F491536
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1196 | 526 | 1162 | 96 |
Family's Representative Sequence
| Representative Sequence | 3300048924|Ga0496121_0017835|Ga0496121_0017835_6160_6507 |
| Length | 115 |
| Sequence | MTEQTGSAAPAEAEAEVAGTDAARTGADGQAAGRGFRKVREGLVVSDKMAKTVVVAVEDRVQHPLYGKTIRRTKKIKAHDENSSSGVGDRVLLMETRPLSATKRWRVVEVLEKAK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2506783011 | Frankia datiscae Dg1 | Isolate | Nodule |
| 2 | 2508501039 | Frankia saprophytica CN3 | Isolate | Nodule |
| 3 | 2515154155 | Actinopolymorpha alba DSM 45243 | Isolate | Rhizosphere |
| 4 | 2527291627 | Frankia casuarinae Thr | Isolate | Nodule |
| 5 | 2527291629 | Frankia sp. BMG5.23 | Isolate | Nodule |
| 6 | 2546825537 | Frankia sp. CcI6 | Isolate | Rhizoplane |
| 7 | 2576861822 | Frankia sp. CeD | Isolate | Nodule |
| 8 | 2579778521 | Frankia torreyi CpI1-S | Isolate | Unclassified |
| 9 | 2619618881 | Frankia sp. ACN1ag | Isolate | Unclassified |
| 10 | 2619619003 | Frankia sp. CpI1-P | Isolate | Nodule |
| 11 | 2626541554 | Frankia sp. AvcI.1 | Isolate | Nodule |
| 12 | 2671180195 | Frankia sp. CcI49 | Isolate | Nodule |
| 13 | 2675902999 | Frankia asymbiotica NRRL B-16386 | Isolate | Nodule |
| 14 | 2675903060 | Nonomuraea wenchangensis CGMCC 4.5598 | Isolate | Rhizosphere |
| 15 | 2684623036 | Frankia sp. CgIM4 | Isolate | Nodule |
| 16 | 2687453737 | Frankia sp. BMG5.36 | Isolate | Nodule |
| 17 | 2687453743 | Frankia colletiae Cc1.17 | Isolate | Nodule |
| 18 | 2710264753 | Frankia sp. KB5 | Isolate | Nodule |
| 19 | 2773857921 | Frankia asymbiotica NRRL B-16386 | Isolate | Nodule |
| 20 | 2773857922 | Frankia sp. CcI49 | Isolate | Nodule |
| 21 | 2773857924 | Frankia sp. CgIS1 | Isolate | Nodule |
| 22 | 2773857933 | Frankia sp. BMG5.30 | Isolate | Nodule |
| 23 | 2827628540 | Actinopolymorpha cephalotaxi DSM 45117 | Isolate | Rhizosphere |
| 24 | 2884693830 | Nonomuraea phyllanthi WYY166 | Isolate | Unclassified |
| 25 | 2891554331 | Microbispora sp. CL1-1 | Isolate | Unclassified |
| 26 | 2891562705 | Microbispora tritici MT50 | Isolate | Unclassified |
| 27 | 2895442618 | Nonomuraea phyllanthi PA1-10 | Isolate | Unclassified |
| 28 | 2895880812 | Frankia sp. BMG5.11 | Isolate | Unclassified |
| 29 | 3001119090 | Lolliginicoccus lacisalsi G463 | Isolate | Rhizosphere |
| 30 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 31 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 32 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 33 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 34 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 35 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 36 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 37 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 38 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 41 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 43 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 47 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 49 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 62 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 63 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 66 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 67 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 68 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 71 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 73 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 74 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 75 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 77 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 78 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 79 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 80 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 81 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 82 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 84 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 85 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 86 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 88 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 89 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 90 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 91 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 92 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 93 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 94 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 95 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009829 | Sorghum rhizosphere soil microbial communities under drought stress in Albany, CA - sample D | Metatranscriptome | Rhizosphere |
| 111 | 3300009835 | Sorghum rhizosphere soil microbial communities under drought stress in Albany, CA - sample B | Metatranscriptome | Rhizosphere |
| 112 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300012475 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 | Metagenome | Rhizosphere |
| 115 | 3300012487 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 | Metagenome | Rhizosphere |
| 116 | 3300012491 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 | Metagenome | Rhizosphere |
| 117 | 3300012494 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 | Metagenome | Rhizosphere |
| 118 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 119 | 3300012503 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R | Metagenome | Rhizosphere |
| 120 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 121 | 3300013045 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 122 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 133 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300019162 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 137 | 3300019176 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 138 | 3300019182 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE1 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 139 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 140 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 141 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 142 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 143 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 144 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 145 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 146 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 147 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 148 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 149 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 150 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 151 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 152 | 3300022730 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 | Metagenome | Rhizosphere |
| 153 | 3300023672 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 154 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 207 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 208 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 209 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 210 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 211 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 212 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 213 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 214 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 215 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 216 | 3300029280 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.stcc.R1 | Metatranscriptome | Rhizosphere |
| 217 | 3300029285 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.stno.R1 | Metatranscriptome | Rhizosphere |
| 218 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 219 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 220 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 221 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 222 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 223 | 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 224 | 3300030836 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 225 | 3300030863 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 226 | 3300030889 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 227 | 3300030963 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 228 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 229 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 230 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 231 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 232 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 233 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 234 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 235 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 236 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 237 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 238 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 239 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 240 | 3300031592 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA4 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 241 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 242 | 3300031614 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI4 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 243 | 3300031615 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 244 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 245 | 3300031635 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA1 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 246 | 3300031667 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 247 | 3300031686 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA6 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 248 | 3300031690 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI1 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 249 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 250 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 251 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 252 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 253 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 254 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 255 | 3300031815 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Unclassified |
| 256 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 257 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 258 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 259 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 260 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 261 | 3300032120 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 262 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 263 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 264 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 265 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 266 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 267 | 3300033545 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 | Metagenome | Unclassified |
| 268 | 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Metagenome | Unclassified |
| 269 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 270 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 271 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 272 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 273 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 274 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 275 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 276 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 277 | 3300036457 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 278 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 279 | 3300036534 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 280 | 3300036535 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU6 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 281 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 282 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 283 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 284 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 285 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 286 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 287 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 288 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 289 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 290 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 291 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 292 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 293 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 294 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 295 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 296 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 297 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 298 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 299 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 300 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 301 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 302 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 303 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 304 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 305 | 3300042132 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 | Metagenome | Rhizosphere |
| 306 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 307 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 308 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 309 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 310 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 311 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 312 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 313 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 314 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 315 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 316 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 317 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 318 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 319 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 320 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 321 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 322 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 323 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 324 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 325 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 326 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 327 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 411 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 412 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 413 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 414 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 415 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 416 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 417 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 418 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 419 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 420 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 421 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 422 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 423 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 424 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 425 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 426 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 427 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 428 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 429 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 430 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 431 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 432 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 433 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 434 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 435 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 436 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 437 | 3300049160 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 438 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 439 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 440 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 441 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 442 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 443 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 444 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 445 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 446 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 447 | 3300049538 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 448 | 3300049541 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 449 | 3300049542 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 450 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 451 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 452 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 453 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 454 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 455 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 456 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 457 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 458 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 459 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 460 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 461 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 462 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 463 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 464 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 465 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 466 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 467 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 468 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 469 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 470 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 471 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 472 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 473 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 474 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 475 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 476 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 477 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 478 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 479 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 480 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 481 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 482 | 3300053099 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere | Metagenome | Endosphere |
| 483 | 3300053100 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere | Metagenome | Endosphere |
| 484 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 485 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 486 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 487 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 488 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 489 | 3300059478 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 490 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 491 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 492 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 493 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 494 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 495 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 496 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 497 | 3300059507 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 498 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 499 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 500 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 501 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 502 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 503 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 504 | 3300059607 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 505 | 3300059622 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 506 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 507 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 508 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 509 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 510 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 511 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 512 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 513 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 514 | 3300059646 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 515 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 516 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 517 | 3300059653 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 145R_CW_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 518 | 3300059655 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 519 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 520 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 521 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 522 | 637000116 | Frankia casuarinae CcI3 | Isolate | Nodule |
| 523 | 8002775197 | Frankia nepalensis CN7 | Isolate | Nodule |
| 524 | 8054913762 | Frankia gtarii Agncl-10 | Isolate | Nodule |
| 525 | 8054920844 | Frankia tisae Agncl-8 | Isolate | Nodule |
| 526 | 8055157932 | Frankia umida Ag45/Mut15 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 77.84 |
| Metatranscriptomes | 19.31 |
| Isolates | 2.84 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.67 |
| Nodule | 1.84 |
| Rhizoplane | 3.26 |
| Rhizosphere | 88.38 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.85 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1055518 | 3300001904 | Bacteria | 611 |
| 2 | JGI24735J21928_10033557 | 3300002067 | Bacteria | 1516 |
| 3 | JGI25406J46586_10003028 | 3300003203 | Bacteria | 7938 |
| 4 | Ga0058859_11790635 | 3300004798 | Bacteria | 1353 |
| 5 | Ga0058859_11834757 | 3300004798 | Bacteria | 886 |
| 6 | Ga0058863_10022412 | 3300004799 | Bacteria | 4259 |
| 7 | Ga0058863_11829867 | 3300004799 | Bacteria | 931 |
| 8 | Ga0058863_11832389 | 3300004799 | Bacteria | 1258 |
| 9 | Ga0058863_11910841 | 3300004799 | Bacteria | 4671 |
| 10 | Ga0058863_11940937 | 3300004799 | Bacteria | 1345 |
| 11 | Ga0058861_10050561 | 3300004800 | Bacteria | 2533 |
| 12 | Ga0058861_11863394 | 3300004800 | Bacteria | 724 |
| 13 | Ga0058861_11886292 | 3300004800 | Bacteria | 578 |
| 14 | Ga0058861_11946098 | 3300004800 | Bacteria | 516 |
| 15 | Ga0058861_11983512 | 3300004800 | Bacteria | 884 |
| 16 | Ga0058861_11995215 | 3300004800 | Bacteria | 962 |
| 17 | Ga0058861_12014800 | 3300004800 | Bacteria | 1756 |
| 18 | Ga0058860_12163264 | 3300004801 | Bacteria | 820 |
| 19 | Ga0058860_12193443 | 3300004801 | Bacteria | 1663 |
| 20 | Ga0058860_12227750 | 3300004801 | Bacteria | 886 |
| 21 | Ga0058862_10092749 | 3300004803 | Bacteria | 841 |
| 22 | Ga0058862_10269038 | 3300004803 | Bacteria | 1265 |
| 23 | Ga0058862_12767850 | 3300004803 | Bacteria | 1195 |
| 24 | Ga0058862_12784181 | 3300004803 | Bacteria | 540 |
| 25 | Ga0058862_12834356 | 3300004803 | Bacteria | 3386 |
| 26 | Ga0070658_10001764 | 3300005327 | Bacteria | 18213 |
| 27 | Ga0070658_10006748 | 3300005327 | Bacteria | 9291 |
| 28 | Ga0070658_10021378 | 3300005327 | Bacteria | 5186 |
| 29 | Ga0070658_10066569 | 3300005327 | Bacteria | 2943 |
| 30 | Ga0070658_10088897 | 3300005327 | Bacteria | 2543 |
| 31 | Ga0070658_10097709 | 3300005327 | Bacteria | 2425 |
| 32 | Ga0070658_10354214 | 3300005327 | Bacteria | 1257 |
| 33 | Ga0070658_10790416 | 3300005327 | Bacteria | 824 |
| 34 | Ga0070683_100239458 | 3300005329 | Bacteria | 1726 |
| 35 | Ga0070683_100446712 | 3300005329 | Bacteria | 1234 |
| 36 | Ga0070683_100495745 | 3300005329 | Bacteria | 1167 |
| 37 | Ga0070683_100752647 | 3300005329 | Bacteria | 934 |
| 38 | Ga0070683_101409968 | 3300005329 | Bacteria | 670 |
| 39 | Ga0070683_102029734 | 3300005329 | Bacteria | 552 |
| 40 | Ga0070690_100110749 | 3300005330 | Bacteria | 1832 |
| 41 | Ga0070670_101181525 | 3300005331 | Bacteria | 699 |
| 42 | Ga0068869_100116541 | 3300005334 | Bacteria | 2038 |
| 43 | Ga0070666_10571181 | 3300005335 | Bacteria | 824 |
| 44 | Ga0070680_100003083 | 3300005336 | Bacteria | 12368 |
| 45 | Ga0070680_100004398 | 3300005336 | Bacteria | 10606 |
| 46 | Ga0070680_100042527 | 3300005336 | Bacteria | 3687 |
| 47 | Ga0070680_100067854 | 3300005336 | Bacteria | 2926 |
| 48 | Ga0070680_100155709 | 3300005336 | Bacteria | 1919 |
| 49 | Ga0070680_100298977 | 3300005336 | Bacteria | 1365 |
| 50 | Ga0070680_100573762 | 3300005336 | Bacteria | 967 |
| 51 | Ga0070680_101234427 | 3300005336 | Bacteria | 647 |
| 52 | Ga0070682_100048057 | 3300005337 | Bacteria | 2655 |
| 53 | Ga0070682_101406113 | 3300005337 | Bacteria | 597 |
| 54 | Ga0068868_100044857 | 3300005338 | Bacteria | 3458 |
| 55 | Ga0068868_102312643 | 3300005338 | Bacteria | 513 |
| 56 | Ga0070660_100070032 | 3300005339 | Bacteria | 2736 |
| 57 | Ga0070660_100237252 | 3300005339 | Bacteria | 1485 |
| 58 | Ga0070660_100286007 | 3300005339 | Bacteria | 1350 |
| 59 | Ga0070660_100352206 | 3300005339 | Bacteria | 1213 |
| 60 | Ga0070660_100404171 | 3300005339 | Bacteria | 1130 |
| 61 | Ga0070660_100426356 | 3300005339 | Bacteria | 1099 |
| 62 | Ga0070660_100602222 | 3300005339 | Bacteria | 919 |
| 63 | Ga0070660_100620314 | 3300005339 | Bacteria | 905 |
| 64 | Ga0070660_101318012 | 3300005339 | Bacteria | 613 |
| 65 | Ga0070660_101468367 | 3300005339 | Bacteria | 580 |
| 66 | Ga0070689_101863387 | 3300005340 | Bacteria | 549 |
| 67 | Ga0070691_10948516 | 3300005341 | Bacteria | 534 |
| 68 | Ga0070661_101247423 | 3300005344 | Bacteria | 623 |
| 69 | Ga0070661_101766147 | 3300005344 | Bacteria | 525 |
| 70 | Ga0070671_102017759 | 3300005355 | Bacteria | 513 |
| 71 | Ga0070673_100177014 | 3300005364 | Bacteria | 1824 |
| 72 | Ga0070659_100066750 | 3300005366 | Bacteria | 2851 |
| 73 | Ga0070659_100171107 | 3300005366 | Bacteria | 1779 |
| 74 | Ga0070659_100608461 | 3300005366 | Bacteria | 939 |
| 75 | Ga0070659_101722669 | 3300005366 | Bacteria | 561 |
| 76 | Ga0070714_100000013 | 3300005435 | Bacteria | 211756 |
| 77 | Ga0070714_100293622 | 3300005435 | Bacteria | 1513 |
| 78 | Ga0070714_100330017 | 3300005435 | Bacteria | 1428 |
| 79 | Ga0070714_100340560 | 3300005435 | Bacteria | 1406 |
| 80 | Ga0070714_100961121 | 3300005435 | Bacteria | 830 |
| 81 | Ga0070714_101144325 | 3300005435 | Bacteria | 759 |
| 82 | Ga0070714_101148405 | 3300005435 | Bacteria | 757 |
| 83 | Ga0070714_102226935 | 3300005435 | Bacteria | 533 |
| 84 | Ga0070714_102362929 | 3300005435 | Bacteria | 517 |
| 85 | Ga0070713_100004669 | 3300005436 | Bacteria | 9248 |
| 86 | Ga0070713_100670831 | 3300005436 | Bacteria | 988 |
| 87 | Ga0070713_100681717 | 3300005436 | Bacteria | 980 |
| 88 | Ga0070713_100699666 | 3300005436 | Bacteria | 967 |
| 89 | Ga0070713_102457547 | 3300005436 | Bacteria | 503 |
| 90 | Ga0070710_10000376 | 3300005437 | Bacteria | 20895 |
| 91 | Ga0070710_10136352 | 3300005437 | Bacteria | 1501 |
| 92 | Ga0070710_10220178 | 3300005437 | Bacteria | 1207 |
| 93 | Ga0070711_101467789 | 3300005439 | Bacteria | 594 |
| 94 | Ga0070708_100073925 | 3300005445 | Bacteria | 3073 |
| 95 | Ga0070708_102214970 | 3300005445 | Bacteria | 507 |
| 96 | Ga0070663_100036695 | 3300005455 | Bacteria | 3406 |
| 97 | Ga0070663_100106678 | 3300005455 | Bacteria | 2099 |
| 98 | Ga0070663_101121236 | 3300005455 | Bacteria | 688 |
| 99 | Ga0070678_100609503 | 3300005456 | Bacteria | 975 |
| 100 | Ga0070681_10004293 | 3300005458 | Bacteria | 13527 |
| 101 | Ga0070681_10009160 | 3300005458 | Bacteria | 9726 |
| 102 | Ga0070681_10189145 | 3300005458 | Bacteria | 1978 |
| 103 | Ga0070681_11166740 | 3300005458 | Bacteria | 692 |
| 104 | Ga0070681_11209480 | 3300005458 | Bacteria | 678 |
| 105 | Ga0068867_102054112 | 3300005459 | Bacteria | 541 |
| 106 | Ga0070706_100094440 | 3300005467 | Bacteria | 2775 |
| 107 | Ga0070706_100448638 | 3300005467 | Bacteria | 1200 |
| 108 | Ga0070698_100007360 | 3300005471 | Bacteria | 11918 |
| 109 | Ga0070679_100003833 | 3300005530 | Bacteria | 13804 |
| 110 | Ga0070679_100006878 | 3300005530 | Bacteria | 10606 |
| 111 | Ga0070679_100014608 | 3300005530 | Bacteria | 7545 |
| 112 | Ga0070679_100087287 | 3300005530 | Bacteria | 3106 |
| 113 | Ga0070679_100169302 | 3300005530 | Bacteria | 2157 |
| 114 | Ga0070679_100205787 | 3300005530 | Bacteria | 1932 |
| 115 | Ga0070679_100295307 | 3300005530 | Bacteria | 1571 |
| 116 | Ga0070679_100468245 | 3300005530 | Bacteria | 1205 |
| 117 | Ga0070679_100506012 | 3300005530 | Bacteria | 1152 |
| 118 | Ga0070679_101410735 | 3300005530 | Bacteria | 643 |
| 119 | Ga0070684_100088289 | 3300005535 | Bacteria | 2754 |
| 120 | Ga0070684_100337218 | 3300005535 | Bacteria | 1386 |
| 121 | Ga0070684_101252820 | 3300005535 | Bacteria | 698 |
| 122 | Ga0070684_101655704 | 3300005535 | Bacteria | 604 |
| 123 | Ga0068853_102139212 | 3300005539 | Bacteria | 542 |
| 124 | Ga0070672_100719870 | 3300005543 | Bacteria | 874 |
| 125 | Ga0070665_100007009 | 3300005548 | Bacteria | 11453 |
| 126 | Ga0070665_100316587 | 3300005548 | Bacteria | 1564 |
| 127 | Ga0070665_100414338 | 3300005548 | Bacteria | 1356 |
| 128 | Ga0070665_100666284 | 3300005548 | Bacteria | 1054 |
| 129 | Ga0068855_100002777 | 3300005563 | Bacteria | 21547 |
| 130 | Ga0068855_100009577 | 3300005563 | Bacteria | 11689 |
| 131 | Ga0068855_100235541 | 3300005563 | Bacteria | 2047 |
| 132 | Ga0068855_100305134 | 3300005563 | Bacteria | 1762 |
| 133 | Ga0068855_100412912 | 3300005563 | Bacteria | 1478 |
| 134 | Ga0068855_101708622 | 3300005563 | Bacteria | 642 |
| 135 | Ga0068855_101907940 | 3300005563 | Bacteria | 602 |
| 136 | Ga0070664_100373466 | 3300005564 | Bacteria | 1300 |
| 137 | Ga0070664_100843650 | 3300005564 | Bacteria | 858 |
| 138 | Ga0068857_100873274 | 3300005577 | Bacteria | 861 |
| 139 | Ga0068857_101358379 | 3300005577 | Bacteria | 691 |
| 140 | Ga0068854_100004690 | 3300005578 | Bacteria | 8614 |
| 141 | Ga0068854_101360982 | 3300005578 | Bacteria | 641 |
| 142 | Ga0068856_100256540 | 3300005614 | Bacteria | 1763 |
| 143 | Ga0068856_100472684 | 3300005614 | Bacteria | 1274 |
| 144 | Ga0068856_102703091 | 3300005614 | Bacteria | 501 |
| 145 | Ga0070702_100456074 | 3300005615 | Bacteria | 928 |
| 146 | Ga0068852_100016981 | 3300005616 | Bacteria | 5697 |
| 147 | Ga0068852_100808395 | 3300005616 | Bacteria | 952 |
| 148 | Ga0068852_100865204 | 3300005616 | Bacteria | 920 |
| 149 | Ga0068852_101960635 | 3300005616 | Bacteria | 608 |
| 150 | Ga0068864_102470557 | 3300005618 | Bacteria | 526 |
| 151 | Ga0068863_100002199 | 3300005841 | Bacteria | 19365 |
| 152 | Ga0068858_100399888 | 3300005842 | Bacteria | 1320 |
| 153 | Ga0068858_101225703 | 3300005842 | Bacteria | 738 |
| 154 | Ga0068862_100000836 | 3300005844 | Bacteria | 30459 |
| 155 | Ga0081539_10000109 | 3300005985 | Bacteria | 193696 |
| 156 | Ga0070717_10272125 | 3300006028 | Bacteria | 1500 |
| 157 | Ga0070717_10761252 | 3300006028 | Bacteria | 880 |
| 158 | Ga0070717_10988004 | 3300006028 | Bacteria | 766 |
| 159 | Ga0075365_10014271 | 3300006038 | Bacteria | 4776 |
| 160 | Ga0070716_100815708 | 3300006173 | Bacteria | 724 |
| 161 | Ga0070716_101015384 | 3300006173 | Bacteria | 657 |
| 162 | Ga0070712_100510727 | 3300006175 | Bacteria | 1008 |
| 163 | Ga0097621_100345238 | 3300006237 | Bacteria | 1322 |
| 164 | Ga0075428_100089494 | 3300006844 | Bacteria | 3357 |
| 165 | Ga0075428_100144016 | 3300006844 | Bacteria | 2590 |
| 166 | Ga0075428_100269806 | 3300006844 | Bacteria | 1831 |
| 167 | Ga0075428_100868657 | 3300006844 | Bacteria | 957 |
| 168 | Ga0075430_100038086 | 3300006846 | Bacteria | 4075 |
| 169 | Ga0075430_100155685 | 3300006846 | Bacteria | 1903 |
| 170 | Ga0075431_100119295 | 3300006847 | Bacteria | 2722 |
| 171 | Ga0075431_100254409 | 3300006847 | Bacteria | 1784 |
| 172 | Ga0075431_101866498 | 3300006847 | Bacteria | 557 |
| 173 | Ga0075434_100760105 | 3300006871 | Bacteria | 986 |
| 174 | Ga0075429_100527814 | 3300006880 | Bacteria | 1034 |
| 175 | Ga0075429_101629322 | 3300006880 | Bacteria | 561 |
| 176 | Ga0075429_102000322 | 3300006880 | Bacteria | 502 |
| 177 | Ga0075436_100286851 | 3300006914 | Bacteria | 1178 |
| 178 | Ga0075435_100514706 | 3300007076 | Bacteria | 1035 |
| 179 | Ga0099794_10193717 | 3300007265 | Bacteria | 1040 |
| 180 | Ga0105251_10053109 | 3300009011 | Bacteria | 1927 |
| 181 | Ga0105244_10167075 | 3300009036 | Bacteria | 1048 |
| 182 | Ga0105250_10329168 | 3300009092 | Bacteria | 665 |
| 183 | Ga0105240_10002670 | 3300009093 | Bacteria | 28391 |
| 184 | Ga0105240_10039358 | 3300009093 | Bacteria | 6055 |
| 185 | Ga0105240_10311096 | 3300009093 | Bacteria | 1799 |
| 186 | Ga0105240_10541121 | 3300009093 | Bacteria | 1290 |
| 187 | Ga0105240_11269647 | 3300009093 | Bacteria | 778 |
| 188 | Ga0111539_11165846 | 3300009094 | Bacteria | 895 |
| 189 | Ga0105245_10711399 | 3300009098 | Bacteria | 1038 |
| 190 | Ga0105245_10878150 | 3300009098 | Bacteria | 938 |
| 191 | Ga0105245_11025418 | 3300009098 | Bacteria | 870 |
| 192 | Ga0105247_10000016 | 3300009101 | Bacteria | 263389 |
| 193 | Ga0105247_10000616 | 3300009101 | Bacteria | 28650 |
| 194 | Ga0105247_10162144 | 3300009101 | Bacteria | 1481 |
| 195 | Ga0105247_10380229 | 3300009101 | Bacteria | 1001 |
| 196 | Ga0114129_10000114 | 3300009147 | Bacteria | 80730 |
| 197 | Ga0114129_10132230 | 3300009147 | Bacteria | 3426 |
| 198 | Ga0114129_10158563 | 3300009147 | Bacteria | 3093 |
| 199 | Ga0114129_10230488 | 3300009147 | Bacteria | 2494 |
| 200 | Ga0105243_12493737 | 3300009148 | Bacteria | 556 |
| 201 | Ga0105241_10000758 | 3300009174 | Bacteria | 24538 |
| 202 | Ga0105241_10769724 | 3300009174 | Bacteria | 884 |
| 203 | Ga0105242_10876810 | 3300009176 | Bacteria | 895 |
| 204 | Ga0105242_12410055 | 3300009176 | Bacteria | 574 |
| 205 | Ga0105242_12716358 | 3300009176 | Bacteria | 545 |
| 206 | Ga0105248_10000035 | 3300009177 | Bacteria | 187578 |
| 207 | Ga0105248_10002899 | 3300009177 | Bacteria | 19028 |
| 208 | Ga0105248_10243255 | 3300009177 | Bacteria | 2025 |
| 209 | Ga0105248_10424628 | 3300009177 | Bacteria | 1497 |
| 210 | Ga0105237_10018147 | 3300009545 | Bacteria | 7285 |
| 211 | Ga0105237_11002543 | 3300009545 | Bacteria | 842 |
| 212 | Ga0105237_12679199 | 3300009545 | Bacteria | 509 |
| 213 | Ga0105238_10010490 | 3300009551 | Bacteria | 9300 |
| 214 | Ga0105238_10360208 | 3300009551 | Bacteria | 1444 |
| 215 | Ga0105238_10567265 | 3300009551 | Bacteria | 1140 |
| 216 | Ga0105238_10593037 | 3300009551 | Bacteria | 1115 |
| 217 | Ga0105238_10966201 | 3300009551 | Bacteria | 872 |
| 218 | Ga0105238_11827189 | 3300009551 | Bacteria | 640 |
| 219 | Ga0105249_10046324 | 3300009553 | Bacteria | 3957 |
| 220 | Ga0105249_11128089 | 3300009553 | Bacteria | 854 |
| 221 | Ga0105249_11634110 | 3300009553 | Bacteria | 717 |
| 222 | Ga0130086_1047822 | 3300009829 | Bacteria | 540 |
| 223 | Ga0130084_1078115 | 3300009835 | Bacteria | 540 |
| 224 | Ga0105239_10226370 | 3300010375 | Bacteria | 2098 |
| 225 | Ga0105239_11081109 | 3300010375 | Bacteria | 923 |
| 226 | Ga0105239_11771672 | 3300010375 | Bacteria | 715 |
| 227 | Ga0105246_10282256 | 3300011119 | Bacteria | 1333 |
| 228 | Ga0105246_10726126 | 3300011119 | Bacteria | 873 |
| 229 | Ga0157317_1001596 | 3300012475 | Bacteria | 1245 |
| 230 | Ga0157321_1004051 | 3300012487 | Bacteria | 902 |
| 231 | Ga0157329_1002301 | 3300012491 | Bacteria | 1074 |
| 232 | Ga0157341_1003106 | 3300012494 | Bacteria | 1143 |
| 233 | Ga0157347_1020817 | 3300012502 | Bacteria | 767 |
| 234 | Ga0157313_1027449 | 3300012503 | Bacteria | 625 |
| 235 | Ga0157342_1006396 | 3300012507 | Bacteria | 1113 |
| 236 | Ga0154016_113959 | 3300013045 | Bacteria | 717 |
| 237 | Ga0154016_124994 | 3300013045 | Bacteria | 585 |
| 238 | Ga0157373_10510066 | 3300013100 | Bacteria | 869 |
| 239 | Ga0157373_10936601 | 3300013100 | Bacteria | 644 |
| 240 | Ga0157371_10017613 | 3300013102 | Bacteria | 5301 |
| 241 | Ga0157371_10421555 | 3300013102 | Bacteria | 979 |
| 242 | Ga0157370_10006658 | 3300013104 | Bacteria | 12691 |
| 243 | Ga0157370_10007858 | 3300013104 | Bacteria | 11558 |
| 244 | Ga0157370_10036228 | 3300013104 | Bacteria | 4789 |
| 245 | Ga0157370_10119394 | 3300013104 | Bacteria | 2462 |
| 246 | Ga0157370_11406531 | 3300013104 | Bacteria | 628 |
| 247 | Ga0157369_10001467 | 3300013105 | Bacteria | 28921 |
| 248 | Ga0157369_10010753 | 3300013105 | Bacteria | 10418 |
| 249 | Ga0157369_10038301 | 3300013105 | Bacteria | 5243 |
| 250 | Ga0157369_10089330 | 3300013105 | Bacteria | 3290 |
| 251 | Ga0157369_10248956 | 3300013105 | Bacteria | 1855 |
| 252 | Ga0157369_10319534 | 3300013105 | Bacteria | 1614 |
| 253 | Ga0157369_10353994 | 3300013105 | Bacteria | 1525 |
| 254 | Ga0157369_10430309 | 3300013105 | Bacteria | 1368 |
| 255 | Ga0157369_10438090 | 3300013105 | Bacteria | 1354 |
| 256 | Ga0157369_10755143 | 3300013105 | Bacteria | 1000 |
| 257 | Ga0157369_11613093 | 3300013105 | Bacteria | 660 |
| 258 | Ga0157369_11675608 | 3300013105 | Bacteria | 646 |
| 259 | Ga0157374_10042287 | 3300013296 | Bacteria | 4203 |
| 260 | Ga0157374_11105391 | 3300013296 | Bacteria | 813 |
| 261 | Ga0157378_11038426 | 3300013297 | Bacteria | 855 |
| 262 | Ga0157378_11112864 | 3300013297 | Bacteria | 827 |
| 263 | Ga0157378_12947994 | 3300013297 | Bacteria | 528 |
| 264 | Ga0163162_11422846 | 3300013306 | Bacteria | 789 |
| 265 | Ga0163162_11859319 | 3300013306 | Bacteria | 689 |
| 266 | Ga0163162_12455970 | 3300013306 | Bacteria | 599 |
| 267 | Ga0157372_10000069 | 3300013307 | Bacteria | 110621 |
| 268 | Ga0157372_10367809 | 3300013307 | Bacteria | 1675 |
| 269 | Ga0157372_11165931 | 3300013307 | Bacteria | 891 |
| 270 | Ga0157372_12066258 | 3300013307 | Bacteria | 655 |
| 271 | Ga0157372_12512895 | 3300013307 | Bacteria | 591 |
| 272 | Ga0157372_12849947 | 3300013307 | Bacteria | 554 |
| 273 | Ga0157375_11231054 | 3300013308 | Bacteria | 879 |
| 274 | Ga0163163_10006948 | 3300014325 | Bacteria | 9943 |
| 275 | Ga0163163_10018482 | 3300014325 | Bacteria | 6527 |
| 276 | Ga0163163_10130437 | 3300014325 | Bacteria | 2554 |
| 277 | Ga0163163_10861787 | 3300014325 | Bacteria | 969 |
| 278 | Ga0163163_11225418 | 3300014325 | Bacteria | 813 |
| 279 | Ga0182008_10293522 | 3300014497 | Bacteria | 849 |
| 280 | Ga0157379_10011242 | 3300014968 | Bacteria | 7798 |
| 281 | Ga0157379_11552768 | 3300014968 | Bacteria | 645 |
| 282 | Ga0157379_12608734 | 3300014968 | Bacteria | 506 |
| 283 | Ga0157376_10232073 | 3300014969 | Bacteria | 1715 |
| 284 | Ga0157376_10990920 | 3300014969 | Bacteria | 862 |
| 285 | Ga0157376_12181147 | 3300014969 | Bacteria | 593 |
| 286 | Ga0163161_10761909 | 3300017792 | Bacteria | 811 |
| 287 | Ga0184597_102121 | 3300019162 | Bacteria | 659 |
| 288 | Ga0184596_120527 | 3300019176 | Bacteria | 652 |
| 289 | Ga0184598_143900 | 3300019182 | Bacteria | 1243 |
| 290 | Ga0197907_10021336 | 3300020069 | Bacteria | 542 |
| 291 | Ga0197907_10081451 | 3300020069 | Bacteria | 849 |
| 292 | Ga0197907_10108336 | 3300020069 | Bacteria | 1203 |
| 293 | Ga0197907_10168473 | 3300020069 | Bacteria | 615 |
| 294 | Ga0197907_10178655 | 3300020069 | Bacteria | 624 |
| 295 | Ga0197907_10191899 | 3300020069 | Bacteria | 775 |
| 296 | Ga0197907_10411133 | 3300020069 | Bacteria | 1339 |
| 297 | Ga0197907_10620284 | 3300020069 | Bacteria | 13642 |
| 298 | Ga0197907_10639128 | 3300020069 | Bacteria | 1995 |
| 299 | Ga0197907_10933733 | 3300020069 | Bacteria | 713 |
| 300 | Ga0197907_11120812 | 3300020069 | Bacteria | 830 |
| 301 | Ga0197907_11247002 | 3300020069 | Bacteria | 3543 |
| 302 | Ga0197907_11327011 | 3300020069 | Bacteria | 1047 |
| 303 | Ga0197907_11333365 | 3300020069 | Bacteria | 2527 |
| 304 | Ga0197907_11336307 | 3300020069 | Bacteria | 1058 |
| 305 | Ga0206356_10028506 | 3300020070 | Bacteria | 594 |
| 306 | Ga0206356_10137316 | 3300020070 | Bacteria | 706 |
| 307 | Ga0206356_10141090 | 3300020070 | Bacteria | 871 |
| 308 | Ga0206356_10378442 | 3300020070 | Bacteria | 2144 |
| 309 | Ga0206356_10627949 | 3300020070 | Bacteria | 3194 |
| 310 | Ga0206356_10701291 | 3300020070 | Bacteria | 894 |
| 311 | Ga0206356_10741805 | 3300020070 | Bacteria | 651 |
| 312 | Ga0206356_10993217 | 3300020070 | Bacteria | 885 |
| 313 | Ga0206356_11085336 | 3300020070 | Bacteria | 4824 |
| 314 | Ga0206356_11190805 | 3300020070 | Bacteria | 915 |
| 315 | Ga0206356_11202941 | 3300020070 | Bacteria | 896 |
| 316 | Ga0206356_11262576 | 3300020070 | Bacteria | 687 |
| 317 | Ga0206356_11528920 | 3300020070 | Bacteria | 1474 |
| 318 | Ga0206356_11602022 | 3300020070 | Bacteria | 966 |
| 319 | Ga0206349_1036328 | 3300020075 | Bacteria | 16217 |
| 320 | Ga0206349_1260332 | 3300020075 | Bacteria | 5094 |
| 321 | Ga0206349_1272138 | 3300020075 | Bacteria | 817 |
| 322 | Ga0206349_1367676 | 3300020075 | Bacteria | 609 |
| 323 | Ga0206349_1822410 | 3300020075 | Bacteria | 812 |
| 324 | Ga0206355_1136018 | 3300020076 | Bacteria | 1822 |
| 325 | Ga0206355_1257286 | 3300020076 | Bacteria | 3023 |
| 326 | Ga0206355_1345158 | 3300020076 | Bacteria | 963 |
| 327 | Ga0206355_1463886 | 3300020076 | Bacteria | 1011 |
| 328 | Ga0206351_10004618 | 3300020077 | Bacteria | 5254 |
| 329 | Ga0206351_10108476 | 3300020077 | Bacteria | 796 |
| 330 | Ga0206351_10144766 | 3300020077 | Bacteria | 1224 |
| 331 | Ga0206351_10246258 | 3300020077 | Bacteria | 943 |
| 332 | Ga0206351_10420459 | 3300020077 | Bacteria | 737 |
| 333 | Ga0206351_10483248 | 3300020077 | Bacteria | 585 |
| 334 | Ga0206351_10864200 | 3300020077 | Bacteria | 1287 |
| 335 | Ga0206351_10910345 | 3300020077 | Bacteria | 2514 |
| 336 | Ga0206352_10099306 | 3300020078 | Bacteria | 532 |
| 337 | Ga0206352_10361311 | 3300020078 | Bacteria | 919 |
| 338 | Ga0206352_10528760 | 3300020078 | Bacteria | 762 |
| 339 | Ga0206352_10681057 | 3300020078 | Bacteria | 1991 |
| 340 | Ga0206352_10756477 | 3300020078 | Bacteria | 968 |
| 341 | Ga0206352_10909807 | 3300020078 | Bacteria | 944 |
| 342 | Ga0206352_11254737 | 3300020078 | Bacteria | 1534 |
| 343 | Ga0206350_10132091 | 3300020080 | Bacteria | 782 |
| 344 | Ga0206350_10210497 | 3300020080 | Bacteria | 2190 |
| 345 | Ga0206350_10457115 | 3300020080 | Bacteria | 2167 |
| 346 | Ga0206350_10473798 | 3300020080 | Bacteria | 610 |
| 347 | Ga0206350_10562667 | 3300020080 | Bacteria | 637 |
| 348 | Ga0206350_10860066 | 3300020080 | Bacteria | 672 |
| 349 | Ga0206350_11039953 | 3300020080 | Bacteria | 1056 |
| 350 | Ga0206350_11175937 | 3300020080 | Bacteria | 1005 |
| 351 | Ga0206350_11319711 | 3300020080 | Bacteria | 844 |
| 352 | Ga0206354_10066967 | 3300020081 | Bacteria | 1509 |
| 353 | Ga0206354_10127370 | 3300020081 | Bacteria | 832 |
| 354 | Ga0206354_10153077 | 3300020081 | Bacteria | 563 |
| 355 | Ga0206354_10226284 | 3300020081 | Bacteria | 795 |
| 356 | Ga0206354_10292391 | 3300020081 | Bacteria | 2798 |
| 357 | Ga0206354_10396601 | 3300020081 | Bacteria | 561 |
| 358 | Ga0206354_10669361 | 3300020081 | Bacteria | 1020 |
| 359 | Ga0206354_10788811 | 3300020081 | Bacteria | 5159 |
| 360 | Ga0206354_10812358 | 3300020081 | Bacteria | 1175 |
| 361 | Ga0206354_10997721 | 3300020081 | Bacteria | 2902 |
| 362 | Ga0206354_11237324 | 3300020081 | Bacteria | 1039 |
| 363 | Ga0206354_11645061 | 3300020081 | Bacteria | 647 |
| 364 | Ga0206353_10108410 | 3300020082 | Bacteria | 1032 |
| 365 | Ga0206353_10375665 | 3300020082 | Bacteria | 532 |
| 366 | Ga0206353_10380596 | 3300020082 | Bacteria | 1526 |
| 367 | Ga0206353_10438480 | 3300020082 | Bacteria | 734 |
| 368 | Ga0206353_10484919 | 3300020082 | Bacteria | 819 |
| 369 | Ga0206353_10544706 | 3300020082 | Bacteria | 818 |
| 370 | Ga0206353_10558793 | 3300020082 | Bacteria | 6343 |
| 371 | Ga0206353_11286618 | 3300020082 | Bacteria | 702 |
| 372 | Ga0206353_11364351 | 3300020082 | Bacteria | 3591 |
| 373 | Ga0206353_11602891 | 3300020082 | Bacteria | 981 |
| 374 | Ga0206353_11707872 | 3300020082 | Bacteria | 679 |
| 375 | Ga0206353_12071772 | 3300020082 | Bacteria | 536 |
| 376 | Ga0154015_1050976 | 3300020610 | Bacteria | 1247 |
| 377 | Ga0154015_1074336 | 3300020610 | Bacteria | 1180 |
| 378 | Ga0154015_1168233 | 3300020610 | Bacteria | 2253 |
| 379 | Ga0213873_10067970 | 3300021358 | Bacteria | 977 |
| 380 | Ga0213876_10000890 | 3300021384 | Bacteria | 19986 |
| 381 | Ga0224712_10000310 | 3300022467 | Bacteria | 9101 |
| 382 | Ga0224712_10002654 | 3300022467 | Bacteria | 4471 |
| 383 | Ga0224712_10061639 | 3300022467 | Bacteria | 1496 |
| 384 | Ga0224712_10087834 | 3300022467 | Bacteria | 1296 |
| 385 | Ga0224712_10089706 | 3300022467 | Bacteria | 1286 |
| 386 | Ga0224712_10119501 | 3300022467 | Bacteria | 1140 |
| 387 | Ga0224712_10130000 | 3300022467 | Bacteria | 1099 |
| 388 | Ga0224712_10174136 | 3300022467 | Bacteria | 966 |
| 389 | Ga0224712_10309417 | 3300022467 | Bacteria | 740 |
| 390 | Ga0224712_10367002 | 3300022467 | Bacteria | 682 |
| 391 | Ga0224712_10446542 | 3300022467 | Bacteria | 621 |
| 392 | Ga0224712_10614986 | 3300022467 | Bacteria | 531 |
| 393 | Ga0224712_10641793 | 3300022467 | Bacteria | 520 |
| 394 | Ga0224570_108923 | 3300022730 | Bacteria | 625 |
| 395 | Ga0247553_104995 | 3300023672 | Bacteria | 682 |
| 396 | Ga0207713_1012538 | 3300025735 | Bacteria | 4520 |
| 397 | Ga0207692_10000368 | 3300025898 | Bacteria | 15470 |
| 398 | Ga0207692_10690750 | 3300025898 | Bacteria | 662 |
| 399 | Ga0207692_11212420 | 3300025898 | Bacteria | 501 |
| 400 | Ga0207642_10880050 | 3300025899 | Bacteria | 573 |
| 401 | Ga0207710_10000017 | 3300025900 | Bacteria | 370962 |
| 402 | Ga0207710_10000048 | 3300025900 | Bacteria | 189597 |
| 403 | Ga0207647_10000925 | 3300025904 | Bacteria | 22625 |
| 404 | Ga0207647_10110271 | 3300025904 | Bacteria | 1627 |
| 405 | Ga0207647_10138118 | 3300025904 | Bacteria | 1429 |
| 406 | Ga0207647_10256926 | 3300025904 | Bacteria | 1001 |
| 407 | Ga0207699_10209075 | 3300025906 | Bacteria | 1326 |
| 408 | Ga0207643_11042639 | 3300025908 | Bacteria | 528 |
| 409 | Ga0207705_10000671 | 3300025909 | Bacteria | 28465 |
| 410 | Ga0207705_10001318 | 3300025909 | Bacteria | 19884 |
| 411 | Ga0207705_10003438 | 3300025909 | Bacteria | 12045 |
| 412 | Ga0207705_10024842 | 3300025909 | Bacteria | 4276 |
| 413 | Ga0207705_10158625 | 3300025909 | Bacteria | 1698 |
| 414 | Ga0207705_10499446 | 3300025909 | Bacteria | 945 |
| 415 | Ga0207705_10578872 | 3300025909 | Bacteria | 873 |
| 416 | Ga0207705_11321033 | 3300025909 | Bacteria | 550 |
| 417 | Ga0207705_11518445 | 3300025909 | Bacteria | 507 |
| 418 | Ga0207684_10034994 | 3300025910 | Bacteria | 4265 |
| 419 | Ga0207684_10969602 | 3300025910 | Bacteria | 712 |
| 420 | Ga0207654_10001876 | 3300025911 | Bacteria | 10890 |
| 421 | Ga0207654_10452296 | 3300025911 | Bacteria | 901 |
| 422 | Ga0207707_10001257 | 3300025912 | Bacteria | 23769 |
| 423 | Ga0207707_10001820 | 3300025912 | Bacteria | 19557 |
| 424 | Ga0207707_10008073 | 3300025912 | Bacteria | 9140 |
| 425 | Ga0207707_10011410 | 3300025912 | Bacteria | 7738 |
| 426 | Ga0207707_10247736 | 3300025912 | Bacteria | 1548 |
| 427 | Ga0207707_10589153 | 3300025912 | Bacteria | 942 |
| 428 | Ga0207707_10815862 | 3300025912 | Bacteria | 776 |
| 429 | Ga0207707_11262091 | 3300025912 | Bacteria | 595 |
| 430 | Ga0207695_10000465 | 3300025913 | Bacteria | 87928 |
| 431 | Ga0207695_10038288 | 3300025913 | Bacteria | 5165 |
| 432 | Ga0207695_10260408 | 3300025913 | Bacteria | 1632 |
| 433 | Ga0207695_10288003 | 3300025913 | Bacteria | 1535 |
| 434 | Ga0207671_10000128 | 3300025914 | Bacteria | 117836 |
| 435 | Ga0207693_11437934 | 3300025915 | Bacteria | 511 |
| 436 | Ga0207663_10289418 | 3300025916 | Bacteria | 1220 |
| 437 | Ga0207660_10000562 | 3300025917 | Bacteria | 24961 |
| 438 | Ga0207660_10012334 | 3300025917 | Bacteria | 5590 |
| 439 | Ga0207660_10660016 | 3300025917 | Bacteria | 853 |
| 440 | Ga0207660_10844220 | 3300025917 | Bacteria | 747 |
| 441 | Ga0207660_10977196 | 3300025917 | Bacteria | 691 |
| 442 | Ga0207660_11336668 | 3300025917 | Bacteria | 581 |
| 443 | Ga0207657_10067642 | 3300025919 | Bacteria | 3037 |
| 444 | Ga0207657_10068034 | 3300025919 | Bacteria | 3027 |
| 445 | Ga0207657_10246922 | 3300025919 | Bacteria | 1424 |
| 446 | Ga0207657_10268714 | 3300025919 | Bacteria | 1356 |
| 447 | Ga0207657_10302551 | 3300025919 | Bacteria | 1267 |
| 448 | Ga0207657_10477719 | 3300025919 | Bacteria | 977 |
| 449 | Ga0207657_10632455 | 3300025919 | Bacteria | 834 |
| 450 | Ga0207657_10819126 | 3300025919 | Bacteria | 719 |
| 451 | Ga0207657_11297927 | 3300025919 | Bacteria | 550 |
| 452 | Ga0207652_10000632 | 3300025921 | Bacteria | 34827 |
| 453 | Ga0207652_10005398 | 3300025921 | Bacteria | 10371 |
| 454 | Ga0207652_10093052 | 3300025921 | Bacteria | 2652 |
| 455 | Ga0207652_10098495 | 3300025921 | Bacteria | 2579 |
| 456 | Ga0207652_10137583 | 3300025921 | Bacteria | 2182 |
| 457 | Ga0207652_10249175 | 3300025921 | Bacteria | 1602 |
| 458 | Ga0207652_10354268 | 3300025921 | Bacteria | 1325 |
| 459 | Ga0207652_10419946 | 3300025921 | Bacteria | 1206 |
| 460 | Ga0207652_10705203 | 3300025921 | Bacteria | 900 |
| 461 | Ga0207652_10711700 | 3300025921 | Bacteria | 895 |
| 462 | Ga0207652_11553125 | 3300025921 | Bacteria | 566 |
| 463 | Ga0207646_10159851 | 3300025922 | Bacteria | 2033 |
| 464 | Ga0207694_10000973 | 3300025924 | Bacteria | 25165 |
| 465 | Ga0207694_10160599 | 3300025924 | Bacteria | 1815 |
| 466 | Ga0207694_10315747 | 3300025924 | Bacteria | 1289 |
| 467 | Ga0207694_10603492 | 3300025924 | Bacteria | 923 |
| 468 | Ga0207694_10741905 | 3300025924 | Bacteria | 829 |
| 469 | Ga0207694_11258965 | 3300025924 | Bacteria | 626 |
| 470 | Ga0207694_11707641 | 3300025924 | Bacteria | 530 |
| 471 | Ga0207650_11268530 | 3300025925 | Bacteria | 627 |
| 472 | Ga0207650_11615820 | 3300025925 | Bacteria | 550 |
| 473 | Ga0207687_10213190 | 3300025927 | Bacteria | 1516 |
| 474 | Ga0207687_10939029 | 3300025927 | Bacteria | 741 |
| 475 | Ga0207700_10373104 | 3300025928 | Bacteria | 1246 |
| 476 | Ga0207700_11137821 | 3300025928 | Bacteria | 697 |
| 477 | Ga0207700_11552962 | 3300025928 | Bacteria | 586 |
| 478 | Ga0207664_10000001 | 3300025929 | Bacteria | 724213 |
| 479 | Ga0207664_10027344 | 3300025929 | Bacteria | 4323 |
| 480 | Ga0207664_10261305 | 3300025929 | Bacteria | 1514 |
| 481 | Ga0207664_10526744 | 3300025929 | Bacteria | 1059 |
| 482 | Ga0207664_10609877 | 3300025929 | Bacteria | 980 |
| 483 | Ga0207644_10916542 | 3300025931 | Bacteria | 735 |
| 484 | Ga0207690_10007372 | 3300025932 | Bacteria | 6529 |
| 485 | Ga0207690_10692724 | 3300025932 | Bacteria | 837 |
| 486 | Ga0207686_10469517 | 3300025934 | Bacteria | 971 |
| 487 | Ga0207686_10932443 | 3300025934 | Bacteria | 702 |
| 488 | Ga0207709_10667301 | 3300025935 | Bacteria | 829 |
| 489 | Ga0207670_11422169 | 3300025936 | Bacteria | 589 |
| 490 | Ga0207665_10033262 | 3300025939 | Bacteria | 3416 |
| 491 | Ga0207665_10190852 | 3300025939 | Bacteria | 1488 |
| 492 | Ga0207665_10254816 | 3300025939 | Bacteria | 1298 |
| 493 | Ga0207691_10020477 | 3300025940 | Bacteria | 6253 |
| 494 | Ga0207711_10000134 | 3300025941 | Bacteria | 77843 |
| 495 | Ga0207711_10002995 | 3300025941 | Bacteria | 14760 |
| 496 | Ga0207711_10083902 | 3300025941 | Bacteria | 2788 |
| 497 | Ga0207711_10417100 | 3300025941 | Bacteria | 1248 |
| 498 | Ga0207689_11631241 | 3300025942 | Bacteria | 536 |
| 499 | Ga0207661_10052310 | 3300025944 | Bacteria | 3262 |
| 500 | Ga0207661_10602118 | 3300025944 | Bacteria | 1009 |
| 501 | Ga0207679_10687782 | 3300025945 | Bacteria | 927 |
| 502 | Ga0207679_12056165 | 3300025945 | Bacteria | 519 |
| 503 | Ga0207667_10017929 | 3300025949 | Bacteria | 7956 |
| 504 | Ga0207667_10023995 | 3300025949 | Bacteria | 6708 |
| 505 | Ga0207667_10071618 | 3300025949 | Bacteria | 3603 |
| 506 | Ga0207667_10323762 | 3300025949 | Bacteria | 1574 |
| 507 | Ga0207667_10485599 | 3300025949 | Bacteria | 1254 |
| 508 | Ga0207667_10823106 | 3300025949 | Bacteria | 924 |
| 509 | Ga0207651_10587420 | 3300025960 | Bacteria | 972 |
| 510 | Ga0207712_10015493 | 3300025961 | Bacteria | 4920 |
| 511 | Ga0207640_10074941 | 3300025981 | Bacteria | 2292 |
| 512 | Ga0207640_10611943 | 3300025981 | Bacteria | 924 |
| 513 | Ga0207640_11786048 | 3300025981 | Bacteria | 556 |
| 514 | Ga0207658_10002262 | 3300025986 | Bacteria | 14246 |
| 515 | Ga0207677_10002332 | 3300026023 | Bacteria | 9960 |
| 516 | Ga0207703_10019334 | 3300026035 | Bacteria | 5321 |
| 517 | Ga0207703_10309913 | 3300026035 | Bacteria | 1442 |
| 518 | Ga0207639_10012050 | 3300026041 | Bacteria | 6016 |
| 519 | Ga0207639_10105527 | 3300026041 | Bacteria | 2286 |
| 520 | Ga0207702_10160228 | 3300026078 | Bacteria | 2054 |
| 521 | Ga0207702_10359869 | 3300026078 | Bacteria | 1394 |
| 522 | Ga0207702_11066934 | 3300026078 | Bacteria | 802 |
| 523 | Ga0207702_11606273 | 3300026078 | Bacteria | 643 |
| 524 | Ga0207641_10009791 | 3300026088 | Bacteria | 7890 |
| 525 | Ga0207676_10656343 | 3300026095 | Bacteria | 1013 |
| 526 | Ga0207674_10736768 | 3300026116 | Bacteria | 951 |
| 527 | Ga0207683_10245585 | 3300026121 | Bacteria | 1633 |
| 528 | Ga0207683_10245955 | 3300026121 | Bacteria | 1632 |
| 529 | Ga0207698_10047616 | 3300026142 | Bacteria | 3250 |
| 530 | Ga0207698_10518860 | 3300026142 | Bacteria | 1162 |
| 531 | Ga0207698_11300448 | 3300026142 | Bacteria | 742 |
| 532 | Ga0207698_11360754 | 3300026142 | Bacteria | 725 |
| 533 | Ga0207698_12361088 | 3300026142 | Bacteria | 543 |
| 534 | Ga0268266_10036608 | 3300028379 | Bacteria | 4178 |
| 535 | Ga0268266_10060046 | 3300028379 | Bacteria | 3277 |
| 536 | Ga0268266_10669462 | 3300028379 | Bacteria | 999 |
| 537 | Ga0268265_10000156 | 3300028380 | Bacteria | 83798 |
| 538 | Ga0268265_10920323 | 3300028380 | Bacteria | 860 |
| 539 | Ga0268264_12460400 | 3300028381 | Bacteria | 526 |
| 540 | Ga0265337_1000049 | 3300028556 | Bacteria | 53677 |
| 541 | Ga0265337_1105293 | 3300028556 | Bacteria | 767 |
| 542 | Ga0265326_10000822 | 3300028558 | Bacteria | 11437 |
| 543 | Ga0265319_1000220 | 3300028563 | Bacteria | 42678 |
| 544 | Ga0265334_10000083 | 3300028573 | Bacteria | 67832 |
| 545 | Ga0265334_10057630 | 3300028573 | Bacteria | 1472 |
| 546 | Ga0265323_10050605 | 3300028653 | Bacteria | 1476 |
| 547 | Ga0265322_10004536 | 3300028654 | Bacteria | 4130 |
| 548 | Ga0265336_10001694 | 3300028666 | Bacteria | 9708 |
| 549 | Ga0307517_10138635 | 3300028786 | Bacteria | 1718 |
| 550 | Ga0307515_10465584 | 3300028794 | Bacteria | 878 |
| 551 | Ga0265338_10000358 | 3300028800 | Bacteria | 82643 |
| 552 | Ga0265338_10011876 | 3300028800 | Bacteria | 10003 |
| 553 | Ga0265338_10256202 | 3300028800 | Bacteria | 1288 |
| 554 | Ga0311011_142744 | 3300029280 | Bacteria | 606 |
| 555 | Ga0310981_1036808 | 3300029285 | Bacteria | 824 |
| 556 | Ga0265324_10001390 | 3300029957 | Bacteria | 13975 |
| 557 | Ga0307512_10008844 | 3300030522 | Bacteria | 9767 |
| 558 | Ga0316176_1099670 | 3300030732 | Bacteria | 577 |
| 559 | Ga0316180_1083427 | 3300030736 | Bacteria | 625 |
| 560 | Ga0265762_1049178 | 3300030760 | Bacteria | 842 |
| 561 | Ga0265763_1005592 | 3300030763 | Bacteria | 1059 |
| 562 | Ga0265767_119800 | 3300030836 | Bacteria | 505 |
| 563 | Ga0265766_1010927 | 3300030863 | Bacteria | 654 |
| 564 | Ga0265761_101567 | 3300030889 | Bacteria | 1014 |
| 565 | Ga0265761_102151 | 3300030889 | Bacteria | 907 |
| 566 | Ga0265761_104400 | 3300030889 | Bacteria | 716 |
| 567 | Ga0265768_116295 | 3300030963 | Bacteria | 521 |
| 568 | Ga0265760_10247674 | 3300031090 | Bacteria | 616 |
| 569 | Ga0265332_10000675 | 3300031238 | Bacteria | 21963 |
| 570 | Ga0265320_10003833 | 3300031240 | Bacteria | 9974 |
| 571 | Ga0265320_10033393 | 3300031240 | Bacteria | 2627 |
| 572 | Ga0265325_10005613 | 3300031241 | Bacteria | 7724 |
| 573 | Ga0265325_10006148 | 3300031241 | Bacteria | 7327 |
| 574 | Ga0265329_10118335 | 3300031242 | Bacteria | 849 |
| 575 | Ga0265340_10000796 | 3300031247 | Bacteria | 17872 |
| 576 | Ga0265340_10007408 | 3300031247 | Bacteria | 5957 |
| 577 | Ga0265339_10013888 | 3300031249 | Bacteria | 4872 |
| 578 | Ga0265339_10090109 | 3300031249 | Bacteria | 1608 |
| 579 | Ga0265331_10244502 | 3300031250 | Bacteria | 805 |
| 580 | Ga0265316_10007400 | 3300031344 | Bacteria | 10348 |
| 581 | Ga0265316_10307515 | 3300031344 | Bacteria | 1154 |
| 582 | Ga0307513_10022677 | 3300031456 | Bacteria | 7367 |
| 583 | Ga0307513_10097294 | 3300031456 | Bacteria | 2978 |
| 584 | Ga0307509_10012707 | 3300031507 | Bacteria | 10038 |
| 585 | Ga0307408_100238013 | 3300031548 | Bacteria | 1495 |
| 586 | Ga0310117_109253 | 3300031592 | Bacteria | 1047 |
| 587 | Ga0310117_109454 | 3300031592 | Bacteria | 1035 |
| 588 | Ga0265313_10017464 | 3300031595 | Bacteria | 4076 |
| 589 | Ga0265313_10125043 | 3300031595 | Bacteria | 1118 |
| 590 | Ga0310103_104508 | 3300031614 | Bacteria | 1813 |
| 591 | Ga0310107_113542 | 3300031615 | Bacteria | 1038 |
| 592 | Ga0307508_10103681 | 3300031616 | Bacteria | 2441 |
| 593 | Ga0307508_10344052 | 3300031616 | Bacteria | 1083 |
| 594 | Ga0307508_10506916 | 3300031616 | Bacteria | 802 |
| 595 | Ga0310115_115158 | 3300031635 | Bacteria | 825 |
| 596 | Ga0310111_115972 | 3300031667 | Bacteria | 940 |
| 597 | Ga0310119_113302 | 3300031686 | Bacteria | 954 |
| 598 | Ga0310101_123079 | 3300031690 | Bacteria | 590 |
| 599 | Ga0316579_10071976 | 3300031691 | Bacteria | 1639 |
| 600 | Ga0316579_10237329 | 3300031691 | Bacteria | 882 |
| 601 | Ga0265314_10008203 | 3300031711 | Bacteria | 8980 |
| 602 | Ga0265314_10039636 | 3300031711 | Bacteria | 3390 |
| 603 | Ga0265342_10029921 | 3300031712 | Bacteria | 3378 |
| 604 | Ga0265342_10048760 | 3300031712 | Bacteria | 2537 |
| 605 | Ga0316576_10003193 | 3300031727 | Bacteria | 9553 |
| 606 | Ga0316576_10003776 | 3300031727 | Bacteria | 8950 |
| 607 | Ga0316576_10030080 | 3300031727 | Bacteria | 3842 |
| 608 | Ga0316578_10010874 | 3300031728 | Bacteria | 4741 |
| 609 | Ga0316578_10034392 | 3300031728 | Bacteria | 2910 |
| 610 | Ga0316578_10082675 | 3300031728 | Bacteria | 1912 |
| 611 | Ga0307405_10537607 | 3300031731 | Bacteria | 943 |
| 612 | Ga0316045_120866 | 3300031815 | Bacteria | 626 |
| 613 | Ga0307413_10758429 | 3300031824 | Bacteria | 812 |
| 614 | Ga0307410_10217117 | 3300031852 | Bacteria | 1469 |
| 615 | Ga0307410_10745674 | 3300031852 | Bacteria | 829 |
| 616 | Ga0307406_10492953 | 3300031901 | Bacteria | 992 |
| 617 | Ga0307406_11387865 | 3300031901 | Bacteria | 615 |
| 618 | Ga0307406_11412873 | 3300031901 | Bacteria | 610 |
| 619 | Ga0307407_11118579 | 3300031903 | Bacteria | 613 |
| 620 | Ga0307409_100762549 | 3300031995 | Bacteria | 972 |
| 621 | Ga0307409_101233060 | 3300031995 | Bacteria | 772 |
| 622 | Ga0307409_102102266 | 3300031995 | Bacteria | 594 |
| 623 | Ga0316053_119119 | 3300032120 | Bacteria | 528 |
| 624 | Ga0307415_100045269 | 3300032126 | Bacteria | 2949 |
| 625 | Ga0307415_100976415 | 3300032126 | Bacteria | 786 |
| 626 | Ga0316585_10087974 | 3300032137 | Bacteria | 1014 |
| 627 | Ga0316593_10008571 | 3300032168 | Bacteria | 2854 |
| 628 | Ga0316593_10079969 | 3300032168 | Bacteria | 1140 |
| 629 | Ga0307507_10185206 | 3300033179 | Bacteria | 1478 |
| 630 | Ga0316596_1064193 | 3300033541 | Bacteria | 981 |
| 631 | Ga0316214_1000853 | 3300033545 | Bacteria | 3335 |
| 632 | Ga0316212_1007476 | 3300033547 | Bacteria | 1576 |
| 633 | Ga0373938_0006655 | 3300034957 | Bacteria | 2006 |
| 634 | Ga0373945_0166032 | 3300035116 | Bacteria | 902 |
| 635 | Ga0373953_0015877 | 3300035117 | Bacteria | 2739 |
| 636 | Ga0373954_0475062 | 3300035118 | Bacteria | 619 |
| 637 | Ga0316574_0002694 | 3300035398 | Bacteria | 8979 |
| 638 | Ga0316574_0021215 | 3300035398 | Bacteria | 3855 |
| 639 | Ga0373935_0084381 | 3300035692 | Bacteria | 2069 |
| 640 | Ga0373935_1118430 | 3300035692 | Bacteria | 586 |
| 641 | Ga0373933_0057955 | 3300035724 | Bacteria | 2329 |
| 642 | Ga0373933_0335038 | 3300035724 | Bacteria | 982 |
| 643 | Ga0373937_1945564 | 3300036401 | Bacteria | 534 |
| 644 | Ga0265778_036711 | 3300036457 | Bacteria | 646 |
| 645 | Ga0372808_003049 | 3300036459 | Bacteria | 2011 |
| 646 | Ga0310109_050305 | 3300036534 | Bacteria | 536 |
| 647 | Ga0310110_022287 | 3300036535 | Bacteria | 867 |
| 648 | Ga0316582_0022131 | 3300036647 | Bacteria | 3770 |
| 649 | Ga0316584_0007224 | 3300036712 | Bacteria | 7577 |
| 650 | Ga0316584_0975543 | 3300036712 | Bacteria | 567 |
| 651 | Ga0373925_0000004 | 3300037068 | Bacteria | 361597 |
| 652 | Ga0373925_0497909 | 3300037068 | Bacteria | 1000 |
| 653 | Ga0395899_0377735 | 3300037312 | Bacteria | 942 |
| 654 | Ga0395900_0201144 | 3300037418 | Bacteria | 2015 |
| 655 | Ga0395900_0286842 | 3300037418 | Bacteria | 1636 |
| 656 | Ga0395900_0389667 | 3300037418 | Bacteria | 1360 |
| 657 | Ga0395900_0652104 | 3300037418 | Bacteria | 989 |
| 658 | Ga0395898_0012144 | 3300037466 | Bacteria | 8913 |
| 659 | Ga0395898_0078143 | 3300037466 | Bacteria | 3193 |
| 660 | Ga0395898_0379339 | 3300037466 | Bacteria | 1348 |
| 661 | Ga0436364_0010700 | 3300037853 | Bacteria | 115369 |
| 662 | Ga0436364_0537875 | 3300037853 | Bacteria | 538 |
| 663 | Ga0436364_0741352 | 3300037853 | Bacteria | 4163 |
| 664 | Ga0395901_0068330 | 3300038443 | Bacteria | 3701 |
| 665 | Ga0395901_0096897 | 3300038443 | Bacteria | 3091 |
| 666 | Ga0395901_0220498 | 3300038443 | Bacteria | 1983 |
| 667 | Ga0395901_1574253 | 3300038443 | Bacteria | 611 |
| 668 | Ga0436365_1257400 | 3300039437 | Bacteria | 59519 |
| 669 | Ga0436363_1218733 | 3300039450 | Bacteria | 1372 |
| 670 | Ga0436363_1286402 | 3300039450 | Bacteria | 547 |
| 671 | Ga0436362_0337635 | 3300039453 | Bacteria | 717 |
| 672 | Ga0436362_0407008 | 3300039453 | Bacteria | 724 |
| 673 | Ga0436362_0792414 | 3300039453 | Bacteria | 1165 |
| 674 | Ga0436362_0962826 | 3300039453 | Bacteria | 530 |
| 675 | Ga0436362_1251521 | 3300039453 | Bacteria | 518 |
| 676 | Ga0439436_0033428 | 3300041404 | Bacteria | 1489 |
| 677 | Ga0439439_0013591 | 3300041406 | Bacteria | 1974 |
| 678 | Ga0439439_0022670 | 3300041406 | Bacteria | 1570 |
| 679 | Ga0439466_0141534 | 3300041411 | Bacteria | 738 |
| 680 | Ga0451793_0664496 | 3300041452 | Bacteria | 568 |
| 681 | Ga0451835_0283475 | 3300041492 | Bacteria | 582 |
| 682 | Ga0451853_2541022 | 3300041512 | Bacteria | 1303 |
| 683 | Ga0439433_0001269 | 3300041999 | Bacteria | 5211 |
| 684 | Ga0439449_0018354 | 3300042007 | Bacteria | 2625 |
| 685 | Ga0439449_0038483 | 3300042007 | Bacteria | 1778 |
| 686 | Ga0439449_0244300 | 3300042007 | Bacteria | 674 |
| 687 | Ga0439457_008613 | 3300042014 | Bacteria | 2399 |
| 688 | Ga0439457_020414 | 3300042014 | Bacteria | 1470 |
| 689 | Ga0439462_0006125 | 3300042015 | Bacteria | 2981 |
| 690 | Ga0439462_0255665 | 3300042015 | Bacteria | 504 |
| 691 | Ga0450920_022811 | 3300042122 | Bacteria | 1213 |
| 692 | Ga0450890_002547 | 3300042127 | Bacteria | 2497 |
| 693 | Ga0450894_005718 | 3300042131 | Bacteria | 1609 |
| 694 | Ga0450895_017014 | 3300042132 | Bacteria | 656 |
| 695 | Ga0450896_000102 | 3300042133 | Bacteria | 6144 |
| 696 | Ga0450898_008092 | 3300042134 | Bacteria | 1650 |
| 697 | Ga0450899_000622 | 3300042135 | Bacteria | 4036 |
| 698 | Ga0450906_008805 | 3300042145 | Bacteria | 1940 |
| 699 | Ga0450908_001340 | 3300042184 | Bacteria | 4776 |
| 700 | Ga0451577_0368442 | 3300042876 | Bacteria | 1303 |
| 701 | Ga0466969_0097189 | 3300044656 | Bacteria | 1389 |
| 702 | Ga0466969_0201131 | 3300044656 | Bacteria | 909 |
| 703 | Ga0466969_0324119 | 3300044656 | Bacteria | 697 |
| 704 | Ga0466969_0541224 | 3300044656 | Bacteria | 533 |
| 705 | Ga0466972_0007279 | 3300044658 | Bacteria | 5557 |
| 706 | Ga0466972_0154886 | 3300044658 | Bacteria | 1076 |
| 707 | Ga0466972_0236239 | 3300044658 | Bacteria | 855 |
| 708 | Ga0466972_0244282 | 3300044658 | Bacteria | 839 |
| 709 | Ga0466972_0304699 | 3300044658 | Bacteria | 744 |
| 710 | Ga0466965_0012176 | 3300044683 | Bacteria | 4042 |
| 711 | Ga0466965_0033398 | 3300044683 | Bacteria | 2514 |
| 712 | Ga0466965_0037716 | 3300044683 | Bacteria | 2373 |
| 713 | Ga0466965_0372340 | 3300044683 | Bacteria | 785 |
| 714 | Ga0466965_0419593 | 3300044683 | Bacteria | 741 |
| 715 | Ga0466965_0487085 | 3300044683 | Bacteria | 690 |
| 716 | Ga0466965_0616153 | 3300044683 | Bacteria | 617 |
| 717 | Ga0466965_0665373 | 3300044683 | Bacteria | 595 |
| 718 | Ga0466965_0946484 | 3300044683 | Bacteria | 504 |
| 719 | Ga0466966_0000383 | 3300044684 | Bacteria | 28757 |
| 720 | Ga0466966_0121744 | 3300044684 | Bacteria | 1602 |
| 721 | Ga0466966_0171555 | 3300044684 | Bacteria | 1318 |
| 722 | Ga0466966_0189226 | 3300044684 | Bacteria | 1247 |
| 723 | Ga0466966_0387250 | 3300044684 | Bacteria | 840 |
| 724 | Ga0466966_0597184 | 3300044684 | Bacteria | 664 |
| 725 | Ga0466961_0005440 | 3300044693 | Bacteria | 8027 |
| 726 | Ga0466961_0010285 | 3300044693 | Bacteria | 5963 |
| 727 | Ga0466961_0041150 | 3300044693 | Bacteria | 2962 |
| 728 | Ga0466961_0054451 | 3300044693 | Bacteria | 2552 |
| 729 | Ga0466961_0147544 | 3300044693 | Bacteria | 1470 |
| 730 | Ga0466961_0223557 | 3300044693 | Bacteria | 1160 |
| 731 | Ga0466961_0282666 | 3300044693 | Bacteria | 1015 |
| 732 | Ga0466961_0387733 | 3300044693 | Bacteria | 848 |
| 733 | Ga0466961_0398087 | 3300044693 | Bacteria | 836 |
| 734 | Ga0466961_0434621 | 3300044693 | Bacteria | 795 |
| 735 | Ga0466961_0501323 | 3300044693 | Bacteria | 733 |
| 736 | Ga0466961_0627642 | 3300044693 | Bacteria | 645 |
| 737 | Ga0466963_0009016 | 3300044694 | Bacteria | 5991 |
| 738 | Ga0466963_0016148 | 3300044694 | Bacteria | 4639 |
| 739 | Ga0466963_0182357 | 3300044694 | Bacteria | 1466 |
| 740 | Ga0466963_0201949 | 3300044694 | Bacteria | 1390 |
| 741 | Ga0466963_0358646 | 3300044694 | Bacteria | 1027 |
| 742 | Ga0466964_0011253 | 3300044706 | Bacteria | 3379 |
| 743 | Ga0466964_0076112 | 3300044706 | Bacteria | 1430 |
| 744 | Ga0466964_0102268 | 3300044706 | Bacteria | 1265 |
| 745 | Ga0466964_0201227 | 3300044706 | Bacteria | 956 |
| 746 | Ga0466964_0230707 | 3300044706 | Bacteria | 903 |
| 747 | Ga0466964_0340009 | 3300044706 | Bacteria | 768 |
| 748 | Ga0466964_0697825 | 3300044706 | Bacteria | 565 |
| 749 | Ga0466971_0001406 | 3300044719 | Bacteria | 10109 |
| 750 | Ga0466971_0009870 | 3300044719 | Bacteria | 4169 |
| 751 | Ga0466971_0224100 | 3300044719 | Bacteria | 892 |
| 752 | Ga0466971_0378482 | 3300044719 | Bacteria | 688 |
| 753 | Ga0466968_0000486 | 3300044735 | Bacteria | 13428 |
| 754 | Ga0466968_0030625 | 3300044735 | Bacteria | 2229 |
| 755 | Ga0466968_0131704 | 3300044735 | Bacteria | 1138 |
| 756 | Ga0466968_0249869 | 3300044735 | Bacteria | 842 |
| 757 | Ga0466968_0647202 | 3300044735 | Bacteria | 536 |
| 758 | Ga0466970_0003384 | 3300044765 | Bacteria | 7764 |
| 759 | Ga0466970_0007149 | 3300044765 | Bacteria | 5589 |
| 760 | Ga0466970_0018820 | 3300044765 | Bacteria | 3577 |
| 761 | Ga0466970_0031860 | 3300044765 | Bacteria | 2785 |
| 762 | Ga0466970_0107886 | 3300044765 | Bacteria | 1519 |
| 763 | Ga0466970_0273099 | 3300044765 | Bacteria | 950 |
| 764 | Ga0466957_0001751 | 3300044842 | Bacteria | 11414 |
| 765 | Ga0466957_0008706 | 3300044842 | Bacteria | 5781 |
| 766 | Ga0466957_0009243 | 3300044842 | Bacteria | 5623 |
| 767 | Ga0466957_0112320 | 3300044842 | Bacteria | 1729 |
| 768 | Ga0466957_0334200 | 3300044842 | Bacteria | 1025 |
| 769 | Ga0466957_0554770 | 3300044842 | Bacteria | 801 |
| 770 | Ga0466957_1163218 | 3300044842 | Bacteria | 557 |
| 771 | Ga0466960_0003887 | 3300044901 | Bacteria | 5793 |
| 772 | Ga0466960_0027272 | 3300044901 | Bacteria | 2603 |
| 773 | Ga0466960_0038077 | 3300044901 | Bacteria | 2259 |
| 774 | Ga0466960_0054879 | 3300044901 | Bacteria | 1936 |
| 775 | Ga0466960_0166223 | 3300044901 | Bacteria | 1188 |
| 776 | Ga0466960_0281435 | 3300044901 | Bacteria | 932 |
| 777 | Ga0466960_0557895 | 3300044901 | Bacteria | 676 |
| 778 | Ga0466960_0880029 | 3300044901 | Bacteria | 545 |
| 779 | Ga0466959_0017822 | 3300045049 | Bacteria | 5209 |
| 780 | Ga0466959_0045060 | 3300045049 | Bacteria | 3249 |
| 781 | Ga0466959_0056983 | 3300045049 | Bacteria | 2850 |
| 782 | Ga0466959_0116146 | 3300045049 | Bacteria | 1906 |
| 783 | Ga0466959_0130095 | 3300045049 | Bacteria | 1784 |
| 784 | Ga0466959_0172941 | 3300045049 | Bacteria | 1514 |
| 785 | Ga0466959_0359411 | 3300045049 | Bacteria | 992 |
| 786 | Ga0466959_0741762 | 3300045049 | Bacteria | 657 |
| 787 | Ga0466958_0000206 | 3300045836 | Bacteria | 21886 |
| 788 | Ga0466958_0007393 | 3300045836 | Bacteria | 6040 |
| 789 | Ga0466958_0012657 | 3300045836 | Bacteria | 4782 |
| 790 | Ga0466958_0182407 | 3300045836 | Bacteria | 1332 |
| 791 | Ga0466967_0045336 | 3300045976 | Bacteria | 3819 |
| 792 | Ga0466967_0064388 | 3300045976 | Bacteria | 3260 |
| 793 | Ga0466967_0414451 | 3300045976 | Bacteria | 1312 |
| 794 | Ga0466967_0479045 | 3300045976 | Bacteria | 1219 |
| 795 | Ga0466967_0574241 | 3300045976 | Bacteria | 1111 |
| 796 | Ga0466967_0617936 | 3300045976 | Bacteria | 1070 |
| 797 | Ga0466967_0678173 | 3300045976 | Bacteria | 1020 |
| 798 | Ga0466967_0863223 | 3300045976 | Bacteria | 899 |
| 799 | Ga0466967_1558375 | 3300045976 | Bacteria | 658 |
| 800 | Ga0466967_1762032 | 3300045976 | Bacteria | 617 |
| 801 | Ga0466967_1845408 | 3300045976 | Bacteria | 601 |
| 802 | Ga0495592_0007064 | 3300046454 | Bacteria | 8400 |
| 803 | Ga0495592_0065762 | 3300046454 | Bacteria | 2653 |
| 804 | Ga0495592_0295064 | 3300046454 | Bacteria | 1055 |
| 805 | Ga0495603_0216725 | 3300046455 | Bacteria | 1104 |
| 806 | Ga0495603_0307456 | 3300046455 | Bacteria | 910 |
| 807 | Ga0495590_0012257 | 3300046457 | Bacteria | 3184 |
| 808 | Ga0495629_0136009 | 3300046459 | Bacteria | 1711 |
| 809 | Ga0495629_0856227 | 3300046459 | Bacteria | 597 |
| 810 | Ga0495638_0266682 | 3300046460 | Bacteria | 936 |
| 811 | Ga0495641_0046104 | 3300046461 | Bacteria | 2005 |
| 812 | Ga0495641_0087695 | 3300046461 | Bacteria | 1392 |
| 813 | Ga0495651_0000169 | 3300046462 | Bacteria | 48128 |
| 814 | Ga0495651_0001372 | 3300046462 | Bacteria | 18867 |
| 815 | Ga0495651_0015125 | 3300046462 | Bacteria | 5963 |
| 816 | Ga0495651_0807383 | 3300046462 | Bacteria | 578 |
| 817 | Ga0495653_0122937 | 3300046463 | Bacteria | 1846 |
| 818 | Ga0495580_0007502 | 3300046472 | Bacteria | 8764 |
| 819 | Ga0495582_0474268 | 3300046473 | Bacteria | 723 |
| 820 | Ga0495605_0047498 | 3300046474 | Bacteria | 2105 |
| 821 | Ga0495662_0000096 | 3300046476 | Bacteria | 32069 |
| 822 | Ga0495662_0293132 | 3300046476 | Bacteria | 800 |
| 823 | Ga0495664_0002322 | 3300046477 | Bacteria | 10191 |
| 824 | Ga0495664_0122341 | 3300046477 | Bacteria | 1573 |
| 825 | Ga0495585_0070600 | 3300046492 | Bacteria | 1904 |
| 826 | Ga0495594_0011474 | 3300046499 | Bacteria | 4606 |
| 827 | Ga0495594_0161811 | 3300046499 | Bacteria | 1273 |
| 828 | Ga0495596_0003837 | 3300046500 | Bacteria | 7470 |
| 829 | Ga0495607_0004843 | 3300046501 | Bacteria | 9815 |
| 830 | Ga0495583_0009440 | 3300046506 | Bacteria | 5825 |
| 831 | Ga0495583_0418750 | 3300046506 | Bacteria | 525 |
| 832 | Ga0495606_0010501 | 3300046507 | Bacteria | 7671 |
| 833 | Ga0495608_0002713 | 3300046511 | Bacteria | 12721 |
| 834 | Ga0495608_0067863 | 3300046511 | Bacteria | 2332 |
| 835 | Ga0495610_0074796 | 3300046512 | Bacteria | 1570 |
| 836 | Ga0495618_0017866 | 3300046514 | Bacteria | 4352 |
| 837 | Ga0495618_0517844 | 3300046514 | Bacteria | 717 |
| 838 | Ga0495620_0068552 | 3300046515 | Bacteria | 1456 |
| 839 | Ga0495628_0002207 | 3300046516 | Bacteria | 17611 |
| 840 | Ga0495628_0016156 | 3300046516 | Bacteria | 6228 |
| 841 | Ga0495628_0140174 | 3300046516 | Bacteria | 1845 |
| 842 | Ga0495630_0002424 | 3300046517 | Bacteria | 12922 |
| 843 | Ga0495630_0868987 | 3300046517 | Bacteria | 687 |
| 844 | Ga0495631_0038283 | 3300046518 | Bacteria | 2132 |
| 845 | Ga0495637_0103270 | 3300046520 | Bacteria | 1111 |
| 846 | Ga0495643_0001180 | 3300046522 | Bacteria | 25444 |
| 847 | Ga0495644_0276459 | 3300046523 | Bacteria | 655 |
| 848 | Ga0495644_0379260 | 3300046523 | Bacteria | 558 |
| 849 | Ga0495648_0024720 | 3300046524 | Bacteria | 4081 |
| 850 | Ga0495648_0054915 | 3300046524 | Bacteria | 2403 |
| 851 | Ga0495666_0000307 | 3300046526 | Bacteria | 21312 |
| 852 | Ga0495652_0010757 | 3300046529 | Bacteria | 8291 |
| 853 | Ga0495652_0013442 | 3300046529 | Bacteria | 7367 |
| 854 | Ga0495652_0018548 | 3300046529 | Bacteria | 6202 |
| 855 | Ga0495654_0003279 | 3300046530 | Bacteria | 9982 |
| 856 | Ga0495665_0001543 | 3300046531 | Bacteria | 12285 |
| 857 | Ga0495665_0032438 | 3300046531 | Bacteria | 2794 |
| 858 | Ga0495665_0226066 | 3300046531 | Bacteria | 967 |
| 859 | Ga0495640_0002906 | 3300046533 | Bacteria | 13796 |
| 860 | Ga0495640_0400265 | 3300046533 | Bacteria | 843 |
| 861 | Ga0495640_0743072 | 3300046533 | Bacteria | 587 |
| 862 | Ga0495587_0001703 | 3300046536 | Bacteria | 14685 |
| 863 | Ga0495587_0413588 | 3300046536 | Bacteria | 749 |
| 864 | Ga0495598_0125405 | 3300046537 | Bacteria | 875 |
| 865 | Ga0495609_0009614 | 3300046538 | Bacteria | 4672 |
| 866 | Ga0495621_0147796 | 3300046539 | Bacteria | 923 |
| 867 | Ga0495597_0052969 | 3300046542 | Bacteria | 1785 |
| 868 | Ga0495645_0002261 | 3300046543 | Bacteria | 13098 |
| 869 | Ga0495645_0020520 | 3300046543 | Bacteria | 4769 |
| 870 | Ga0495622_0031757 | 3300046557 | Bacteria | 2466 |
| 871 | Ga0495622_0265234 | 3300046557 | Bacteria | 753 |
| 872 | Ga0495633_0014557 | 3300046558 | Bacteria | 4107 |
| 873 | Ga0495667_0028951 | 3300046559 | Bacteria | 3728 |
| 874 | Ga0495667_0056543 | 3300046559 | Bacteria | 2580 |
| 875 | Ga0495667_0290983 | 3300046559 | Bacteria | 1036 |
| 876 | Ga0495667_0667388 | 3300046559 | Bacteria | 645 |
| 877 | Ga0495656_0042504 | 3300046615 | Bacteria | 1903 |
| 878 | Ga0495656_0050533 | 3300046615 | Bacteria | 1776 |
| 879 | Ga0495668_0001638 | 3300046616 | Bacteria | 20892 |
| 880 | Ga0495634_0007090 | 3300046642 | Bacteria | 8452 |
| 881 | Ga0495634_0024406 | 3300046642 | Bacteria | 4242 |
| 882 | Ga0495611_0009288 | 3300046648 | Bacteria | 4151 |
| 883 | Ga0495625_0006809 | 3300046660 | Bacteria | 10098 |
| 884 | Ga0495625_0049329 | 3300046660 | Bacteria | 3026 |
| 885 | Ga0495625_0592391 | 3300046660 | Bacteria | 666 |
| 886 | Ga0495635_0005159 | 3300046663 | Bacteria | 9093 |
| 887 | Ga0495635_0098521 | 3300046663 | Bacteria | 1998 |
| 888 | Ga0495661_0090733 | 3300046665 | Bacteria | 1738 |
| 889 | Ga0495657_0005637 | 3300046675 | Bacteria | 9879 |
| 890 | Ga0495657_0047630 | 3300046675 | Bacteria | 2896 |
| 891 | Ga0495657_0088733 | 3300046675 | Bacteria | 1987 |
| 892 | Ga0495599_0007801 | 3300046678 | Bacteria | 6496 |
| 893 | Ga0495599_0018530 | 3300046678 | Bacteria | 4337 |
| 894 | Ga0495599_0221149 | 3300046678 | Bacteria | 1158 |
| 895 | Ga0495599_0328383 | 3300046678 | Bacteria | 920 |
| 896 | Ga0495623_0010498 | 3300046679 | Bacteria | 5994 |
| 897 | Ga0495646_0088466 | 3300046680 | Bacteria | 1793 |
| 898 | Ga0495646_0121733 | 3300046680 | Bacteria | 1476 |
| 899 | Ga0495647_0109875 | 3300046681 | Bacteria | 1150 |
| 900 | Ga0495658_0029856 | 3300046683 | Bacteria | 2955 |
| 901 | Ga0495658_0073694 | 3300046683 | Bacteria | 1988 |
| 902 | Ga0495613_0005309 | 3300046689 | Bacteria | 9676 |
| 903 | Ga0495613_0839668 | 3300046689 | Bacteria | 597 |
| 904 | Ga0495624_0042222 | 3300046690 | Bacteria | 2914 |
| 905 | Ga0495649_0077694 | 3300046694 | Bacteria | 1776 |
| 906 | Ga0495589_0074826 | 3300046794 | Bacteria | 1651 |
| 907 | Ga0495600_0002715 | 3300046809 | Bacteria | 10238 |
| 908 | Ga0495600_0011482 | 3300046809 | Bacteria | 5520 |
| 909 | Ga0495600_0339868 | 3300046809 | Bacteria | 941 |
| 910 | Ga0495660_0045943 | 3300046810 | Bacteria | 2395 |
| 911 | Ga0495581_0015465 | 3300047315 | Bacteria | 4430 |
| 912 | Ga0495581_0205410 | 3300047315 | Bacteria | 1152 |
| 913 | Ga0495581_0242218 | 3300047315 | Bacteria | 1054 |
| 914 | Ga0495604_0002362 | 3300047317 | Bacteria | 15139 |
| 915 | Ga0495604_0198955 | 3300047317 | Bacteria | 1391 |
| 916 | Ga0495636_0350808 | 3300047318 | Bacteria | 696 |
| 917 | Ga0495636_0570312 | 3300047318 | Bacteria | 551 |
| 918 | Ga0495674_0026033 | 3300047319 | Bacteria | 5353 |
| 919 | Ga0495674_0158431 | 3300047319 | Bacteria | 1895 |
| 920 | Ga0495674_0230718 | 3300047319 | Bacteria | 1528 |
| 921 | Ga0495674_0458138 | 3300047319 | Bacteria | 1024 |
| 922 | Ga0495674_0798347 | 3300047319 | Bacteria | 734 |
| 923 | Ga0495672_0029562 | 3300047320 | Bacteria | 3449 |
| 924 | Ga0495672_0493891 | 3300047320 | Bacteria | 545 |
| 925 | Ga0495676_0153676 | 3300047321 | Bacteria | 1634 |
| 926 | Ga0495676_0346616 | 3300047321 | Bacteria | 993 |
| 927 | Ga0495676_0878541 | 3300047321 | Bacteria | 575 |
| 928 | Ga0495680_0258306 | 3300047322 | Bacteria | 1232 |
| 929 | Ga0495680_0314129 | 3300047322 | Bacteria | 1098 |
| 930 | Ga0495683_0008496 | 3300047323 | Bacteria | 5492 |
| 931 | Ga0495683_0009389 | 3300047323 | Bacteria | 5212 |
| 932 | Ga0495675_0005831 | 3300047444 | Bacteria | 7524 |
| 933 | Ga0495675_0048524 | 3300047444 | Bacteria | 2700 |
| 934 | Ga0495677_0116537 | 3300047445 | Bacteria | 1017 |
| 935 | Ga0495679_052439 | 3300047446 | Bacteria | 1220 |
| 936 | Ga0495685_105446 | 3300047447 | Bacteria | 929 |
| 937 | Ga0495681_0057526 | 3300047470 | Bacteria | 1805 |
| 938 | Ga0495681_0341214 | 3300047470 | Bacteria | 571 |
| 939 | Ga0495684_0012770 | 3300047471 | Bacteria | 6480 |
| 940 | Ga0495684_0178913 | 3300047471 | Bacteria | 1573 |
| 941 | Ga0495684_0239299 | 3300047471 | Bacteria | 1325 |
| 942 | Ga0495686_0016607 | 3300047472 | Bacteria | 4987 |
| 943 | Ga0495593_0004470 | 3300047673 | Bacteria | 8309 |
| 944 | Ga0495593_0009251 | 3300047673 | Bacteria | 5715 |
| 945 | Ga0495593_0494119 | 3300047673 | Bacteria | 613 |
| 946 | Ga0495602_0013431 | 3300048088 | Bacteria | 8370 |
| 947 | Ga0495602_0915814 | 3300048088 | Bacteria | 583 |
| 948 | Ga0495614_0081925 | 3300048089 | Bacteria | 1398 |
| 949 | Ga0495615_0085372 | 3300048090 | Bacteria | 872 |
| 950 | Ga0495615_0150865 | 3300048090 | Bacteria | 692 |
| 951 | Ga0495626_0002897 | 3300048091 | Bacteria | 11430 |
| 952 | Ga0495626_0014129 | 3300048091 | Bacteria | 4129 |
| 953 | Ga0496100_0434567 | 3300048903 | Bacteria | 1004 |
| 954 | Ga0496100_0726312 | 3300048903 | Bacteria | 776 |
| 955 | Ga0496102_0153859 | 3300048905 | Bacteria | 2162 |
| 956 | Ga0496102_0251664 | 3300048905 | Bacteria | 1666 |
| 957 | Ga0496103_0161226 | 3300048906 | Bacteria | 1438 |
| 958 | Ga0496104_0089127 | 3300048907 | Bacteria | 2947 |
| 959 | Ga0496104_0138327 | 3300048907 | Bacteria | 2340 |
| 960 | Ga0496104_0215285 | 3300048907 | Bacteria | 1833 |
| 961 | Ga0496104_0466077 | 3300048907 | Bacteria | 1175 |
| 962 | Ga0496104_0571587 | 3300048907 | Bacteria | 1041 |
| 963 | Ga0496104_1780769 | 3300048907 | Bacteria | 518 |
| 964 | Ga0496105_0059980 | 3300048908 | Bacteria | 3139 |
| 965 | Ga0496105_0083619 | 3300048908 | Bacteria | 2636 |
| 966 | Ga0496105_0259952 | 3300048908 | Bacteria | 1404 |
| 967 | Ga0496105_0664833 | 3300048908 | Bacteria | 803 |
| 968 | Ga0496107_0253576 | 3300048910 | Bacteria | 1309 |
| 969 | Ga0496108_0094197 | 3300048911 | Bacteria | 2549 |
| 970 | Ga0496108_0352911 | 3300048911 | Bacteria | 1283 |
| 971 | Ga0496109_0195452 | 3300048912 | Bacteria | 1901 |
| 972 | Ga0496109_1195684 | 3300048912 | Bacteria | 697 |
| 973 | Ga0496110_0001862 | 3300048913 | Bacteria | 15584 |
| 974 | Ga0496110_0124579 | 3300048913 | Bacteria | 2324 |
| 975 | Ga0496110_1016179 | 3300048913 | Bacteria | 737 |
| 976 | Ga0496110_1276380 | 3300048913 | Bacteria | 643 |
| 977 | Ga0496111_0020580 | 3300048914 | Bacteria | 4594 |
| 978 | Ga0496111_0125391 | 3300048914 | Bacteria | 1898 |
| 979 | Ga0496111_0201873 | 3300048914 | Bacteria | 1478 |
| 980 | Ga0496112_0343000 | 3300048915 | Bacteria | 1437 |
| 981 | Ga0496112_0350909 | 3300048915 | Bacteria | 1418 |
| 982 | Ga0496112_0419013 | 3300048915 | Bacteria | 1278 |
| 983 | Ga0496112_0556047 | 3300048915 | Bacteria | 1081 |
| 984 | Ga0496113_0394154 | 3300048916 | Bacteria | 1111 |
| 985 | Ga0496114_0400759 | 3300048917 | Bacteria | 1215 |
| 986 | Ga0496114_0655080 | 3300048917 | Bacteria | 923 |
| 987 | Ga0496114_0761891 | 3300048917 | Bacteria | 845 |
| 988 | Ga0496115_0268221 | 3300048918 | Bacteria | 1403 |
| 989 | Ga0496115_0892587 | 3300048918 | Bacteria | 686 |
| 990 | Ga0496116_0001739 | 3300048919 | Bacteria | 23720 |
| 991 | Ga0496117_0021752 | 3300048920 | Bacteria | 5175 |
| 992 | Ga0496118_0011170 | 3300048921 | Bacteria | 8795 |
| 993 | Ga0496118_0013367 | 3300048921 | Bacteria | 7771 |
| 994 | Ga0496118_0046340 | 3300048921 | Bacteria | 3384 |
| 995 | Ga0496119_0000855 | 3300048922 | Bacteria | 40135 |
| 996 | Ga0496119_0009028 | 3300048922 | Bacteria | 8645 |
| 997 | Ga0496119_0013889 | 3300048922 | Bacteria | 6356 |
| 998 | Ga0496119_0095006 | 3300048922 | Bacteria | 1685 |
| 999 | Ga0496119_0108730 | 3300048922 | Bacteria | 1543 |
| 1000 | Ga0496119_0213356 | 3300048922 | Bacteria | 992 |
| 1001 | Ga0496120_0000372 | 3300048923 | Bacteria | 72951 |
| 1002 | Ga0496120_0192930 | 3300048923 | Bacteria | 992 |
| 1003 | Ga0496120_0268798 | 3300048923 | Bacteria | 793 |
| 1004 | Ga0496120_0400801 | 3300048923 | Bacteria | 606 |
| 1005 | Ga0496121_0012636 | 3300048924 | Bacteria | 9173 |
| 1006 | Ga0496121_0017835 | 3300048924 | Bacteria | 7209 |
| 1007 | Ga0496121_0040377 | 3300048924 | Bacteria | 4095 |
| 1008 | Ga0496123_0361362 | 3300048926 | Bacteria | 672 |
| 1009 | Ga0496125_0258633 | 3300048928 | Bacteria | 1093 |
| 1010 | Ga0496126_0046941 | 3300048929 | Bacteria | 3956 |
| 1011 | Ga0496126_0186755 | 3300048929 | Bacteria | 1757 |
| 1012 | Ga0496126_0563945 | 3300048929 | Bacteria | 902 |
| 1013 | Ga0496126_0997735 | 3300048929 | Bacteria | 628 |
| 1014 | Ga0496126_1155865 | 3300048929 | Bacteria | 572 |
| 1015 | Ga0501306_002889 | 3300049127 | Bacteria | 1805 |
| 1016 | Ga0501306_093857 | 3300049127 | Bacteria | 530 |
| 1017 | Ga0501308_000276 | 3300049128 | Bacteria | 3066 |
| 1018 | Ga0501309_025458 | 3300049129 | Bacteria | 850 |
| 1019 | Ga0501310_015638 | 3300049130 | Bacteria | 902 |
| 1020 | Ga0501304_005680 | 3300049160 | Bacteria | 984 |
| 1021 | Ga0501305_024295 | 3300049161 | Bacteria | 912 |
| 1022 | Ga0501307_000101 | 3300049162 | Bacteria | 3967 |
| 1023 | Ga0495678_011561 | 3300049459 | Bacteria | 4220 |
| 1024 | Ga0495682_0090884 | 3300049460 | Bacteria | 1096 |
| 1025 | Ga0501311_065545 | 3300049527 | Bacteria | 594 |
| 1026 | Ga0501312_048349 | 3300049528 | Bacteria | 712 |
| 1027 | Ga0501316_026744 | 3300049532 | Bacteria | 756 |
| 1028 | Ga0501316_073835 | 3300049532 | Bacteria | 520 |
| 1029 | Ga0501317_000812 | 3300049533 | Bacteria | 2422 |
| 1030 | Ga0501317_014549 | 3300049533 | Bacteria | 998 |
| 1031 | Ga0501317_066142 | 3300049533 | Bacteria | 602 |
| 1032 | Ga0501318_047129 | 3300049534 | Bacteria | 631 |
| 1033 | Ga0501322_013198 | 3300049538 | Bacteria | 664 |
| 1034 | Ga0501325_026113 | 3300049541 | Bacteria | 645 |
| 1035 | Ga0501326_02682 | 3300049542 | Bacteria | 886 |
| 1036 | Ga0501031_0076041 | 3300049568 | Bacteria | 2186 |
| 1037 | Ga0501032_1063669 | 3300049569 | Bacteria | 507 |
| 1038 | Ga0501033_0014092 | 3300049570 | Bacteria | 6079 |
| 1039 | Ga0501034_0027993 | 3300049571 | Bacteria | 5731 |
| 1040 | Ga0501034_0193563 | 3300049571 | Bacteria | 1995 |
| 1041 | Ga0501034_1107795 | 3300049571 | Bacteria | 672 |
| 1042 | Ga0501034_1352442 | 3300049571 | Bacteria | 588 |
| 1043 | Ga0501036_0027287 | 3300049572 | Bacteria | 4824 |
| 1044 | Ga0501036_1476200 | 3300049572 | Bacteria | 550 |
| 1045 | Ga0501037_0618337 | 3300049573 | Bacteria | 726 |
| 1046 | Ga0501038_0539128 | 3300049574 | Bacteria | 888 |
| 1047 | Ga0501040_0006258 | 3300049576 | Bacteria | 7727 |
| 1048 | Ga0501043_0023095 | 3300049579 | Bacteria | 4878 |
| 1049 | Ga0501046_0522737 | 3300049580 | Bacteria | 848 |
| 1050 | Ga0501047_0023199 | 3300049581 | Bacteria | 5958 |
| 1051 | Ga0501047_0109201 | 3300049581 | Bacteria | 2649 |
| 1052 | Ga0501047_0248456 | 3300049581 | Bacteria | 1628 |
| 1053 | Ga0501047_0361296 | 3300049581 | Bacteria | 1288 |
| 1054 | Ga0501067_0815538 | 3300049583 | Bacteria | 526 |
| 1055 | Ga0501070_0006424 | 3300049586 | Bacteria | 10005 |
| 1056 | Ga0501070_0018699 | 3300049586 | Bacteria | 5813 |
| 1057 | Ga0501070_0166769 | 3300049586 | Bacteria | 1815 |
| 1058 | Ga0501070_0227045 | 3300049586 | Bacteria | 1530 |
| 1059 | Ga0501070_0328045 | 3300049586 | Bacteria | 1244 |
| 1060 | Ga0501070_0481253 | 3300049586 | Bacteria | 998 |
| 1061 | Ga0501070_0695643 | 3300049586 | Bacteria | 804 |
| 1062 | Ga0501070_1510886 | 3300049586 | Bacteria | 508 |
| 1063 | Ga0501073_0072398 | 3300049589 | Bacteria | 2400 |
| 1064 | Ga0501074_0002630 | 3300049590 | Bacteria | 12572 |
| 1065 | Ga0501243_082740 | 3300049675 | Bacteria | 627 |
| 1066 | Ga0501079_0001234 | 3300049741 | Bacteria | 17906 |
| 1067 | Ga0501080_0039768 | 3300049742 | Bacteria | 4388 |
| 1068 | Ga0501080_0173230 | 3300049742 | Bacteria | 1989 |
| 1069 | Ga0501080_0449416 | 3300049742 | Bacteria | 1155 |
| 1070 | Ga0501080_1871846 | 3300049742 | Bacteria | 503 |
| 1071 | Ga0501035_0045392 | 3300049822 | Bacteria | 3953 |
| 1072 | Ga0501035_0341597 | 3300049822 | Bacteria | 1254 |
| 1073 | Ga0501044_0038405 | 3300049823 | Bacteria | 4999 |
| 1074 | Ga0501044_0088185 | 3300049823 | Bacteria | 3132 |
| 1075 | Ga0501044_0618549 | 3300049823 | Bacteria | 975 |
| 1076 | Ga0501045_0242225 | 3300049824 | Bacteria | 1342 |
| 1077 | nmdc:mga0yw44_45501_c1 | 3300050492 | Bacteria | 2017 |
| 1078 | nmdc:mga05p37_162208_c1 | 3300050507 | Bacteria | 2729 |
| 1079 | nmdc:mga05p37_231129_c1 | 3300050507 | Bacteria | 2228 |
| 1080 | nmdc:mga05p37_363629_c1 | 3300050507 | Bacteria | 1700 |
| 1081 | nmdc:mga05p37_5679_c1 | 3300050507 | Bacteria | 14665 |
| 1082 | nmdc:mga05p37_93825_c1 | 3300050507 | Bacteria | 3698 |
| 1083 | nmdc:mga09592_1450919_c1 | 3300050508 | Bacteria | 560 |
| 1084 | nmdc:mga09592_155694_c1 | 3300050508 | Bacteria | 1972 |
| 1085 | nmdc:mga09592_334103_c1 | 3300050508 | Bacteria | 1312 |
| 1086 | nmdc:mga0qj67_2506_c1 | 3300050509 | Bacteria | 13106 |
| 1087 | nmdc:mga0qj67_70050_c1 | 3300050509 | Bacteria | 2797 |
| 1088 | nmdc:mga06r32_1592375_c1 | 3300050510 | Bacteria | 592 |
| 1089 | nmdc:mga06r32_193463_c1 | 3300050510 | Bacteria | 2021 |
| 1090 | nmdc:mga0n895_316660_c1 | 3300050512 | Bacteria | 1581 |
| 1091 | nmdc:mga0rr50_219225_c1 | 3300050513 | Bacteria | 1050 |
| 1092 | Ga0495601_0010241 | 3300053077 | Bacteria | 5575 |
| 1093 | Ga0495601_0028869 | 3300053077 | Bacteria | 3438 |
| 1094 | Ga0495601_0080406 | 3300053077 | Bacteria | 2091 |
| 1095 | Ga0495612_0016852 | 3300053078 | Bacteria | 2927 |
| 1096 | Ga0495619_0098160 | 3300053085 | Bacteria | 1991 |
| 1097 | Ga0495619_0416108 | 3300053085 | Bacteria | 927 |
| 1098 | Ga0500583_0011796 | 3300053092 | Bacteria | 3309 |
| 1099 | Ga0500654_115131 | 3300053099 | Bacteria | 1083 |
| 1100 | Ga0500660_129288 | 3300053100 | Bacteria | 1031 |
| 1101 | Ga0500628_070191 | 3300053129 | Bacteria | 876 |
| 1102 | Ga0500577_0001143 | 3300053142 | Bacteria | 6808 |
| 1103 | Ga0500616_0132586 | 3300053153 | Bacteria | 1175 |
| 1104 | Ga0501084_0120390 | 3300054114 | Bacteria | 2207 |
| 1105 | Ga0587084_066412 | 3300059477 | Bacteria | 672 |
| 1106 | Ga0587093_019083 | 3300059478 | Bacteria | 900 |
| 1107 | Ga0587066_089645 | 3300059490 | Bacteria | 681 |
| 1108 | Ga0587070_113159 | 3300059491 | Bacteria | 640 |
| 1109 | Ga0587070_129654 | 3300059491 | Bacteria | 612 |
| 1110 | Ga0587073_0030599 | 3300059492 | Bacteria | 1109 |
| 1111 | Ga0587073_0131699 | 3300059492 | Bacteria | 687 |
| 1112 | Ga0587080_046008 | 3300059503 | Bacteria | 810 |
| 1113 | Ga0587082_015336 | 3300059504 | Bacteria | 1182 |
| 1114 | Ga0587082_037345 | 3300059504 | Bacteria | 875 |
| 1115 | Ga0587082_082338 | 3300059504 | Bacteria | 673 |
| 1116 | Ga0587082_119777 | 3300059504 | Bacteria | 593 |
| 1117 | Ga0587083_0109780 | 3300059505 | Bacteria | 699 |
| 1118 | Ga0587083_0213010 | 3300059505 | Bacteria | 558 |
| 1119 | Ga0587085_040772 | 3300059506 | Bacteria | 808 |
| 1120 | Ga0587086_025247 | 3300059507 | Bacteria | 840 |
| 1121 | Ga0587088_036342 | 3300059508 | Bacteria | 907 |
| 1122 | Ga0587088_180665 | 3300059508 | Bacteria | 528 |
| 1123 | Ga0587090_055549 | 3300059510 | Bacteria | 737 |
| 1124 | Ga0587090_107533 | 3300059510 | Bacteria | 591 |
| 1125 | Ga0587091_019007 | 3300059511 | Bacteria | 1176 |
| 1126 | Ga0587092_163809 | 3300059512 | Bacteria | 505 |
| 1127 | Ga0587094_091932 | 3300059513 | Bacteria | 575 |
| 1128 | Ga0587106_034110 | 3300059605 | Bacteria | 832 |
| 1129 | Ga0587125_010667 | 3300059607 | Bacteria | 952 |
| 1130 | Ga0587099_052589 | 3300059622 | Bacteria | 547 |
| 1131 | Ga0587101_057370 | 3300059623 | Bacteria | 687 |
| 1132 | Ga0587101_131720 | 3300059623 | Bacteria | 527 |
| 1133 | Ga0587128_064370 | 3300059630 | Bacteria | 700 |
| 1134 | Ga0587067_017251 | 3300059640 | Bacteria | 1196 |
| 1135 | Ga0587067_081438 | 3300059640 | Bacteria | 717 |
| 1136 | Ga0587067_105092 | 3300059640 | Bacteria | 659 |
| 1137 | Ga0587068_059859 | 3300059641 | Bacteria | 730 |
| 1138 | Ga0587068_098995 | 3300059641 | Bacteria | 610 |
| 1139 | Ga0587069_040127 | 3300059642 | Bacteria | 795 |
| 1140 | Ga0587072_014988 | 3300059643 | Bacteria | 1311 |
| 1141 | Ga0587072_017983 | 3300059643 | Bacteria | 1224 |
| 1142 | Ga0587075_017503 | 3300059644 | Bacteria | 1031 |
| 1143 | Ga0587075_081417 | 3300059644 | Bacteria | 618 |
| 1144 | Ga0587076_047041 | 3300059645 | Bacteria | 828 |
| 1145 | Ga0587078_034841 | 3300059646 | Bacteria | 692 |
| 1146 | Ga0587079_090444 | 3300059647 | Bacteria | 715 |
| 1147 | Ga0587079_115115 | 3300059647 | Bacteria | 658 |
| 1148 | Ga0587079_199776 | 3300059647 | Bacteria | 545 |
| 1149 | Ga0587107_134990 | 3300059652 | Bacteria | 522 |
| 1150 | Ga0587108_010089 | 3300059653 | Bacteria | 788 |
| 1151 | Ga0587114_017298 | 3300059655 | Bacteria | 976 |
| 1152 | Ga0587114_115088 | 3300059655 | Bacteria | 539 |
| 1153 | Ga0587071_171532 | 3300060344 | Bacteria | 552 |
| 1154 | Ga0587111_0025486 | 3300060346 | Bacteria | 1172 |
| 1155 | Ga0587111_0037820 | 3300060346 | Bacteria | 1016 |
| 1156 | Ga0587111_0084148 | 3300060346 | Bacteria | 765 |
| 1157 | Ga0466962_0001686 | 3300061719 | Bacteria | 10365 |
| 1158 | Ga0466962_0003094 | 3300061719 | Bacteria | 7915 |
| 1159 | Ga0466962_0386486 | 3300061719 | Bacteria | 700 |
| 1160 | Ga0466962_0394145 | 3300061719 | Bacteria | 693 |
| 1161 | Ga0466962_0565371 | 3300061719 | Bacteria | 578 |
| 1162 | Ga0466962_0668870 | 3300061719 | Bacteria | 531 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300039453 | Ga0436362_0407008 | Ga0436362_0407008_421_714 | 80 |
| 2 | 3300007265 | Ga0099794_10193717 | Ga0099794_101937172 | 88 |
| 3 | 3300032168 | Ga0316593_10079969 | Ga0316593_100799693 | 88 |
| 4 | 3300059655 | Ga0587114_115088 | Ga0587114_115088_108_395 | 88 |
| 5 | 3300003203 | JGI25406J46586_10003028 | JGI25406J46586_100030283 | 89 |
| 6 | 3300004801 | Ga0058860_12227750 | Ga0058860_122277501 | 89 |
| 7 | 3300005435 | Ga0070714_101144325 | Ga0070714_1011443252 | 89 |
| 8 | 3300005563 | Ga0068855_100305134 | Ga0068855_1003051343 | 89 |
| 9 | 3300005985 | Ga0081539_10000109 | Ga0081539_10000109112 | 89 |
| 10 | 3300006173 | Ga0070716_101015384 | Ga0070716_1010153842 | 89 |
| 11 | 3300006844 | Ga0075428_100089494 | Ga0075428_1000894944 | 89 |
| 12 | 3300006844 | Ga0075428_100269806 | Ga0075428_1002698062 | 89 |
| 13 | 3300006846 | Ga0075430_100038086 | Ga0075430_1000380867 | 89 |
| 14 | 3300006847 | Ga0075431_100119295 | Ga0075431_1001192954 | 89 |
| 15 | 3300006847 | Ga0075431_100254409 | Ga0075431_1002544094 | 89 |
| 16 | 3300006880 | Ga0075429_101629322 | Ga0075429_1016293222 | 89 |
| 17 | 3300006880 | Ga0075429_102000322 | Ga0075429_1020003221 | 89 |
| 18 | 3300009147 | Ga0114129_10000114 | Ga0114129_1000011456 | 89 |
| 19 | 3300009147 | Ga0114129_10230488 | Ga0114129_102304884 | 89 |
| 20 | 3300013307 | Ga0157372_12066258 | Ga0157372_120662582 | 89 |
| 21 | 3300020070 | Ga0206356_10141090 | Ga0206356_101410902 | 89 |
| 22 | 3300020081 | Ga0206354_10997721 | Ga0206354_109977217 | 89 |
| 23 | 3300025939 | Ga0207665_10254816 | Ga0207665_102548164 | 89 |
| 24 | 3300026095 | Ga0207676_10656343 | Ga0207676_106563432 | 89 |
| 25 | 3300028381 | Ga0268264_12460400 | Ga0268264_124604002 | 89 |
| 26 | 3300031548 | Ga0307408_100238013 | Ga0307408_1002380134 | 89 |
| 27 | 3300031691 | Ga0316579_10237329 | Ga0316579_102373291 | 89 |
| 28 | 3300031727 | Ga0316576_10003193 | Ga0316576_100031933 | 89 |
| 29 | 3300031727 | Ga0316576_10030080 | Ga0316576_100300807 | 89 |
| 30 | 3300031728 | Ga0316578_10034392 | Ga0316578_100343924 | 89 |
| 31 | 3300031728 | Ga0316578_10082675 | Ga0316578_100826753 | 89 |
| 32 | 3300031901 | Ga0307406_10492953 | Ga0307406_104929533 | 89 |
| 33 | 3300031995 | Ga0307409_101233060 | Ga0307409_1012330602 | 89 |
| 34 | 3300032126 | Ga0307415_100976415 | Ga0307415_1009764151 | 89 |
| 35 | 3300032137 | Ga0316585_10087974 | Ga0316585_100879743 | 89 |
| 36 | 3300032168 | Ga0316593_10008571 | Ga0316593_100085716 | 89 |
| 37 | 3300033541 | Ga0316596_1064193 | Ga0316596_10641933 | 89 |
| 38 | 3300035117 | Ga0373953_0015877 | Ga0373953_0015877_579_857 | 89 |
| 39 | 3300035118 | Ga0373954_0475062 | Ga0373954_0475062_157_435 | 89 |
| 40 | 3300035398 | Ga0316574_0021215 | Ga0316574_0021215_626_907 | 89 |
| 41 | 3300035724 | Ga0373933_0057955 | Ga0373933_0057955_799_1077 | 89 |
| 42 | 3300036712 | Ga0316584_0975543 | Ga0316584_0975543_141_422 | 89 |
| 43 | 3300037418 | Ga0395900_0652104 | Ga0395900_0652104_282_563 | 89 |
| 44 | 3300044656 | Ga0466969_0201131 | Ga0466969_0201131_120_398 | 89 |
| 45 | 3300044684 | Ga0466966_0000383 | Ga0466966_0000383_23987_24265 | 89 |
| 46 | 3300044693 | Ga0466961_0054451 | Ga0466961_0054451_613_891 | 89 |
| 47 | 3300044694 | Ga0466963_0009016 | Ga0466963_0009016_4469_4747 | 89 |
| 48 | 3300044706 | Ga0466964_0076112 | Ga0466964_0076112_316_594 | 89 |
| 49 | 3300044719 | Ga0466971_0009870 | Ga0466971_0009870_2358_2636 | 89 |
| 50 | 3300044735 | Ga0466968_0131704 | Ga0466968_0131704_28_306 | 89 |
| 51 | 3300044842 | Ga0466957_0009243 | Ga0466957_0009243_727_1005 | 89 |
| 52 | 3300044842 | Ga0466957_0334200 | Ga0466957_0334200_132_416 | 89 |
| 53 | 3300045049 | Ga0466959_0017822 | Ga0466959_0017822_712_990 | 89 |
| 54 | 3300045836 | Ga0466958_0000206 | Ga0466958_0000206_18743_19021 | 89 |
| 55 | 3300045976 | Ga0466967_0479045 | Ga0466967_0479045_498_776 | 89 |
| 56 | 3300045976 | Ga0466967_0574241 | Ga0466967_0574241_471_755 | 89 |
| 57 | 3300045976 | Ga0466967_1845408 | Ga0466967_1845408_269_550 | 89 |
| 58 | 3300046461 | Ga0495641_0087695 | Ga0495641_0087695_656_943 | 89 |
| 59 | 3300046533 | Ga0495640_0400265 | Ga0495640_0400265_471_749 | 89 |
| 60 | 3300046616 | Ga0495668_0001638 | Ga0495668_0001638_13677_13955 | 89 |
| 61 | 3300046660 | Ga0495625_0006809 | Ga0495625_0006809_4358_4636 | 89 |
| 62 | 3300047319 | Ga0495674_0230718 | Ga0495674_0230718_235_513 | 89 |
| 63 | 3300047323 | Ga0495683_0008496 | Ga0495683_0008496_3096_3374 | 89 |
| 64 | 3300048091 | Ga0495626_0002897 | Ga0495626_0002897_4345_4623 | 89 |
| 65 | 3300048922 | Ga0496119_0213356 | Ga0496119_0213356_216_590 | 89 |
| 66 | 3300049533 | Ga0501317_014549 | Ga0501317_014549_467_760 | 89 |
| 67 | 3300049576 | Ga0501040_0006258 | Ga0501040_0006258_637_933 | 89 |
| 68 | 3300049675 | Ga0501243_082740 | Ga0501243_082740_107_406 | 89 |
| 69 | 3300050507 | nmdc:mga05p37_162208_c1 | nmdc:mga05p37_162208_c1_382_660 | 89 |
| 70 | 3300050507 | nmdc:mga05p37_363629_c1 | nmdc:mga05p37_363629_c1_1052_1330 | 89 |
| 71 | 3300050507 | nmdc:mga05p37_5679_c1 | nmdc:mga05p37_5679_c1_2652_2930 | 89 |
| 72 | 3300050508 | nmdc:mga09592_1450919_c1 | nmdc:mga09592_1450919_c1_256_534 | 89 |
| 73 | 3300050508 | nmdc:mga09592_155694_c1 | nmdc:mga09592_155694_c1_1030_1308 | 89 |
| 74 | 3300050509 | nmdc:mga0qj67_2506_c1 | nmdc:mga0qj67_2506_c1_5275_5565 | 89 |
| 75 | 3300050510 | nmdc:mga06r32_193463_c1 | nmdc:mga06r32_193463_c1_1342_1620 | 89 |
| 76 | 3300053085 | Ga0495619_0098160 | Ga0495619_0098160_664_942 | 89 |
| 77 | 3300059510 | Ga0587090_107533 | Ga0587090_107533_197_475 | 89 |
| 78 | 3300061719 | Ga0466962_0003094 | Ga0466962_0003094_4780_5058 | 89 |
| 79 | 3300004799 | Ga0058863_11832389 | Ga0058863_118323893 | 90 |
| 80 | 3300004800 | Ga0058861_11863394 | Ga0058861_118633942 | 90 |
| 81 | 3300005327 | Ga0070658_10001764 | Ga0070658_1000176417 | 90 |
| 82 | 3300005336 | Ga0070680_100004398 | Ga0070680_10000439812 | 90 |
| 83 | 3300005445 | Ga0070708_100073925 | Ga0070708_1000739251 | 90 |
| 84 | 3300005445 | Ga0070708_102214970 | Ga0070708_1022149701 | 90 |
| 85 | 3300005458 | Ga0070681_10004293 | Ga0070681_1000429312 | 90 |
| 86 | 3300005467 | Ga0070706_100094440 | Ga0070706_1000944404 | 90 |
| 87 | 3300005471 | Ga0070698_100007360 | Ga0070698_10000736013 | 90 |
| 88 | 3300005530 | Ga0070679_100006878 | Ga0070679_10000687812 | 90 |
| 89 | 3300005618 | Ga0068864_102470557 | Ga0068864_1024705571 | 90 |
| 90 | 3300005842 | Ga0068858_101225703 | Ga0068858_1012257032 | 90 |
| 91 | 3300006028 | Ga0070717_10272125 | Ga0070717_102721252 | 90 |
| 92 | 3300006844 | Ga0075428_100144016 | Ga0075428_1001440164 | 90 |
| 93 | 3300009094 | Ga0111539_11165846 | Ga0111539_111658461 | 90 |
| 94 | 3300009147 | Ga0114129_10158563 | Ga0114129_101585636 | 90 |
| 95 | 3300013105 | Ga0157369_10248956 | Ga0157369_102489564 | 90 |
| 96 | 3300013105 | Ga0157369_11675608 | Ga0157369_116756082 | 90 |
| 97 | 3300020069 | Ga0197907_10639128 | Ga0197907_106391284 | 90 |
| 98 | 3300020081 | Ga0206354_10292391 | Ga0206354_102923913 | 90 |
| 99 | 3300020081 | Ga0206354_10669361 | Ga0206354_106693613 | 90 |
| 100 | 3300020082 | Ga0206353_10558793 | Ga0206353_105587934 | 90 |
| 101 | 3300020082 | Ga0206353_11707872 | Ga0206353_117078722 | 90 |
| 102 | 3300020610 | Ga0154015_1050976 | Ga0154015_10509763 | 90 |
| 103 | 3300022467 | Ga0224712_10119501 | Ga0224712_101195014 | 90 |
| 104 | 3300025909 | Ga0207705_10000671 | Ga0207705_1000067126 | 90 |
| 105 | 3300025910 | Ga0207684_10034994 | Ga0207684_100349947 | 90 |
| 106 | 3300025912 | Ga0207707_10001820 | Ga0207707_1000182029 | 90 |
| 107 | 3300025917 | Ga0207660_10000562 | Ga0207660_1000056227 | 90 |
| 108 | 3300025919 | Ga0207657_10302551 | Ga0207657_103025512 | 90 |
| 109 | 3300025921 | Ga0207652_10000632 | Ga0207652_1000063217 | 90 |
| 110 | 3300025922 | Ga0207646_10159851 | Ga0207646_101598514 | 90 |
| 111 | 3300028556 | Ga0265337_1105293 | Ga0265337_11052932 | 90 |
| 112 | 3300028573 | Ga0265334_10057630 | Ga0265334_100576303 | 90 |
| 113 | 3300028800 | Ga0265338_10011876 | Ga0265338_100118764 | 90 |
| 114 | 3300030963 | Ga0265768_116295 | Ga0265768_1162952 | 90 |
| 115 | 3300031240 | Ga0265320_10033393 | Ga0265320_100333935 | 90 |
| 116 | 3300031241 | Ga0265325_10005613 | Ga0265325_100056136 | 90 |
| 117 | 3300031247 | Ga0265340_10007408 | Ga0265340_1000740811 | 90 |
| 118 | 3300031249 | Ga0265339_10013888 | Ga0265339_100138887 | 90 |
| 119 | 3300031250 | Ga0265331_10244502 | Ga0265331_102445022 | 90 |
| 120 | 3300031344 | Ga0265316_10307515 | Ga0265316_103075151 | 90 |
| 121 | 3300031595 | Ga0265313_10125043 | Ga0265313_101250433 | 90 |
| 122 | 3300031686 | Ga0310119_113302 | Ga0310119_1133021 | 90 |
| 123 | 3300031711 | Ga0265314_10039636 | Ga0265314_100396362 | 90 |
| 124 | 3300031712 | Ga0265342_10048760 | Ga0265342_100487603 | 90 |
| 125 | 3300031901 | Ga0307406_11387865 | Ga0307406_113878651 | 90 |
| 126 | 3300031903 | Ga0307407_11118579 | Ga0307407_111185792 | 90 |
| 127 | 3300036457 | Ga0265778_036711 | Ga0265778_036711_47_331 | 90 |
| 128 | 3300037853 | Ga0436364_0537875 | Ga0436364_0537875_155_433 | 90 |
| 129 | 3300039453 | Ga0436362_0337635 | Ga0436362_0337635_118_429 | 90 |
| 130 | 3300044658 | Ga0466972_0236239 | Ga0466972_0236239_89_367 | 90 |
| 131 | 3300044683 | Ga0466965_0012176 | Ga0466965_0012176_2385_2663 | 90 |
| 132 | 3300044683 | Ga0466965_0037716 | Ga0466965_0037716_1775_2056 | 90 |
| 133 | 3300044683 | Ga0466965_0487085 | Ga0466965_0487085_179_457 | 90 |
| 134 | 3300044683 | Ga0466965_0616153 | Ga0466965_0616153_148_441 | 90 |
| 135 | 3300044693 | Ga0466961_0398087 | Ga0466961_0398087_124_417 | 90 |
| 136 | 3300044694 | Ga0466963_0358646 | Ga0466963_0358646_528_821 | 90 |
| 137 | 3300044706 | Ga0466964_0102268 | Ga0466964_0102268_25_303 | 90 |
| 138 | 3300044765 | Ga0466970_0007149 | Ga0466970_0007149_2484_2762 | 90 |
| 139 | 3300044842 | Ga0466957_0112320 | Ga0466957_0112320_428_706 | 90 |
| 140 | 3300044901 | Ga0466960_0027272 | Ga0466960_0027272_1087_1365 | 90 |
| 141 | 3300044901 | Ga0466960_0054879 | Ga0466960_0054879_91_372 | 90 |
| 142 | 3300044901 | Ga0466960_0166223 | Ga0466960_0166223_518_808 | 90 |
| 143 | 3300045976 | Ga0466967_0863223 | Ga0466967_0863223_193_471 | 90 |
| 144 | 3300046454 | Ga0495592_0007064 | Ga0495592_0007064_336_614 | 90 |
| 145 | 3300046462 | Ga0495651_0015125 | Ga0495651_0015125_5350_5628 | 90 |
| 146 | 3300046463 | Ga0495653_0122937 | Ga0495653_0122937_336_614 | 90 |
| 147 | 3300046472 | Ga0495580_0007502 | Ga0495580_0007502_8179_8457 | 90 |
| 148 | 3300046476 | Ga0495662_0000096 | Ga0495662_0000096_26670_26948 | 90 |
| 149 | 3300046477 | Ga0495664_0002322 | Ga0495664_0002322_9525_9803 | 90 |
| 150 | 3300046499 | Ga0495594_0161811 | Ga0495594_0161811_697_975 | 90 |
| 151 | 3300046511 | Ga0495608_0002713 | Ga0495608_0002713_4785_5063 | 90 |
| 152 | 3300046514 | Ga0495618_0517844 | Ga0495618_0517844_261_539 | 90 |
| 153 | 3300046516 | Ga0495628_0002207 | Ga0495628_0002207_4484_4762 | 90 |
| 154 | 3300046517 | Ga0495630_0002424 | Ga0495630_0002424_8161_8439 | 90 |
| 155 | 3300046526 | Ga0495666_0000307 | Ga0495666_0000307_8874_9152 | 90 |
| 156 | 3300046529 | Ga0495652_0013442 | Ga0495652_0013442_2606_2884 | 90 |
| 157 | 3300046531 | Ga0495665_0001543 | Ga0495665_0001543_6318_6596 | 90 |
| 158 | 3300046533 | Ga0495640_0002906 | Ga0495640_0002906_5860_6138 | 90 |
| 159 | 3300046536 | Ga0495587_0001703 | Ga0495587_0001703_5350_5628 | 90 |
| 160 | 3300046543 | Ga0495645_0002261 | Ga0495645_0002261_3296_3574 | 90 |
| 161 | 3300046559 | Ga0495667_0028951 | Ga0495667_0028951_47_325 | 90 |
| 162 | 3300046642 | Ga0495634_0007090 | Ga0495634_0007090_4332_4610 | 90 |
| 163 | 3300046663 | Ga0495635_0005159 | Ga0495635_0005159_4484_4762 | 90 |
| 164 | 3300046675 | Ga0495657_0005637 | Ga0495657_0005637_5270_5548 | 90 |
| 165 | 3300046678 | Ga0495599_0007801 | Ga0495599_0007801_4986_5264 | 90 |
| 166 | 3300046679 | Ga0495623_0010498 | Ga0495623_0010498_4484_4762 | 90 |
| 167 | 3300046680 | Ga0495646_0088466 | Ga0495646_0088466_1481_1759 | 90 |
| 168 | 3300046681 | Ga0495647_0109875 | Ga0495647_0109875_169_447 | 90 |
| 169 | 3300046683 | Ga0495658_0029856 | Ga0495658_0029856_2460_2738 | 90 |
| 170 | 3300046683 | Ga0495658_0073694 | Ga0495658_0073694_296_574 | 90 |
| 171 | 3300046689 | Ga0495613_0005309 | Ga0495613_0005309_5350_5628 | 90 |
| 172 | 3300046809 | Ga0495600_0002715 | Ga0495600_0002715_5477_5755 | 90 |
| 173 | 3300047315 | Ga0495581_0015465 | Ga0495581_0015465_3818_4096 | 90 |
| 174 | 3300047315 | Ga0495581_0205410 | Ga0495581_0205410_702_980 | 90 |
| 175 | 3300047317 | Ga0495604_0002362 | Ga0495604_0002362_4484_4762 | 90 |
| 176 | 3300047319 | Ga0495674_0026033 | Ga0495674_0026033_3843_4121 | 90 |
| 177 | 3300047321 | Ga0495676_0153676 | Ga0495676_0153676_834_1112 | 90 |
| 178 | 3300047444 | Ga0495675_0005831 | Ga0495675_0005831_3843_4121 | 90 |
| 179 | 3300047471 | Ga0495684_0012770 | Ga0495684_0012770_4722_5000 | 90 |
| 180 | 3300047673 | Ga0495593_0009251 | Ga0495593_0009251_4217_4495 | 90 |
| 181 | 3300047673 | Ga0495593_0494119 | Ga0495593_0494119_202_480 | 90 |
| 182 | 3300048088 | Ga0495602_0013431 | Ga0495602_0013431_4689_4967 | 90 |
| 183 | 3300048913 | Ga0496110_1276380 | Ga0496110_1276380_205_534 | 90 |
| 184 | 3300049571 | Ga0501034_1107795 | Ga0501034_1107795_368_646 | 90 |
| 185 | 3300049586 | Ga0501070_0481253 | Ga0501070_0481253_99_377 | 90 |
| 186 | 3300050507 | nmdc:mga05p37_93825_c1 | nmdc:mga05p37_93825_c1_2681_2962 | 90 |
| 187 | 3300053077 | Ga0495601_0010241 | Ga0495601_0010241_3318_3596 | 90 |
| 188 | 3300059491 | Ga0587070_129654 | Ga0587070_129654_289_567 | 90 |
| 189 | 3300059508 | Ga0587088_036342 | Ga0587088_036342_166_459 | 90 |
| 190 | 3300060346 | Ga0587111_0037820 | Ga0587111_0037820_140_436 | 90 |
| 191 | iso_pu_bacteria | 2506783011 | 2506868517 | 90 |
| 192 | iso_pu_bacteria | 2508501039 | 2508670631 | 90 |
| 193 | iso_pu_bacteria | 2675902999 | 2676199473 | 90 |
| 194 | iso_pu_bacteria | 2675903060 | 2676494463 | 90 |
| 195 | iso_pu_bacteria | 2687453737 | 2689960408 | 90 |
| 196 | iso_pu_bacteria | 2773857921 | 2774844051 | 90 |
| 197 | iso_pu_bacteria | 2773857933 | 2774902898 | 90 |
| 198 | iso_pu_bacteria | 3001119090 | 3001120675 | 90 |
| 199 | iso_pu_bacteria | 637000116 | 637877924 | 90 |
| 200 | 3300004798 | Ga0058859_11790635 | Ga0058859_117906352 | 91 |
| 201 | 3300004800 | Ga0058861_12014800 | Ga0058861_120148004 | 91 |
| 202 | 3300004801 | Ga0058860_12163264 | Ga0058860_121632641 | 91 |
| 203 | 3300004801 | Ga0058860_12193443 | Ga0058860_121934434 | 91 |
| 204 | 3300004803 | Ga0058862_10092749 | Ga0058862_100927491 | 91 |
| 205 | 3300005327 | Ga0070658_10066569 | Ga0070658_100665693 | 91 |
| 206 | 3300005329 | Ga0070683_100239458 | Ga0070683_1002394584 | 91 |
| 207 | 3300005329 | Ga0070683_100495745 | Ga0070683_1004957453 | 91 |
| 208 | 3300005335 | Ga0070666_10571181 | Ga0070666_105711813 | 91 |
| 209 | 3300005336 | Ga0070680_100298977 | Ga0070680_1002989771 | 91 |
| 210 | 3300005336 | Ga0070680_100573762 | Ga0070680_1005737622 | 91 |
| 211 | 3300005336 | Ga0070680_101234427 | Ga0070680_1012344272 | 91 |
| 212 | 3300005339 | Ga0070660_100237252 | Ga0070660_1002372523 | 91 |
| 213 | 3300005339 | Ga0070660_100404171 | Ga0070660_1004041712 | 91 |
| 214 | 3300005339 | Ga0070660_101318012 | Ga0070660_1013180122 | 91 |
| 215 | 3300005344 | Ga0070661_101247423 | Ga0070661_1012474231 | 91 |
| 216 | 3300005355 | Ga0070671_102017759 | Ga0070671_1020177591 | 91 |
| 217 | 3300005435 | Ga0070714_100000013 | Ga0070714_10000001319 | 91 |
| 218 | 3300005467 | Ga0070706_100448638 | Ga0070706_1004486383 | 91 |
| 219 | 3300005530 | Ga0070679_100205787 | Ga0070679_1002057874 | 91 |
| 220 | 3300005530 | Ga0070679_100295307 | Ga0070679_1002953074 | 91 |
| 221 | 3300005535 | Ga0070684_100337218 | Ga0070684_1003372184 | 91 |
| 222 | 3300005543 | Ga0070672_100719870 | Ga0070672_1007198701 | 91 |
| 223 | 3300005548 | Ga0070665_100316587 | Ga0070665_1003165874 | 91 |
| 224 | 3300005548 | Ga0070665_100414338 | Ga0070665_1004143383 | 91 |
| 225 | 3300005563 | Ga0068855_100412912 | Ga0068855_1004129124 | 91 |
| 226 | 3300005564 | Ga0070664_100843650 | Ga0070664_1008436501 | 91 |
| 227 | 3300005615 | Ga0070702_100456074 | Ga0070702_1004560741 | 91 |
| 228 | 3300005842 | Ga0068858_100399888 | Ga0068858_1003998883 | 91 |
| 229 | 3300006237 | Ga0097621_100345238 | Ga0097621_1003452382 | 91 |
| 230 | 3300006844 | Ga0075428_100868657 | Ga0075428_1008686572 | 91 |
| 231 | 3300006846 | Ga0075430_100155685 | Ga0075430_1001556854 | 91 |
| 232 | 3300006847 | Ga0075431_101866498 | Ga0075431_1018664982 | 91 |
| 233 | 3300006880 | Ga0075429_100527814 | Ga0075429_1005278143 | 91 |
| 234 | 3300009011 | Ga0105251_10053109 | Ga0105251_100531093 | 91 |
| 235 | 3300009092 | Ga0105250_10329168 | Ga0105250_103291681 | 91 |
| 236 | 3300009098 | Ga0105245_10711399 | Ga0105245_107113993 | 91 |
| 237 | 3300009098 | Ga0105245_10878150 | Ga0105245_108781502 | 91 |
| 238 | 3300009101 | Ga0105247_10000616 | Ga0105247_1000061617 | 91 |
| 239 | 3300009101 | Ga0105247_10380229 | Ga0105247_103802291 | 91 |
| 240 | 3300009147 | Ga0114129_10132230 | Ga0114129_101322303 | 91 |
| 241 | 3300009148 | Ga0105243_12493737 | Ga0105243_124937372 | 91 |
| 242 | 3300009177 | Ga0105248_10243255 | Ga0105248_102432554 | 91 |
| 243 | 3300009177 | Ga0105248_10424628 | Ga0105248_104246284 | 91 |
| 244 | 3300009545 | Ga0105237_12679199 | Ga0105237_126791991 | 91 |
| 245 | 3300009553 | Ga0105249_11128089 | Ga0105249_111280893 | 91 |
| 246 | 3300009553 | Ga0105249_11634110 | Ga0105249_116341102 | 91 |
| 247 | 3300010375 | Ga0105239_11081109 | Ga0105239_110811091 | 91 |
| 248 | 3300012475 | Ga0157317_1001596 | Ga0157317_10015963 | 91 |
| 249 | 3300012502 | Ga0157347_1020817 | Ga0157347_10208171 | 91 |
| 250 | 3300012503 | Ga0157313_1027449 | Ga0157313_10274492 | 91 |
| 251 | 3300013105 | Ga0157369_10319534 | Ga0157369_103195343 | 91 |
| 252 | 3300013105 | Ga0157369_10438090 | Ga0157369_104380904 | 91 |
| 253 | 3300013296 | Ga0157374_11105391 | Ga0157374_111053912 | 91 |
| 254 | 3300013307 | Ga0157372_12512895 | Ga0157372_125128952 | 91 |
| 255 | 3300013308 | Ga0157375_11231054 | Ga0157375_112310542 | 91 |
| 256 | 3300014325 | Ga0163163_10130437 | Ga0163163_101304376 | 91 |
| 257 | 3300014325 | Ga0163163_11225418 | Ga0163163_112254182 | 91 |
| 258 | 3300014497 | Ga0182008_10293522 | Ga0182008_102935222 | 91 |
| 259 | 3300014968 | Ga0157379_12608734 | Ga0157379_126087341 | 91 |
| 260 | 3300017792 | Ga0163161_10761909 | Ga0163161_107619091 | 91 |
| 261 | 3300020069 | Ga0197907_11333365 | Ga0197907_113333654 | 91 |
| 262 | 3300020070 | Ga0206356_10137316 | Ga0206356_101373161 | 91 |
| 263 | 3300020070 | Ga0206356_10993217 | Ga0206356_109932173 | 91 |
| 264 | 3300020070 | Ga0206356_11202941 | Ga0206356_112029412 | 91 |
| 265 | 3300020078 | Ga0206352_10361311 | Ga0206352_103613112 | 91 |
| 266 | 3300020080 | Ga0206350_10562667 | Ga0206350_105626672 | 91 |
| 267 | 3300020081 | Ga0206354_10226284 | Ga0206354_102262843 | 91 |
| 268 | 3300020081 | Ga0206354_11237324 | Ga0206354_112373243 | 91 |
| 269 | 3300020082 | Ga0206353_10484919 | Ga0206353_104849193 | 91 |
| 270 | 3300022467 | Ga0224712_10174136 | Ga0224712_101741361 | 91 |
| 271 | 3300022730 | Ga0224570_108923 | Ga0224570_1089232 | 91 |
| 272 | 3300025735 | Ga0207713_1012538 | Ga0207713_10125383 | 91 |
| 273 | 3300025900 | Ga0207710_10000048 | Ga0207710_1000004826 | 91 |
| 274 | 3300025904 | Ga0207647_10138118 | Ga0207647_101381184 | 91 |
| 275 | 3300025909 | Ga0207705_10003438 | Ga0207705_1000343821 | 91 |
| 276 | 3300025910 | Ga0207684_10969602 | Ga0207684_109696021 | 91 |
| 277 | 3300025912 | Ga0207707_10247736 | Ga0207707_102477362 | 91 |
| 278 | 3300025912 | Ga0207707_10815862 | Ga0207707_108158621 | 91 |
| 279 | 3300025915 | Ga0207693_11437934 | Ga0207693_114379342 | 91 |
| 280 | 3300025917 | Ga0207660_10844220 | Ga0207660_108442202 | 91 |
| 281 | 3300025917 | Ga0207660_11336668 | Ga0207660_113366681 | 91 |
| 282 | 3300025919 | Ga0207657_10246922 | Ga0207657_102469223 | 91 |
| 283 | 3300025919 | Ga0207657_10477719 | Ga0207657_104777192 | 91 |
| 284 | 3300025919 | Ga0207657_10819126 | Ga0207657_108191262 | 91 |
| 285 | 3300025921 | Ga0207652_10249175 | Ga0207652_102491754 | 91 |
| 286 | 3300025921 | Ga0207652_10705203 | Ga0207652_107052033 | 91 |
| 287 | 3300025924 | Ga0207694_10603492 | Ga0207694_106034923 | 91 |
| 288 | 3300025927 | Ga0207687_10213190 | Ga0207687_102131904 | 91 |
| 289 | 3300025929 | Ga0207664_10000001 | Ga0207664_10000001525 | 91 |
| 290 | 3300025931 | Ga0207644_10916542 | Ga0207644_109165422 | 91 |
| 291 | 3300025940 | Ga0207691_10020477 | Ga0207691_100204775 | 91 |
| 292 | 3300025941 | Ga0207711_10083902 | Ga0207711_100839024 | 91 |
| 293 | 3300025941 | Ga0207711_10417100 | Ga0207711_104171003 | 91 |
| 294 | 3300026035 | Ga0207703_10309913 | Ga0207703_103099133 | 91 |
| 295 | 3300026121 | Ga0207683_10245955 | Ga0207683_102459553 | 91 |
| 296 | 3300026142 | Ga0207698_11360754 | Ga0207698_113607543 | 91 |
| 297 | 3300028379 | Ga0268266_10669462 | Ga0268266_106694623 | 91 |
| 298 | 3300028380 | Ga0268265_10920323 | Ga0268265_109203233 | 91 |
| 299 | 3300031090 | Ga0265760_10247674 | Ga0265760_102476742 | 91 |
| 300 | 3300031824 | Ga0307413_10758429 | Ga0307413_107584291 | 91 |
| 301 | 3300031852 | Ga0307410_10217117 | Ga0307410_102171173 | 91 |
| 302 | 3300031995 | Ga0307409_102102266 | Ga0307409_1021022662 | 91 |
| 303 | 3300032120 | Ga0316053_119119 | Ga0316053_1191191 | 91 |
| 304 | 3300037068 | Ga0373925_0497909 | Ga0373925_0497909_127_405 | 91 |
| 305 | 3300039450 | Ga0436363_1286402 | Ga0436363_1286402_16_300 | 91 |
| 306 | 3300041406 | Ga0439439_0013591 | Ga0439439_0013591_1370_1657 | 91 |
| 307 | 3300041411 | Ga0439466_0141534 | Ga0439466_0141534_135_422 | 91 |
| 308 | 3300041999 | Ga0439433_0001269 | Ga0439433_0001269_4253_4540 | 91 |
| 309 | 3300042007 | Ga0439449_0018354 | Ga0439449_0018354_1288_1575 | 91 |
| 310 | 3300042014 | Ga0439457_008613 | Ga0439457_008613_1051_1338 | 91 |
| 311 | 3300042015 | Ga0439462_0006125 | Ga0439462_0006125_1289_1576 | 91 |
| 312 | 3300044683 | Ga0466965_0372340 | Ga0466965_0372340_410_694 | 91 |
| 313 | 3300044683 | Ga0466965_0419593 | Ga0466965_0419593_121_408 | 91 |
| 314 | 3300044706 | Ga0466964_0201227 | Ga0466964_0201227_387_677 | 91 |
| 315 | 3300044735 | Ga0466968_0000486 | Ga0466968_0000486_2140_2424 | 91 |
| 316 | 3300044842 | Ga0466957_0008706 | Ga0466957_0008706_2963_3253 | 91 |
| 317 | 3300045049 | Ga0466959_0359411 | Ga0466959_0359411_279_560 | 91 |
| 318 | 3300045976 | Ga0466967_1558375 | Ga0466967_1558375_173_454 | 91 |
| 319 | 3300046455 | Ga0495603_0307456 | Ga0495603_0307456_270_554 | 91 |
| 320 | 3300046473 | Ga0495582_0474268 | Ga0495582_0474268_309_593 | 91 |
| 321 | 3300046499 | Ga0495594_0011474 | Ga0495594_0011474_1066_1356 | 91 |
| 322 | 3300046506 | Ga0495583_0418750 | Ga0495583_0418750_38_322 | 91 |
| 323 | 3300046537 | Ga0495598_0125405 | Ga0495598_0125405_51_344 | 91 |
| 324 | 3300046539 | Ga0495621_0147796 | Ga0495621_0147796_253_552 | 91 |
| 325 | 3300046557 | Ga0495622_0265234 | Ga0495622_0265234_263_547 | 91 |
| 326 | 3300046615 | Ga0495656_0042504 | Ga0495656_0042504_903_1187 | 91 |
| 327 | 3300046615 | Ga0495656_0050533 | Ga0495656_0050533_187_486 | 91 |
| 328 | 3300047318 | Ga0495636_0350808 | Ga0495636_0350808_226_510 | 91 |
| 329 | 3300047320 | Ga0495672_0493891 | Ga0495672_0493891_244_525 | 91 |
| 330 | 3300047444 | Ga0495675_0048524 | Ga0495675_0048524_1959_2243 | 91 |
| 331 | 3300047470 | Ga0495681_0341214 | Ga0495681_0341214_104_388 | 91 |
| 332 | 3300048090 | Ga0495615_0085372 | Ga0495615_0085372_76_360 | 91 |
| 333 | 3300048903 | Ga0496100_0434567 | Ga0496100_0434567_81_416 | 91 |
| 334 | 3300048903 | Ga0496100_0726312 | Ga0496100_0726312_321_611 | 91 |
| 335 | 3300048905 | Ga0496102_0251664 | Ga0496102_0251664_582_872 | 91 |
| 336 | 3300048907 | Ga0496104_0138327 | Ga0496104_0138327_1234_1569 | 91 |
| 337 | 3300048907 | Ga0496104_0215285 | Ga0496104_0215285_439_729 | 91 |
| 338 | 3300048907 | Ga0496104_0571587 | Ga0496104_0571587_554_838 | 91 |
| 339 | 3300048907 | Ga0496104_1780769 | Ga0496104_1780769_43_333 | 91 |
| 340 | 3300048908 | Ga0496105_0083619 | Ga0496105_0083619_1258_1542 | 91 |
| 341 | 3300048908 | Ga0496105_0259952 | Ga0496105_0259952_544_879 | 91 |
| 342 | 3300048908 | Ga0496105_0664833 | Ga0496105_0664833_97_432 | 91 |
| 343 | 3300048911 | Ga0496108_0352911 | Ga0496108_0352911_324_608 | 91 |
| 344 | 3300048913 | Ga0496110_0124579 | Ga0496110_0124579_857_1147 | 91 |
| 345 | 3300048913 | Ga0496110_1016179 | Ga0496110_1016179_386_676 | 91 |
| 346 | 3300048914 | Ga0496111_0125391 | Ga0496111_0125391_609_944 | 91 |
| 347 | 3300048914 | Ga0496111_0201873 | Ga0496111_0201873_1087_1371 | 91 |
| 348 | 3300048915 | Ga0496112_0343000 | Ga0496112_0343000_1041_1331 | 91 |
| 349 | 3300048915 | Ga0496112_0556047 | Ga0496112_0556047_271_561 | 91 |
| 350 | 3300048917 | Ga0496114_0400759 | Ga0496114_0400759_577_867 | 91 |
| 351 | 3300048917 | Ga0496114_0761891 | Ga0496114_0761891_235_570 | 91 |
| 352 | 3300048918 | Ga0496115_0268221 | Ga0496115_0268221_653_943 | 91 |
| 353 | 3300048923 | Ga0496120_0192930 | Ga0496120_0192930_281_565 | 91 |
| 354 | 3300048926 | Ga0496123_0361362 | Ga0496123_0361362_36_320 | 91 |
| 355 | 3300048928 | Ga0496125_0258633 | Ga0496125_0258633_527_811 | 91 |
| 356 | 3300048929 | Ga0496126_0563945 | Ga0496126_0563945_247_537 | 91 |
| 357 | 3300049130 | Ga0501310_015638 | Ga0501310_015638_542_841 | 91 |
| 358 | 3300049571 | Ga0501034_1352442 | Ga0501034_1352442_176_466 | 91 |
| 359 | 3300049581 | Ga0501047_0248456 | Ga0501047_0248456_622_912 | 91 |
| 360 | 3300049583 | Ga0501067_0815538 | Ga0501067_0815538_49_327 | 91 |
| 361 | 3300049586 | Ga0501070_0227045 | Ga0501070_0227045_153_443 | 91 |
| 362 | 3300049586 | Ga0501070_1510886 | Ga0501070_1510886_30_320 | 91 |
| 363 | 3300049742 | Ga0501080_1871846 | Ga0501080_1871846_27_317 | 91 |
| 364 | 3300049823 | Ga0501044_0618549 | Ga0501044_0618549_16_306 | 91 |
| 365 | 3300050507 | nmdc:mga05p37_231129_c1 | nmdc:mga05p37_231129_c1_756_1040 | 91 |
| 366 | 3300050508 | nmdc:mga09592_334103_c1 | nmdc:mga09592_334103_c1_1015_1296 | 91 |
| 367 | 3300050509 | nmdc:mga0qj67_70050_c1 | nmdc:mga0qj67_70050_c1_1657_1938 | 91 |
| 368 | 3300050510 | nmdc:mga06r32_1592375_c1 | nmdc:mga06r32_1592375_c1_260_544 | 91 |
| 369 | 3300059491 | Ga0587070_113159 | Ga0587070_113159_221_511 | 91 |
| 370 | 3300059503 | Ga0587080_046008 | Ga0587080_046008_410_700 | 91 |
| 371 | 3300059505 | Ga0587083_0213010 | Ga0587083_0213010_214_504 | 91 |
| 372 | 3300059640 | Ga0587067_105092 | Ga0587067_105092_189_479 | 91 |
| 373 | 3300059643 | Ga0587072_014988 | Ga0587072_014988_664_954 | 91 |
| 374 | 3300059644 | Ga0587075_081417 | Ga0587075_081417_188_478 | 91 |
| 375 | 3300059647 | Ga0587079_090444 | Ga0587079_090444_72_362 | 91 |
| 376 | 3300059652 | Ga0587107_134990 | Ga0587107_134990_36_326 | 91 |
| 377 | 3300060344 | Ga0587071_171532 | Ga0587071_171532_189_479 | 91 |
| 378 | 3300060346 | Ga0587111_0084148 | Ga0587111_0084148_62_352 | 91 |
| 379 | iso_pu_bacteria | 2671180195 | 2671835736 | 91 |
| 380 | iso_pu_bacteria | 2773857922 | 2774853892 | 91 |
| 381 | iso_pu_bacteria | 2884693830 | 2884694822 | 91 |
| 382 | iso_pu_bacteria | 2895442618 | 2895446482 | 91 |
| 383 | 3300004798 | Ga0058859_11834757 | Ga0058859_118347573 | 92 |
| 384 | 3300004799 | Ga0058863_10022412 | Ga0058863_100224123 | 92 |
| 385 | 3300004799 | Ga0058863_11910841 | Ga0058863_119108415 | 92 |
| 386 | 3300004800 | Ga0058861_11946098 | Ga0058861_119460981 | 92 |
| 387 | 3300004800 | Ga0058861_11983512 | Ga0058861_119835122 | 92 |
| 388 | 3300004800 | Ga0058861_11995215 | Ga0058861_119952151 | 92 |
| 389 | 3300004803 | Ga0058862_12767850 | Ga0058862_127678502 | 92 |
| 390 | 3300004803 | Ga0058862_12784181 | Ga0058862_127841812 | 92 |
| 391 | 3300004803 | Ga0058862_12834356 | Ga0058862_128343567 | 92 |
| 392 | 3300005327 | Ga0070658_10097709 | Ga0070658_100977095 | 92 |
| 393 | 3300005327 | Ga0070658_10354214 | Ga0070658_103542143 | 92 |
| 394 | 3300005329 | Ga0070683_100446712 | Ga0070683_1004467123 | 92 |
| 395 | 3300005329 | Ga0070683_100752647 | Ga0070683_1007526472 | 92 |
| 396 | 3300005330 | Ga0070690_100110749 | Ga0070690_1001107492 | 92 |
| 397 | 3300005331 | Ga0070670_101181525 | Ga0070670_1011815252 | 92 |
| 398 | 3300005334 | Ga0068869_100116541 | Ga0068869_1001165413 | 92 |
| 399 | 3300005336 | Ga0070680_100003083 | Ga0070680_10000308314 | 92 |
| 400 | 3300005336 | Ga0070680_100155709 | Ga0070680_1001557094 | 92 |
| 401 | 3300005337 | Ga0070682_101406113 | Ga0070682_1014061132 | 92 |
| 402 | 3300005338 | Ga0068868_100044857 | Ga0068868_1000448579 | 92 |
| 403 | 3300005338 | Ga0068868_102312643 | Ga0068868_1023126431 | 92 |
| 404 | 3300005339 | Ga0070660_100286007 | Ga0070660_1002860071 | 92 |
| 405 | 3300005339 | Ga0070660_100602222 | Ga0070660_1006022223 | 92 |
| 406 | 3300005339 | Ga0070660_100620314 | Ga0070660_1006203142 | 92 |
| 407 | 3300005340 | Ga0070689_101863387 | Ga0070689_1018633871 | 92 |
| 408 | 3300005344 | Ga0070661_101766147 | Ga0070661_1017661471 | 92 |
| 409 | 3300005364 | Ga0070673_100177014 | Ga0070673_1001770144 | 92 |
| 410 | 3300005366 | Ga0070659_100066750 | Ga0070659_1000667505 | 92 |
| 411 | 3300005366 | Ga0070659_100171107 | Ga0070659_1001711074 | 92 |
| 412 | 3300005366 | Ga0070659_101722669 | Ga0070659_1017226692 | 92 |
| 413 | 3300005435 | Ga0070714_100340560 | Ga0070714_1003405603 | 92 |
| 414 | 3300005435 | Ga0070714_100961121 | Ga0070714_1009611212 | 92 |
| 415 | 3300005435 | Ga0070714_102362929 | Ga0070714_1023629291 | 92 |
| 416 | 3300005436 | Ga0070713_100004669 | Ga0070713_10000466915 | 92 |
| 417 | 3300005437 | Ga0070710_10000376 | Ga0070710_1000037611 | 92 |
| 418 | 3300005437 | Ga0070710_10136352 | Ga0070710_101363523 | 92 |
| 419 | 3300005455 | Ga0070663_100106678 | Ga0070663_1001066785 | 92 |
| 420 | 3300005456 | Ga0070678_100609503 | Ga0070678_1006095033 | 92 |
| 421 | 3300005458 | Ga0070681_10009160 | Ga0070681_100091604 | 92 |
| 422 | 3300005459 | Ga0068867_102054112 | Ga0068867_1020541122 | 92 |
| 423 | 3300005530 | Ga0070679_100003833 | Ga0070679_10000383311 | 92 |
| 424 | 3300005530 | Ga0070679_100014608 | Ga0070679_10001460814 | 92 |
| 425 | 3300005530 | Ga0070679_100468245 | Ga0070679_1004682453 | 92 |
| 426 | 3300005535 | Ga0070684_101252820 | Ga0070684_1012528202 | 92 |
| 427 | 3300005535 | Ga0070684_101655704 | Ga0070684_1016557042 | 92 |
| 428 | 3300005548 | Ga0070665_100007009 | Ga0070665_10000700913 | 92 |
| 429 | 3300005563 | Ga0068855_100002777 | Ga0068855_10000277730 | 92 |
| 430 | 3300005563 | Ga0068855_100009577 | Ga0068855_10000957716 | 92 |
| 431 | 3300005563 | Ga0068855_101708622 | Ga0068855_1017086222 | 92 |
| 432 | 3300005563 | Ga0068855_101907940 | Ga0068855_1019079402 | 92 |
| 433 | 3300005578 | Ga0068854_100004690 | Ga0068854_10000469014 | 92 |
| 434 | 3300005614 | Ga0068856_100472684 | Ga0068856_1004726843 | 92 |
| 435 | 3300005614 | Ga0068856_102703091 | Ga0068856_1027030912 | 92 |
| 436 | 3300005616 | Ga0068852_100016981 | Ga0068852_10001698111 | 92 |
| 437 | 3300005616 | Ga0068852_100808395 | Ga0068852_1008083952 | 92 |
| 438 | 3300005616 | Ga0068852_100865204 | Ga0068852_1008652042 | 92 |
| 439 | 3300006038 | Ga0075365_10014271 | Ga0075365_100142715 | 92 |
| 440 | 3300006173 | Ga0070716_100815708 | Ga0070716_1008157082 | 92 |
| 441 | 3300009036 | Ga0105244_10167075 | Ga0105244_101670751 | 92 |
| 442 | 3300009093 | Ga0105240_10002670 | Ga0105240_100026707 | 92 |
| 443 | 3300009093 | Ga0105240_10039358 | Ga0105240_100393582 | 92 |
| 444 | 3300009098 | Ga0105245_11025418 | Ga0105245_110254183 | 92 |
| 445 | 3300009174 | Ga0105241_10000758 | Ga0105241_1000075818 | 92 |
| 446 | 3300009176 | Ga0105242_10876810 | Ga0105242_108768103 | 92 |
| 447 | 3300009176 | Ga0105242_12410055 | Ga0105242_124100552 | 92 |
| 448 | 3300009176 | Ga0105242_12716358 | Ga0105242_127163582 | 92 |
| 449 | 3300009545 | Ga0105237_10018147 | Ga0105237_100181477 | 92 |
| 450 | 3300009545 | Ga0105237_11002543 | Ga0105237_110025432 | 92 |
| 451 | 3300009551 | Ga0105238_10010490 | Ga0105238_1001049014 | 92 |
| 452 | 3300009551 | Ga0105238_10966201 | Ga0105238_109662013 | 92 |
| 453 | 3300009829 | Ga0130086_1047822 | Ga0130086_10478221 | 92 |
| 454 | 3300009835 | Ga0130084_1078115 | Ga0130084_10781151 | 92 |
| 455 | 3300010375 | Ga0105239_10226370 | Ga0105239_102263703 | 92 |
| 456 | 3300011119 | Ga0105246_10282256 | Ga0105246_102822562 | 92 |
| 457 | 3300012487 | Ga0157321_1004051 | Ga0157321_10040512 | 92 |
| 458 | 3300012491 | Ga0157329_1002301 | Ga0157329_10023012 | 92 |
| 459 | 3300012494 | Ga0157341_1003106 | Ga0157341_10031062 | 92 |
| 460 | 3300012507 | Ga0157342_1006396 | Ga0157342_10063962 | 92 |
| 461 | 3300013045 | Ga0154016_124994 | Ga0154016_1249941 | 92 |
| 462 | 3300013102 | Ga0157371_10017613 | Ga0157371_100176137 | 92 |
| 463 | 3300013104 | Ga0157370_10007858 | Ga0157370_1000785817 | 92 |
| 464 | 3300013105 | Ga0157369_10001467 | Ga0157369_100014677 | 92 |
| 465 | 3300013105 | Ga0157369_10038301 | Ga0157369_1003830110 | 92 |
| 466 | 3300013105 | Ga0157369_10755143 | Ga0157369_107551432 | 92 |
| 467 | 3300013105 | Ga0157369_11613093 | Ga0157369_116130932 | 92 |
| 468 | 3300013296 | Ga0157374_10042287 | Ga0157374_100422874 | 92 |
| 469 | 3300013297 | Ga0157378_11038426 | Ga0157378_110384262 | 92 |
| 470 | 3300013297 | Ga0157378_11112864 | Ga0157378_111128642 | 92 |
| 471 | 3300013297 | Ga0157378_12947994 | Ga0157378_129479942 | 92 |
| 472 | 3300013306 | Ga0163162_11422846 | Ga0163162_114228461 | 92 |
| 473 | 3300013306 | Ga0163162_12455970 | Ga0163162_124559702 | 92 |
| 474 | 3300013307 | Ga0157372_12849947 | Ga0157372_128499472 | 92 |
| 475 | 3300014969 | Ga0157376_10232073 | Ga0157376_102320732 | 92 |
| 476 | 3300014969 | Ga0157376_10990920 | Ga0157376_109909203 | 92 |
| 477 | 3300014969 | Ga0157376_12181147 | Ga0157376_121811471 | 92 |
| 478 | 3300020069 | Ga0197907_10081451 | Ga0197907_100814513 | 92 |
| 479 | 3300020069 | Ga0197907_10108336 | Ga0197907_101083362 | 92 |
| 480 | 3300020069 | Ga0197907_10168473 | Ga0197907_101684732 | 92 |
| 481 | 3300020069 | Ga0197907_10933733 | Ga0197907_109337332 | 92 |
| 482 | 3300020069 | Ga0197907_11247002 | Ga0197907_112470023 | 92 |
| 483 | 3300020069 | Ga0197907_11336307 | Ga0197907_113363072 | 92 |
| 484 | 3300020070 | Ga0206356_10378442 | Ga0206356_103784424 | 92 |
| 485 | 3300020070 | Ga0206356_10701291 | Ga0206356_107012913 | 92 |
| 486 | 3300020070 | Ga0206356_10741805 | Ga0206356_107418052 | 92 |
| 487 | 3300020070 | Ga0206356_11085336 | Ga0206356_110853369 | 92 |
| 488 | 3300020070 | Ga0206356_11528920 | Ga0206356_115289204 | 92 |
| 489 | 3300020075 | Ga0206349_1260332 | Ga0206349_126033211 | 92 |
| 490 | 3300020076 | Ga0206355_1257286 | Ga0206355_12572866 | 92 |
| 491 | 3300020076 | Ga0206355_1345158 | Ga0206355_13451582 | 92 |
| 492 | 3300020077 | Ga0206351_10004618 | Ga0206351_100046185 | 92 |
| 493 | 3300020077 | Ga0206351_10108476 | Ga0206351_101084762 | 92 |
| 494 | 3300020077 | Ga0206351_10483248 | Ga0206351_104832481 | 92 |
| 495 | 3300020077 | Ga0206351_10864200 | Ga0206351_108642003 | 92 |
| 496 | 3300020078 | Ga0206352_10528760 | Ga0206352_105287602 | 92 |
| 497 | 3300020078 | Ga0206352_10681057 | Ga0206352_106810572 | 92 |
| 498 | 3300020078 | Ga0206352_10909807 | Ga0206352_109098073 | 92 |
| 499 | 3300020080 | Ga0206350_10132091 | Ga0206350_101320912 | 92 |
| 500 | 3300020080 | Ga0206350_10473798 | Ga0206350_104737982 | 92 |
| 501 | 3300020080 | Ga0206350_11175937 | Ga0206350_111759373 | 92 |
| 502 | 3300020080 | Ga0206350_11319711 | Ga0206350_113197112 | 92 |
| 503 | 3300020081 | Ga0206354_10127370 | Ga0206354_101273702 | 92 |
| 504 | 3300020081 | Ga0206354_10788811 | Ga0206354_107888113 | 92 |
| 505 | 3300020081 | Ga0206354_10812358 | Ga0206354_108123583 | 92 |
| 506 | 3300020082 | Ga0206353_11286618 | Ga0206353_112866181 | 92 |
| 507 | 3300020082 | Ga0206353_11364351 | Ga0206353_113643519 | 92 |
| 508 | 3300020082 | Ga0206353_11602891 | Ga0206353_116028913 | 92 |
| 509 | 3300020610 | Ga0154015_1168233 | Ga0154015_11682334 | 92 |
| 510 | 3300022467 | Ga0224712_10002654 | Ga0224712_100026542 | 92 |
| 511 | 3300022467 | Ga0224712_10061639 | Ga0224712_100616394 | 92 |
| 512 | 3300022467 | Ga0224712_10089706 | Ga0224712_100897063 | 92 |
| 513 | 3300022467 | Ga0224712_10309417 | Ga0224712_103094171 | 92 |
| 514 | 3300022467 | Ga0224712_10641793 | Ga0224712_106417931 | 92 |
| 515 | 3300025898 | Ga0207692_10000368 | Ga0207692_1000036811 | 92 |
| 516 | 3300025898 | Ga0207692_11212420 | Ga0207692_112124201 | 92 |
| 517 | 3300025899 | Ga0207642_10880050 | Ga0207642_108800501 | 92 |
| 518 | 3300025904 | Ga0207647_10000925 | Ga0207647_1000092511 | 92 |
| 519 | 3300025908 | Ga0207643_11042639 | Ga0207643_110426391 | 92 |
| 520 | 3300025909 | Ga0207705_10578872 | Ga0207705_105788722 | 92 |
| 521 | 3300025911 | Ga0207654_10001876 | Ga0207654_1000187611 | 92 |
| 522 | 3300025912 | Ga0207707_10001257 | Ga0207707_1000125720 | 92 |
| 523 | 3300025912 | Ga0207707_10011410 | Ga0207707_100114107 | 92 |
| 524 | 3300025912 | Ga0207707_11262091 | Ga0207707_112620912 | 92 |
| 525 | 3300025913 | Ga0207695_10000465 | Ga0207695_1000046538 | 92 |
| 526 | 3300025913 | Ga0207695_10038288 | Ga0207695_100382884 | 92 |
| 527 | 3300025914 | Ga0207671_10000128 | Ga0207671_1000012837 | 92 |
| 528 | 3300025916 | Ga0207663_10289418 | Ga0207663_102894183 | 92 |
| 529 | 3300025917 | Ga0207660_10012334 | Ga0207660_1001233412 | 92 |
| 530 | 3300025919 | Ga0207657_10068034 | Ga0207657_100680346 | 92 |
| 531 | 3300025919 | Ga0207657_10268714 | Ga0207657_102687142 | 92 |
| 532 | 3300025919 | Ga0207657_10632455 | Ga0207657_106324553 | 92 |
| 533 | 3300025921 | Ga0207652_10005398 | Ga0207652_1000539811 | 92 |
| 534 | 3300025921 | Ga0207652_10093052 | Ga0207652_100930522 | 92 |
| 535 | 3300025921 | Ga0207652_10354268 | Ga0207652_103542683 | 92 |
| 536 | 3300025921 | Ga0207652_10711700 | Ga0207652_107117003 | 92 |
| 537 | 3300025924 | Ga0207694_10000973 | Ga0207694_1000097327 | 92 |
| 538 | 3300025924 | Ga0207694_10315747 | Ga0207694_103157472 | 92 |
| 539 | 3300025924 | Ga0207694_10741905 | Ga0207694_107419052 | 92 |
| 540 | 3300025924 | Ga0207694_11258965 | Ga0207694_112589652 | 92 |
| 541 | 3300025925 | Ga0207650_11268530 | Ga0207650_112685301 | 92 |
| 542 | 3300025925 | Ga0207650_11615820 | Ga0207650_116158202 | 92 |
| 543 | 3300025927 | Ga0207687_10939029 | Ga0207687_109390292 | 92 |
| 544 | 3300025928 | Ga0207700_10373104 | Ga0207700_103731042 | 92 |
| 545 | 3300025929 | Ga0207664_10261305 | Ga0207664_102613054 | 92 |
| 546 | 3300025932 | Ga0207690_10007372 | Ga0207690_100073724 | 92 |
| 547 | 3300025932 | Ga0207690_10692724 | Ga0207690_106927242 | 92 |
| 548 | 3300025934 | Ga0207686_10932443 | Ga0207686_109324433 | 92 |
| 549 | 3300025935 | Ga0207709_10667301 | Ga0207709_106673012 | 92 |
| 550 | 3300025942 | Ga0207689_11631241 | Ga0207689_116312412 | 92 |
| 551 | 3300025944 | Ga0207661_10052310 | Ga0207661_100523106 | 92 |
| 552 | 3300025944 | Ga0207661_10602118 | Ga0207661_106021183 | 92 |
| 553 | 3300025945 | Ga0207679_12056165 | Ga0207679_120561652 | 92 |
| 554 | 3300025949 | Ga0207667_10023995 | Ga0207667_100239955 | 92 |
| 555 | 3300025949 | Ga0207667_10071618 | Ga0207667_100716183 | 92 |
| 556 | 3300025960 | Ga0207651_10587420 | Ga0207651_105874202 | 92 |
| 557 | 3300025981 | Ga0207640_10074941 | Ga0207640_100749414 | 92 |
| 558 | 3300025981 | Ga0207640_11786048 | Ga0207640_117860482 | 92 |
| 559 | 3300026023 | Ga0207677_10002332 | Ga0207677_1000233219 | 92 |
| 560 | 3300026041 | Ga0207639_10012050 | Ga0207639_1001205012 | 92 |
| 561 | 3300026078 | Ga0207702_10359869 | Ga0207702_103598693 | 92 |
| 562 | 3300026078 | Ga0207702_11066934 | Ga0207702_110669342 | 92 |
| 563 | 3300026078 | Ga0207702_11606273 | Ga0207702_116062733 | 92 |
| 564 | 3300026121 | Ga0207683_10245585 | Ga0207683_102455854 | 92 |
| 565 | 3300026142 | Ga0207698_10047616 | Ga0207698_100476167 | 92 |
| 566 | 3300026142 | Ga0207698_10518860 | Ga0207698_105188602 | 92 |
| 567 | 3300026142 | Ga0207698_11300448 | Ga0207698_113004482 | 92 |
| 568 | 3300028379 | Ga0268266_10036608 | Ga0268266_100366084 | 92 |
| 569 | 3300028786 | Ga0307517_10138635 | Ga0307517_101386352 | 92 |
| 570 | 3300028794 | Ga0307515_10465584 | Ga0307515_104655843 | 92 |
| 571 | 3300029280 | Ga0311011_142744 | Ga0311011_1427442 | 92 |
| 572 | 3300029285 | Ga0310981_1036808 | Ga0310981_10368082 | 92 |
| 573 | 3300030522 | Ga0307512_10008844 | Ga0307512_1000884411 | 92 |
| 574 | 3300030732 | Ga0316176_1099670 | Ga0316176_10996702 | 92 |
| 575 | 3300030736 | Ga0316180_1083427 | Ga0316180_10834272 | 92 |
| 576 | 3300030763 | Ga0265763_1005592 | Ga0265763_10055922 | 92 |
| 577 | 3300031456 | Ga0307513_10022677 | Ga0307513_1002267710 | 92 |
| 578 | 3300031456 | Ga0307513_10097294 | Ga0307513_100972944 | 92 |
| 579 | 3300031507 | Ga0307509_10012707 | Ga0307509_1001270712 | 92 |
| 580 | 3300031616 | Ga0307508_10344052 | Ga0307508_103440521 | 92 |
| 581 | 3300031616 | Ga0307508_10506916 | Ga0307508_105069161 | 92 |
| 582 | 3300031731 | Ga0307405_10537607 | Ga0307405_105376072 | 92 |
| 583 | 3300031852 | Ga0307410_10745674 | Ga0307410_107456742 | 92 |
| 584 | 3300031901 | Ga0307406_11412873 | Ga0307406_114128732 | 92 |
| 585 | 3300031995 | Ga0307409_100762549 | Ga0307409_1007625493 | 92 |
| 586 | 3300032126 | Ga0307415_100045269 | Ga0307415_1000452693 | 92 |
| 587 | 3300033179 | Ga0307507_10185206 | Ga0307507_101852062 | 92 |
| 588 | 3300034957 | Ga0373938_0006655 | Ga0373938_0006655_1392_1685 | 92 |
| 589 | 3300035116 | Ga0373945_0166032 | Ga0373945_0166032_295_579 | 92 |
| 590 | 3300035692 | Ga0373935_0084381 | Ga0373935_0084381_912_1196 | 92 |
| 591 | 3300036401 | Ga0373937_1945564 | Ga0373937_1945564_29_316 | 92 |
| 592 | 3300036459 | Ga0372808_003049 | Ga0372808_003049_1228_1536 | 92 |
| 593 | 3300037312 | Ga0395899_0377735 | Ga0395899_0377735_638_925 | 92 |
| 594 | 3300037418 | Ga0395900_0201144 | Ga0395900_0201144_1556_1843 | 92 |
| 595 | 3300037418 | Ga0395900_0286842 | Ga0395900_0286842_1175_1468 | 92 |
| 596 | 3300037418 | Ga0395900_0389667 | Ga0395900_0389667_771_1052 | 92 |
| 597 | 3300037466 | Ga0395898_0012144 | Ga0395898_0012144_8582_8869 | 92 |
| 598 | 3300037466 | Ga0395898_0379339 | Ga0395898_0379339_171_464 | 92 |
| 599 | 3300037853 | Ga0436364_0010700 | Ga0436364_0010700_90904_91191 | 92 |
| 600 | 3300037853 | Ga0436364_0741352 | Ga0436364_0741352_700_984 | 92 |
| 601 | 3300038443 | Ga0395901_0068330 | Ga0395901_0068330_785_1078 | 92 |
| 602 | 3300038443 | Ga0395901_0096897 | Ga0395901_0096897_2211_2498 | 92 |
| 603 | 3300039450 | Ga0436363_1218733 | Ga0436363_1218733_1048_1329 | 92 |
| 604 | 3300039453 | Ga0436362_0962826 | Ga0436362_0962826_135_416 | 92 |
| 605 | 3300039453 | Ga0436362_1251521 | Ga0436362_1251521_111_392 | 92 |
| 606 | 3300041404 | Ga0439436_0033428 | Ga0439436_0033428_889_1176 | 92 |
| 607 | 3300041406 | Ga0439439_0022670 | Ga0439439_0022670_42_329 | 92 |
| 608 | 3300041492 | Ga0451835_0283475 | Ga0451835_0283475_152_439 | 92 |
| 609 | 3300041512 | Ga0451853_2541022 | Ga0451853_2541022_263_550 | 92 |
| 610 | 3300042007 | Ga0439449_0038483 | Ga0439449_0038483_208_489 | 92 |
| 611 | 3300042007 | Ga0439449_0244300 | Ga0439449_0244300_128_409 | 92 |
| 612 | 3300042014 | Ga0439457_020414 | Ga0439457_020414_867_1154 | 92 |
| 613 | 3300042015 | Ga0439462_0255665 | Ga0439462_0255665_156_443 | 92 |
| 614 | 3300042122 | Ga0450920_022811 | Ga0450920_022811_584_871 | 92 |
| 615 | 3300042127 | Ga0450890_002547 | Ga0450890_002547_1557_1844 | 92 |
| 616 | 3300042131 | Ga0450894_005718 | Ga0450894_005718_294_581 | 92 |
| 617 | 3300042132 | Ga0450895_017014 | Ga0450895_017014_95_382 | 92 |
| 618 | 3300042133 | Ga0450896_000102 | Ga0450896_000102_3764_4051 | 92 |
| 619 | 3300042134 | Ga0450898_008092 | Ga0450898_008092_1108_1395 | 92 |
| 620 | 3300042135 | Ga0450899_000622 | Ga0450899_000622_3089_3376 | 92 |
| 621 | 3300042145 | Ga0450906_008805 | Ga0450906_008805_404_691 | 92 |
| 622 | 3300042184 | Ga0450908_001340 | Ga0450908_001340_728_1015 | 92 |
| 623 | 3300044656 | Ga0466969_0097189 | Ga0466969_0097189_856_1137 | 92 |
| 624 | 3300044656 | Ga0466969_0324119 | Ga0466969_0324119_198_479 | 92 |
| 625 | 3300044658 | Ga0466972_0007279 | Ga0466972_0007279_4241_4522 | 92 |
| 626 | 3300044658 | Ga0466972_0304699 | Ga0466972_0304699_237_518 | 92 |
| 627 | 3300044683 | Ga0466965_0033398 | Ga0466965_0033398_2077_2358 | 92 |
| 628 | 3300044683 | Ga0466965_0946484 | Ga0466965_0946484_72_353 | 92 |
| 629 | 3300044684 | Ga0466966_0121744 | Ga0466966_0121744_1088_1369 | 92 |
| 630 | 3300044684 | Ga0466966_0189226 | Ga0466966_0189226_710_991 | 92 |
| 631 | 3300044693 | Ga0466961_0010285 | Ga0466961_0010285_4880_5161 | 92 |
| 632 | 3300044693 | Ga0466961_0147544 | Ga0466961_0147544_710_991 | 92 |
| 633 | 3300044693 | Ga0466961_0223557 | Ga0466961_0223557_244_522 | 92 |
| 634 | 3300044693 | Ga0466961_0282666 | Ga0466961_0282666_281_580 | 92 |
| 635 | 3300044693 | Ga0466961_0387733 | Ga0466961_0387733_288_575 | 92 |
| 636 | 3300044694 | Ga0466963_0182357 | Ga0466963_0182357_595_882 | 92 |
| 637 | 3300044694 | Ga0466963_0201949 | Ga0466963_0201949_976_1260 | 92 |
| 638 | 3300044706 | Ga0466964_0230707 | Ga0466964_0230707_352_633 | 92 |
| 639 | 3300044706 | Ga0466964_0697825 | Ga0466964_0697825_274_555 | 92 |
| 640 | 3300044735 | Ga0466968_0030625 | Ga0466968_0030625_504_785 | 92 |
| 641 | 3300044765 | Ga0466970_0003384 | Ga0466970_0003384_2795_3076 | 92 |
| 642 | 3300044765 | Ga0466970_0018820 | Ga0466970_0018820_3283_3564 | 92 |
| 643 | 3300044901 | Ga0466960_0003887 | Ga0466960_0003887_1036_1317 | 92 |
| 644 | 3300045049 | Ga0466959_0056983 | Ga0466959_0056983_808_1089 | 92 |
| 645 | 3300045049 | Ga0466959_0172941 | Ga0466959_0172941_788_1069 | 92 |
| 646 | 3300045049 | Ga0466959_0741762 | Ga0466959_0741762_59_337 | 92 |
| 647 | 3300045836 | Ga0466958_0007393 | Ga0466958_0007393_5224_5505 | 92 |
| 648 | 3300045976 | Ga0466967_0414451 | Ga0466967_0414451_736_1017 | 92 |
| 649 | 3300045976 | Ga0466967_1762032 | Ga0466967_1762032_74_358 | 92 |
| 650 | 3300046454 | Ga0495592_0065762 | Ga0495592_0065762_385_672 | 92 |
| 651 | 3300046454 | Ga0495592_0295064 | Ga0495592_0295064_750_1031 | 92 |
| 652 | 3300046455 | Ga0495603_0216725 | Ga0495603_0216725_16_303 | 92 |
| 653 | 3300046457 | Ga0495590_0012257 | Ga0495590_0012257_1677_1961 | 92 |
| 654 | 3300046459 | Ga0495629_0856227 | Ga0495629_0856227_16_303 | 92 |
| 655 | 3300046460 | Ga0495638_0266682 | Ga0495638_0266682_29_316 | 92 |
| 656 | 3300046461 | Ga0495641_0046104 | Ga0495641_0046104_178_501 | 92 |
| 657 | 3300046462 | Ga0495651_0000169 | Ga0495651_0000169_23992_24276 | 92 |
| 658 | 3300046462 | Ga0495651_0001372 | Ga0495651_0001372_1909_2190 | 92 |
| 659 | 3300046462 | Ga0495651_0807383 | Ga0495651_0807383_12_299 | 92 |
| 660 | 3300046474 | Ga0495605_0047498 | Ga0495605_0047498_1436_1723 | 92 |
| 661 | 3300046476 | Ga0495662_0293132 | Ga0495662_0293132_65_352 | 92 |
| 662 | 3300046477 | Ga0495664_0122341 | Ga0495664_0122341_776_1063 | 92 |
| 663 | 3300046492 | Ga0495585_0070600 | Ga0495585_0070600_1208_1495 | 92 |
| 664 | 3300046500 | Ga0495596_0003837 | Ga0495596_0003837_2075_2359 | 92 |
| 665 | 3300046501 | Ga0495607_0004843 | Ga0495607_0004843_4981_5265 | 92 |
| 666 | 3300046506 | Ga0495583_0009440 | Ga0495583_0009440_2146_2433 | 92 |
| 667 | 3300046507 | Ga0495606_0010501 | Ga0495606_0010501_4359_4646 | 92 |
| 668 | 3300046511 | Ga0495608_0067863 | Ga0495608_0067863_989_1276 | 92 |
| 669 | 3300046512 | Ga0495610_0074796 | Ga0495610_0074796_1156_1440 | 92 |
| 670 | 3300046514 | Ga0495618_0017866 | Ga0495618_0017866_410_697 | 92 |
| 671 | 3300046515 | Ga0495620_0068552 | Ga0495620_0068552_410_694 | 92 |
| 672 | 3300046516 | Ga0495628_0016156 | Ga0495628_0016156_1497_1778 | 92 |
| 673 | 3300046516 | Ga0495628_0140174 | Ga0495628_0140174_1327_1614 | 92 |
| 674 | 3300046518 | Ga0495631_0038283 | Ga0495631_0038283_727_1014 | 92 |
| 675 | 3300046520 | Ga0495637_0103270 | Ga0495637_0103270_597_881 | 92 |
| 676 | 3300046522 | Ga0495643_0001180 | Ga0495643_0001180_21581_21865 | 92 |
| 677 | 3300046523 | Ga0495644_0276459 | Ga0495644_0276459_317_625 | 92 |
| 678 | 3300046523 | Ga0495644_0379260 | Ga0495644_0379260_199_486 | 92 |
| 679 | 3300046524 | Ga0495648_0024720 | Ga0495648_0024720_1557_1841 | 92 |
| 680 | 3300046529 | Ga0495652_0010757 | Ga0495652_0010757_7016_7303 | 92 |
| 681 | 3300046529 | Ga0495652_0018548 | Ga0495652_0018548_5623_5904 | 92 |
| 682 | 3300046530 | Ga0495654_0003279 | Ga0495654_0003279_5129_5416 | 92 |
| 683 | 3300046531 | Ga0495665_0032438 | Ga0495665_0032438_1930_2217 | 92 |
| 684 | 3300046533 | Ga0495640_0743072 | Ga0495640_0743072_51_338 | 92 |
| 685 | 3300046536 | Ga0495587_0413588 | Ga0495587_0413588_224_505 | 92 |
| 686 | 3300046538 | Ga0495609_0009614 | Ga0495609_0009614_4284_4568 | 92 |
| 687 | 3300046542 | Ga0495597_0052969 | Ga0495597_0052969_105_389 | 92 |
| 688 | 3300046543 | Ga0495645_0020520 | Ga0495645_0020520_2053_2334 | 92 |
| 689 | 3300046557 | Ga0495622_0031757 | Ga0495622_0031757_1645_1929 | 92 |
| 690 | 3300046558 | Ga0495633_0014557 | Ga0495633_0014557_568_855 | 92 |
| 691 | 3300046559 | Ga0495667_0056543 | Ga0495667_0056543_1176_1463 | 92 |
| 692 | 3300046559 | Ga0495667_0290983 | Ga0495667_0290983_531_812 | 92 |
| 693 | 3300046559 | Ga0495667_0667388 | Ga0495667_0667388_35_316 | 92 |
| 694 | 3300046642 | Ga0495634_0024406 | Ga0495634_0024406_3250_3537 | 92 |
| 695 | 3300046648 | Ga0495611_0009288 | Ga0495611_0009288_3760_4047 | 92 |
| 696 | 3300046660 | Ga0495625_0049329 | Ga0495625_0049329_1390_1677 | 92 |
| 697 | 3300046660 | Ga0495625_0592391 | Ga0495625_0592391_22_306 | 92 |
| 698 | 3300046663 | Ga0495635_0098521 | Ga0495635_0098521_1036_1323 | 92 |
| 699 | 3300046665 | Ga0495661_0090733 | Ga0495661_0090733_970_1257 | 92 |
| 700 | 3300046675 | Ga0495657_0047630 | Ga0495657_0047630_295_582 | 92 |
| 701 | 3300046675 | Ga0495657_0088733 | Ga0495657_0088733_241_549 | 92 |
| 702 | 3300046678 | Ga0495599_0221149 | Ga0495599_0221149_614_901 | 92 |
| 703 | 3300046680 | Ga0495646_0121733 | Ga0495646_0121733_377_658 | 92 |
| 704 | 3300046689 | Ga0495613_0839668 | Ga0495613_0839668_72_380 | 92 |
| 705 | 3300046690 | Ga0495624_0042222 | Ga0495624_0042222_2146_2433 | 92 |
| 706 | 3300046694 | Ga0495649_0077694 | Ga0495649_0077694_763_1050 | 92 |
| 707 | 3300046794 | Ga0495589_0074826 | Ga0495589_0074826_374_661 | 92 |
| 708 | 3300046809 | Ga0495600_0011482 | Ga0495600_0011482_813_1094 | 92 |
| 709 | 3300046809 | Ga0495600_0339868 | Ga0495600_0339868_282_569 | 92 |
| 710 | 3300046810 | Ga0495660_0045943 | Ga0495660_0045943_1385_1669 | 92 |
| 711 | 3300047315 | Ga0495581_0242218 | Ga0495581_0242218_501_788 | 92 |
| 712 | 3300047317 | Ga0495604_0198955 | Ga0495604_0198955_648_929 | 92 |
| 713 | 3300047318 | Ga0495636_0570312 | Ga0495636_0570312_178_465 | 92 |
| 714 | 3300047319 | Ga0495674_0158431 | Ga0495674_0158431_1262_1549 | 92 |
| 715 | 3300047319 | Ga0495674_0458138 | Ga0495674_0458138_719_1003 | 92 |
| 716 | 3300047320 | Ga0495672_0029562 | Ga0495672_0029562_1287_1574 | 92 |
| 717 | 3300047321 | Ga0495676_0346616 | Ga0495676_0346616_295_582 | 92 |
| 718 | 3300047321 | Ga0495676_0878541 | Ga0495676_0878541_193_516 | 92 |
| 719 | 3300047322 | Ga0495680_0258306 | Ga0495680_0258306_347_634 | 92 |
| 720 | 3300047323 | Ga0495683_0009389 | Ga0495683_0009389_4516_4803 | 92 |
| 721 | 3300047445 | Ga0495677_0116537 | Ga0495677_0116537_46_330 | 92 |
| 722 | 3300047446 | Ga0495679_052439 | Ga0495679_052439_875_1162 | 92 |
| 723 | 3300047447 | Ga0495685_105446 | Ga0495685_105446_351_635 | 92 |
| 724 | 3300047470 | Ga0495681_0057526 | Ga0495681_0057526_288_575 | 92 |
| 725 | 3300047471 | Ga0495684_0178913 | Ga0495684_0178913_1036_1323 | 92 |
| 726 | 3300047472 | Ga0495686_0016607 | Ga0495686_0016607_280_567 | 92 |
| 727 | 3300047673 | Ga0495593_0004470 | Ga0495593_0004470_6867_7154 | 92 |
| 728 | 3300048089 | Ga0495614_0081925 | Ga0495614_0081925_295_582 | 92 |
| 729 | 3300048090 | Ga0495615_0150865 | Ga0495615_0150865_43_330 | 92 |
| 730 | 3300048091 | Ga0495626_0014129 | Ga0495626_0014129_285_572 | 92 |
| 731 | 3300048907 | Ga0496104_0089127 | Ga0496104_0089127_2549_2872 | 92 |
| 732 | 3300048907 | Ga0496104_0466077 | Ga0496104_0466077_850_1131 | 92 |
| 733 | 3300048908 | Ga0496105_0059980 | Ga0496105_0059980_1916_2239 | 92 |
| 734 | 3300048911 | Ga0496108_0094197 | Ga0496108_0094197_1492_1815 | 92 |
| 735 | 3300048912 | Ga0496109_0195452 | Ga0496109_0195452_720_1043 | 92 |
| 736 | 3300048912 | Ga0496109_1195684 | Ga0496109_1195684_345_626 | 92 |
| 737 | 3300048913 | Ga0496110_0001862 | Ga0496110_0001862_8245_8568 | 92 |
| 738 | 3300048914 | Ga0496111_0020580 | Ga0496111_0020580_2310_2633 | 92 |
| 739 | 3300048917 | Ga0496114_0655080 | Ga0496114_0655080_575_880 | 92 |
| 740 | 3300048929 | Ga0496126_1155865 | Ga0496126_1155865_126_419 | 92 |
| 741 | 3300049127 | Ga0501306_002889 | Ga0501306_002889_324_611 | 92 |
| 742 | 3300049127 | Ga0501306_093857 | Ga0501306_093857_100_387 | 92 |
| 743 | 3300049128 | Ga0501308_000276 | Ga0501308_000276_324_611 | 92 |
| 744 | 3300049129 | Ga0501309_025458 | Ga0501309_025458_354_641 | 92 |
| 745 | 3300049160 | Ga0501304_005680 | Ga0501304_005680_324_611 | 92 |
| 746 | 3300049161 | Ga0501305_024295 | Ga0501305_024295_314_601 | 92 |
| 747 | 3300049162 | Ga0501307_000101 | Ga0501307_000101_2674_2961 | 92 |
| 748 | 3300049459 | Ga0495678_011561 | Ga0495678_011561_2473_2757 | 92 |
| 749 | 3300049460 | Ga0495682_0090884 | Ga0495682_0090884_726_1013 | 92 |
| 750 | 3300049527 | Ga0501311_065545 | Ga0501311_065545_190_483 | 92 |
| 751 | 3300049528 | Ga0501312_048349 | Ga0501312_048349_132_419 | 92 |
| 752 | 3300049532 | Ga0501316_026744 | Ga0501316_026744_258_545 | 92 |
| 753 | 3300049532 | Ga0501316_073835 | Ga0501316_073835_160_441 | 92 |
| 754 | 3300049533 | Ga0501317_000812 | Ga0501317_000812_322_609 | 92 |
| 755 | 3300049533 | Ga0501317_066142 | Ga0501317_066142_54_341 | 92 |
| 756 | 3300049538 | Ga0501322_013198 | Ga0501322_013198_252_539 | 92 |
| 757 | 3300049541 | Ga0501325_026113 | Ga0501325_026113_194_481 | 92 |
| 758 | 3300049542 | Ga0501326_02682 | Ga0501326_02682_312_599 | 92 |
| 759 | 3300049568 | Ga0501031_0076041 | Ga0501031_0076041_823_1107 | 92 |
| 760 | 3300049569 | Ga0501032_1063669 | Ga0501032_1063669_65_349 | 92 |
| 761 | 3300049570 | Ga0501033_0014092 | Ga0501033_0014092_4085_4369 | 92 |
| 762 | 3300049571 | Ga0501034_0027993 | Ga0501034_0027993_3394_3678 | 92 |
| 763 | 3300049571 | Ga0501034_0193563 | Ga0501034_0193563_317_622 | 92 |
| 764 | 3300049572 | Ga0501036_0027287 | Ga0501036_0027287_3395_3679 | 92 |
| 765 | 3300049572 | Ga0501036_1476200 | Ga0501036_1476200_28_315 | 92 |
| 766 | 3300049574 | Ga0501038_0539128 | Ga0501038_0539128_295_579 | 92 |
| 767 | 3300049579 | Ga0501043_0023095 | Ga0501043_0023095_1146_1430 | 92 |
| 768 | 3300049581 | Ga0501047_0023199 | Ga0501047_0023199_3642_3926 | 92 |
| 769 | 3300049586 | Ga0501070_0006424 | Ga0501070_0006424_3823_4128 | 92 |
| 770 | 3300049586 | Ga0501070_0018699 | Ga0501070_0018699_4876_5172 | 92 |
| 771 | 3300049586 | Ga0501070_0328045 | Ga0501070_0328045_548_832 | 92 |
| 772 | 3300049586 | Ga0501070_0695643 | Ga0501070_0695643_165_443 | 92 |
| 773 | 3300049589 | Ga0501073_0072398 | Ga0501073_0072398_273_578 | 92 |
| 774 | 3300049590 | Ga0501074_0002630 | Ga0501074_0002630_513_818 | 92 |
| 775 | 3300049741 | Ga0501079_0001234 | Ga0501079_0001234_15134_15439 | 92 |
| 776 | 3300049742 | Ga0501080_0039768 | Ga0501080_0039768_74_379 | 92 |
| 777 | 3300049742 | Ga0501080_0173230 | Ga0501080_0173230_723_1019 | 92 |
| 778 | 3300049822 | Ga0501035_0045392 | Ga0501035_0045392_2964_3248 | 92 |
| 779 | 3300049823 | Ga0501044_0038405 | Ga0501044_0038405_3423_3707 | 92 |
| 780 | 3300049824 | Ga0501045_0242225 | Ga0501045_0242225_1026_1310 | 92 |
| 781 | 3300050492 | nmdc:mga0yw44_45501_c1 | nmdc:mga0yw44_45501_c1_1376_1669 | 92 |
| 782 | 3300053077 | Ga0495601_0080406 | Ga0495601_0080406_1292_1573 | 92 |
| 783 | 3300053078 | Ga0495612_0016852 | Ga0495612_0016852_1032_1316 | 92 |
| 784 | 3300053085 | Ga0495619_0416108 | Ga0495619_0416108_42_326 | 92 |
| 785 | 3300053099 | Ga0500654_115131 | Ga0500654_115131_610_897 | 92 |
| 786 | 3300053100 | Ga0500660_129288 | Ga0500660_129288_22_303 | 92 |
| 787 | 3300053142 | Ga0500577_0001143 | Ga0500577_0001143_990_1271 | 92 |
| 788 | 3300054114 | Ga0501084_0120390 | Ga0501084_0120390_1117_1422 | 92 |
| 789 | 3300059504 | Ga0587082_037345 | Ga0587082_037345_293_577 | 92 |
| 790 | 3300059504 | Ga0587082_119777 | Ga0587082_119777_120_401 | 92 |
| 791 | 3300059506 | Ga0587085_040772 | Ga0587085_040772_271_561 | 92 |
| 792 | 3300059508 | Ga0587088_180665 | Ga0587088_180665_209_496 | 92 |
| 793 | 3300059510 | Ga0587090_055549 | Ga0587090_055549_91_381 | 92 |
| 794 | 3300059605 | Ga0587106_034110 | Ga0587106_034110_541_822 | 92 |
| 795 | 3300059622 | Ga0587099_052589 | Ga0587099_052589_193_483 | 92 |
| 796 | 3300059623 | Ga0587101_057370 | Ga0587101_057370_81_368 | 92 |
| 797 | 3300059644 | Ga0587075_017503 | Ga0587075_017503_119_400 | 92 |
| 798 | 3300059645 | Ga0587076_047041 | Ga0587076_047041_28_309 | 92 |
| 799 | 3300059653 | Ga0587108_010089 | Ga0587108_010089_16_306 | 92 |
| 800 | 3300060346 | Ga0587111_0025486 | Ga0587111_0025486_372_653 | 92 |
| 801 | 3300061719 | Ga0466962_0386486 | Ga0466962_0386486_179_460 | 92 |
| 802 | 3300061719 | Ga0466962_0394145 | Ga0466962_0394145_188_469 | 92 |
| 803 | 3300061719 | Ga0466962_0565371 | Ga0466962_0565371_32_319 | 92 |
| 804 | iso_pu_bacteria | 8055157932 | 8055160606 | 92 |
| 805 | 3300004799 | Ga0058863_11829867 | Ga0058863_118298672 | 93 |
| 806 | 3300004799 | Ga0058863_11940937 | Ga0058863_119409372 | 93 |
| 807 | 3300004800 | Ga0058861_10050561 | Ga0058861_100505613 | 93 |
| 808 | 3300004803 | Ga0058862_10269038 | Ga0058862_102690382 | 93 |
| 809 | 3300005327 | Ga0070658_10006748 | Ga0070658_100067489 | 93 |
| 810 | 3300005327 | Ga0070658_10021378 | Ga0070658_100213787 | 93 |
| 811 | 3300005327 | Ga0070658_10088897 | Ga0070658_100888973 | 93 |
| 812 | 3300005327 | Ga0070658_10790416 | Ga0070658_107904161 | 93 |
| 813 | 3300005329 | Ga0070683_101409968 | Ga0070683_1014099682 | 93 |
| 814 | 3300005329 | Ga0070683_102029734 | Ga0070683_1020297341 | 93 |
| 815 | 3300005336 | Ga0070680_100042527 | Ga0070680_1000425279 | 93 |
| 816 | 3300005336 | Ga0070680_100067854 | Ga0070680_1000678544 | 93 |
| 817 | 3300005337 | Ga0070682_100048057 | Ga0070682_1000480574 | 93 |
| 818 | 3300005339 | Ga0070660_100070032 | Ga0070660_1000700323 | 93 |
| 819 | 3300005339 | Ga0070660_100426356 | Ga0070660_1004263563 | 93 |
| 820 | 3300005339 | Ga0070660_101468367 | Ga0070660_1014683671 | 93 |
| 821 | 3300005366 | Ga0070659_100608461 | Ga0070659_1006084611 | 93 |
| 822 | 3300005435 | Ga0070714_100293622 | Ga0070714_1002936224 | 93 |
| 823 | 3300005435 | Ga0070714_100330017 | Ga0070714_1003300172 | 93 |
| 824 | 3300005435 | Ga0070714_101148405 | Ga0070714_1011484051 | 93 |
| 825 | 3300005435 | Ga0070714_102226935 | Ga0070714_1022269351 | 93 |
| 826 | 3300005436 | Ga0070713_100670831 | Ga0070713_1006708313 | 93 |
| 827 | 3300005436 | Ga0070713_100681717 | Ga0070713_1006817173 | 93 |
| 828 | 3300005436 | Ga0070713_100699666 | Ga0070713_1006996661 | 93 |
| 829 | 3300005436 | Ga0070713_102457547 | Ga0070713_1024575471 | 93 |
| 830 | 3300005437 | Ga0070710_10220178 | Ga0070710_102201782 | 93 |
| 831 | 3300005439 | Ga0070711_101467789 | Ga0070711_1014677892 | 93 |
| 832 | 3300005455 | Ga0070663_100036695 | Ga0070663_1000366957 | 93 |
| 833 | 3300005455 | Ga0070663_101121236 | Ga0070663_1011212361 | 93 |
| 834 | 3300005458 | Ga0070681_10189145 | Ga0070681_101891452 | 93 |
| 835 | 3300005458 | Ga0070681_11209480 | Ga0070681_112094802 | 93 |
| 836 | 3300005530 | Ga0070679_100087287 | Ga0070679_1000872874 | 93 |
| 837 | 3300005530 | Ga0070679_100169302 | Ga0070679_1001693024 | 93 |
| 838 | 3300005530 | Ga0070679_100506012 | Ga0070679_1005060122 | 93 |
| 839 | 3300005535 | Ga0070684_100088289 | Ga0070684_1000882896 | 93 |
| 840 | 3300005548 | Ga0070665_100666284 | Ga0070665_1006662842 | 93 |
| 841 | 3300005563 | Ga0068855_100235541 | Ga0068855_1002355414 | 93 |
| 842 | 3300005577 | Ga0068857_100873274 | Ga0068857_1008732742 | 93 |
| 843 | 3300005577 | Ga0068857_101358379 | Ga0068857_1013583792 | 93 |
| 844 | 3300005614 | Ga0068856_100256540 | Ga0068856_1002565403 | 93 |
| 845 | 3300005616 | Ga0068852_101960635 | Ga0068852_1019606352 | 93 |
| 846 | 3300006028 | Ga0070717_10761252 | Ga0070717_107612523 | 93 |
| 847 | 3300006028 | Ga0070717_10988004 | Ga0070717_109880042 | 93 |
| 848 | 3300006175 | Ga0070712_100510727 | Ga0070712_1005107272 | 93 |
| 849 | 3300006871 | Ga0075434_100760105 | Ga0075434_1007601054 | 93 |
| 850 | 3300006914 | Ga0075436_100286851 | Ga0075436_1002868513 | 93 |
| 851 | 3300007076 | Ga0075435_100514706 | Ga0075435_1005147062 | 93 |
| 852 | 3300009093 | Ga0105240_10311096 | Ga0105240_103110962 | 93 |
| 853 | 3300009093 | Ga0105240_11269647 | Ga0105240_112696472 | 93 |
| 854 | 3300009551 | Ga0105238_10593037 | Ga0105238_105930373 | 93 |
| 855 | 3300009551 | Ga0105238_11827189 | Ga0105238_118271892 | 93 |
| 856 | 3300011119 | Ga0105246_10726126 | Ga0105246_107261263 | 93 |
| 857 | 3300013045 | Ga0154016_113959 | Ga0154016_1139591 | 93 |
| 858 | 3300013100 | Ga0157373_10510066 | Ga0157373_105100663 | 93 |
| 859 | 3300013100 | Ga0157373_10936601 | Ga0157373_109366011 | 93 |
| 860 | 3300013102 | Ga0157371_10421555 | Ga0157371_104215552 | 93 |
| 861 | 3300013104 | Ga0157370_10006658 | Ga0157370_1000665817 | 93 |
| 862 | 3300013104 | Ga0157370_10036228 | Ga0157370_100362286 | 93 |
| 863 | 3300013104 | Ga0157370_10119394 | Ga0157370_101193946 | 93 |
| 864 | 3300013104 | Ga0157370_11406531 | Ga0157370_114065312 | 93 |
| 865 | 3300013105 | Ga0157369_10010753 | Ga0157369_1001075319 | 93 |
| 866 | 3300013105 | Ga0157369_10089330 | Ga0157369_100893303 | 93 |
| 867 | 3300013105 | Ga0157369_10353994 | Ga0157369_103539942 | 93 |
| 868 | 3300013105 | Ga0157369_10430309 | Ga0157369_104303095 | 93 |
| 869 | 3300013307 | Ga0157372_10367809 | Ga0157372_103678094 | 93 |
| 870 | 3300014325 | Ga0163163_10861787 | Ga0163163_108617871 | 93 |
| 871 | 3300014968 | Ga0157379_11552768 | Ga0157379_115527682 | 93 |
| 872 | 3300019162 | Ga0184597_102121 | Ga0184597_1021211 | 93 |
| 873 | 3300019176 | Ga0184596_120527 | Ga0184596_1205272 | 93 |
| 874 | 3300019182 | Ga0184598_143900 | Ga0184598_1439003 | 93 |
| 875 | 3300020069 | Ga0197907_10021336 | Ga0197907_100213361 | 93 |
| 876 | 3300020069 | Ga0197907_10178655 | Ga0197907_101786552 | 93 |
| 877 | 3300020069 | Ga0197907_10191899 | Ga0197907_101918993 | 93 |
| 878 | 3300020069 | Ga0197907_10411133 | Ga0197907_104111333 | 93 |
| 879 | 3300020069 | Ga0197907_10620284 | Ga0197907_1062028412 | 93 |
| 880 | 3300020069 | Ga0197907_11120812 | Ga0197907_111208122 | 93 |
| 881 | 3300020070 | Ga0206356_10028506 | Ga0206356_100285062 | 93 |
| 882 | 3300020070 | Ga0206356_10627949 | Ga0206356_106279496 | 93 |
| 883 | 3300020070 | Ga0206356_11190805 | Ga0206356_111908051 | 93 |
| 884 | 3300020070 | Ga0206356_11262576 | Ga0206356_112625762 | 93 |
| 885 | 3300020070 | Ga0206356_11602022 | Ga0206356_116020223 | 93 |
| 886 | 3300020075 | Ga0206349_1036328 | Ga0206349_103632813 | 93 |
| 887 | 3300020075 | Ga0206349_1272138 | Ga0206349_12721382 | 93 |
| 888 | 3300020075 | Ga0206349_1367676 | Ga0206349_13676761 | 93 |
| 889 | 3300020076 | Ga0206355_1136018 | Ga0206355_11360183 | 93 |
| 890 | 3300020076 | Ga0206355_1463886 | Ga0206355_14638863 | 93 |
| 891 | 3300020077 | Ga0206351_10144766 | Ga0206351_101447665 | 93 |
| 892 | 3300020077 | Ga0206351_10246258 | Ga0206351_102462581 | 93 |
| 893 | 3300020077 | Ga0206351_10420459 | Ga0206351_104204592 | 93 |
| 894 | 3300020077 | Ga0206351_10910345 | Ga0206351_109103453 | 93 |
| 895 | 3300020078 | Ga0206352_10099306 | Ga0206352_100993062 | 93 |
| 896 | 3300020078 | Ga0206352_10756477 | Ga0206352_107564773 | 93 |
| 897 | 3300020078 | Ga0206352_11254737 | Ga0206352_112547376 | 93 |
| 898 | 3300020080 | Ga0206350_10210497 | Ga0206350_102104973 | 93 |
| 899 | 3300020080 | Ga0206350_10457115 | Ga0206350_104571154 | 93 |
| 900 | 3300020080 | Ga0206350_10860066 | Ga0206350_108600661 | 93 |
| 901 | 3300020080 | Ga0206350_11039953 | Ga0206350_110399532 | 93 |
| 902 | 3300020081 | Ga0206354_10066967 | Ga0206354_100669676 | 93 |
| 903 | 3300020081 | Ga0206354_10396601 | Ga0206354_103966011 | 93 |
| 904 | 3300020082 | Ga0206353_10108410 | Ga0206353_101084101 | 93 |
| 905 | 3300020082 | Ga0206353_10375665 | Ga0206353_103756652 | 93 |
| 906 | 3300020082 | Ga0206353_10380596 | Ga0206353_103805963 | 93 |
| 907 | 3300020082 | Ga0206353_10438480 | Ga0206353_104384801 | 93 |
| 908 | 3300020082 | Ga0206353_10544706 | Ga0206353_105447063 | 93 |
| 909 | 3300020610 | Ga0154015_1074336 | Ga0154015_10743365 | 93 |
| 910 | 3300021358 | Ga0213873_10067970 | Ga0213873_100679703 | 93 |
| 911 | 3300021384 | Ga0213876_10000890 | Ga0213876_1000089012 | 93 |
| 912 | 3300022467 | Ga0224712_10000310 | Ga0224712_1000031012 | 93 |
| 913 | 3300022467 | Ga0224712_10087834 | Ga0224712_100878342 | 93 |
| 914 | 3300022467 | Ga0224712_10130000 | Ga0224712_101300002 | 93 |
| 915 | 3300022467 | Ga0224712_10367002 | Ga0224712_103670022 | 93 |
| 916 | 3300022467 | Ga0224712_10446542 | Ga0224712_104465421 | 93 |
| 917 | 3300022467 | Ga0224712_10614986 | Ga0224712_106149861 | 93 |
| 918 | 3300023672 | Ga0247553_104995 | Ga0247553_1049952 | 93 |
| 919 | 3300025898 | Ga0207692_10690750 | Ga0207692_106907501 | 93 |
| 920 | 3300025904 | Ga0207647_10256926 | Ga0207647_102569264 | 93 |
| 921 | 3300025906 | Ga0207699_10209075 | Ga0207699_102090754 | 93 |
| 922 | 3300025909 | Ga0207705_10001318 | Ga0207705_1000131819 | 93 |
| 923 | 3300025909 | Ga0207705_10024842 | Ga0207705_100248426 | 93 |
| 924 | 3300025909 | Ga0207705_10158625 | Ga0207705_101586251 | 93 |
| 925 | 3300025909 | Ga0207705_11321033 | Ga0207705_113210332 | 93 |
| 926 | 3300025909 | Ga0207705_11518445 | Ga0207705_115184452 | 93 |
| 927 | 3300025912 | Ga0207707_10008073 | Ga0207707_100080735 | 93 |
| 928 | 3300025913 | Ga0207695_10260408 | Ga0207695_102604081 | 93 |
| 929 | 3300025917 | Ga0207660_10660016 | Ga0207660_106600163 | 93 |
| 930 | 3300025919 | Ga0207657_10067642 | Ga0207657_100676427 | 93 |
| 931 | 3300025919 | Ga0207657_11297927 | Ga0207657_112979272 | 93 |
| 932 | 3300025921 | Ga0207652_10098495 | Ga0207652_100984954 | 93 |
| 933 | 3300025921 | Ga0207652_10137583 | Ga0207652_101375835 | 93 |
| 934 | 3300025921 | Ga0207652_10419946 | Ga0207652_104199463 | 93 |
| 935 | 3300025924 | Ga0207694_11707641 | Ga0207694_117076411 | 93 |
| 936 | 3300025928 | Ga0207700_11137821 | Ga0207700_111378212 | 93 |
| 937 | 3300025928 | Ga0207700_11552962 | Ga0207700_115529621 | 93 |
| 938 | 3300025929 | Ga0207664_10027344 | Ga0207664_100273444 | 93 |
| 939 | 3300025929 | Ga0207664_10526744 | Ga0207664_105267442 | 93 |
| 940 | 3300025929 | Ga0207664_10609877 | Ga0207664_106098772 | 93 |
| 941 | 3300025934 | Ga0207686_10469517 | Ga0207686_104695172 | 93 |
| 942 | 3300025936 | Ga0207670_11422169 | Ga0207670_114221691 | 93 |
| 943 | 3300025939 | Ga0207665_10033262 | Ga0207665_100332627 | 93 |
| 944 | 3300025939 | Ga0207665_10190852 | Ga0207665_101908522 | 93 |
| 945 | 3300025949 | Ga0207667_10017929 | Ga0207667_100179294 | 93 |
| 946 | 3300025949 | Ga0207667_10485599 | Ga0207667_104855994 | 93 |
| 947 | 3300026116 | Ga0207674_10736768 | Ga0207674_107367682 | 93 |
| 948 | 3300028379 | Ga0268266_10060046 | Ga0268266_100600468 | 93 |
| 949 | 3300028556 | Ga0265337_1000049 | Ga0265337_100004934 | 93 |
| 950 | 3300028558 | Ga0265326_10000822 | Ga0265326_1000082215 | 93 |
| 951 | 3300028563 | Ga0265319_1000220 | Ga0265319_100022024 | 93 |
| 952 | 3300028573 | Ga0265334_10000083 | Ga0265334_1000008340 | 93 |
| 953 | 3300028653 | Ga0265323_10050605 | Ga0265323_100506052 | 93 |
| 954 | 3300028654 | Ga0265322_10004536 | Ga0265322_100045363 | 93 |
| 955 | 3300028666 | Ga0265336_10001694 | Ga0265336_1000169416 | 93 |
| 956 | 3300028800 | Ga0265338_10000358 | Ga0265338_1000035853 | 93 |
| 957 | 3300028800 | Ga0265338_10256202 | Ga0265338_102562024 | 93 |
| 958 | 3300029957 | Ga0265324_10001390 | Ga0265324_1000139010 | 93 |
| 959 | 3300030760 | Ga0265762_1049178 | Ga0265762_10491783 | 93 |
| 960 | 3300030836 | Ga0265767_119800 | Ga0265767_1198001 | 93 |
| 961 | 3300030863 | Ga0265766_1010927 | Ga0265766_10109272 | 93 |
| 962 | 3300030889 | Ga0265761_101567 | Ga0265761_1015672 | 93 |
| 963 | 3300030889 | Ga0265761_102151 | Ga0265761_1021513 | 93 |
| 964 | 3300030889 | Ga0265761_104400 | Ga0265761_1044001 | 93 |
| 965 | 3300031238 | Ga0265332_10000675 | Ga0265332_1000067512 | 93 |
| 966 | 3300031240 | Ga0265320_10003833 | Ga0265320_1000383312 | 93 |
| 967 | 3300031241 | Ga0265325_10006148 | Ga0265325_100061484 | 93 |
| 968 | 3300031242 | Ga0265329_10118335 | Ga0265329_101183352 | 93 |
| 969 | 3300031247 | Ga0265340_10000796 | Ga0265340_1000079616 | 93 |
| 970 | 3300031249 | Ga0265339_10090109 | Ga0265339_100901092 | 93 |
| 971 | 3300031344 | Ga0265316_10007400 | Ga0265316_1000740014 | 93 |
| 972 | 3300031592 | Ga0310117_109253 | Ga0310117_1092533 | 93 |
| 973 | 3300031592 | Ga0310117_109454 | Ga0310117_1094542 | 93 |
| 974 | 3300031595 | Ga0265313_10017464 | Ga0265313_100174642 | 93 |
| 975 | 3300031614 | Ga0310103_104508 | Ga0310103_1045084 | 93 |
| 976 | 3300031615 | Ga0310107_113542 | Ga0310107_1135424 | 93 |
| 977 | 3300031616 | Ga0307508_10103681 | Ga0307508_101036816 | 93 |
| 978 | 3300031635 | Ga0310115_115158 | Ga0310115_1151581 | 93 |
| 979 | 3300031667 | Ga0310111_115972 | Ga0310111_1159722 | 93 |
| 980 | 3300031690 | Ga0310101_123079 | Ga0310101_1230791 | 93 |
| 981 | 3300031691 | Ga0316579_10071976 | Ga0316579_100719764 | 93 |
| 982 | 3300031711 | Ga0265314_10008203 | Ga0265314_1000820312 | 93 |
| 983 | 3300031712 | Ga0265342_10029921 | Ga0265342_100299213 | 93 |
| 984 | 3300031727 | Ga0316576_10003776 | Ga0316576_1000377611 | 93 |
| 985 | 3300031728 | Ga0316578_10010874 | Ga0316578_100108749 | 93 |
| 986 | 3300031815 | Ga0316045_120866 | Ga0316045_1208662 | 93 |
| 987 | 3300033545 | Ga0316214_1000853 | Ga0316214_10008534 | 93 |
| 988 | 3300033547 | Ga0316212_1007476 | Ga0316212_10074764 | 93 |
| 989 | 3300035398 | Ga0316574_0002694 | Ga0316574_0002694_4137_4436 | 93 |
| 990 | 3300035692 | Ga0373935_1118430 | Ga0373935_1118430_210_509 | 93 |
| 991 | 3300035724 | Ga0373933_0335038 | Ga0373933_0335038_108_404 | 93 |
| 992 | 3300036534 | Ga0310109_050305 | Ga0310109_050305_201_497 | 93 |
| 993 | 3300036535 | Ga0310110_022287 | Ga0310110_022287_162_458 | 93 |
| 994 | 3300036647 | Ga0316582_0022131 | Ga0316582_0022131_486_785 | 93 |
| 995 | 3300036712 | Ga0316584_0007224 | Ga0316584_0007224_3582_3881 | 93 |
| 996 | 3300037068 | Ga0373925_0000004 | Ga0373925_0000004_302451_302747 | 93 |
| 997 | 3300037466 | Ga0395898_0078143 | Ga0395898_0078143_1164_1460 | 93 |
| 998 | 3300038443 | Ga0395901_0220498 | Ga0395901_0220498_726_1022 | 93 |
| 999 | 3300038443 | Ga0395901_1574253 | Ga0395901_1574253_287_583 | 93 |
| 1000 | 3300039437 | Ga0436365_1257400 | Ga0436365_1257400_43915_44208 | 93 |
| 1001 | 3300039453 | Ga0436362_0792414 | Ga0436362_0792414_511_804 | 93 |
| 1002 | 3300042876 | Ga0451577_0368442 | Ga0451577_0368442_718_1011 | 93 |
| 1003 | 3300044693 | Ga0466961_0434621 | Ga0466961_0434621_107_400 | 93 |
| 1004 | 3300044693 | Ga0466961_0627642 | Ga0466961_0627642_176_475 | 93 |
| 1005 | 3300044706 | Ga0466964_0340009 | Ga0466964_0340009_263_544 | 93 |
| 1006 | 3300044765 | Ga0466970_0273099 | Ga0466970_0273099_421_720 | 93 |
| 1007 | 3300044842 | Ga0466957_0554770 | Ga0466957_0554770_400_690 | 93 |
| 1008 | 3300044901 | Ga0466960_0880029 | Ga0466960_0880029_86_367 | 93 |
| 1009 | 3300045976 | Ga0466967_0678173 | Ga0466967_0678173_558_854 | 93 |
| 1010 | 3300046459 | Ga0495629_0136009 | Ga0495629_0136009_195_494 | 93 |
| 1011 | 3300046517 | Ga0495630_0868987 | Ga0495630_0868987_342_641 | 93 |
| 1012 | 3300046524 | Ga0495648_0054915 | Ga0495648_0054915_1940_2224 | 93 |
| 1013 | 3300046531 | Ga0495665_0226066 | Ga0495665_0226066_321_623 | 93 |
| 1014 | 3300046678 | Ga0495599_0018530 | Ga0495599_0018530_3208_3498 | 93 |
| 1015 | 3300046678 | Ga0495599_0328383 | Ga0495599_0328383_525_821 | 93 |
| 1016 | 3300047319 | Ga0495674_0798347 | Ga0495674_0798347_24_320 | 93 |
| 1017 | 3300047322 | Ga0495680_0314129 | Ga0495680_0314129_31_333 | 93 |
| 1018 | 3300047471 | Ga0495684_0239299 | Ga0495684_0239299_353_652 | 93 |
| 1019 | 3300048918 | Ga0496115_0892587 | Ga0496115_0892587_200_496 | 93 |
| 1020 | 3300048919 | Ga0496116_0001739 | Ga0496116_0001739_10727_11014 | 93 |
| 1021 | 3300048921 | Ga0496118_0013367 | Ga0496118_0013367_820_1107 | 93 |
| 1022 | 3300048922 | Ga0496119_0009028 | Ga0496119_0009028_4419_4706 | 93 |
| 1023 | 3300048922 | Ga0496119_0095006 | Ga0496119_0095006_21_317 | 93 |
| 1024 | 3300048922 | Ga0496119_0108730 | Ga0496119_0108730_869_1165 | 93 |
| 1025 | 3300048923 | Ga0496120_0268798 | Ga0496120_0268798_350_637 | 93 |
| 1026 | 3300048923 | Ga0496120_0400801 | Ga0496120_0400801_60_356 | 93 |
| 1027 | 3300048924 | Ga0496121_0012636 | Ga0496121_0012636_3425_3712 | 93 |
| 1028 | 3300048929 | Ga0496126_0046941 | Ga0496126_0046941_45_341 | 93 |
| 1029 | 3300048929 | Ga0496126_0186755 | Ga0496126_0186755_1218_1514 | 93 |
| 1030 | 3300048929 | Ga0496126_0997735 | Ga0496126_0997735_178_474 | 93 |
| 1031 | 3300049534 | Ga0501318_047129 | Ga0501318_047129_267_557 | 93 |
| 1032 | 3300049581 | Ga0501047_0109201 | Ga0501047_0109201_1115_1411 | 93 |
| 1033 | 3300050512 | nmdc:mga0n895_316660_c1 | nmdc:mga0n895_316660_c1_138_434 | 93 |
| 1034 | 3300050513 | nmdc:mga0rr50_219225_c1 | nmdc:mga0rr50_219225_c1_659_964 | 93 |
| 1035 | 3300053077 | Ga0495601_0028869 | Ga0495601_0028869_80_379 | 93 |
| 1036 | 3300059477 | Ga0587084_066412 | Ga0587084_066412_330_626 | 93 |
| 1037 | 3300059478 | Ga0587093_019083 | Ga0587093_019083_465_761 | 93 |
| 1038 | 3300059492 | Ga0587073_0030599 | Ga0587073_0030599_368_679 | 93 |
| 1039 | 3300059492 | Ga0587073_0131699 | Ga0587073_0131699_86_382 | 93 |
| 1040 | 3300059504 | Ga0587082_015336 | Ga0587082_015336_217_513 | 93 |
| 1041 | 3300059505 | Ga0587083_0109780 | Ga0587083_0109780_18_314 | 93 |
| 1042 | 3300059507 | Ga0587086_025247 | Ga0587086_025247_99_395 | 93 |
| 1043 | 3300059511 | Ga0587091_019007 | Ga0587091_019007_649_945 | 93 |
| 1044 | 3300059512 | Ga0587092_163809 | Ga0587092_163809_184_480 | 93 |
| 1045 | 3300059513 | Ga0587094_091932 | Ga0587094_091932_233_529 | 93 |
| 1046 | 3300059607 | Ga0587125_010667 | Ga0587125_010667_302_598 | 93 |
| 1047 | 3300059623 | Ga0587101_131720 | Ga0587101_131720_174_470 | 93 |
| 1048 | 3300059630 | Ga0587128_064370 | Ga0587128_064370_124_420 | 93 |
| 1049 | 3300059640 | Ga0587067_017251 | Ga0587067_017251_367_663 | 93 |
| 1050 | 3300059640 | Ga0587067_081438 | Ga0587067_081438_190_486 | 93 |
| 1051 | 3300059641 | Ga0587068_059859 | Ga0587068_059859_72_368 | 93 |
| 1052 | 3300059641 | Ga0587068_098995 | Ga0587068_098995_268_564 | 93 |
| 1053 | 3300059642 | Ga0587069_040127 | Ga0587069_040127_316_612 | 93 |
| 1054 | 3300059643 | Ga0587072_017983 | Ga0587072_017983_435_731 | 93 |
| 1055 | 3300059646 | Ga0587078_034841 | Ga0587078_034841_189_485 | 93 |
| 1056 | 3300059647 | Ga0587079_115115 | Ga0587079_115115_273_581 | 93 |
| 1057 | 3300059647 | Ga0587079_199776 | Ga0587079_199776_47_343 | 93 |
| 1058 | iso_pu_bacteria | 2515154155 | 2515851622 | 93 |
| 1059 | iso_pu_bacteria | 2527291627 | 2528204321 | 93 |
| 1060 | iso_pu_bacteria | 2527291629 | 2528212109 | 93 |
| 1061 | iso_pu_bacteria | 2546825537 | 2546946892 | 93 |
| 1062 | iso_pu_bacteria | 2576861822 | 2579747599 | 93 |
| 1063 | iso_pu_bacteria | 2579778521 | 2579853564 | 93 |
| 1064 | iso_pu_bacteria | 2619618881 | 2619853755 | 93 |
| 1065 | iso_pu_bacteria | 2619619003 | 2620349851 | 93 |
| 1066 | iso_pu_bacteria | 2626541554 | 2626634898 | 93 |
| 1067 | iso_pu_bacteria | 2684623036 | 2686543593 | 93 |
| 1068 | iso_pu_bacteria | 2710264753 | 2710602553 | 93 |
| 1069 | iso_pu_bacteria | 2773857924 | 2774867014 | 93 |
| 1070 | iso_pu_bacteria | 2827628540 | 2827632191 | 93 |
| 1071 | iso_pu_bacteria | 2891554331 | 2891560654 | 93 |
| 1072 | iso_pu_bacteria | 2891562705 | 2891566098 | 93 |
| 1073 | iso_pu_bacteria | 8002775197 | 8002782898 | 93 |
| 1074 | iso_pu_bacteria | 8054913762 | 8054918466 | 93 |
| 1075 | iso_pu_bacteria | 8054920844 | 8054926293 | 93 |
| 1076 | 3300001904 | JGI24736J21556_1055518 | JGI24736J21556_10555182 | 94 |
| 1077 | 3300002067 | JGI24735J21928_10033557 | JGI24735J21928_100335573 | 94 |
| 1078 | 3300004800 | Ga0058861_11886292 | Ga0058861_118862922 | 94 |
| 1079 | 3300005339 | Ga0070660_100352206 | Ga0070660_1003522063 | 94 |
| 1080 | 3300005341 | Ga0070691_10948516 | Ga0070691_109485161 | 94 |
| 1081 | 3300005458 | Ga0070681_11166740 | Ga0070681_111667401 | 94 |
| 1082 | 3300005530 | Ga0070679_101410735 | Ga0070679_1014107351 | 94 |
| 1083 | 3300005539 | Ga0068853_102139212 | Ga0068853_1021392122 | 94 |
| 1084 | 3300005564 | Ga0070664_100373466 | Ga0070664_1003734662 | 94 |
| 1085 | 3300005578 | Ga0068854_101360982 | Ga0068854_1013609821 | 94 |
| 1086 | 3300005841 | Ga0068863_100002199 | Ga0068863_10000219921 | 94 |
| 1087 | 3300005844 | Ga0068862_100000836 | Ga0068862_10000083613 | 94 |
| 1088 | 3300009093 | Ga0105240_10541121 | Ga0105240_105411213 | 94 |
| 1089 | 3300009101 | Ga0105247_10000016 | Ga0105247_10000016219 | 94 |
| 1090 | 3300009101 | Ga0105247_10162144 | Ga0105247_101621443 | 94 |
| 1091 | 3300009174 | Ga0105241_10769724 | Ga0105241_107697242 | 94 |
| 1092 | 3300009177 | Ga0105248_10000035 | Ga0105248_10000035108 | 94 |
| 1093 | 3300009177 | Ga0105248_10002899 | Ga0105248_1000289923 | 94 |
| 1094 | 3300009551 | Ga0105238_10360208 | Ga0105238_103602083 | 94 |
| 1095 | 3300009551 | Ga0105238_10567265 | Ga0105238_105672652 | 94 |
| 1096 | 3300009553 | Ga0105249_10046324 | Ga0105249_100463247 | 94 |
| 1097 | 3300010375 | Ga0105239_11771672 | Ga0105239_117716722 | 94 |
| 1098 | 3300013306 | Ga0163162_11859319 | Ga0163162_118593192 | 94 |
| 1099 | 3300013307 | Ga0157372_10000069 | Ga0157372_1000006989 | 94 |
| 1100 | 3300013307 | Ga0157372_11165931 | Ga0157372_111659312 | 94 |
| 1101 | 3300014325 | Ga0163163_10006948 | Ga0163163_100069487 | 94 |
| 1102 | 3300014325 | Ga0163163_10018482 | Ga0163163_1001848211 | 94 |
| 1103 | 3300014968 | Ga0157379_10011242 | Ga0157379_1001124214 | 94 |
| 1104 | 3300020069 | Ga0197907_11327011 | Ga0197907_113270113 | 94 |
| 1105 | 3300020075 | Ga0206349_1822410 | Ga0206349_18224103 | 94 |
| 1106 | 3300020081 | Ga0206354_10153077 | Ga0206354_101530772 | 94 |
| 1107 | 3300020081 | Ga0206354_11645061 | Ga0206354_116450612 | 94 |
| 1108 | 3300020082 | Ga0206353_12071772 | Ga0206353_120717721 | 94 |
| 1109 | 3300025900 | Ga0207710_10000017 | Ga0207710_10000017114 | 94 |
| 1110 | 3300025904 | Ga0207647_10110271 | Ga0207647_101102714 | 94 |
| 1111 | 3300025909 | Ga0207705_10499446 | Ga0207705_104994462 | 94 |
| 1112 | 3300025911 | Ga0207654_10452296 | Ga0207654_104522962 | 94 |
| 1113 | 3300025912 | Ga0207707_10589153 | Ga0207707_105891532 | 94 |
| 1114 | 3300025913 | Ga0207695_10288003 | Ga0207695_102880033 | 94 |
| 1115 | 3300025917 | Ga0207660_10977196 | Ga0207660_109771962 | 94 |
| 1116 | 3300025921 | Ga0207652_11553125 | Ga0207652_115531252 | 94 |
| 1117 | 3300025924 | Ga0207694_10160599 | Ga0207694_101605992 | 94 |
| 1118 | 3300025941 | Ga0207711_10000134 | Ga0207711_1000013443 | 94 |
| 1119 | 3300025941 | Ga0207711_10002995 | Ga0207711_1000299523 | 94 |
| 1120 | 3300025945 | Ga0207679_10687782 | Ga0207679_106877822 | 94 |
| 1121 | 3300025949 | Ga0207667_10323762 | Ga0207667_103237622 | 94 |
| 1122 | 3300025949 | Ga0207667_10823106 | Ga0207667_108231063 | 94 |
| 1123 | 3300025961 | Ga0207712_10015493 | Ga0207712_100154934 | 94 |
| 1124 | 3300025981 | Ga0207640_10611943 | Ga0207640_106119432 | 94 |
| 1125 | 3300025986 | Ga0207658_10002262 | Ga0207658_1000226220 | 94 |
| 1126 | 3300026035 | Ga0207703_10019334 | Ga0207703_100193346 | 94 |
| 1127 | 3300026041 | Ga0207639_10105527 | Ga0207639_101055274 | 94 |
| 1128 | 3300026078 | Ga0207702_10160228 | Ga0207702_101602284 | 94 |
| 1129 | 3300026088 | Ga0207641_10009791 | Ga0207641_1000979112 | 94 |
| 1130 | 3300026142 | Ga0207698_12361088 | Ga0207698_123610882 | 94 |
| 1131 | 3300028380 | Ga0268265_10000156 | Ga0268265_1000015622 | 94 |
| 1132 | 3300041452 | Ga0451793_0664496 | Ga0451793_0664496_253_546 | 94 |
| 1133 | 3300044656 | Ga0466969_0541224 | Ga0466969_0541224_17_307 | 94 |
| 1134 | 3300044658 | Ga0466972_0154886 | Ga0466972_0154886_84_368 | 94 |
| 1135 | 3300044658 | Ga0466972_0244282 | Ga0466972_0244282_116_403 | 94 |
| 1136 | 3300044683 | Ga0466965_0665373 | Ga0466965_0665373_56_346 | 94 |
| 1137 | 3300044684 | Ga0466966_0171555 | Ga0466966_0171555_370_669 | 94 |
| 1138 | 3300044684 | Ga0466966_0387250 | Ga0466966_0387250_239_523 | 94 |
| 1139 | 3300044684 | Ga0466966_0597184 | Ga0466966_0597184_142_426 | 94 |
| 1140 | 3300044693 | Ga0466961_0005440 | Ga0466961_0005440_6108_6392 | 94 |
| 1141 | 3300044693 | Ga0466961_0041150 | Ga0466961_0041150_1089_1373 | 94 |
| 1142 | 3300044693 | Ga0466961_0501323 | Ga0466961_0501323_223_507 | 94 |
| 1143 | 3300044694 | Ga0466963_0016148 | Ga0466963_0016148_4275_4559 | 94 |
| 1144 | 3300044706 | Ga0466964_0011253 | Ga0466964_0011253_2328_2612 | 94 |
| 1145 | 3300044719 | Ga0466971_0001406 | Ga0466971_0001406_4277_4561 | 94 |
| 1146 | 3300044719 | Ga0466971_0224100 | Ga0466971_0224100_268_558 | 94 |
| 1147 | 3300044719 | Ga0466971_0378482 | Ga0466971_0378482_80_373 | 94 |
| 1148 | 3300044735 | Ga0466968_0249869 | Ga0466968_0249869_526_810 | 94 |
| 1149 | 3300044735 | Ga0466968_0647202 | Ga0466968_0647202_132_416 | 94 |
| 1150 | 3300044765 | Ga0466970_0031860 | Ga0466970_0031860_1475_1759 | 94 |
| 1151 | 3300044765 | Ga0466970_0107886 | Ga0466970_0107886_158_442 | 94 |
| 1152 | 3300044842 | Ga0466957_0001751 | Ga0466957_0001751_6882_7166 | 94 |
| 1153 | 3300044842 | Ga0466957_1163218 | Ga0466957_1163218_84_371 | 94 |
| 1154 | 3300044901 | Ga0466960_0038077 | Ga0466960_0038077_1895_2179 | 94 |
| 1155 | 3300044901 | Ga0466960_0281435 | Ga0466960_0281435_509_799 | 94 |
| 1156 | 3300044901 | Ga0466960_0557895 | Ga0466960_0557895_133_417 | 94 |
| 1157 | 3300045049 | Ga0466959_0045060 | Ga0466959_0045060_272_556 | 94 |
| 1158 | 3300045049 | Ga0466959_0116146 | Ga0466959_0116146_738_1043 | 94 |
| 1159 | 3300045049 | Ga0466959_0130095 | Ga0466959_0130095_1105_1389 | 94 |
| 1160 | 3300045836 | Ga0466958_0012657 | Ga0466958_0012657_917_1201 | 94 |
| 1161 | 3300045836 | Ga0466958_0182407 | Ga0466958_0182407_607_900 | 94 |
| 1162 | 3300045976 | Ga0466967_0045336 | Ga0466967_0045336_3455_3739 | 94 |
| 1163 | 3300045976 | Ga0466967_0064388 | Ga0466967_0064388_136_423 | 94 |
| 1164 | 3300045976 | Ga0466967_0617936 | Ga0466967_0617936_582_869 | 94 |
| 1165 | 3300048088 | Ga0495602_0915814 | Ga0495602_0915814_17_313 | 94 |
| 1166 | 3300048905 | Ga0496102_0153859 | Ga0496102_0153859_1632_1925 | 94 |
| 1167 | 3300048906 | Ga0496103_0161226 | Ga0496103_0161226_1074_1367 | 94 |
| 1168 | 3300048910 | Ga0496107_0253576 | Ga0496107_0253576_112_420 | 94 |
| 1169 | 3300048915 | Ga0496112_0350909 | Ga0496112_0350909_610_903 | 94 |
| 1170 | 3300048915 | Ga0496112_0419013 | Ga0496112_0419013_297_590 | 94 |
| 1171 | 3300048916 | Ga0496113_0394154 | Ga0496113_0394154_266_559 | 94 |
| 1172 | 3300048920 | Ga0496117_0021752 | Ga0496117_0021752_4274_4588 | 94 |
| 1173 | 3300048921 | Ga0496118_0011170 | Ga0496118_0011170_3235_3549 | 94 |
| 1174 | 3300048921 | Ga0496118_0046340 | Ga0496118_0046340_911_1231 | 94 |
| 1175 | 3300048922 | Ga0496119_0000855 | Ga0496119_0000855_35538_35846 | 94 |
| 1176 | 3300048922 | Ga0496119_0013889 | Ga0496119_0013889_5689_6030 | 94 |
| 1177 | 3300048923 | Ga0496120_0000372 | Ga0496120_0000372_65979_66287 | 94 |
| 1178 | 3300048924 | Ga0496121_0017835 | Ga0496121_0017835_6160_6507 | 94 |
| 1179 | 3300048924 | Ga0496121_0040377 | Ga0496121_0040377_35_355 | 94 |
| 1180 | 3300049573 | Ga0501037_0618337 | Ga0501037_0618337_96_380 | 94 |
| 1181 | 3300049580 | Ga0501046_0522737 | Ga0501046_0522737_363_647 | 94 |
| 1182 | 3300049581 | Ga0501047_0361296 | Ga0501047_0361296_748_1032 | 94 |
| 1183 | 3300049586 | Ga0501070_0166769 | Ga0501070_0166769_355_639 | 94 |
| 1184 | 3300049742 | Ga0501080_0449416 | Ga0501080_0449416_416_700 | 94 |
| 1185 | 3300049822 | Ga0501035_0341597 | Ga0501035_0341597_249_533 | 94 |
| 1186 | 3300049823 | Ga0501044_0088185 | Ga0501044_0088185_2520_2804 | 94 |
| 1187 | 3300053092 | Ga0500583_0011796 | Ga0500583_0011796_837_1142 | 94 |
| 1188 | 3300053129 | Ga0500628_070191 | Ga0500628_070191_32_325 | 94 |
| 1189 | 3300053153 | Ga0500616_0132586 | Ga0500616_0132586_75_380 | 94 |
| 1190 | 3300059490 | Ga0587066_089645 | Ga0587066_089645_284_571 | 94 |
| 1191 | 3300059504 | Ga0587082_082338 | Ga0587082_082338_160_447 | 94 |
| 1192 | 3300059655 | Ga0587114_017298 | Ga0587114_017298_36_323 | 94 |
| 1193 | 3300061719 | Ga0466962_0001686 | Ga0466962_0001686_2563_2847 | 94 |
| 1194 | 3300061719 | Ga0466962_0668870 | Ga0466962_0668870_158_448 | 94 |
| 1195 | iso_pu_bacteria | 2687453743 | 2689992356 | 94 |
| 1196 | iso_pu_bacteria | 2895880812 | 2895884603 | 94 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8fmw-assembly1.cif.gz_Q | the structure of a hibernating ribosome in the lyme disease pathogen | 0.8671 | 14 | 94 |
| 8fr8-assembly1.cif.gz_r | structure of mycobacterium smegmatis rsh bound to a 70s translation initiation complex | 0.8595 | 16 | 93 |
| 1i96-assembly1.cif.gz_Q | crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with the translation initiation factor if3 (c-terminal domain) | 0.8559 | 16 | 94 |
| 6hiv-assembly1.cif.gz_CQ | cryo-em structure of the trypanosoma brucei mitochondrial ribosome - this entry contains the complete mitoribosome | 0.8521 | 18 | 93 |
| 7ane-assembly1.cif.gz_k | leishmania major mitochondrial ribosome | 0.8506 | 18 | 92 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q8ID56_26_114_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.8798 | 18 | 94 | 2.40.50.140 |
| af_C6T0V9_1_79_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.852 | 17 | 94 | 2.40.50.140 |
| 5xyuQ00 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.8388 | 16 | 93 | 2.40.50.140 |
| af_Q9LHN1_1_100_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.8383 | 17 | 94 | 2.40.50.140 |
| af_Q03246_1_107_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.8383 | 16 | 92 | 2.40.50.140 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A5J6V8B7-F1-model_v4 | Small ribosomal subunit protein uS17 | 0.8856 | 16 | 94 |
GO:0003735
GO:0006412 GO:0019843 GO:0022627 |
| AF-A0A7X7L2N5-F1-model_v4 | Small ribosomal subunit protein uS17 | 0.885 | 16 | 94 |
GO:0003735
GO:0006412 GO:0019843 GO:0022627 |
| AF-A0A853CCF9-F1-model_v4 | Small ribosomal subunit protein uS17 | 0.8824 | 16 | 94 |
GO:0003735
GO:0006412 GO:0019843 GO:0022627 |
| AF-A0A1R1M581-F1-model_v4 | Small ribosomal subunit protein uS17 | 0.8823 | 16 | 94 |
GO:0003735
GO:0006412 GO:0019843 GO:0022627 |
| AF-A0A536EHN0-F1-model_v4 | Small ribosomal subunit protein uS17 | 0.8822 | 16 | 94 |
GO:0003735
GO:0006412 GO:0019843 GO:0022627 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar