048915 Ga0496112_0343000 Ga0496112_0343000_1041_1331 91
349 3300048915 Ga0496112_0556047 Ga0496112_0556047_271_561 91
350 3300048917 Ga0496114_0400759 Ga0496114_0400759_577_867 91
351 3300048917 Ga0496114_0761891 Ga0496114_0761891_235_570 91
352 3300048918 Ga0496115_0268221 Ga0496115_0268221_653_943 91
353 3300048923 Ga0496120_0192930 Ga0496120_0192930_281_565 91
354 3300048926 Ga0496123_0361362 Ga0496123_0361362_36_320 91
355 3300048928 Ga0496125_0258633 Ga0496125_0258633_527_811 91
356 3300048929 Ga0496126_0563945 Ga0496126_0563945_247_537 91
357 3300049130 Ga0501310_015638 Ga0501310_015638_542_841 91
358 3300049571 Ga0501034_1352442 Ga0501034_1352442_176_466 91
359 3300049581 Ga0501047_0248456 Ga0501047_0248456_622_912 91
360 3300049583 Ga0501067_0815538 Ga0501067_0815538_49_327 91
361 3300049586 Ga0501070_0227045 Ga0501070_0227045_153_443 91
362 3300049586 Ga0501070_1510886 Ga0501070_1510886_30_320 91
363 3300049742 Ga0501080_1871846 Ga0501080_1871846_27_317 91
364 3300049823 Ga0501044_0618549 Ga0501044_0618549_16_306 91
365 3300050507 nmdc:mga05p37_231129_c1 nmdc:mga05p37_231129_c1_756_1040 91
366 3300050508 nmdc:mga09592_334103_c1 nmdc:mga09592_334103_c1_1015_1296 91
367 3300050509 nmdc:mga0qj67_70050_c1 nmdc:mga0qj67_70050_c1_1657_1938 91
368 3300050510 nmdc:mga06r32_1592375_c1 nmdc:mga06r32_1592375_c1_260_544 91
369 3300059491 Ga0587070_113159 Ga0587070_113159_221_511 91
370 3300059503 Ga0587080_046008 Ga0587080_046008_410_700 91
371 3300059505 Ga0587083_0213010 Ga0587083_0213010_214_504 91
372 3300059640 Ga0587067_105092 Ga0587067_105092_189_479 91
373 3300059643 Ga0587072_014988 Ga0587072_014988_664_954 91
374 3300059644 Ga0587075_081417 Ga0587075_081417_188_478 91
375 3300059647 Ga0587079_090444 Ga0587079_090444_72_362 91
376 3300059652 Ga0587107_134990 Ga0587107_134990_36_326 91
377 3300060344 Ga0587071_171532 Ga0587071_171532_189_479 91
378 3300060346 Ga0587111_0084148 Ga0587111_0084148_62_352 91
379 iso_pu_bacteria 2671180195 2671835736 91
380 iso_pu_bacteria 2773857922 2774853892 91
381 iso_pu_bacteria 2884693830 2884694822 91
382 iso_pu_bacteria 2895442618 2895446482 91
383 3300004798 Ga0058859_11834757 Ga0058859_118347573 92
384 3300004799 Ga0058863_10022412 Ga0058863_100224123 92
385 3300004799 Ga0058863_11910841 Ga0058863_119108415 92
386 3300004800 Ga0058861_11946098 Ga0058861_119460981 92
387 3300004800 Ga0058861_11983512 Ga0058861_119835122 92
388 3300004800 Ga0058861_11995215 Ga0058861_119952151 92
389 3300004803 Ga0058862_12767850 Ga0058862_127678502 92
390 3300004803 Ga0058862_12784181 Ga0058862_127841812 92
391 3300004803 Ga0058862_12834356 Ga0058862_128343567 92
392 3300005327 Ga0070658_10097709 Ga0070658_100977095 92
393 3300005327 Ga0070658_10354214 Ga0070658_103542143 92
394 3300005329 Ga0070683_100446712 Ga0070683_1004467123 92
395 3300005329 Ga0070683_100752647 Ga0070683_1007526472 92
396 3300005330 Ga0070690_100110749 Ga0070690_1001107492 92
397 3300005331 Ga0070670_101181525 Ga0070670_1011815252 92
398 3300005334 Ga0068869_100116541 Ga0068869_1001165413 92
399 3300005336 Ga0070680_100003083 Ga0070680_10000308314 92
400 3300005336 Ga0070680_100155709 Ga0070680_1001557094 92
401 3300005337 Ga0070682_101406113 Ga0070682_1014061132 92
402 3300005338 Ga0068868_100044857 Ga0068868_1000448579 92
403 3300005338 Ga0068868_102312643 Ga0068868_1023126431 92
404 3300005339 Ga0070660_100286007 Ga0070660_1002860071 92
405 3300005339 Ga0070660_100602222 Ga0070660_1006022223 92
406 3300005339 Ga0070660_100620314 Ga0070660_1006203142 92
407 3300005340 Ga0070689_101863387 Ga0070689_1018633871 92
408 3300005344 Ga0070661_101766147 Ga0070661_1017661471 92
409 3300005364 Ga0070673_100177014 Ga0070673_1001770144 92
410 3300005366 Ga0070659_100066750 Ga0070659_1000667505 92
411 3300005366 Ga0070659_100171107 Ga0070659_1001711074 92
412 3300005366 Ga0070659_101722669 Ga0070659_1017226692 92
413 3300005435 Ga0070714_100340560 Ga0070714_1003405603 92
414 3300005435 Ga0070714_100961121 Ga0070714_1009611212 92
415 3300005435 Ga0070714_102362929 Ga0070714_1023629291 92
416 3300005436 Ga0070713_100004669 Ga0070713_10000466915 92
417 3300005437 Ga0070710_10000376 Ga0070710_1000037611 92
418 3300005437 Ga0070710_10136352 Ga0070710_101363523 92
419 3300005455 Ga0070663_100106678 Ga0070663_1001066785 92
420 3300005456 Ga0070678_100609503 Ga0070678_1006095033 92
421 3300005458 Ga0070681_10009160 Ga0070681_100091604 92
422 3300005459 Ga0068867_102054112 Ga0068867_1020541122 92
423 3300005530 Ga0070679_100003833 Ga0070679_10000383311 92
424 3300005530 Ga0070679_100014608 Ga0070679_10001460814 92
425 3300005530 Ga0070679_100468245 Ga0070679_1004682453 92
426 3300005535 Ga0070684_101252820 Ga0070684_1012528202 92
427 3300005535 Ga0070684_101655704 Ga0070684_1016557042 92
428 3300005548 Ga0070665_100007009 Ga0070665_10000700913 92
429 3300005563 Ga0068855_100002777 Ga0068855_10000277730 92
430 3300005563 Ga0068855_100009577 Ga0068855_10000957716 92
431 3300005563 Ga0068855_101708622 Ga0068855_1017086222 92
432 3300005563 Ga0068855_101907940 Ga0068855_1019079402 92
433 3300005578 Ga0068854_100004690 Ga0068854_10000469014 92
434 3300005614 Ga0068856_100472684 Ga0068856_1004726843 92
435 3300005614 Ga0068856_102703091 Ga0068856_1027030912 92
436 3300005616 Ga0068852_100016981 Ga0068852_10001698111 92
437 3300005616 Ga0068852_100808395 Ga0068852_1008083952 92
438 3300005616 Ga0068852_100865204 Ga0068852_1008652042 92
439 3300006038 Ga0075365_10014271 Ga0075365_100142715 92
440 3300006173 Ga0070716_100815708 Ga0070716_1008157082 92
441 3300009036 Ga0105244_10167075 Ga0105244_101670751 92
442 3300009093 Ga0105240_10002670 Ga0105240_100026707 92
443 3300009093 Ga0105240_10039358 Ga0105240_100393582 92
444 3300009098 Ga0105245_11025418 Ga0105245_110254183 92
445 3300009174 Ga0105241_10000758 Ga0105241_1000075818 92
446 3300009176 Ga0105242_10876810 Ga0105242_108768103 92
447 3300009176 Ga0105242_12410055 Ga0105242_124100552 92
448 3300009176 Ga0105242_12716358 Ga0105242_127163582 92
449 3300009545 Ga0105237_10018147 Ga0105237_100181477 92
450 3300009545 Ga0105237_11002543 Ga0105237_110025432 92
451 3300009551 Ga0105238_10010490 Ga0105238_1001049014 92
452 3300009551 Ga0105238_10966201 Ga0105238_109662013 92
453 3300009829 Ga0130086_1047822 Ga0130086_10478221 92
454 3300009835 Ga0130084_1078115 Ga0130084_10781151 92
455 3300010375 Ga0105239_10226370 Ga0105239_102263703 92
456 3300011119 Ga0105246_10282256 Ga0105246_102822562 92
457 3300012487 Ga0157321_1004051 Ga0157321_10040512 92
458 3300012491 Ga0157329_1002301 Ga0157329_10023012 92
459 3300012494 Ga0157341_1003106 Ga0157341_10031062 92
460 3300012507 Ga0157342_1006396 Ga0157342_10063962 92
461 3300013045 Ga0154016_124994 Ga0154016_1249941 92
462 3300013102 Ga0157371_10017613 Ga0157371_100176137 92
463 3300013104 Ga0157370_10007858 Ga0157370_1000785817 92
464 3300013105 Ga0157369_10001467 Ga0157369_100014677 92
465 3300013105 Ga0157369_10038301 Ga0157369_1003830110 92
466 3300013105 Ga0157369_10755143 Ga0157369_107551432 92
467 3300013105 Ga0157369_11613093 Ga0157369_116130932 92
468 3300013296 Ga0157374_10042287 Ga0157374_100422874 92
469 3300013297 Ga0157378_11038426 Ga0157378_110384262 92
470 3300013297 Ga0157378_11112864 Ga0157378_111128642 92
471 3300013297 Ga0157378_12947994 Ga0157378_129479942 92
472 3300013306 Ga0163162_11422846 Ga0163162_114228461 92
473 3300013306 Ga0163162_12455970 Ga0163162_124559702 92
474 3300013307 Ga0157372_12849947 Ga0157372_128499472 92
475 3300014969 Ga0157376_10232073 Ga0157376_102320732 92
476 3300014969 Ga0157376_10990920 Ga0157376_109909203 92
477 3300014969 Ga0157376_12181147 Ga0157376_121811471 92
478 3300020069 Ga0197907_10081451 Ga0197907_100814513 92
479 3300020069 Ga0197907_10108336 Ga0197907_101083362 92
480 3300020069 Ga0197907_10168473 Ga0197907_101684732 92
481 3300020069 Ga0197907_10933733 Ga0197907_109337332 92
482 3300020069 Ga0197907_11247002 Ga0197907_112470023 92
483 3300020069 Ga0197907_11336307 Ga0197907_113363072 92
484 3300020070 Ga0206356_10378442 Ga0206356_103784424 92
485 3300020070 Ga0206356_10701291 Ga0206356_107012913 92
486 3300020070 Ga0206356_10741805 Ga0206356_107418052 92
487 3300020070 Ga0206356_11085336 Ga0206356_110853369 92
488 3300020070 Ga0206356_11528920 Ga0206356_115289204 92
489 3300020075 Ga0206349_1260332 Ga0206349_126033211 92
490 3300020076 Ga0206355_1257286 Ga0206355_12572866 92
491 3300020076 Ga0206355_1345158 Ga0206355_13451582 92
492 3300020077 Ga0206351_10004618 Ga0206351_100046185 92
493 3300020077 Ga0206351_10108476 Ga0206351_101084762 92
494 3300020077 Ga0206351_10483248 Ga0206351_104832481 92
495 3300020077 Ga0206351_10864200 Ga0206351_108642003 92
496 3300020078 Ga0206352_10528760 Ga0206352_105287602 92
497 3300020078 Ga0206352_10681057 Ga0206352_106810572 92
498 3300020078 Ga0206352_10909807 Ga0206352_109098073 92
499 3300020080 Ga0206350_10132091 Ga0206350_101320912 92
500 3300020080 Ga0206350_10473798 Ga0206350_104737982 92
501 3300020080 Ga0206350_11175937 Ga0206350_111759373 92
502 3300020080 Ga0206350_11319711 Ga0206350_113197112 92
503 3300020081 Ga0206354_10127370 Ga0206354_101273702 92
504 3300020081 Ga0206354_10788811 Ga0206354_107888113 92
505 3300020081 Ga0206354_10812358 Ga0206354_108123583 92
506 3300020082 Ga0206353_11286618 Ga0206353_112866181 92
507 3300020082 Ga0206353_11364351 Ga0206353_113643519 92
508 3300020082 Ga0206353_11602891 Ga0206353_116028913 92
509 3300020610 Ga0154015_1168233 Ga0154015_11682334 92
510 3300022467 Ga0224712_10002654 Ga0224712_100026542 92
511 3300022467 Ga0224712_10061639 Ga0224712_100616394 92
512 3300022467 Ga0224712_10089706 Ga0224712_100897063 92
513 3300022467 Ga0224712_10309417 Ga0224712_103094171 92
514 3300022467 Ga0224712_10641793 Ga0224712_106417931 92
515 3300025898 Ga0207692_10000368 Ga0207692_1000036811 92
516 3300025898 Ga0207692_11212420 Ga0207692_112124201 92
517 3300025899 Ga0207642_10880050 Ga0207642_108800501 92
518 3300025904 Ga0207647_10000925 Ga0207647_1000092511 92
519 3300025908 Ga0207643_11042639 Ga0207643_110426391 92
520 3300025909 Ga0207705_10578872 Ga0207705_105788722 92
521 3300025911 Ga0207654_10001876 Ga0207654_1000187611 92
522 3300025912 Ga0207707_10001257 Ga0207707_1000125720 92
523 3300025912 Ga0207707_10011410 Ga0207707_100114107 92
524 3300025912 Ga0207707_11262091 Ga0207707_112620912 92
525 3300025913 Ga0207695_10000465 Ga0207695_1000046538 92
526 3300025913 Ga0207695_10038288 Ga0207695_100382884 92
527 3300025914 Ga0207671_10000128 Ga0207671_1000012837 92
528 3300025916 Ga0207663_10289418 Ga0207663_102894183 92
529 3300025917 Ga0207660_10012334 Ga0207660_1001233412 92
530 3300025919 Ga0207657_10068034 Ga0207657_100680346 92
531 3300025919 Ga0207657_10268714 Ga0207657_102687142 92
532 3300025919 Ga0207657_10632455 Ga0207657_106324553 92
533 3300025921 Ga0207652_10005398 Ga0207652_1000539811 92
534 3300025921 Ga0207652_10093052 Ga0207652_100930522 92
535 3300025921 Ga0207652_10354268 Ga0207652_103542683 92
536 3300025921 Ga0207652_10711700 Ga0207652_107117003 92
537 3300025924 Ga0207694_10000973 Ga0207694_1000097327 92
538 3300025924 Ga0207694_10315747 Ga0207694_103157472 92
539 3300025924 Ga0207694_10741905 Ga0207694_107419052 92
540 3300025924 Ga0207694_11258965 Ga0207694_112589652 92
541 3300025925 Ga0207650_11268530 Ga0207650_112685301 92
542 3300025925 Ga0207650_11615820 Ga0207650_116158202 92
543 3300025927 Ga0207687_10939029 Ga0207687_109390292 92
544 3300025928 Ga0207700_10373104 Ga0207700_103731042 92
545 3300025929 Ga0207664_10261305 Ga0207664_102613054 92
546 3300025932 Ga0207690_10007372 Ga0207690_100073724 92
547 3300025932 Ga0207690_10692724 Ga0207690_106927242 92
548 3300025934 Ga0207686_10932443 Ga0207686_109324433 92
549 3300025935 Ga0207709_10667301 Ga0207709_106673012 92
550 3300025942 Ga0207689_11631241 Ga0207689_116312412 92
551 3300025944 Ga0207661_10052310 Ga0207661_100523106 92
552 3300025944 Ga0207661_10602118 Ga0207661_106021183 92
553 3300025945 Ga0207679_12056165 Ga0207679_120561652 92
554 3300025949 Ga0207667_10023995 Ga0207667_100239955 92
555 3300025949 Ga0207667_10071618 Ga0207667_100716183 92
556 3300025960 Ga0207651_10587420 Ga0207651_105874202 92
557 3300025981 Ga0207640_10074941 Ga0207640_100749414 92
558 3300025981 Ga0207640_11786048 Ga0207640_117860482 92
559 3300026023 Ga0207677_10002332 Ga0207677_1000233219 92
560 3300026041 Ga0207639_10012050 Ga0207639_1001205012 92
561 3300026078 Ga0207702_10359869 Ga0207702_103598693 92
562 3300026078 Ga0207702_11066934 Ga0207702_110669342 92
563 3300026078 Ga0207702_11606273 Ga0207702_116062733 92
564 3300026121 Ga0207683_10245585 Ga0207683_102455854 92
565 3300026142 Ga0207698_10047616 Ga0207698_100476167 92
566 3300026142 Ga0207698_10518860 Ga0207698_105188602 92
567 3300026142 Ga0207698_11300448 Ga0207698_113004482 92
568 3300028379 Ga0268266_10036608 Ga0268266_100366084 92
569 3300028786 Ga0307517_10138635 Ga0307517_101386352 92
570 3300028794 Ga0307515_10465584 Ga0307515_104655843 92
571 3300029280 Ga0311011_142744 Ga0311011_1427442 92
572 3300029285 Ga0310981_1036808 Ga0310981_10368082 92
573 3300030522 Ga0307512_10008844 Ga0307512_1000884411 92
574 3300030732 Ga0316176_1099670 Ga0316176_10996702 92
575 3300030736 Ga0316180_1083427 Ga0316180_10834272 92
576 3300030763 Ga0265763_1005592 Ga0265763_10055922 92
577 3300031456 Ga0307513_10022677 Ga0307513_1002267710 92
578 3300031456 Ga0307513_10097294 Ga0307513_100972944 92
579 3300031507 Ga0307509_10012707 Ga0307509_1001270712 92
580 3300031616 Ga0307508_10344052 Ga0307508_103440521 92
581 3300031616 Ga0307508_10506916 Ga0307508_105069161 92
582 3300031731 Ga0307405_10537607 Ga0307405_105376072 92
583 3300031852 Ga0307410_10745674 Ga0307410_107456742 92
584 3300031901 Ga0307406_11412873 Ga0307406_114128732 92
585 3300031995 Ga0307409_100762549 Ga0307409_1007625493 92
586 3300032126 Ga0307415_100045269 Ga0307415_1000452693 92
587 3300033179 Ga0307507_10185206 Ga0307507_101852062 92
588 3300034957 Ga0373938_0006655 Ga0373938_0006655_1392_1685 92
589 3300035116 Ga0373945_0166032 Ga0373945_0166032_295_579 92
590 3300035692 Ga0373935_0084381 Ga0373935_0084381_912_1196 92
591 3300036401 Ga0373937_1945564 Ga0373937_1945564_29_316 92
592 3300036459 Ga0372808_003049 Ga0372808_003049_1228_1536 92
593 3300037312 Ga0395899_0377735 Ga0395899_0377735_638_925 92
594 3300037418 Ga0395900_0201144 Ga0395900_0201144_1556_1843 92
595 3300037418 Ga0395900_0286842 Ga0395900_0286842_1175_1468 92
596 3300037418 Ga0395900_0389667 Ga0395900_0389667_771_1052 92
597 3300037466 Ga0395898_0012144 Ga0395898_0012144_8582_8869 92
598 3300037466 Ga0395898_0379339 Ga0395898_0379339_171_464 92
599 3300037853 Ga0436364_0010700 Ga0436364_0010700_90904_91191 92
600 3300037853 Ga0436364_0741352 Ga0436364_0741352_700_984 92
601 3300038443 Ga0395901_0068330 Ga0395901_0068330_785_1078 92
602 3300038443 Ga0395901_0096897 Ga0395901_0096897_2211_2498 92
603 3300039450 Ga0436363_1218733 Ga0436363_1218733_1048_1329 92
604 3300039453 Ga0436362_0962826 Ga0436362_0962826_135_416 92
605 3300039453 Ga0436362_1251521 Ga0436362_1251521_111_392 92
606 3300041404 Ga0439436_0033428 Ga0439436_0033428_889_1176 92
607 3300041406 Ga0439439_0022670 Ga0439439_0022670_42_329 92
608 3300041492 Ga0451835_0283475 Ga0451835_0283475_152_439 92
609 3300041512 Ga0451853_2541022 Ga0451853_2541022_263_550 92
610 3300042007 Ga0439449_0038483 Ga0439449_0038483_208_489 92
611 3300042007 Ga0439449_0244300 Ga0439449_0244300_128_409 92
612 3300042014 Ga0439457_020414 Ga0439457_020414_867_1154 92
613 3300042015 Ga0439462_0255665 Ga0439462_0255665_156_443 92
614 3300042122 Ga0450920_022811 Ga0450920_022811_584_871 92
615 3300042127 Ga0450890_002547 Ga0450890_002547_1557_1844 92
616 3300042131 Ga0450894_005718 Ga0450894_005718_294_581 92
617 3300042132 Ga0450895_017014 Ga0450895_017014_95_382 92
618 3300042133 Ga0450896_000102 Ga0450896_000102_3764_4051 92
619 3300042134 Ga0450898_008092 Ga0450898_008092_1108_1395 92
620 3300042135 Ga0450899_000622 Ga0450899_000622_3089_3376 92
621 3300042145 Ga0450906_008805 Ga0450906_008805_404_691 92
622 3300042184 Ga0450908_001340 Ga0450908_001340_728_1015 92
623 3300044656 Ga0466969_0097189 Ga0466969_0097189_856_1137 92
624 3300044656 Ga0466969_0324119 Ga0466969_0324119_198_479 92
625 3300044658 Ga0466972_0007279 Ga0466972_0007279_4241_4522 92
626 3300044658 Ga0466972_0304699 Ga0466972_0304699_237_518 92
627 3300044683 Ga0466965_0033398 Ga0466965_0033398_2077_2358 92
628 3300044683 Ga0466965_0946484 Ga0466965_0946484_72_353 92
629 3300044684 Ga0466966_0121744 Ga0466966_0121744_1088_1369 92
630 3300044684 Ga0466966_0189226 Ga0466966_0189226_710_991 92
631 3300044693 Ga0466961_0010285 Ga0466961_0010285_4880_5161 92
632 3300044693 Ga0466961_0147544 Ga0466961_0147544_710_991 92
633 3300044693 Ga0466961_0223557 Ga0466961_0223557_244_522 92
634 3300044693 Ga0466961_0282666 Ga0466961_0282666_281_580 92
635 3300044693 Ga0466961_0387733 Ga0466961_0387733_288_575 92
636 3300044694 Ga0466963_0182357 Ga0466963_0182357_595_882 92
637 3300044694 Ga0466963_0201949 Ga0466963_0201949_976_1260 92
638 3300044706 Ga0466964_0230707 Ga0466964_0230707_352_633 92
639 3300044706 Ga0466964_0697825 Ga0466964_0697825_274_555 92
640 3300044735 Ga0466968_0030625 Ga0466968_0030625_504_785 92
641 3300044765 Ga0466970_0003384 Ga0466970_0003384_2795_3076 92
642 3300044765 Ga0466970_0018820 Ga0466970_0018820_3283_3564 92
643 3300044901 Ga0466960_0003887 Ga0466960_0003887_1036_1317 92
644 3300045049 Ga0466959_0056983 Ga0466959_0056983_808_1089 92
645 3300045049 Ga0466959_0172941 Ga0466959_0172941_788_1069 92
646 3300045049 Ga0466959_0741762 Ga0466959_0741762_59_337 92
647 3300045836 Ga0466958_0007393 Ga0466958_0007393_5224_5505 92
648 3300045976 Ga0466967_0414451 Ga0466967_0414451_736_1017 92
649 3300045976 Ga0466967_1762032 Ga0466967_1762032_74_358 92
650 3300046454 Ga0495592_0065762 Ga0495592_0065762_385_672 92
651 3300046454 Ga0495592_0295064 Ga0495592_0295064_750_1031 92
652 3300046455 Ga0495603_0216725 Ga0495603_0216725_16_303 92
653 3300046457 Ga0495590_0012257 Ga0495590_0012257_1677_1961 92
654 3300046459 Ga0495629_0856227 Ga0495629_0856227_16_303 92
655 3300046460 Ga0495638_0266682 Ga0495638_0266682_29_316 92
656 3300046461 Ga0495641_0046104 Ga0495641_0046104_178_501 92
657 3300046462 Ga0495651_0000169 Ga0495651_0000169_23992_24276 92
658 3300046462 Ga0495651_0001372 Ga0495651_0001372_1909_2190 92
659 3300046462 Ga0495651_0807383 Ga0495651_0807383_12_299 92
660 3300046474 Ga0495605_0047498 Ga0495605_0047498_1436_1723 92
661 3300046476 Ga0495662_0293132 Ga0495662_0293132_65_352 92
662 3300046477 Ga0495664_0122341 Ga0495664_0122341_776_1063 92
663 3300046492 Ga0495585_0070600 Ga0495585_0070600_1208_1495 92
664 3300046500 Ga0495596_0003837 Ga0495596_0003837_2075_2359 92
665 3300046501 Ga0495607_0004843 Ga0495607_0004843_4981_5265 92
666 3300046506 Ga0495583_0009440 Ga0495583_0009440_2146_2433 92
667 3300046507 Ga0495606_0010501 Ga0495606_0010501_4359_4646 92
668 3300046511 Ga0495608_0067863 Ga0495608_0067863_989_1276 92
669 3300046512 Ga0495610_0074796 Ga0495610_0074796_1156_1440 92
670 3300046514 Ga0495618_0017866 Ga0495618_0017866_410_697 92
671 3300046515 Ga0495620_0068552 Ga0495620_0068552_410_694 92
672 3300046516 Ga0495628_0016156 Ga0495628_0016156_1497_1778 92
673 3300046516 Ga0495628_0140174 Ga0495628_0140174_1327_1614 92
674 3300046518 Ga0495631_0038283 Ga0495631_0038283_727_1014 92
675 3300046520 Ga0495637_0103270 Ga0495637_0103270_597_881 92
676 3300046522 Ga0495643_0001180 Ga0495643_0001180_21581_21865 92
677 3300046523 Ga0495644_0276459 Ga0495644_0276459_317_625 92
678 3300046523 Ga0495644_0379260 Ga0495644_0379260_199_486 92
679 3300046524 Ga0495648_0024720 Ga0495648_0024720_1557_1841 92
680 3300046529 Ga0495652_0010757 Ga0495652_0010757_7016_7303 92
681 3300046529 Ga0495652_0018548 Ga0495652_0018548_5623_5904 92
682 3300046530 Ga0495654_0003279 Ga0495654_0003279_5129_5416 92
683 3300046531 Ga0495665_0032438 Ga0495665_0032438_1930_2217 92
684 3300046533 Ga0495640_0743072 Ga0495640_0743072_51_338 92
685 3300046536 Ga0495587_0413588 Ga0495587_0413588_224_505 92
686 3300046538 Ga0495609_0009614 Ga0495609_0009614_4284_4568 92
687 3300046542 Ga0495597_0052969 Ga0495597_0052969_105_389 92
688 3300046543 Ga0495645_0020520 Ga0495645_0020520_2053_2334 92
689 3300046557 Ga0495622_0031757 Ga0495622_0031757_1645_1929 92
690 3300046558 Ga0495633_0014557 Ga0495633_0014557_568_855 92
691 3300046559 Ga0495667_0056543 Ga0495667_0056543_1176_1463 92
692 3300046559 Ga0495667_0290983 Ga0495667_0290983_531_812 92
693 3300046559 Ga0495667_0667388 Ga0495667_0667388_35_316 92
694 3300046642 Ga0495634_0024406 Ga0495634_0024406_3250_3537 92
695 3300046648 Ga0495611_0009288 Ga0495611_0009288_3760_4047 92
696 3300046660 Ga0495625_0049329 Ga0495625_0049329_1390_1677 92
697 3300046660 Ga0495625_0592391 Ga0495625_0592391_22_306 92
698 3300046663 Ga0495635_0098521 Ga0495635_0098521_1036_1323 92
699 3300046665 Ga0495661_0090733 Ga0495661_0090733_970_1257 92
700 3300046675 Ga0495657_0047630 Ga0495657_0047630_295_582 92
701 3300046675 Ga0495657_0088733 Ga0495657_0088733_241_549 92
702 3300046678 Ga0495599_0221149 Ga0495599_0221149_614_901 92
703 3300046680 Ga0495646_0121733 Ga0495646_0121733_377_658 92
704 3300046689 Ga0495613_0839668 Ga0495613_0839668_72_380 92
705 3300046690 Ga0495624_0042222 Ga0495624_0042222_2146_2433 92
706 3300046694 Ga0495649_0077694 Ga0495649_0077694_763_1050 92
707 3300046794 Ga0495589_0074826 Ga0495589_0074826_374_661 92
708 3300046809 Ga0495600_0011482 Ga0495600_0011482_813_1094 92
709 3300046809 Ga0495600_0339868 Ga0495600_0339868_282_569 92
710 3300046810 Ga0495660_0045943 Ga0495660_0045943_1385_1669 92
711 3300047315 Ga0495581_0242218 Ga0495581_0242218_501_788 92
712 3300047317 Ga0495604_0198955 Ga0495604_0198955_648_929 92
713 3300047318 Ga0495636_0570312 Ga0495636_0570312_178_465 92
714 3300047319 Ga0495674_0158431 Ga0495674_0158431_1262_1549 92
715 3300047319 Ga0495674_0458138 Ga0495674_0458138_719_1003 92
716 3300047320 Ga0495672_0029562 Ga0495672_0029562_1287_1574 92
717 3300047321 Ga0495676_0346616 Ga0495676_0346616_295_582 92
718 3300047321 Ga0495676_0878541 Ga0495676_0878541_193_516 92
719 3300047322 Ga0495680_0258306 Ga0495680_0258306_347_634 92
720 3300047323 Ga0495683_0009389 Ga0495683_0009389_4516_4803 92
721 3300047445 Ga0495677_0116537 Ga0495677_0116537_46_330 92
722 3300047446 Ga0495679_052439 Ga0495679_052439_875_1162 92
723 3300047447 Ga0495685_105446 Ga0495685_105446_351_635 92
724 3300047470 Ga0495681_0057526 Ga0495681_0057526_288_575 92
725 3300047471 Ga0495684_0178913 Ga0495684_0178913_1036_1323 92
726 3300047472 Ga0495686_0016607 Ga0495686_0016607_280_567 92
727 3300047673 Ga0495593_0004470 Ga0495593_0004470_6867_7154 92
728 3300048089 Ga0495614_0081925 Ga0495614_0081925_295_582 92
729 3300048090 Ga0495615_0150865 Ga0495615_0150865_43_330 92
730 3300048091 Ga0495626_0014129 Ga0495626_0014129_285_572 92
731 3300048907 Ga0496104_0089127 Ga0496104_0089127_2549_2872 92
732 3300048907 Ga0496104_0466077 Ga0496104_0466077_850_1131 92
733 3300048908 Ga0496105_0059980 Ga0496105_0059980_1916_2239 92
734 3300048911 Ga0496108_0094197 Ga0496108_0094197_1492_1815 92
735 3300048912 Ga0496109_0195452 Ga0496109_0195452_720_1043 92
736 3300048912 Ga0496109_1195684 Ga0496109_1195684_345_626 92
737 3300048913 Ga0496110_0001862 Ga0496110_0001862_8245_8568 92
738 3300048914 Ga0496111_0020580 Ga0496111_0020580_2310_2633 92
739 3300048917 Ga0496114_0655080 Ga0496114_0655080_575_880 92
740 3300048929 Ga0496126_1155865 Ga0496126_1155865_126_419 92
741 3300049127 Ga0501306_002889 Ga0501306_002889_324_611 92
742 3300049127 Ga0501306_093857 Ga0501306_093857_100_387 92
743 3300049128 Ga0501308_000276 Ga0501308_000276_324_611 92
744 3300049129 Ga0501309_025458 Ga0501309_025458_354_641 92
745 3300049160 Ga0501304_005680 Ga0501304_005680_324_611 92
746 3300049161 Ga0501305_024295 Ga0501305_024295_314_601 92
747 3300049162 Ga0501307_000101 Ga0501307_000101_2674_2961 92
748 3300049459 Ga0495678_011561 Ga0495678_011561_2473_2757 92
749 3300049460 Ga0495682_0090884 Ga0495682_0090884_726_1013 92
750 3300049527 Ga0501311_065545 Ga0501311_065545_190_483 92
751 3300049528 Ga0501312_048349 Ga0501312_048349_132_419 92
752 3300049532 Ga0501316_026744 Ga0501316_026744_258_545 92
753 3300049532 Ga0501316_073835 Ga0501316_073835_160_441 92
754 3300049533 Ga0501317_000812 Ga0501317_000812_322_609 92
755 3300049533 Ga0501317_066142 Ga0501317_066142_54_341 92
756 3300049538 Ga0501322_013198 Ga0501322_013198_252_539 92
757 3300049541 Ga0501325_026113 Ga0501325_026113_194_481 92
758 3300049542 Ga0501326_02682 Ga0501326_02682_312_599 92
759 3300049568 Ga0501031_0076041 Ga0501031_0076041_823_1107 92
760 3300049569 Ga0501032_1063669 Ga0501032_1063669_65_349 92
761 3300049570 Ga0501033_0014092 Ga0501033_0014092_4085_4369 92
762 3300049571 Ga0501034_0027993 Ga0501034_0027993_3394_3678 92
763 3300049571 Ga0501034_0193563 Ga0501034_0193563_317_622 92
764 3300049572 Ga0501036_0027287 Ga0501036_0027287_3395_3679 92
765 3300049572 Ga0501036_1476200 Ga0501036_1476200_28_315 92
766 3300049574 Ga0501038_0539128 Ga0501038_0539128_295_579 92
767 3300049579 Ga0501043_0023095 Ga0501043_0023095_1146_1430 92
768 3300049581 Ga0501047_0023199 Ga0501047_0023199_3642_3926 92
769 3300049586 Ga0501070_0006424 Ga0501070_0006424_3823_4128 92
770 3300049586 Ga0501070_0018699 Ga0501070_0018699_4876_5172 92
771 3300049586 Ga0501070_0328045 Ga0501070_0328045_548_832 92
772 3300049586 Ga0501070_0695643 Ga0501070_0695643_165_443 92
773 3300049589 Ga0501073_0072398 Ga0501073_0072398_273_578 92
774 3300049590 Ga0501074_0002630 Ga0501074_0002630_513_818 92
775 3300049741 Ga0501079_0001234 Ga0501079_0001234_15134_15439 92
776 3300049742 Ga0501080_0039768 Ga0501080_0039768_74_379 92
777 3300049742 Ga0501080_0173230 Ga0501080_0173230_723_1019 92
778 3300049822 Ga0501035_0045392 Ga0501035_0045392_2964_3248 92
779 3300049823 Ga0501044_0038405 Ga0501044_0038405_3423_3707 92
780 3300049824 Ga0501045_0242225 Ga0501045_0242225_1026_1310 92
781 3300050492 nmdc:mga0yw44_45501_c1 nmdc:mga0yw44_45501_c1_1376_1669 92
782 3300053077 Ga0495601_0080406 Ga0495601_0080406_1292_1573 92
783 3300053078 Ga0495612_0016852 Ga0495612_0016852_1032_1316 92
784 3300053085 Ga0495619_0416108 Ga0495619_0416108_42_326 92
785 3300053099 Ga0500654_115131 Ga0500654_115131_610_897 92
786 3300053100 Ga0500660_129288 Ga0500660_129288_22_303 92
787 3300053142 Ga0500577_0001143 Ga0500577_0001143_990_1271 92
788 3300054114 Ga0501084_0120390 Ga0501084_0120390_1117_1422 92
789 3300059504 Ga0587082_037345 Ga0587082_037345_293_577 92
790 3300059504 Ga0587082_119777 Ga0587082_119777_120_401 92
791 3300059506 Ga0587085_040772 Ga0587085_040772_271_561 92
792 3300059508 Ga0587088_180665 Ga0587088_180665_209_496 92
793 3300059510 Ga0587090_055549 Ga0587090_055549_91_381 92
794 3300059605 Ga0587106_034110 Ga0587106_034110_541_822 92
795 3300059622 Ga0587099_052589 Ga0587099_052589_193_483 92
796 3300059623 Ga0587101_057370 Ga0587101_057370_81_368 92
797 3300059644 Ga0587075_017503 Ga0587075_017503_119_400 92
798 3300059645 Ga0587076_047041 Ga0587076_047041_28_309 92
799 3300059653 Ga0587108_010089 Ga0587108_010089_16_306 92
800 3300060346 Ga0587111_0025486 Ga0587111_0025486_372_653 92
801 3300061719 Ga0466962_0386486 Ga0466962_0386486_179_460 92
802 3300061719 Ga0466962_0394145 Ga0466962_0394145_188_469 92
803 3300061719 Ga0466962_0565371 Ga0466962_0565371_32_319 92
804 iso_pu_bacteria 8055157932 8055160606 92
805 3300004799 Ga0058863_11829867 Ga0058863_118298672 93
806 3300004799 Ga0058863_11940937 Ga0058863_119409372 93
807 3300004800 Ga0058861_10050561 Ga0058861_100505613 93
808 3300004803 Ga0058862_10269038 Ga0058862_102690382 93
809 3300005327 Ga0070658_10006748 Ga0070658_100067489 93
810 3300005327 Ga0070658_10021378 Ga0070658_100213787 93
811 3300005327 Ga0070658_10088897 Ga0070658_100888973 93
812 3300005327 Ga0070658_10790416 Ga0070658_107904161 93
813 3300005329 Ga0070683_101409968 Ga0070683_1014099682 93
814 3300005329 Ga0070683_102029734 Ga0070683_1020297341 93
815 3300005336 Ga0070680_100042527 Ga0070680_1000425279 93
816 3300005336 Ga0070680_100067854 Ga0070680_1000678544 93
817 3300005337 Ga0070682_100048057 Ga0070682_1000480574 93
818 3300005339 Ga0070660_100070032 Ga0070660_1000700323 93
819 3300005339 Ga0070660_100426356 Ga0070660_1004263563 93
820 3300005339 Ga0070660_101468367 Ga0070660_1014683671 93
821 3300005366 Ga0070659_100608461 Ga0070659_1006084611 93
822 3300005435 Ga0070714_100293622 Ga0070714_1002936224 93
823 3300005435 Ga0070714_100330017 Ga0070714_1003300172 93
824 3300005435 Ga0070714_101148405 Ga0070714_1011484051 93
825 3300005435 Ga0070714_102226935 Ga0070714_1022269351 93
826 3300005436 Ga0070713_100670831 Ga0070713_1006708313 93
827 3300005436 Ga0070713_100681717 Ga0070713_1006817173 93
828 3300005436 Ga0070713_100699666 Ga0070713_1006996661 93
829 3300005436 Ga0070713_102457547 Ga0070713_1024575471 93
830 3300005437 Ga0070710_10220178 Ga0070710_102201782 93
831 3300005439 Ga0070711_101467789 Ga0070711_1014677892 93
832 3300005455 Ga0070663_100036695 Ga0070663_1000366957 93
833 3300005455 Ga0070663_101121236 Ga0070663_1011212361 93
834 3300005458 Ga0070681_10189145 Ga0070681_101891452 93
835 3300005458 Ga0070681_11209480 Ga0070681_112094802 93
836 3300005530 Ga0070679_100087287 Ga0070679_1000872874 93
837 3300005530 Ga0070679_100169302 Ga0070679_1001693024 93
838 3300005530 Ga0070679_100506012 Ga0070679_1005060122 93
839 3300005535 Ga0070684_100088289 Ga0070684_1000882896 93
840 3300005548 Ga0070665_100666284 Ga0070665_1006662842 93
841 3300005563 Ga0068855_100235541 Ga0068855_1002355414 93
842 3300005577 Ga0068857_100873274 Ga0068857_1008732742 93
843 3300005577 Ga0068857_101358379 Ga0068857_1013583792 93
844 3300005614 Ga0068856_100256540 Ga0068856_1002565403 93
845 3300005616 Ga0068852_101960635 Ga0068852_1019606352 93
846 3300006028 Ga0070717_10761252 Ga0070717_107612523 93
847 3300006028 Ga0070717_10988004 Ga0070717_109880042 93
848 3300006175 Ga0070712_100510727 Ga0070712_1005107272 93
849 3300006871 Ga0075434_100760105 Ga0075434_1007601054 93
850 3300006914 Ga0075436_100286851 Ga0075436_1002868513 93
851 3300007076 Ga0075435_100514706 Ga0075435_1005147062 93
852 3300009093 Ga0105240_10311096 Ga0105240_103110962 93
853 3300009093 Ga0105240_11269647 Ga0105240_112696472 93
854 3300009551 Ga0105238_10593037 Ga0105238_105930373 93
855 3300009551 Ga0105238_11827189 Ga0105238_118271892 93
856 3300011119 Ga0105246_10726126 Ga0105246_107261263 93
857 3300013045 Ga0154016_113959 Ga0154016_1139591 93
858 3300013100 Ga0157373_10510066 Ga0157373_105100663 93
859 3300013100 Ga0157373_10936601 Ga0157373_109366011 93
860 3300013102 Ga0157371_10421555 Ga0157371_104215552 93
861 3300013104 Ga0157370_10006658 Ga0157370_1000665817 93
862 3300013104 Ga0157370_10036228 Ga0157370_100362286 93
863 3300013104 Ga0157370_10119394 Ga0157370_101193946 93
864 3300013104 Ga0157370_11406531 Ga0157370_114065312 93
865 3300013105 Ga0157369_10010753 Ga0157369_1001075319 93
866 3300013105 Ga0157369_10089330 Ga0157369_100893303 93
867 3300013105 Ga0157369_10353994 Ga0157369_103539942 93
868 3300013105 Ga0157369_10430309 Ga0157369_104303095 93
869 3300013307 Ga0157372_10367809 Ga0157372_103678094 93
870 3300014325 Ga0163163_10861787 Ga0163163_108617871 93
871 3300014968 Ga0157379_11552768 Ga0157379_115527682 93
872 3300019162 Ga0184597_102121 Ga0184597_1021211 93
873 3300019176 Ga0184596_120527 Ga0184596_1205272 93
874 3300019182 Ga0184598_143900 Ga0184598_1439003 93
875 3300020069 Ga0197907_10021336 Ga0197907_100213361 93
876 3300020069 Ga0197907_10178655 Ga0197907_101786552 93
877 3300020069 Ga0197907_10191899 Ga0197907_101918993 93
878 3300020069 Ga0197907_10411133 Ga0197907_104111333 93
879 3300020069 Ga0197907_10620284 Ga0197907_1062028412 93
880 3300020069 Ga0197907_11120812 Ga0197907_111208122 93
881 3300020070 Ga0206356_10028506 Ga0206356_100285062 93
882 3300020070 Ga0206356_10627949 Ga0206356_106279496 93
883 3300020070 Ga0206356_11190805 Ga0206356_111908051 93
884 3300020070 Ga0206356_11262576 Ga0206356_112625762 93
885 3300020070 Ga0206356_11602022 Ga0206356_116020223 93
886 3300020075 Ga0206349_1036328 Ga0206349_103632813 93
887 3300020075 Ga0206349_1272138 Ga0206349_12721382 93
888 3300020075 Ga0206349_1367676 Ga0206349_13676761 93
889 3300020076 Ga0206355_1136018 Ga0206355_11360183 93
890 3300020076 Ga0206355_1463886 Ga0206355_14638863 93
891 3300020077 Ga0206351_10144766 Ga0206351_101447665 93
892 3300020077 Ga0206351_10246258 Ga0206351_102462581 93
893 3300020077 Ga0206351_10420459 Ga0206351_104204592 93
894 3300020077 Ga0206351_10910345 Ga0206351_109103453 93
895 3300020078 Ga0206352_10099306 Ga0206352_100993062 93
896 3300020078 Ga0206352_10756477 Ga0206352_107564773 93
897 3300020078 Ga0206352_11254737 Ga0206352_112547376 93
898 3300020080 Ga0206350_10210497 Ga0206350_102104973 93
899 3300020080 Ga0206350_10457115 Ga0206350_104571154 93
900 3300020080 Ga0206350_10860066 Ga0206350_108600661 93
901 3300020080 Ga0206350_11039953 Ga0206350_110399532 93
902 3300020081 Ga0206354_10066967 Ga0206354_100669676 93
903 3300020081 Ga0206354_10396601 Ga0206354_103966011 93
904 3300020082 Ga0206353_10108410 Ga0206353_101084101 93
905 3300020082 Ga0206353_10375665 Ga0206353_103756652 93
906 3300020082 Ga0206353_10380596 Ga0206353_103805963 93
907 3300020082 Ga0206353_10438480 Ga0206353_104384801 93
908 3300020082 Ga0206353_10544706 Ga0206353_105447063 93
909 3300020610 Ga0154015_1074336 Ga0154015_10743365 93
910 3300021358 Ga0213873_10067970 Ga0213873_100679703 93
911 3300021384 Ga0213876_10000890 Ga0213876_1000089012 93
912 3300022467 Ga0224712_10000310 Ga0224712_1000031012 93
913 3300022467 Ga0224712_10087834 Ga0224712_100878342 93
914 3300022467 Ga0224712_10130000 Ga0224712_101300002 93
915 3300022467 Ga0224712_10367002 Ga0224712_103670022 93
916 3300022467 Ga0224712_10446542 Ga0224712_104465421 93
917 3300022467 Ga0224712_10614986 Ga0224712_106149861 93
918 3300023672 Ga0247553_104995 Ga0247553_1049952 93
919 3300025898 Ga0207692_10690750 Ga0207692_106907501 93
920 3300025904 Ga0207647_10256926 Ga0207647_102569264 93
921 3300025906 Ga0207699_10209075 Ga0207699_102090754 93
922 3300025909 Ga0207705_10001318 Ga0207705_1000131819 93
923 3300025909 Ga0207705_10024842 Ga0207705_100248426 93
924 3300025909 Ga0207705_10158625 Ga0207705_101586251 93
925 3300025909 Ga0207705_11321033 Ga0207705_113210332 93
926 3300025909 Ga0207705_11518445 Ga0207705_115184452 93
927 3300025912 Ga0207707_10008073 Ga0207707_100080735 93
928 3300025913 Ga0207695_10260408 Ga0207695_102604081 93
929 3300025917 Ga0207660_10660016 Ga0207660_106600163 93
930 3300025919 Ga0207657_10067642 Ga0207657_100676427 93
931 3300025919 Ga0207657_11297927 Ga0207657_112979272 93
932 3300025921 Ga0207652_10098495 Ga0207652_100984954 93
933 3300025921 Ga0207652_10137583 Ga0207652_101375835 93
934 3300025921 Ga0207652_10419946 Ga0207652_104199463 93
935 3300025924 Ga0207694_11707641 Ga0207694_117076411 93
936 3300025928 Ga0207700_11137821 Ga0207700_111378212 93
937 3300025928 Ga0207700_11552962 Ga0207700_115529621 93
938 3300025929 Ga0207664_10027344 Ga0207664_100273444 93
939 3300025929 Ga0207664_10526744 Ga0207664_105267442 93
940 3300025929 Ga0207664_10609877 Ga0207664_106098772 93
941 3300025934 Ga0207686_10469517 Ga0207686_104695172 93
942 3300025936 Ga0207670_11422169 Ga0207670_114221691 93
943 3300025939 Ga0207665_10033262 Ga0207665_100332627 93
944 3300025939 Ga0207665_10190852 Ga0207665_101908522 93
945 3300025949 Ga0207667_10017929 Ga0207667_100179294 93
946 3300025949 Ga0207667_10485599 Ga0207667_104855994 93
947 3300026116 Ga0207674_10736768 Ga0207674_107367682 93
948 3300028379 Ga0268266_10060046 Ga0268266_100600468 93
949 3300028556 Ga0265337_1000049 Ga0265337_100004934 93
950 3300028558 Ga0265326_10000822 Ga0265326_1000082215 93
951 3300028563 Ga0265319_1000220 Ga0265319_100022024 93
952 3300028573 Ga0265334_10000083 Ga0265334_1000008340 93
953 3300028653 Ga0265323_10050605 Ga0265323_100506052 93
954 3300028654 Ga0265322_10004536 Ga0265322_100045363 93
955 3300028666 Ga0265336_10001694 Ga0265336_1000169416 93
956 3300028800 Ga0265338_10000358 Ga0265338_1000035853 93
957 3300028800 Ga0265338_10256202 Ga0265338_102562024 93
958 3300029957 Ga0265324_10001390 Ga0265324_1000139010 93
959 3300030760 Ga0265762_1049178 Ga0265762_10491783 93
960 3300030836 Ga0265767_119800 Ga0265767_1198001 93
961 3300030863 Ga0265766_1010927 Ga0265766_10109272 93
962 3300030889 Ga0265761_101567 Ga0265761_1015672 93
963 3300030889 Ga0265761_102151 Ga0265761_1021513 93
964 3300030889 Ga0265761_104400 Ga0265761_1044001 93
965 3300031238 Ga0265332_10000675 Ga0265332_1000067512 93
966 3300031240 Ga0265320_10003833 Ga0265320_1000383312 93
967 3300031241 Ga0265325_10006148 Ga0265325_100061484 93
968 3300031242 Ga0265329_10118335 Ga0265329_101183352 93
969 3300031247 Ga0265340_10000796 Ga0265340_1000079616 93
970 3300031249 Ga0265339_10090109 Ga0265339_100901092 93
971 3300031344 Ga0265316_10007400 Ga0265316_1000740014 93
972 3300031592 Ga0310117_109253 Ga0310117_1092533 93
973 3300031592 Ga0310117_109454 Ga0310117_1094542 93
974 3300031595 Ga0265313_10017464 Ga0265313_100174642 93
975 3300031614 Ga0310103_104508 Ga0310103_1045084 93
976 3300031615 Ga0310107_113542 Ga0310107_1135424 93
977 3300031616 Ga0307508_10103681 Ga0307508_101036816 93
978 3300031635 Ga0310115_115158 Ga0310115_1151581 93
979 3300031667 Ga0310111_115972 Ga0310111_1159722 93
980 3300031690 Ga0310101_123079 Ga0310101_1230791 93
981 3300031691 Ga0316579_10071976 Ga0316579_100719764 93
982 3300031711 Ga0265314_10008203 Ga0265314_1000820312 93
983 3300031712 Ga0265342_10029921 Ga0265342_100299213 93
984 3300031727 Ga0316576_10003776 Ga0316576_1000377611 93
985 3300031728 Ga0316578_10010874 Ga0316578_100108749 93
986 3300031815 Ga0316045_120866 Ga0316045_1208662 93
987 3300033545 Ga0316214_1000853 Ga0316214_10008534 93
988 3300033547 Ga0316212_1007476 Ga0316212_10074764 93
989 3300035398 Ga0316574_0002694 Ga0316574_0002694_4137_4436 93
990 3300035692 Ga0373935_1118430 Ga0373935_1118430_210_509 93
991 3300035724 Ga0373933_0335038 Ga0373933_0335038_108_404 93
992 3300036534 Ga0310109_050305 Ga0310109_050305_201_497 93
993 3300036535 Ga0310110_022287 Ga0310110_022287_162_458 93
994 3300036647 Ga0316582_0022131 Ga0316582_0022131_486_785 93
995 3300036712 Ga0316584_0007224 Ga0316584_0007224_3582_3881 93
996 3300037068 Ga0373925_0000004 Ga0373925_0000004_302451_302747 93
997 3300037466 Ga0395898_0078143 Ga0395898_0078143_1164_1460 93
998 3300038443 Ga0395901_0220498 Ga0395901_0220498_726_1022 93
999 3300038443 Ga0395901_1574253 Ga0395901_1574253_287_583 93
1000 3300039437 Ga0436365_1257400 Ga0436365_1257400_43915_44208 93
1001 3300039453 Ga0436362_0792414 Ga0436362_0792414_511_804 93
1002 3300042876 Ga0451577_0368442 Ga0451577_0368442_718_1011 93
1003 3300044693 Ga0466961_0434621 Ga0466961_0434621_107_400 93
1004 3300044693 Ga0466961_0627642 Ga0466961_0627642_176_475 93
1005 3300044706 Ga0466964_0340009 Ga0466964_0340009_263_544 93
1006 3300044765 Ga0466970_0273099 Ga0466970_0273099_421_720 93
1007 3300044842 Ga0466957_0554770 Ga0466957_0554770_400_690 93
1008 3300044901 Ga0466960_0880029 Ga0466960_0880029_86_367 93
1009 3300045976 Ga0466967_0678173 Ga0466967_0678173_558_854 93
1010 3300046459 Ga0495629_0136009 Ga0495629_0136009_195_494 93
1011 3300046517 Ga0495630_0868987 Ga0495630_0868987_342_641 93
1012 3300046524 Ga0495648_0054915 Ga0495648_0054915_1940_2224 93
1013 3300046531 Ga0495665_0226066 Ga0495665_0226066_321_623 93
1014 3300046678 Ga0495599_0018530 Ga0495599_0018530_3208_3498 93
1015 3300046678 Ga0495599_0328383 Ga0495599_0328383_525_821 93
1016 3300047319 Ga0495674_0798347 Ga0495674_0798347_24_320 93
1017 3300047322 Ga0495680_0314129 Ga0495680_0314129_31_333 93
1018 3300047471 Ga0495684_0239299 Ga0495684_0239299_353_652 93
1019 3300048918 Ga0496115_0892587 Ga0496115_0892587_200_496 93
1020 3300048919 Ga0496116_0001739 Ga0496116_0001739_10727_11014 93
1021 3300048921 Ga0496118_0013367 Ga0496118_0013367_820_1107 93
1022 3300048922 Ga0496119_0009028 Ga0496119_0009028_4419_4706 93
1023 3300048922 Ga0496119_0095006 Ga0496119_0095006_21_317 93
1024 3300048922 Ga0496119_0108730 Ga0496119_0108730_869_1165 93
1025 3300048923 Ga0496120_0268798 Ga0496120_0268798_350_637 93
1026 3300048923 Ga0496120_0400801 Ga0496120_0400801_60_356 93
1027 3300048924 Ga0496121_0012636 Ga0496121_0012636_3425_3712 93
1028 3300048929 Ga0496126_0046941 Ga0496126_0046941_45_341 93
1029 3300048929 Ga0496126_0186755 Ga0496126_0186755_1218_1514 93
1030 3300048929 Ga0496126_0997735 Ga0496126_0997735_178_474 93
1031 3300049534 Ga0501318_047129 Ga0501318_047129_267_557 93
1032 3300049581 Ga0501047_0109201 Ga0501047_0109201_1115_1411 93
1033 3300050512 nmdc:mga0n895_316660_c1 nmdc:mga0n895_316660_c1_138_434 93
1034 3300050513 nmdc:mga0rr50_219225_c1 nmdc:mga0rr50_219225_c1_659_964 93
1035 3300053077 Ga0495601_0028869 Ga0495601_0028869_80_379 93
1036 3300059477 Ga0587084_066412 Ga0587084_066412_330_626 93
1037 3300059478 Ga0587093_019083 Ga0587093_019083_465_761 93
1038 3300059492 Ga0587073_0030599 Ga0587073_0030599_368_679 93
1039 3300059492 Ga0587073_0131699 Ga0587073_0131699_86_382 93
1040 3300059504 Ga0587082_015336 Ga0587082_015336_217_513 93
1041 3300059505 Ga0587083_0109780 Ga0587083_0109780_18_314 93
1042 3300059507 Ga0587086_025247 Ga0587086_025247_99_395 93
1043 3300059511 Ga0587091_019007 Ga0587091_019007_649_945 93
1044 3300059512 Ga0587092_163809 Ga0587092_163809_184_480 93
1045 3300059513 Ga0587094_091932 Ga0587094_091932_233_529 93
1046 3300059607 Ga0587125_010667 Ga0587125_010667_302_598 93
1047 3300059623 Ga0587101_131720 Ga0587101_131720_174_470 93
1048 3300059630 Ga0587128_064370 Ga0587128_064370_124_420 93
1049 3300059640 Ga0587067_017251 Ga0587067_017251_367_663 93
1050 3300059640 Ga0587067_081438 Ga0587067_081438_190_486 93
1051 3300059641 Ga0587068_059859 Ga0587068_059859_72_368 93
1052 3300059641 Ga0587068_098995 Ga0587068_098995_268_564 93
1053 3300059642 Ga0587069_040127 Ga0587069_040127_316_612 93
1054 3300059643 Ga0587072_017983 Ga0587072_017983_435_731 93
1055 3300059646 Ga0587078_034841 Ga0587078_034841_189_485 93
1056 3300059647 Ga0587079_115115 Ga0587079_115115_273_581 93
1057 3300059647 Ga0587079_199776 Ga0587079_199776_47_343 93
1058 iso_pu_bacteria 2515154155 2515851622 93
1059 iso_pu_bacteria 2527291627 2528204321 93
1060 iso_pu_bacteria 2527291629 2528212109 93
1061 iso_pu_bacteria 2546825537 2546946892 93
1062 iso_pu_bacteria 2576861822 2579747599 93
1063 iso_pu_bacteria 2579778521 2579853564 93
1064 iso_pu_bacteria 2619618881 2619853755 93
1065 iso_pu_bacteria 2619619003 2620349851 93
1066 iso_pu_bacteria 2626541554 2626634898 93
1067 iso_pu_bacteria 2684623036 2686543593 93
1068 iso_pu_bacteria 2710264753 2710602553 93
1069 iso_pu_bacteria 2773857924 2774867014 93
1070 iso_pu_bacteria 2827628540 2827632191 93
1071 iso_pu_bacteria 2891554331 2891560654 93
1072 iso_pu_bacteria 2891562705 2891566098 93
1073 iso_pu_bacteria 8002775197 8002782898 93
1074 iso_pu_bacteria 8054913762 8054918466 93
1075 iso_pu_bacteria 8054920844 8054926293 93
1076 3300001904 JGI24736J21556_1055518 JGI24736J21556_10555182 94
1077 3300002067 JGI24735J21928_10033557 JGI24735J21928_100335573 94
1078 3300004800 Ga0058861_11886292 Ga0058861_118862922 94
1079 3300005339 Ga0070660_100352206 Ga0070660_1003522063 94
1080 3300005341 Ga0070691_10948516 Ga0070691_109485161 94
1081 3300005458 Ga0070681_11166740 Ga0070681_111667401 94
1082 3300005530 Ga0070679_101410735 Ga0070679_1014107351 94
1083 3300005539 Ga0068853_102139212 Ga0068853_1021392122 94
1084 3300005564 Ga0070664_100373466 Ga0070664_1003734662 94
1085 3300005578 Ga0068854_101360982 Ga0068854_1013609821 94
1086 3300005841 Ga0068863_100002199 Ga0068863_10000219921 94
1087 3300005844 Ga0068862_100000836 Ga0068862_10000083613 94
1088 3300009093 Ga0105240_10541121 Ga0105240_105411213 94
1089 3300009101 Ga0105247_10000016 Ga0105247_10000016219 94
1090 3300009101 Ga0105247_10162144 Ga0105247_101621443 94
1091 3300009174 Ga0105241_10769724 Ga0105241_107697242 94
1092 3300009177 Ga0105248_10000035 Ga0105248_10000035108 94
1093 3300009177 Ga0105248_10002899 Ga0105248_1000289923 94
1094 3300009551 Ga0105238_10360208 Ga0105238_103602083 94
1095 3300009551 Ga0105238_10567265 Ga0105238_105672652 94
1096 3300009553 Ga0105249_10046324 Ga0105249_100463247 94
1097 3300010375 Ga0105239_11771672 Ga0105239_117716722 94
1098 3300013306 Ga0163162_11859319 Ga0163162_118593192 94
1099 3300013307 Ga0157372_10000069 Ga0157372_1000006989 94
1100 3300013307 Ga0157372_11165931 Ga0157372_111659312 94
1101 3300014325 Ga0163163_10006948 Ga0163163_100069487 94
1102 3300014325 Ga0163163_10018482 Ga0163163_1001848211 94
1103 3300014968 Ga0157379_10011242 Ga0157379_1001124214 94
1104 3300020069 Ga0197907_11327011 Ga0197907_113270113 94
1105 3300020075 Ga0206349_1822410 Ga0206349_18224103 94
1106 3300020081 Ga0206354_10153077 Ga0206354_101530772 94
1107 3300020081 Ga0206354_11645061 Ga0206354_116450612 94
1108 3300020082 Ga0206353_12071772 Ga0206353_120717721 94
1109 3300025900 Ga0207710_10000017 Ga0207710_10000017114 94
1110 3300025904 Ga0207647_10110271 Ga0207647_101102714 94
1111 3300025909 Ga0207705_10499446 Ga0207705_104994462 94
1112 3300025911 Ga0207654_10452296 Ga0207654_104522962 94
1113 3300025912 Ga0207707_10589153 Ga0207707_105891532 94
1114 3300025913 Ga0207695_10288003 Ga0207695_102880033 94
1115 3300025917 Ga0207660_10977196 Ga0207660_109771962 94
1116 3300025921 Ga0207652_11553125 Ga0207652_115531252 94
1117 3300025924 Ga0207694_10160599 Ga0207694_101605992 94
1118 3300025941 Ga0207711_10000134 Ga0207711_1000013443 94
1119 3300025941 Ga0207711_10002995 Ga0207711_1000299523 94
1120 3300025945 Ga0207679_10687782 Ga0207679_106877822 94
1121 3300025949 Ga0207667_10323762 Ga0207667_103237622 94
1122 3300025949 Ga0207667_10823106 Ga0207667_108231063 94
1123 3300025961 Ga0207712_10015493 Ga0207712_100154934 94
1124 3300025981 Ga0207640_10611943 Ga0207640_106119432 94
1125 3300025986 Ga0207658_10002262 Ga0207658_1000226220 94
1126 3300026035 Ga0207703_10019334 Ga0207703_100193346 94
1127 3300026041 Ga0207639_10105527 Ga0207639_101055274 94
1128 3300026078 Ga0207702_10160228 Ga0207702_101602284 94
1129 3300026088 Ga0207641_10009791 Ga0207641_1000979112 94
1130 3300026142 Ga0207698_12361088 Ga0207698_123610882 94
1131 3300028380 Ga0268265_10000156 Ga0268265_1000015622 94
1132 3300041452 Ga0451793_0664496 Ga0451793_0664496_253_546 94
1133 3300044656 Ga0466969_0541224 Ga0466969_0541224_17_307 94
1134 3300044658 Ga0466972_0154886 Ga0466972_0154886_84_368 94
1135 3300044658 Ga0466972_0244282 Ga0466972_0244282_116_403 94
1136 3300044683 Ga0466965_0665373 Ga0466965_0665373_56_346 94
1137 3300044684 Ga0466966_0171555 Ga0466966_0171555_370_669 94
1138 3300044684 Ga0466966_0387250 Ga0466966_0387250_239_523 94
1139 3300044684 Ga0466966_0597184 Ga0466966_0597184_142_426 94
1140 3300044693 Ga0466961_0005440 Ga0466961_0005440_6108_6392 94
1141 3300044693 Ga0466961_0041150 Ga0466961_0041150_1089_1373 94
1142 3300044693 Ga0466961_0501323 Ga0466961_0501323_223_507 94
1143 3300044694 Ga0466963_0016148 Ga0466963_0016148_4275_4559 94
1144 3300044706 Ga0466964_0011253 Ga0466964_0011253_2328_2612 94
1145 3300044719 Ga0466971_0001406 Ga0466971_0001406_4277_4561 94
1146 3300044719 Ga0466971_0224100 Ga0466971_0224100_268_558 94
1147 3300044719 Ga0466971_0378482 Ga0466971_0378482_80_373 94
1148 3300044735 Ga0466968_0249869 Ga0466968_0249869_526_810 94
1149 3300044735 Ga0466968_0647202 Ga0466968_0647202_132_416 94
1150 3300044765 Ga0466970_0031860 Ga0466970_0031860_1475_1759 94
1151 3300044765 Ga0466970_0107886 Ga0466970_0107886_158_442 94
1152 3300044842 Ga0466957_0001751 Ga0466957_0001751_6882_7166 94
1153 3300044842 Ga0466957_1163218 Ga0466957_1163218_84_371 94
1154 3300044901 Ga0466960_0038077 Ga0466960_0038077_1895_2179 94
1155 3300044901 Ga0466960_0281435 Ga0466960_0281435_509_799 94
1156 3300044901 Ga0466960_0557895 Ga0466960_0557895_133_417 94
1157 3300045049 Ga0466959_0045060 Ga0466959_0045060_272_556 94
1158 3300045049 Ga0466959_0116146 Ga0466959_0116146_738_1043 94
1159 3300045049 Ga0466959_0130095 Ga0466959_0130095_1105_1389 94
1160 3300045836 Ga0466958_0012657 Ga0466958_0012657_917_1201 94
1161 3300045836 Ga0466958_0182407 Ga0466958_0182407_607_900 94
1162 3300045976 Ga0466967_0045336 Ga0466967_0045336_3455_3739 94
1163 3300045976 Ga0466967_0064388 Ga0466967_0064388_136_423 94
1164 3300045976 Ga0466967_0617936 Ga0466967_0617936_582_869 94
1165 3300048088 Ga0495602_0915814 Ga0495602_0915814_17_313 94
1166 3300048905 Ga0496102_0153859 Ga0496102_0153859_1632_1925 94
1167 3300048906 Ga0496103_0161226 Ga0496103_0161226_1074_1367 94
1168 3300048910 Ga0496107_0253576 Ga0496107_0253576_112_420 94
1169 3300048915 Ga0496112_0350909 Ga0496112_0350909_610_903 94
1170 3300048915 Ga0496112_0419013 Ga0496112_0419013_297_590 94
1171 3300048916 Ga0496113_0394154 Ga0496113_0394154_266_559 94
1172 3300048920 Ga0496117_0021752 Ga0496117_0021752_4274_4588 94
1173 3300048921 Ga0496118_0011170 Ga0496118_0011170_3235_3549 94
1174 3300048921 Ga0496118_0046340 Ga0496118_0046340_911_1231 94
1175 3300048922 Ga0496119_0000855 Ga0496119_0000855_35538_35846 94
1176 3300048922 Ga0496119_0013889 Ga0496119_0013889_5689_6030 94
1177 3300048923 Ga0496120_0000372 Ga0496120_0000372_65979_66287 94
1178 3300048924 Ga0496121_0017835 Ga0496121_0017835_6160_6507 94
1179 3300048924 Ga0496121_0040377 Ga0496121_0040377_35_355 94
1180 3300049573 Ga0501037_0618337 Ga0501037_0618337_96_380 94
1181 3300049580 Ga0501046_0522737 Ga0501046_0522737_363_647 94
1182 3300049581 Ga0501047_0361296 Ga0501047_0361296_748_1032 94
1183 3300049586 Ga0501070_0166769 Ga0501070_0166769_355_639 94
1184 3300049742 Ga0501080_0449416 Ga0501080_0449416_416_700 94
1185 3300049822 Ga0501035_0341597 Ga0501035_0341597_249_533 94
1186 3300049823 Ga0501044_0088185 Ga0501044_0088185_2520_2804 94
1187 3300053092 Ga0500583_0011796 Ga0500583_0011796_837_1142 94
1188 3300053129 Ga0500628_070191 Ga0500628_070191_32_325 94
1189 3300053153 Ga0500616_0132586 Ga0500616_0132586_75_380 94
1190 3300059490 Ga0587066_089645 Ga0587066_089645_284_571 94
1191 3300059504 Ga0587082_082338 Ga0587082_082338_160_447 94
1192 3300059655 Ga0587114_017298 Ga0587114_017298_36_323 94
1193 3300061719 Ga0466962_0001686 Ga0466962_0001686_2563_2847 94
1194 3300061719 Ga0466962_0668870 Ga0466962_0668870_158_448 94
1195 iso_pu_bacteria 2687453743 2689992356 94
1196 iso_pu_bacteria 2895880812 2895884603 94

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00366

Ribosomal_S17

Ribosomal protein S17

42

109

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
8fmw-assembly1.cif.gz_Q the structure of a hibernating ribosome in the lyme disease pathogen 0.8671 14 94
8fr8-assembly1.cif.gz_r structure of mycobacterium smegmatis rsh bound to a 70s translation initiation complex 0.8595 16 93
1i96-assembly1.cif.gz_Q crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with the translation initiation factor if3 (c-terminal domain) 0.8559 16 94
6hiv-assembly1.cif.gz_CQ cryo-em structure of the trypanosoma brucei mitochondrial ribosome - this entry contains the complete mitoribosome 0.8521 18 93
7ane-assembly1.cif.gz_k leishmania major mitochondrial ribosome 0.8506 18 92
ID Description Score Start End Superfamily
af_Q8ID56_26_114_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8798 18 94 2.40.50.140
af_C6T0V9_1_79_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.852 17 94 2.40.50.140
5xyuQ00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8388 16 93 2.40.50.140
af_Q9LHN1_1_100_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8383 17 94 2.40.50.140
af_Q03246_1_107_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8383 16 92 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A5J6V8B7-F1-model_v4 Small ribosomal subunit protein uS17 0.8856 16 94 GO:0003735
GO:0006412
GO:0019843
GO:0022627
AF-A0A7X7L2N5-F1-model_v4 Small ribosomal subunit protein uS17 0.885 16 94 GO:0003735
GO:0006412
GO:0019843
GO:0022627
AF-A0A853CCF9-F1-model_v4 Small ribosomal subunit protein uS17 0.8824 16 94 GO:0003735
GO:0006412
GO:0019843
GO:0022627
AF-A0A1R1M581-F1-model_v4 Small ribosomal subunit protein uS17 0.8823 16 94 GO:0003735
GO:0006412
GO:0019843
GO:0022627
AF-A0A536EHN0-F1-model_v4 Small ribosomal subunit protein uS17 0.8822 16 94 GO:0003735
GO:0006412
GO:0019843
GO:0022627

Feature Viewer

pLDDT pTM Quality
79.41 0.6 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map