F491534

General Info

Members Datasets Scaffolds Average Seq Length
1196 633 974 303

Family's Representative Sequence

Representative Sequence 3300046463|Ga0495653_0037943|Ga0495653_0037943_1448_2344
Length 298
Sequence MAKLPDFEALAIFAKVVELRSFAGAASELAMSKATVSKAVTRLEERLGARLFNRTSRRLALTDAGHKLADRATRLLADGEAAENEALAQSVAPRGLVRLAVPMTFGVKAVAPLLPEFFETYPEVSVDLHLSDATVDLIGEGFEIARRLFTMPRFTVAAPSYLKKHGRPTHPMHLAEHKCFSYAYLSTPNIWHYTNSAGEQASVRPGGLLRVNNGEAVMPSLIAGLGIAELPEFIVGDAISSGAVEVILKDWKQAEGAVHLVTPPGGPRPARVEALGDFLAAKLPGTCKRRPTKGGKLL

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
5 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
6 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
7 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
8 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
9 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
10 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
11 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
12 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
13 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
14 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
15 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
16 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
17 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
18 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
19 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
20 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
21 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
22 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
23 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
24 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
25 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
26 2643221651 Afipia sp. Root123D2 Isolate Unclassified
27 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
28 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
29 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
30 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
31 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
32 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
33 2791355199
34 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
35 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
36 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
37 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
38 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
39 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
40 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
41 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
42 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
43 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
44 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
45 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
46 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
47 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
48 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
49 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
50 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
51 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
52 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
53 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
54 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
55 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
56 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
57 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
58 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
59 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
60 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
61 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
62 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
63 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
64 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
65 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
66 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
67 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
68 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
69 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
70 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
71 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
72 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
73 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
74 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
75 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
76 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
77 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
78 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
79 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
80 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
81 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
82 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
83 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
84 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
85 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
86 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
87 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
88 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
89 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
90 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
91 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
92 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
93 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
94 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
95 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
96 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
97 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
98 2904699407
99 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
100 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
101 2906610324
102 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
103 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
104 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
105 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
106 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
107 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
108 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
109 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
110 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
111 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
112 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
113 2922425934
114 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
115 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
116 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
117 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
118 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
119 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
120 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
121 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
122 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
123 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
124 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
125 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
126 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
127 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
128 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
129 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
130 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
131 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
132 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
133 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
134 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
135 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
136 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
137 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
138 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
139 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
140 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
141 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
142 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
143 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
144 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
145 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
146 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
147 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
148 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
149 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
150 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
151 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
152 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
153 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
154 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
155 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
156 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
157 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
158 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
159 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
160 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
161 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
162 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
163 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
164 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
165 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
166 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
167 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
168 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
169 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
170 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
171 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
172 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
173 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
174 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
175 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
176 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
177 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
178 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
179 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
180 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
181 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
182 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
183 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
184 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
185 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
186 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
187 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
188 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
189 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
190 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
191 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
192 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
193 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
194 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
195 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
196 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
197 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
198 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
199 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
200 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
201 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
202 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
203 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
204 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
205 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
206 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
207 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
208 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
209 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
210 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
211 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
212 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
213 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
214 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
215 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
216 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
217 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
218 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
219 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
220 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
221 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
222 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
223 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
224 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
225 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
226 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
227 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
228 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
229 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
230 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
231 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
232 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
233 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
234 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
235 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
236 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
237 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
238 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
239 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
240 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
241 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
242 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
243 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
244 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
245 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
246 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
247 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
248 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
249 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
250 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
251 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
252 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
253 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
254 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
255 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
256 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
257 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
258 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
259 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
260 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
261 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
262 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
263 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
264 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
265 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
266 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
267 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
268 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
269 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
270 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
271 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
272 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
273 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
274 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
275 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
276 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
277 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
278 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
279 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
280 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
281 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
282 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
283 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
284 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
285 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
286 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
287 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
288 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
289 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
290 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
291 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
292 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
293 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
294 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
295 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
296 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
297 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
298 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
299 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
300 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
301 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
302 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
303 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
304 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
305 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
306 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
307 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
308 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
309 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
310 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
311 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
312 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
313 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
314 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
315 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
316 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
317 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
318 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
319 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
320 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
321 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
322 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
323 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
324 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
325 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
326 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
327 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
328 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
329 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
330 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
331 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
332 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
333 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
334 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
335 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
336 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
337 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
338 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
339 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
340 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
341 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
342 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
343 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
344 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
345 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
346 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
347 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
348 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
349 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
350 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
351 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
352 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
353 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
354 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
355 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
356 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
357 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
358 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
359 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
360 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
361 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
362 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
363 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
364 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
365 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
366 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
367 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
368 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
369 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
370 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
371 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
372 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
373 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
374 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
375 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
376 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
377 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
378 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
379 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
380 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
381 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
382 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
383 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
384 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
385 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
386 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
387 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
388 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
389 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
390 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
391 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
392 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
393 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
394 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
395 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
396 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
397 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
398 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
399 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
400 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
401 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
402 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
403 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
404 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
405 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
406 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
407 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
408 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
409 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
410 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
411 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
412 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
413 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
414 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
415 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
416 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
417 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
418 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
419 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
420 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
421 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
422 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
423 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
424 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
425 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
426 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
427 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
428 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
429 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
430 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
431 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
432 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
433 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
434 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
435 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
436 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
437 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
438 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
439 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
440 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
441 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
442 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
443 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
444 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
445 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
446 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
447 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
448 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
449 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
450 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
451 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
452 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
453 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
454 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
455 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
456 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
457 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
458 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
459 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
460 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
461 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
462 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
463 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
464 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
465 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
466 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
467 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
468 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
469 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
470 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
471 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
472 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
473 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
474 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
475 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
476 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
477 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
478 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
479 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
480 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
481 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
482 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
483 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
484 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
485 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
486 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
487 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
488 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
489 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
490 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
491 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
492 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
493 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
494 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
495 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
496 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
497 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
498 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
499 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
500 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
501 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
502 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
503 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
504 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
505 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
506 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
507 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
508 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
509 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
510 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
511 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
512 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
513 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
514 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
515 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
516 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
517 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
518 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
519 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
520 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
521 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
522 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
523 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
524 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
525 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
526 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
527 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
528 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
529 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
530 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
531 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
532 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
533 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
534 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
535 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
536 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
537 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
538 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
539 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
540 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
541 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
542 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
543 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
544 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
545 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
546 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
547 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
548 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
549 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
550 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
551 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
552 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
553 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
554 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
555 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
556 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
557 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
558 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
559 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
560 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
561 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
562 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
563 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
564 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
565 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
566 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
567 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
568 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
569 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
570 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
571 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
572 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
573 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
574 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
575 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
576 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
577 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
578 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
579 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
580 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
581 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
582 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
583 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
584 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
585 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
586 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
587 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
588 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
589 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
590 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
591 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
592 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
593 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
594 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
595 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
596 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
597 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
598 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
599 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
600 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
601 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
602 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
603 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
604 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
605 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
606 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
607 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
608 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
609 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
610 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
611 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
612 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
613 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
614 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
615 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
616 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
617 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
618 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
619 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
620 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
621 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
622 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
623 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
624 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
625 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
626 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
627 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
628 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
629 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
630 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
631 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
632 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
633 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 81.54
Metatranscriptomes 0.17
Isolates 18.29

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.21
Nodule 14.97
Rhizoplane 4.43
Rhizosphere 55.94
Stem 0
Stem Tuber 0
Unclassified 12.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10003240 3300001979 Bacteria 7183
2 JGI24739J22299_10001701 3300001989 Bacteria 8365
3 JGI25406J46586_10000133 3300003203 Bacteria 32510
4 JGI25406J46586_10001255 3300003203 Bacteria 11909
5 JGI25153J46596_10000371 3300003215 Bacteria 30777
6 JGI25153J46596_10019202 3300003215 Bacteria 2625
7 JGI25160J50197_1000678 3300003354 Bacteria 18870
8 JGI25160J50197_1017605 3300003354 Bacteria 2256
9 JGI25404J52841_10001741 3300003659 Bacteria 3938
10 JGI25404J52841_10002080 3300003659 Bacteria 3714
11 JGI25404J52841_10003832 3300003659 Bacteria 3007
12 JGI25404J52841_10033481 3300003659 Bacteria 1095
13 Ga0055542_1006371 3300003762 Bacteria 2530
14 Ga0055531_10005980 3300003794 Bacteria 6988
15 Ga0055543_1005948 3300004625 Bacteria 3031
16 Ga0065165_1001685 3300005262 Bacteria 22303
17 Ga0065165_1004072 3300005262 Bacteria 9480
18 Ga0065165_1011137 3300005262 Bacteria 3793
19 Ga0070658_10120295 3300005327 Bacteria 2182
20 Ga0070683_100003434 3300005329 Bacteria 12861
21 Ga0070683_100034098 3300005329 Bacteria 4648
22 Ga0070683_100137127 3300005329 Bacteria 2317
23 Ga0068869_100095218 3300005334 Bacteria 2246
24 Ga0070666_10124556 3300005335 Bacteria 1788
25 Ga0070680_100008274 3300005336 Bacteria 7957
26 Ga0070680_100086453 3300005336 Bacteria 2592
27 Ga0070680_100227457 3300005336 Bacteria 1575
28 Ga0070680_100244826 3300005336 Bacteria 1516
29 Ga0068868_100446864 3300005338 Bacteria 1124
30 Ga0070689_100124563 3300005340 Bacteria 2061
31 Ga0070661_100039075 3300005344 Bacteria 3457
32 Ga0070661_100128503 3300005344 Bacteria 1902
33 Ga0070668_100040165 3300005347 Bacteria 3580
34 Ga0070668_100206152 3300005347 Bacteria 1615
35 Ga0070669_100025831 3300005353 Bacteria 4221
36 Ga0070671_100062828 3300005355 Bacteria 3091
37 Ga0070674_100068180 3300005356 Bacteria 2505
38 Ga0070674_100131017 3300005356 Bacteria 1869
39 Ga0070673_100498952 3300005364 Bacteria 1101
40 Ga0070659_100083479 3300005366 Bacteria 2554
41 Ga0070709_10006064 3300005434 Bacteria 6579
42 Ga0070714_100021573 3300005435 Bacteria 5270
43 Ga0070714_100061439 3300005435 Bacteria 3227
44 Ga0070714_100211711 3300005435 Bacteria 1777
45 Ga0070714_100411043 3300005435 Bacteria 1281
46 Ga0070713_100012380 3300005436 Bacteria 6253
47 Ga0070713_100019302 3300005436 Bacteria 5201
48 Ga0070713_100028548 3300005436 Bacteria 4406
49 Ga0070713_100068744 3300005436 Bacteria 2985
50 Ga0070710_10021944 3300005437 Bacteria 3334
51 Ga0070711_100005721 3300005439 Bacteria 7455
52 Ga0070711_100006314 3300005439 Bacteria 7135
53 Ga0070711_100015903 3300005439 Bacteria 4767
54 Ga0070663_100078602 3300005455 Bacteria 2418
55 Ga0070663_100097511 3300005455 Bacteria 2189
56 Ga0070663_100129356 3300005455 Bacteria 1916
57 Ga0070663_100190268 3300005455 Bacteria 1597
58 Ga0070663_100227386 3300005455 Bacteria 1467
59 Ga0070678_100081554 3300005456 Bacteria 2452
60 Ga0070678_100160737 3300005456 Bacteria 1820
61 Ga0070662_100098106 3300005457 Bacteria 2212
62 Ga0070662_100427618 3300005457 Bacteria 1096
63 Ga0070681_10080393 3300005458 Bacteria 3215
64 Ga0070685_10030369 3300005466 Bacteria 3010
65 Ga0070706_100058712 3300005467 Bacteria 3551
66 Ga0070706_100361878 3300005467 Bacteria 1352
67 Ga0070679_100030709 3300005530 Bacteria 5306
68 Ga0070679_100111083 3300005530 Bacteria 2727
69 Ga0070679_100139229 3300005530 Bacteria 2407
70 Ga0070679_100170009 3300005530 Bacteria 2153
71 Ga0070684_100001737 3300005535 Bacteria 15848
72 Ga0070684_100010514 3300005535 Bacteria 7333
73 Ga0070684_100335588 3300005535 Bacteria 1389
74 Ga0068853_100001167 3300005539 Bacteria 18689
75 Ga0068853_100005211 3300005539 Bacteria 10168
76 Ga0068853_100075816 3300005539 Bacteria 2936
77 Ga0068853_100081100 3300005539 Bacteria 2840
78 Ga0068853_100272272 3300005539 Bacteria 1559
79 Ga0070672_100422676 3300005543 Bacteria 1145
80 Ga0070665_100078112 3300005548 Bacteria 3316
81 Ga0070665_100113165 3300005548 Bacteria 2716
82 Ga0070665_100198970 3300005548 Bacteria 2004
83 Ga0070665_100371102 3300005548 Bacteria 1438
84 Ga0068855_100006609 3300005563 Bacteria 14087
85 Ga0068855_100024736 3300005563 Bacteria 7184
86 Ga0068855_100089780 3300005563 Bacteria 3547
87 Ga0068855_100253725 3300005563 Bacteria 1961
88 Ga0068857_100008553 3300005577 Bacteria 8850
89 Ga0068857_100009553 3300005577 Bacteria 8423
90 Ga0068857_100088595 3300005577 Bacteria 2769
91 Ga0068854_100003740 3300005578 Bacteria 9510
92 Ga0068854_100150709 3300005578 Bacteria 1793
93 Ga0068854_100175380 3300005578 Bacteria 1671
94 Ga0068856_100000046 3300005614 Bacteria 109174
95 Ga0068856_100211995 3300005614 Bacteria 1952
96 Ga0070702_100250351 3300005615 Bacteria 1200
97 Ga0068852_100052205 3300005616 Bacteria 3513
98 Ga0068852_100064164 3300005616 Bacteria 3201
99 Ga0068852_100102292 3300005616 Bacteria 2588
100 Ga0068859_100049211 3300005617 Bacteria 4233
101 Ga0068859_100640173 3300005617 Bacteria 1155
102 Ga0068864_100032861 3300005618 Bacteria 4409
103 Ga0068861_100046356 3300005719 Bacteria 3276
104 Ga0068851_10000375 3300005834 Bacteria 20232
105 Ga0068851_10006569 3300005834 Bacteria 5317
106 Ga0068858_100088777 3300005842 Bacteria 2876
107 Ga0068858_100648682 3300005842 Bacteria 1026
108 Ga0068860_100087140 3300005843 Bacteria 2972
109 Ga0068860_100478164 3300005843 Bacteria 1241
110 Ga0081455_10001281 3300005937 Bacteria 31263
111 Ga0081455_10005322 3300005937 Bacteria 14133
112 Ga0081455_10022178 3300005937 Bacteria 5942
113 Ga0081455_10038296 3300005937 Bacteria 4247
114 Ga0081455_10071810 3300005937 Bacteria 2868
115 Ga0081540_1000593 3300005983 Bacteria 34646
116 Ga0081540_1004374 3300005983 Bacteria 10802
117 Ga0081540_1005482 3300005983 Bacteria 9468
118 Ga0081540_1006150 3300005983 Bacteria 8811
119 Ga0081540_1007526 3300005983 Bacteria 7753
120 Ga0081540_1008353 3300005983 Bacteria 7236
121 Ga0081540_1025136 3300005983 Bacteria 3437
122 Ga0081540_1028243 3300005983 Bacteria 3156
123 Ga0081540_1047939 3300005983 Bacteria 2144
124 Ga0081539_10000099 3300005985 Bacteria 201018
125 Ga0081539_10000540 3300005985 Bacteria 78243
126 Ga0081539_10024335 3300005985 Bacteria 3933
127 Ga0070717_10019892 3300006028 Bacteria 5272
128 Ga0070717_10025976 3300006028 Bacteria 4668
129 Ga0075365_10023866 3300006038 Bacteria 3851
130 Ga0075365_10034666 3300006038 Bacteria 3260
131 Ga0075365_10056359 3300006038 Bacteria 2612
132 Ga0075365_10070672 3300006038 Bacteria 2349
133 Ga0075365_10191308 3300006038 Bacteria 1432
134 Ga0075363_100009873 3300006048 Bacteria 4504
135 Ga0070715_10004432 3300006163 Bacteria 4607
136 Ga0070716_100024043 3300006173 Bacteria 3239
137 Ga0070712_100035302 3300006175 Bacteria 3394
138 Ga0070712_100047857 3300006175 Bacteria 2961
139 Ga0070712_100049612 3300006175 Bacteria 2916
140 Ga0070712_100055917 3300006175 Bacteria 2766
141 Ga0075362_10019479 3300006177 Bacteria 2822
142 Ga0075367_10026687 3300006178 Bacteria 3277
143 Ga0075367_10084503 3300006178 Bacteria 1924
144 Ga0075367_10123004 3300006178 Bacteria 1600
145 Ga0075369_10014471 3300006186 Bacteria 3151
146 Ga0075369_10081319 3300006186 Bacteria 1437
147 Ga0075366_10015948 3300006195 Bacteria 4313
148 Ga0075366_10024275 3300006195 Bacteria 3536
149 Ga0097621_100301754 3300006237 Bacteria 1415
150 Ga0075370_10082434 3300006353 Bacteria 1850
151 Ga0075370_10120580 3300006353 Bacteria 1527
152 Ga0075434_100052099 3300006871 Bacteria 4066
153 Ga0075429_100306272 3300006880 Bacteria 1391
154 Ga0097620_100049210 3300006931 Bacteria 4233
155 Ga0097620_100640191 3300006931 Bacteria 1155
156 Ga0099825_1033319 3300006941 Bacteria 2009
157 Ga0099822_1000157 3300006943 Bacteria 48143
158 Ga0099822_1041031 3300006943 Bacteria 2524
159 Ga0099823_1038597 3300006944 Bacteria 3554
160 Ga0099795_10021931 3300007788 Bacteria 2102
161 Ga0099795_10043275 3300007788 Bacteria 1611
162 Ga0105240_10001197 3300009093 Bacteria 45241
163 Ga0105240_10004093 3300009093 Bacteria 22404
164 Ga0105240_10008326 3300009093 Bacteria 14839
165 Ga0105240_10019367 3300009093 Bacteria 9095
166 Ga0105240_10021579 3300009093 Bacteria 8564
167 Ga0105240_10061754 3300009093 Bacteria 4669
168 Ga0105240_10082281 3300009093 Bacteria 3954
169 Ga0105240_10084380 3300009093 Bacteria 3895
170 Ga0105240_10097953 3300009093 Bacteria 3573
171 Ga0105240_10146948 3300009093 Bacteria 2812
172 Ga0105240_10411072 3300009093 Bacteria 1522
173 Ga0105240_10658832 3300009093 Bacteria 1147
174 Ga0105245_10095059 3300009098 Bacteria 2748
175 Ga0105247_10025196 3300009101 Bacteria 3588
176 Ga0105247_10139172 3300009101 Bacteria 1589
177 Ga0105247_10380066 3300009101 Bacteria 1001
178 Ga0105241_10009544 3300009174 Bacteria 7129
179 Ga0105241_10084517 3300009174 Bacteria 2492
180 Ga0105248_10000001 3300009177 Bacteria 1881304
181 Ga0105237_10008240 3300009545 Bacteria 11316
182 Ga0105237_10043361 3300009545 Bacteria 4532
183 Ga0105237_10082171 3300009545 Bacteria 3212
184 Ga0105237_10126193 3300009545 Bacteria 2553
185 Ga0105237_10252266 3300009545 Bacteria 1766
186 Ga0105237_10365773 3300009545 Bacteria 1447
187 Ga0105237_10664001 3300009545 Bacteria 1049
188 Ga0105238_10003746 3300009551 Bacteria 15114
189 Ga0105238_10003767 3300009551 Bacteria 15070
190 Ga0105238_10006093 3300009551 Bacteria 11960
191 Ga0105238_10006431 3300009551 Bacteria 11688
192 Ga0105238_10055299 3300009551 Bacteria 3984
193 Ga0105238_10092078 3300009551 Bacteria 3019
194 Ga0105238_10142801 3300009551 Bacteria 2371
195 Ga0105238_10269200 3300009551 Bacteria 1684
196 Ga0099796_10024147 3300010159 Bacteria 1906
197 Ga0105239_10019170 3300010375 Bacteria 7557
198 Ga0105239_10023758 3300010375 Bacteria 6750
199 Ga0105239_10026562 3300010375 Bacteria 6372
200 Ga0105239_10033754 3300010375 Bacteria 5618
201 Ga0105239_10079923 3300010375 Bacteria 3598
202 Ga0105239_10151152 3300010375 Bacteria 2591
203 Ga0105239_10174356 3300010375 Bacteria 2405
204 Ga0105239_10475588 3300010375 Bacteria 1419
205 Ga0105239_10749881 3300010375 Bacteria 1117
206 Ga0105246_10011337 3300011119 Bacteria 5533
207 Ga0105246_10151539 3300011119 Bacteria 1756
208 Ga0105246_10280480 3300011119 Bacteria 1336
209 Ga0157370_10042220 3300013104 Bacteria 4396
210 Ga0157370_10044446 3300013104 Bacteria 4270
211 Ga0157370_10047747 3300013104 Bacteria 4103
212 Ga0157370_10049797 3300013104 Bacteria 4008
213 Ga0157370_10249774 3300013104 Bacteria 1641
214 Ga0157369_10004737 3300013105 Bacteria 15983
215 Ga0157369_10016172 3300013105 Bacteria 8398
216 Ga0157369_10053866 3300013105 Bacteria 4345
217 Ga0157369_10060994 3300013105 Bacteria 4066
218 Ga0157369_10305283 3300013105 Bacteria 1655
219 Ga0157369_10329069 3300013105 Bacteria 1588
220 Ga0157374_10439642 3300013296 Bacteria 1305
221 Ga0157378_10015652 3300013297 Bacteria 6644
222 Ga0157378_10046086 3300013297 Bacteria 3876
223 Ga0163162_10174231 3300013306 Bacteria 2276
224 Ga0157372_10045762 3300013307 Bacteria 4856
225 Ga0157372_10105931 3300013307 Bacteria 3216
226 Ga0157372_10695279 3300013307 Bacteria 1183
227 Ga0157375_10123008 3300013308 Bacteria 2707
228 Ga0157375_10812339 3300013308 Bacteria 1083
229 Ga0163163_10006013 3300014325 Bacteria 10560
230 Ga0163163_10047767 3300014325 Bacteria 4208
231 Ga0163163_10320384 3300014325 Bacteria 1604
232 Ga0157380_10587038 3300014326 Bacteria 1100
233 Ga0157380_10632504 3300014326 Bacteria 1064
234 Ga0163161_10211273 3300017792 Bacteria 1499
235 Ga0206353_12034910 3300020082 Bacteria 2116
236 Ga0214544_1000003 3300021320 Bacteria 643752
237 Ga0214542_1000022 3300021321 Bacteria 193578
238 Ga0214545_1000010 3300021324 Bacteria 193578
239 Ga0214543_1000035 3300021327 Bacteria 183100
240 Ga0213872_10049871 3300021361 Bacteria 1901
241 Ga0209563_105359 3300025230 Bacteria 2336
242 Ga0209677_105299 3300025253 Bacteria 3405
243 Ga0209148_1000335 3300025254 Bacteria 63754
244 Ga0209233_1025811 3300025261 Bacteria 1447
245 Ga0209455_1002543 3300025272 Bacteria 6976
246 Ga0209564_1000503 3300025295 Bacteria 64437
247 Ga0209564_1005823 3300025295 Bacteria 6873
248 Ga0209564_1009493 3300025295 Bacteria 4621
249 Ga0209564_1017199 3300025295 Bacteria 2831
250 Ga0209758_1000106 3300025297 Bacteria 218450
251 Ga0209758_1000344 3300025297 Bacteria 85133
252 Ga0209758_1001326 3300025297 Bacteria 30016
253 Ga0209758_1002294 3300025297 Bacteria 19787
254 Ga0209758_1003819 3300025297 Bacteria 13240
255 Ga0209758_1009962 3300025297 Bacteria 5783
256 Ga0209758_1017145 3300025297 Bacteria 3628
257 Ga0209256_1004815 3300025299 Bacteria 8187
258 Ga0207426_1000440 3300025302 Bacteria 66997
259 Ga0207426_1000819 3300025302 Bacteria 33379
260 Ga0207426_1017585 3300025302 Bacteria 2537
261 Ga0209051_1039340 3300025303 Bacteria 1709
262 Ga0209257_1000819 3300025304 Bacteria 45046
263 Ga0209257_1007500 3300025304 Bacteria 6562
264 Ga0209257_1019000 3300025304 Bacteria 2610
265 Ga0209257_1026694 3300025304 Bacteria 1939
266 Ga0207656_10001607 3300025321 Bacteria 7517
267 Ga0207692_10000264 3300025898 Bacteria 17986
268 Ga0207692_10012181 3300025898 Bacteria 3686
269 Ga0207688_10065618 3300025901 Bacteria 2052
270 Ga0207680_10057239 3300025903 Bacteria 2358
271 Ga0207647_10005180 3300025904 Bacteria 9593
272 Ga0207647_10150183 3300025904 Bacteria 1362
273 Ga0207685_10018555 3300025905 Bacteria 2274
274 Ga0207699_10007722 3300025906 Bacteria 5266
275 Ga0207699_10034863 3300025906 Bacteria 2858
276 Ga0207645_10194183 3300025907 Bacteria 1334
277 Ga0207645_10250729 3300025907 Bacteria 1171
278 Ga0207705_10015948 3300025909 Bacteria 5393
279 Ga0207684_10028686 3300025910 Bacteria 4741
280 Ga0207684_10276110 3300025910 Bacteria 1450
281 Ga0207654_10000212 3300025911 Bacteria 35772
282 Ga0207654_10088868 3300025911 Bacteria 1878
283 Ga0207707_10001530 3300025912 Bacteria 21349
284 Ga0207707_10118209 3300025912 Bacteria 2317
285 Ga0207695_10000012 3300025913 Bacteria 840961
286 Ga0207695_10000123 3300025913 Bacteria 232059
287 Ga0207695_10002042 3300025913 Bacteria 30945
288 Ga0207695_10024485 3300025913 Bacteria 6790
289 Ga0207695_10053040 3300025913 Bacteria 4244
290 Ga0207695_10061763 3300025913 Bacteria 3871
291 Ga0207695_10099850 3300025913 Bacteria 2899
292 Ga0207695_10211105 3300025913 Bacteria 1852
293 Ga0207695_10265528 3300025913 Bacteria 1613
294 Ga0207695_10321474 3300025913 Bacteria 1437
295 Ga0207671_10002081 3300025914 Bacteria 21897
296 Ga0207671_10012099 3300025914 Bacteria 6967
297 Ga0207671_10039297 3300025914 Bacteria 3504
298 Ga0207671_10168384 3300025914 Bacteria 1700
299 Ga0207693_10004353 3300025915 Bacteria 11975
300 Ga0207693_10005579 3300025915 Bacteria 10469
301 Ga0207693_10021458 3300025915 Bacteria 5131
302 Ga0207693_10042871 3300025915 Bacteria 3561
303 Ga0207663_10003268 3300025916 Bacteria 7910
304 Ga0207663_10022584 3300025916 Bacteria 3599
305 Ga0207663_10041046 3300025916 Bacteria 2817
306 Ga0207663_10141865 3300025916 Bacteria 1674
307 Ga0207660_10001829 3300025917 Bacteria 14174
308 Ga0207660_10173882 3300025917 Bacteria 1669
309 Ga0207657_10010330 3300025919 Bacteria 9320
310 Ga0207649_10054349 3300025920 Bacteria 2492
311 Ga0207652_10006474 3300025921 Bacteria 9442
312 Ga0207652_10229266 3300025921 Bacteria 1674
313 Ga0207646_10031950 3300025922 Bacteria 4765
314 Ga0207681_10231181 3300025923 Bacteria 1435
315 Ga0207681_10448473 3300025923 Bacteria 1049
316 Ga0207694_10000156 3300025924 Bacteria 70186
317 Ga0207694_10000826 3300025924 Bacteria 27601
318 Ga0207694_10231246 3300025924 Bacteria 1510
319 Ga0207650_10467272 3300025925 Bacteria 1051
320 Ga0207659_10404086 3300025926 Bacteria 1143
321 Ga0207687_10096865 3300025927 Bacteria 2163
322 Ga0207687_10285179 3300025927 Bacteria 1325
323 Ga0207700_10025918 3300025928 Bacteria 4080
324 Ga0207700_10081539 3300025928 Bacteria 2526
325 Ga0207700_10159011 3300025928 Bacteria 1875
326 Ga0207700_10383268 3300025928 Bacteria 1230
327 Ga0207664_10037088 3300025929 Bacteria 3771
328 Ga0207664_10213791 3300025929 Bacteria 1669
329 Ga0207644_10360734 3300025931 Bacteria 1182
330 Ga0207706_10095886 3300025933 Bacteria 2609
331 Ga0207686_10351896 3300025934 Bacteria 1109
332 Ga0207709_10022456 3300025935 Bacteria 3579
333 Ga0207709_10026424 3300025935 Bacteria 3334
334 Ga0207709_10041668 3300025935 Bacteria 2757
335 Ga0207669_10273263 3300025937 Bacteria 1270
336 Ga0207669_10284843 3300025937 Bacteria 1248
337 Ga0207704_10035898 3300025938 Bacteria 2846
338 Ga0207704_10136731 3300025938 Bacteria 1707
339 Ga0207665_10004886 3300025939 Bacteria 8928
340 Ga0207665_10081997 3300025939 Bacteria 2222
341 Ga0207665_10311213 3300025939 Bacteria 1180
342 Ga0207691_10202336 3300025940 Bacteria 1728
343 Ga0207711_10000001 3300025941 Bacteria 1325674
344 Ga0207711_10057836 3300025941 Bacteria 3334
345 Ga0207711_10181659 3300025941 Bacteria 1913
346 Ga0207661_10002953 3300025944 Bacteria 11757
347 Ga0207661_10340895 3300025944 Bacteria 1350
348 Ga0207667_10005117 3300025949 Bacteria 16011
349 Ga0207667_10008657 3300025949 Bacteria 12068
350 Ga0207667_10221883 3300025949 Bacteria 1937
351 Ga0207667_10320446 3300025949 Bacteria 1583
352 Ga0207667_10330572 3300025949 Bacteria 1556
353 Ga0207651_10374639 3300025960 Bacteria 1205
354 Ga0207668_10010865 3300025972 Bacteria 5516
355 Ga0207668_10014836 3300025972 Bacteria 4829
356 Ga0207668_10278070 3300025972 Bacteria 1371
357 Ga0207640_10340937 3300025981 Bacteria 1200
358 Ga0207639_10005343 3300026041 Bacteria 8679
359 Ga0207639_10010313 3300026041 Bacteria 6468
360 Ga0207639_10212394 3300026041 Bacteria 1666
361 Ga0207639_10468715 3300026041 Bacteria 1146
362 Ga0207678_10029661 3300026067 Bacteria 4776
363 Ga0207678_10064611 3300026067 Bacteria 3144
364 Ga0207678_10104230 3300026067 Bacteria 2420
365 Ga0207678_10137534 3300026067 Bacteria 2084
366 Ga0207678_10200944 3300026067 Bacteria 1704
367 Ga0207702_10000003 3300026078 Bacteria 434196
368 Ga0207702_10000014 3300026078 Bacteria 253304
369 Ga0207702_10024157 3300026078 Bacteria 5042
370 Ga0207702_10174808 3300026078 Bacteria 1972
371 Ga0207641_10230313 3300026088 Bacteria 1722
372 Ga0207641_10287131 3300026088 Bacteria 1550
373 Ga0207674_10002259 3300026116 Bacteria 24418
374 Ga0207674_10013973 3300026116 Bacteria 8879
375 Ga0207674_10034505 3300026116 Bacteria 5287
376 Ga0207674_10072022 3300026116 Bacteria 3472
377 Ga0207674_10397060 3300026116 Bacteria 1333
378 Ga0207683_10403190 3300026121 Bacteria 1258
379 Ga0207698_10047385 3300026142 Bacteria 3255
380 Ga0207698_10050515 3300026142 Bacteria 3173
381 Ga0207698_10073445 3300026142 Bacteria 2724
382 Ga0207698_10073640 3300026142 Bacteria 2721
383 Ga0207698_10133630 3300026142 Bacteria 2125
384 Ga0209389_1000016 3300027296 Bacteria 184844
385 Ga0209389_1000027 3300027296 Bacteria 146917
386 Ga0209589_1000005 3300027357 Bacteria 530958
387 Ga0209589_1000031 3300027357 Bacteria 147054
388 Ga0209489_100005 3300027361 Bacteria 530958
389 Ga0209489_100057 3300027361 Bacteria 147398
390 Ga0209489_100063 3300027361 Bacteria 144408
391 Ga0209700_100006 3300027363 Bacteria 530958
392 Ga0209700_100012 3300027363 Bacteria 357892
393 Ga0209179_1005840 3300027512 Bacteria 1949
394 Ga0209813_10030980 3300027866 Bacteria 1576
395 Ga0207428_10253237 3300027907 Bacteria 1313
396 Ga0268266_10052627 3300028379 Bacteria 3496
397 Ga0268266_10103489 3300028379 Bacteria 2512
398 Ga0268266_10283478 3300028379 Bacteria 1541
399 Ga0268265_10027240 3300028380 Bacteria 4076
400 Ga0268265_10103699 3300028380 Bacteria 2304
401 Ga0268264_10208803 3300028381 Bacteria 1791
402 Ga0265334_10037206 3300028573 Bacteria 1919
403 Ga0265336_10003128 3300028666 Bacteria 6583
404 Ga0307517_10000176 3300028786 Bacteria 105402
405 Ga0307517_10176619 3300028786 Bacteria 1389
406 Ga0307517_10191175 3300028786 Bacteria 1299
407 Ga0265338_10000043 3300028800 Bacteria 226293
408 Ga0265338_10000318 3300028800 Bacteria 87296
409 Ga0265324_10066346 3300029957 Bacteria 1231
410 Ga0307511_10103124 3300030521 Bacteria 1860
411 Ga0265330_10037649 3300031235 Bacteria 2153
412 Ga0265330_10043356 3300031235 Bacteria 1990
413 Ga0265332_10012204 3300031238 Bacteria 3812
414 Ga0265332_10118906 3300031238 Bacteria 1110
415 Ga0265325_10000002 3300031241 Bacteria 396758
416 Ga0265325_10010610 3300031241 Bacteria 5325
417 Ga0265340_10001290 3300031247 Bacteria 14381
418 Ga0265340_10066728 3300031247 Bacteria 1711
419 Ga0265339_10000216 3300031249 Bacteria 47017
420 Ga0265339_10001372 3300031249 Bacteria 18190
421 Ga0265339_10033300 3300031249 Bacteria 2902
422 Ga0265331_10030896 3300031250 Bacteria 2665
423 Ga0307509_10022374 3300031507 Bacteria 7127
424 Ga0307509_10135413 3300031507 Bacteria 2410
425 Ga0307509_10358074 3300031507 Bacteria 1180
426 Ga0265313_10001374 3300031595 Bacteria 22847
427 Ga0307508_10046720 3300031616 Bacteria 3865
428 Ga0307508_10062521 3300031616 Bacteria 3286
429 Ga0307508_10123051 3300031616 Bacteria 2197
430 Ga0307508_10124094 3300031616 Bacteria 2184
431 Ga0307508_10155675 3300031616 Bacteria 1889
432 Ga0265314_10007706 3300031711 Bacteria 9310
433 Ga0265314_10016415 3300031711 Bacteria 5849
434 Ga0265314_10021331 3300031711 Bacteria 4983
435 Ga0265314_10050084 3300031711 Bacteria 2920
436 Ga0265342_10009595 3300031712 Bacteria 6796
437 Ga0265342_10023757 3300031712 Bacteria 3875
438 Ga0265342_10163634 3300031712 Bacteria 1228
439 Ga0307516_10020012 3300031730 Bacteria 6920
440 Ga0307516_10032551 3300031730 Bacteria 5250
441 Ga0307516_10070586 3300031730 Bacteria 3356
442 Ga0307516_10082172 3300031730 Bacteria 3063
443 Ga0307516_10112661 3300031730 Bacteria 2520
444 Ga0307406_10120093 3300031901 Bacteria 1826
445 Ga0307412_10056255 3300031911 Bacteria 2621
446 Ga0307409_100101192 3300031995 Bacteria 2391
447 Ga0307409_100224062 3300031995 Bacteria 1700
448 Ga0307415_100105885 3300032126 Bacteria 2075
449 Ga0307507_10073019 3300033179 Bacteria 3087
450 Ga0307507_10274482 3300033179 Bacteria 1061
451 Ga0307510_10007730 3300033180 Bacteria 12823
452 Ga0307510_10024013 3300033180 Bacteria 7054
453 Ga0307510_10037836 3300033180 Bacteria 5347
454 Ga0307510_10247799 3300033180 Bacteria 1271
455 Ga0315911_1000005 3300033442 Bacteria 426255
456 Ga0316215_1002400 3300033544 Bacteria 1771
457 Ga0373926_0005379 3300035083 Bacteria 4218
458 Ga0373934_0002178 3300035086 Bacteria 7205
459 Ga0373934_0056678 3300035086 Bacteria 1559
460 Ga0373934_0128973 3300035086 Bacteria 1031
461 Ga0373944_0025210 3300035089 Bacteria 1749
462 Ga0373923_0001946 3300035111 Bacteria 6191
463 Ga0373923_0055799 3300035111 Bacteria 1666
464 Ga0373936_0008199 3300035113 Bacteria 3926
465 Ga0373936_0044876 3300035113 Bacteria 1779
466 Ga0373945_0030352 3300035116 Bacteria 1905
467 Ga0373953_0030578 3300035117 Bacteria 2089
468 Ga0373954_0002355 3300035118 Bacteria 7899
469 Ga0373956_0002239 3300035119 Bacteria 7967
470 Ga0373957_0000527 3300035120 Bacteria 9628
471 Ga0373957_0045081 3300035120 Bacteria 1670
472 Ga0373943_0022820 3300035170 Bacteria 2905
473 Ga0373943_0092610 3300035170 Bacteria 1568
474 Ga0373943_0102631 3300035170 Bacteria 1498
475 Ga0373946_0016253 3300035171 Bacteria 2833
476 Ga0373946_0050038 3300035171 Bacteria 1744
477 Ga0373955_0000535 3300035172 Bacteria 16084
478 Ga0373955_0258799 3300035172 Bacteria 1044
479 Ga0373924_0004005 3300035410 Bacteria 5117
480 Ga0373924_0041013 3300035410 Bacteria 1896
481 Ga0373931_0014148 3300035691 Bacteria 3896
482 Ga0373931_0086136 3300035691 Bacteria 1743
483 Ga0373935_0002921 3300035692 Bacteria 9842
484 Ga0373935_0020330 3300035692 Bacteria 4055
485 Ga0373935_0023018 3300035692 Bacteria 3826
486 Ga0373935_0301426 3300035692 Bacteria 1133
487 Ga0373927_0005026 3300035695 Bacteria 9156
488 Ga0373927_0012684 3300035695 Bacteria 5606
489 Ga0373927_0022088 3300035695 Bacteria 4169
490 Ga0373927_0031199 3300035695 Bacteria 3475
491 Ga0373927_0034781 3300035695 Bacteria 3277
492 Ga0373927_0044280 3300035695 Bacteria 2880
493 Ga0373927_0103187 3300035695 Bacteria 1855
494 Ga0373933_0000017 3300035724 Bacteria 100816
495 Ga0373933_0002165 3300035724 Bacteria 11241
496 Ga0373933_0179788 3300035724 Bacteria 1349
497 Ga0373947_0066854 3300035725 Bacteria 2194
498 Ga0373947_0089965 3300035725 Bacteria 1912
499 Ga0373947_0323785 3300035725 Bacteria 1031
500 Ga0373937_0022868 3300036401 Bacteria 5623
501 Ga0373937_0033007 3300036401 Bacteria 4697
502 Ga0373937_0050675 3300036401 Bacteria 3803
503 Ga0372808_012313 3300036459 Bacteria 1214
504 Ga0373925_0002335 3300037068 Bacteria 15260
505 Ga0373925_0031042 3300037068 Bacteria 3924
506 Ga0373925_0037370 3300037068 Bacteria 3585
507 Ga0395900_0001282 3300037418 Bacteria 30694
508 Ga0395900_0082356 3300037418 Bacteria 3306
509 Ga0395900_0399946 3300037418 Bacteria 1338
510 Ga0395900_0404803 3300037418 Bacteria 1328
511 Ga0395898_0037345 3300037466 Bacteria 4820
512 Ga0395898_0048844 3300037466 Bacteria 4148
513 Ga0395898_0167326 3300037466 Bacteria 2102
514 Ga0395898_0265479 3300037466 Bacteria 1637
515 Ga0395898_0374522 3300037466 Bacteria 1358
516 Ga0395905_0004232 3300037471 Bacteria 15003
517 Ga0395905_0194260 3300037471 Bacteria 1903
518 Ga0395905_0238834 3300037471 Bacteria 1698
519 Ga0395905_0284546 3300037471 Bacteria 1540
520 Ga0395905_0290637 3300037471 Bacteria 1521
521 Ga0436364_1108748 3300037853 Bacteria 1243
522 Ga0436364_1171946 3300037853 Bacteria 2170
523 Ga0395901_0006277 3300038443 Bacteria 12045
524 Ga0395901_0242616 3300038443 Bacteria 1879
525 Ga0395901_0400194 3300038443 Bacteria 1411
526 Ga0436365_0186993 3300039437 Bacteria 1386
527 Ga0436365_0279031 3300039437 Bacteria 3587
528 Ga0436365_1460691 3300039437 Bacteria 2762
529 Ga0436365_1461183 3300039437 Bacteria 1245
530 Ga0436365_1775413 3300039437 Bacteria 1093
531 Ga0436360_0435243 3300039438 Bacteria 1110
532 Ga0436360_1271326 3300039438 Bacteria 1299
533 Ga0436361_1059134 3300039447 Bacteria 1980
534 Ga0436363_0341762 3300039450 Bacteria 2173
535 Ga0436363_0637508 3300039450 Bacteria 1289
536 Ga0439465_0064341 3300041413 Bacteria 1220
537 Ga0451789_1107124 3300041443 Bacteria 1101
538 Ga0466969_0082551 3300044656 Bacteria 1531
539 Ga0466972_0000179 3300044658 Bacteria 49010
540 Ga0466972_0000516 3300044658 Bacteria 19219
541 Ga0466966_0005539 3300044684 Bacteria 8295
542 Ga0466966_0277528 3300044684 Bacteria 1008
543 Ga0466961_0000023 3300044693 Bacteria 97134
544 Ga0466961_0093578 3300044693 Bacteria 1897
545 Ga0466963_0219813 3300044694 Bacteria 1330
546 Ga0466964_0017912 3300044706 Bacteria 2714
547 Ga0466968_0008321 3300044735 Bacteria 3970
548 Ga0466968_0044628 3300044735 Bacteria 1879
549 Ga0466968_0083121 3300044735 Bacteria 1410
550 Ga0466970_0067980 3300044765 Bacteria 1914
551 Ga0466960_0052665 3300044901 Bacteria 1970
552 Ga0466959_0003727 3300045049 Bacteria 10069
553 Ga0466967_0427634 3300045976 Bacteria 1291
554 Ga0495617_006222 3300046452 Bacteria 4200
555 Ga0495592_0021832 3300046454 Bacteria 4870
556 Ga0495592_0041663 3300046454 Bacteria 3441
557 Ga0495592_0051399 3300046454 Bacteria 3061
558 Ga0495592_0167241 3300046454 Bacteria 1508
559 Ga0495603_0000923 3300046455 Bacteria 16862
560 Ga0495603_0008603 3300046455 Bacteria 6169
561 Ga0495603_0028744 3300046455 Bacteria 3354
562 Ga0495603_0077189 3300046455 Bacteria 1954
563 Ga0495603_0116984 3300046455 Bacteria 1554
564 Ga0495590_0116036 3300046457 Bacteria 958
565 Ga0495629_0001841 3300046459 Bacteria 16607
566 Ga0495629_0002400 3300046459 Bacteria 14408
567 Ga0495629_0033029 3300046459 Bacteria 3662
568 Ga0495629_0116831 3300046459 Bacteria 1859
569 Ga0495638_0001078 3300046460 Bacteria 26592
570 Ga0495638_0011310 3300046460 Bacteria 6150
571 Ga0495638_0030773 3300046460 Bacteria 3451
572 Ga0495651_0044231 3300046462 Bacteria 3452
573 Ga0495651_0046362 3300046462 Bacteria 3364
574 Ga0495651_0057001 3300046462 Bacteria 3000
575 Ga0495651_0100123 3300046462 Bacteria 2159
576 Ga0495651_0101608 3300046462 Bacteria 2139
577 Ga0495653_0004149 3300046463 Bacteria 11724
578 Ga0495653_0034694 3300046463 Bacteria 3986
579 Ga0495653_0037943 3300046463 Bacteria 3783
580 Ga0495653_0159104 3300046463 Bacteria 1570
581 Ga0495580_0009257 3300046472 Bacteria 7756
582 Ga0495580_0010859 3300046472 Bacteria 7068
583 Ga0495580_0030671 3300046472 Bacteria 3891
584 Ga0495582_0000283 3300046473 Bacteria 28312
585 Ga0495582_0171800 3300046473 Bacteria 1234
586 Ga0495639_0004800 3300046475 Bacteria 5813
587 Ga0495639_0031638 3300046475 Bacteria 2356
588 Ga0495639_0043363 3300046475 Bacteria 2032
589 Ga0495639_0110306 3300046475 Bacteria 1305
590 Ga0495662_0001975 3300046476 Bacteria 10288
591 Ga0495664_0003810 3300046477 Bacteria 8225
592 Ga0495664_0007158 3300046477 Bacteria 6183
593 Ga0495664_0013420 3300046477 Bacteria 4645
594 Ga0495664_0091912 3300046477 Bacteria 1825
595 Ga0495594_0000509 3300046499 Bacteria 19796
596 Ga0495594_0185398 3300046499 Bacteria 1185
597 Ga0495606_0000357 3300046507 Bacteria 78015
598 Ga0495606_0010827 3300046507 Bacteria 7515
599 Ga0495606_0171829 3300046507 Bacteria 1257
600 Ga0495608_0066765 3300046511 Bacteria 2354
601 Ga0495610_0058580 3300046512 Bacteria 1842
602 Ga0495610_0058888 3300046512 Bacteria 1836
603 Ga0495610_0135904 3300046512 Bacteria 1063
604 Ga0495618_0032005 3300046514 Bacteria 3294
605 Ga0495618_0048943 3300046514 Bacteria 2669
606 Ga0495618_0281935 3300046514 Bacteria 1036
607 Ga0495620_0016755 3300046515 Bacteria 3669
608 Ga0495630_0008393 3300046517 Bacteria 7407
609 Ga0495630_0018211 3300046517 Bacteria 5157
610 Ga0495630_0130835 3300046517 Bacteria 1906
611 Ga0495632_0050040 3300046519 Bacteria 2063
612 Ga0495643_0108152 3300046522 Bacteria 1416
613 Ga0495648_0001411 3300046524 Bacteria 23498
614 Ga0495648_0006902 3300046524 Bacteria 9160
615 Ga0495648_0160246 3300046524 Bacteria 1164
616 Ga0495666_0044887 3300046526 Bacteria 2133
617 Ga0495652_0016077 3300046529 Bacteria 6694
618 Ga0495652_0040475 3300046529 Bacteria 4028
619 Ga0495652_0114790 3300046529 Bacteria 2160
620 Ga0495652_0146685 3300046529 Bacteria 1849
621 Ga0495665_0000145 3300046531 Bacteria 34959
622 Ga0495665_0025922 3300046531 Bacteria 3148
623 Ga0495640_0007751 3300046533 Bacteria 8449
624 Ga0495640_0016865 3300046533 Bacteria 5459
625 Ga0495640_0132101 3300046533 Bacteria 1615
626 Ga0495640_0182539 3300046533 Bacteria 1336
627 Ga0495587_0052290 3300046536 Bacteria 2410
628 Ga0495645_0001274 3300046543 Bacteria 17169
629 Ga0495645_0008376 3300046543 Bacteria 7220
630 Ga0495645_0013988 3300046543 Bacteria 5686
631 Ga0495645_0128833 3300046543 Bacteria 1776
632 Ga0495645_0171257 3300046543 Bacteria 1495
633 Ga0495622_0006137 3300046557 Bacteria 5584
634 Ga0495622_0018451 3300046557 Bacteria 3249
635 Ga0495622_0025034 3300046557 Bacteria 2787
636 Ga0495622_0065884 3300046557 Bacteria 1674
637 Ga0495667_0033824 3300046559 Bacteria 3419
638 Ga0495667_0066888 3300046559 Bacteria 2349
639 Ga0495667_0102445 3300046559 Bacteria 1851
640 Ga0495656_0003804 3300046615 Bacteria 5129
641 Ga0495656_0037632 3300046615 Bacteria 2000
642 Ga0495656_0087813 3300046615 Bacteria 1417
643 Ga0495668_0063059 3300046616 Bacteria 2042
644 Ga0495668_0245267 3300046616 Bacteria 981
645 Ga0495634_0001108 3300046642 Bacteria 24957
646 Ga0495634_0009918 3300046642 Bacteria 7000
647 Ga0495634_0047491 3300046642 Bacteria 2892
648 Ga0495611_0123558 3300046648 Bacteria 1207
649 Ga0495635_0002477 3300046663 Bacteria 12604
650 Ga0495635_0009937 3300046663 Bacteria 6652
651 Ga0495661_0167179 3300046665 Bacteria 1176
652 Ga0495588_0010104 3300046674 Bacteria 4379
653 Ga0495588_0013234 3300046674 Bacteria 3926
654 Ga0495588_0022019 3300046674 Bacteria 3147
655 Ga0495588_0023760 3300046674 Bacteria 3038
656 Ga0495588_0028524 3300046674 Bacteria 2794
657 Ga0495657_0060429 3300046675 Bacteria 2510
658 Ga0495599_0005563 3300046678 Bacteria 7558
659 Ga0495599_0014179 3300046678 Bacteria 4935
660 Ga0495599_0168913 3300046678 Bacteria 1350
661 Ga0495623_0002992 3300046679 Bacteria 11118
662 Ga0495623_0010731 3300046679 Bacteria 5931
663 Ga0495623_0045628 3300046679 Bacteria 2783
664 Ga0495646_0021267 3300046680 Bacteria 4101
665 Ga0495646_0049099 3300046680 Bacteria 2561
666 Ga0495646_0059363 3300046680 Bacteria 2284
667 Ga0495647_0007604 3300046681 Bacteria 3636
668 Ga0495647_0021966 3300046681 Bacteria 2303
669 Ga0495658_0000547 3300046683 Bacteria 20542
670 Ga0495658_0035174 3300046683 Bacteria 2754
671 Ga0495669_0047010 3300046684 Bacteria 1927
672 Ga0495613_0002250 3300046689 Bacteria 14591
673 Ga0495613_0083138 3300046689 Bacteria 2325
674 Ga0495613_0091415 3300046689 Bacteria 2204
675 Ga0495624_0005060 3300046690 Bacteria 9536
676 Ga0495624_0069921 3300046690 Bacteria 2186
677 Ga0495624_0210755 3300046690 Bacteria 1179
678 Ga0495624_0259508 3300046690 Bacteria 1050
679 Ga0495670_0048377 3300046691 Bacteria 2127
680 Ga0495670_0049540 3300046691 Bacteria 2102
681 Ga0495589_0030502 3300046794 Bacteria 2715
682 Ga0495600_0027802 3300046809 Bacteria 3656
683 Ga0495600_0040834 3300046809 Bacteria 3023
684 Ga0495600_0101812 3300046809 Bacteria 1872
685 Ga0495660_0105137 3300046810 Bacteria 1448
686 Ga0495581_0000529 3300047315 Bacteria 19610
687 Ga0495581_0030657 3300047315 Bacteria 3115
688 Ga0495604_0040425 3300047317 Bacteria 3661
689 Ga0495604_0049547 3300047317 Bacteria 3263
690 Ga0495604_0192898 3300047317 Bacteria 1418
691 Ga0495674_0005462 3300047319 Bacteria 12209
692 Ga0495674_0012072 3300047319 Bacteria 8141
693 Ga0495674_0032883 3300047319 Bacteria 4701
694 Ga0495672_0003965 3300047320 Bacteria 12392
695 Ga0495676_0088078 3300047321 Bacteria 2330
696 Ga0495676_0092859 3300047321 Bacteria 2252
697 Ga0495676_0102774 3300047321 Bacteria 2111
698 Ga0495676_0301025 3300047321 Bacteria 1081
699 Ga0495680_0001426 3300047322 Bacteria 25752
700 Ga0495680_0012571 3300047322 Bacteria 7441
701 Ga0495680_0066707 3300047322 Bacteria 2753
702 Ga0495675_0032501 3300047444 Bacteria 3330
703 Ga0495684_0001145 3300047471 Bacteria 21346
704 Ga0495684_0148877 3300047471 Bacteria 1751
705 Ga0495684_0355267 3300047471 Bacteria 1039
706 Ga0495686_0049064 3300047472 Bacteria 2658
707 Ga0495686_0069990 3300047472 Bacteria 2162
708 Ga0495686_0086150 3300047472 Bacteria 1912
709 Ga0495686_0090735 3300047472 Bacteria 1855
710 Ga0495593_0000526 3300047673 Bacteria 21677
711 Ga0495593_0000877 3300047673 Bacteria 17432
712 Ga0495593_0144698 3300047673 Bacteria 1203
713 Ga0495602_0007749 3300048088 Bacteria 11224
714 Ga0495602_0009427 3300048088 Bacteria 10154
715 Ga0495602_0028167 3300048088 Bacteria 5381
716 Ga0495602_0199354 3300048088 Bacteria 1528
717 Ga0495614_0026282 3300048089 Bacteria 2509
718 Ga0496100_0035991 3300048903 Bacteria 3119
719 Ga0496100_0181902 3300048903 Bacteria 1521
720 Ga0496100_0295475 3300048903 Bacteria 1211
721 Ga0496101_0103181 3300048904 Bacteria 2137
722 Ga0496102_0077517 3300048905 Bacteria 3059
723 Ga0496102_0089716 3300048905 Bacteria 2844
724 Ga0496102_0130542 3300048905 Bacteria 2351
725 Ga0496102_0313522 3300048905 Bacteria 1478
726 Ga0496103_0047232 3300048906 Bacteria 2660
727 Ga0496103_0232495 3300048906 Bacteria 1186
728 Ga0496104_0017315 3300048907 Bacteria 6559
729 Ga0496104_0025169 3300048907 Bacteria 5485
730 Ga0496104_0032765 3300048907 Bacteria 4837
731 Ga0496104_0041576 3300048907 Bacteria 4311
732 Ga0496104_0125233 3300048907 Bacteria 2467
733 Ga0496104_0194668 3300048907 Bacteria 1939
734 Ga0496104_0434562 3300048907 Bacteria 1224
735 Ga0496105_0044074 3300048908 Bacteria 3678
736 Ga0496105_0124309 3300048908 Bacteria 2127
737 Ga0496106_0010776 3300048909 Bacteria 6755
738 Ga0496106_0030126 3300048909 Bacteria 4045
739 Ga0496106_0105713 3300048909 Bacteria 2187
740 Ga0496106_0328558 3300048909 Bacteria 1228
741 Ga0496108_0000392 3300048911 Bacteria 36249
742 Ga0496108_0219118 3300048911 Bacteria 1653
743 Ga0496109_0000509 3300048912 Bacteria 33001
744 Ga0496109_0021350 3300048912 Bacteria 5724
745 Ga0496109_0059361 3300048912 Bacteria 3494
746 Ga0496109_0059912 3300048912 Bacteria 3478
747 Ga0496110_0002823 3300048913 Bacteria 13112
748 Ga0496111_0053075 3300048914 Bacteria 2928
749 Ga0496111_0127085 3300048914 Bacteria 1885
750 Ga0496111_0175081 3300048914 Bacteria 1595
751 Ga0496111_0274136 3300048914 Bacteria 1251
752 Ga0496111_0287847 3300048914 Bacteria 1218
753 Ga0496112_0000052 3300048915 Bacteria 81285
754 Ga0496112_0001604 3300048915 Bacteria 17489
755 Ga0496112_0015619 3300048915 Bacteria 7091
756 Ga0496112_0097025 3300048915 Bacteria 2918
757 Ga0496113_0035965 3300048916 Bacteria 3626
758 Ga0496113_0110381 3300048916 Bacteria 2140
759 Ga0496113_0132196 3300048916 Bacteria 1959
760 Ga0496113_0146761 3300048916 Bacteria 1859
761 Ga0496114_0301961 3300048917 Bacteria 1413
762 Ga0496115_0048409 3300048918 Bacteria 3400
763 Ga0496115_0054399 3300048918 Bacteria 3214
764 Ga0496115_0071871 3300048918 Bacteria 2806
765 Ga0496115_0120672 3300048918 Bacteria 2157
766 Ga0496115_0222510 3300048918 Bacteria 1557
767 Ga0496115_0307171 3300048918 Bacteria 1299
768 Ga0496116_0001611 3300048919 Bacteria 24820
769 Ga0496116_0068609 3300048919 Bacteria 2258
770 Ga0496117_0009803 3300048920 Bacteria 8831
771 Ga0496117_0089099 3300048920 Bacteria 1994
772 Ga0496117_0115666 3300048920 Bacteria 1659
773 Ga0496118_0004079 3300048921 Bacteria 17718
774 Ga0496118_0025336 3300048921 Bacteria 5090
775 Ga0496118_0025358 3300048921 Bacteria 5087
776 Ga0496118_0149747 3300048921 Bacteria 1462
777 Ga0496118_0188736 3300048921 Bacteria 1235
778 Ga0496118_0242480 3300048921 Bacteria 1031
779 Ga0496119_0034621 3300048922 Bacteria 3321
780 Ga0496119_0069778 3300048922 Bacteria 2064
781 Ga0496119_0081165 3300048922 Bacteria 1869
782 Ga0496119_0099593 3300048922 Bacteria 1634
783 Ga0496120_0072926 3300048923 Bacteria 1880
784 Ga0496121_0000753 3300048924 Bacteria 59517
785 Ga0496121_0001173 3300048924 Bacteria 45935
786 Ga0496121_0002265 3300048924 Bacteria 29946
787 Ga0496121_0003552 3300048924 Bacteria 22075
788 Ga0496121_0011996 3300048924 Bacteria 9526
789 Ga0496121_0028031 3300048924 Bacteria 5253
790 Ga0496121_0113253 3300048924 Bacteria 2065
791 Ga0496121_0140820 3300048924 Bacteria 1790
792 Ga0496121_0158898 3300048924 Bacteria 1655
793 Ga0496121_0196284 3300048924 Bacteria 1442
794 Ga0496121_0202247 3300048924 Bacteria 1415
795 Ga0496122_0017207 3300048925 Bacteria 6776
796 Ga0496122_0041692 3300048925 Bacteria 3624
797 Ga0496122_0080711 3300048925 Bacteria 2267
798 Ga0496123_0155995 3300048926 Bacteria 1224
799 Ga0496124_0002443 3300048927 Bacteria 24353
800 Ga0496124_0025489 3300048927 Bacteria 5355
801 Ga0496124_0045919 3300048927 Bacteria 3743
802 Ga0496124_0120736 3300048927 Bacteria 2095
803 Ga0496124_0124166 3300048927 Bacteria 2059
804 Ga0496124_0167621 3300048927 Bacteria 1705
805 Ga0496125_0000099 3300048928 Bacteria 203333
806 Ga0496125_0002962 3300048928 Bacteria 21340
807 Ga0496125_0005975 3300048928 Bacteria 13323
808 Ga0496125_0069968 3300048928 Bacteria 2750
809 Ga0496125_0084233 3300048928 Bacteria 2415
810 Ga0496126_0003779 3300048929 Bacteria 18791
811 Ga0496126_0004189 3300048929 Bacteria 17378
812 Ga0496126_0004375 3300048929 Bacteria 16937
813 Ga0496126_0010575 3300048929 Bacteria 9650
814 Ga0496126_0027713 3300048929 Bacteria 5407
815 Ga0496126_0030836 3300048929 Bacteria 5075
816 Ga0496126_0033750 3300048929 Bacteria 4814
817 Ga0496126_0054808 3300048929 Bacteria 3609
818 Ga0496126_0060475 3300048929 Bacteria 3406
819 Ga0496126_0090319 3300048929 Bacteria 2695
820 Ga0496126_0090527 3300048929 Bacteria 2692
821 Ga0496126_0109600 3300048929 Bacteria 2406
822 Ga0496126_0186119 3300048929 Bacteria 1761
823 Ga0496126_0194172 3300048929 Bacteria 1718
824 Ga0496126_0260069 3300048929 Bacteria 1444
825 Ga0501032_0018727 3300049569 Bacteria 4846
826 Ga0501032_0066426 3300049569 Bacteria 2410
827 Ga0501032_0111388 3300049569 Bacteria 1811
828 Ga0501033_0009531 3300049570 Bacteria 7473
829 Ga0501033_0017000 3300049570 Bacteria 5499
830 Ga0501033_0106691 3300049570 Bacteria 2040
831 Ga0501033_0133335 3300049570 Bacteria 1798
832 Ga0501034_0203159 3300049571 Bacteria 1939
833 Ga0501036_0030784 3300049572 Bacteria 4534
834 Ga0501036_0160400 3300049572 Bacteria 1896
835 Ga0501037_0009620 3300049573 Bacteria 7092
836 Ga0501038_0024403 3300049574 Bacteria 5395
837 Ga0501038_0280951 3300049574 Bacteria 1310
838 Ga0501039_0005003 3300049575 Bacteria 10058
839 Ga0501039_0285832 3300049575 Bacteria 1296
840 Ga0501043_0015306 3300049579 Bacteria 6008
841 Ga0501043_0161140 3300049579 Bacteria 1753
842 Ga0501046_0035855 3300049580 Bacteria 3995
843 Ga0501046_0079087 3300049580 Bacteria 2542
844 Ga0501046_0088041 3300049580 Bacteria 2392
845 Ga0501046_0134868 3300049580 Bacteria 1870
846 Ga0501047_0112245 3300049581 Bacteria 2608
847 Ga0501047_0142745 3300049581 Bacteria 2272
848 Ga0501047_0395420 3300049581 Bacteria 1215
849 Ga0501047_0408026 3300049581 Bacteria 1191
850 Ga0501048_0144768 3300049582 Bacteria 1681
851 Ga0501067_0034503 3300049583 Bacteria 2808
852 Ga0501068_0038894 3300049584 Bacteria 2851
853 Ga0501069_0147500 3300049585 Bacteria 1351
854 Ga0501070_0106083 3300049586 Bacteria 2322
855 Ga0501070_0185454 3300049586 Bacteria 1711
856 Ga0501071_0064618 3300049587 Bacteria 2655
857 Ga0501073_0123849 3300049589 Bacteria 1792
858 Ga0501073_0142649 3300049589 Bacteria 1660
859 Ga0501080_0032454 3300049742 Bacteria 4871
860 Ga0501080_0033915 3300049742 Bacteria 4765
861 Ga0501035_0009729 3300049822 Bacteria 8939
862 Ga0501035_0206728 3300049822 Bacteria 1681
863 Ga0501035_0338831 3300049822 Bacteria 1260
864 Ga0501035_0346193 3300049822 Bacteria 1244
865 Ga0501044_0027655 3300049823 Bacteria 5988
866 Ga0501044_0078639 3300049823 Bacteria 3342
867 Ga0501044_0181031 3300049823 Bacteria 2074
868 Ga0501044_0287163 3300049823 Bacteria 1577
869 nmdc:mga03n38_448_c1 3300050490 Bacteria 10279
870 nmdc:mga00v17_192244_c1 3300050491 Bacteria 1318
871 nmdc:mga00v17_43859_c2 3300050491 Bacteria 1258
872 nmdc:mga0yw44_215840_c1 3300050492 Bacteria 1270
873 nmdc:mga0yw44_49348_c1 3300050492 Bacteria 2540
874 nmdc:mga0yw44_54077_c1 3300050492 Bacteria 2439
875 nmdc:mga0yw44_58599_c1 3300050492 Bacteria 2353
876 nmdc:mga0yw44_97579_c1 3300050492 Bacteria 1867
877 nmdc:mga06z11_102721_c1 3300050494 Bacteria 1571
878 nmdc:mga06z11_16892_c1 3300050494 Bacteria 3299
879 nmdc:mga06z11_50507_c1 3300050494 Bacteria 2126
880 nmdc:mga04h51_18332_c1 3300050495 Bacteria 2060
881 nmdc:mga04h51_18626_c1 3300050495 Bacteria 2047
882 nmdc:mga07m45_17174_c1 3300050496 Bacteria 3881
883 nmdc:mga07m45_17807_c1 3300050496 Bacteria 3823
884 nmdc:mga07m45_217547_c1 3300050496 Bacteria 1111
885 nmdc:mga05p37_561866_c1 3300050507 Bacteria 1296
886 nmdc:mga08y16_635823_c1 3300050511 Bacteria 1073
887 nmdc:mga0n895_146602_c1 3300050512 Bacteria 2390
888 nmdc:mga0sz30_108426_c1 3300050516 Bacteria 1216
889 nmdc:mga0sz30_28196_c1 3300050516 Bacteria 2309
890 nmdc:mga0sz30_46160_c1 3300050516 Bacteria 1839
891 Ga0495601_0026489 3300053077 Bacteria 3580
892 Ga0495601_0150130 3300053077 Bacteria 1521
893 Ga0495612_0074170 3300053078 Bacteria 1422
894 Ga0500635_0084412 3300053080 Bacteria 1146
895 Ga0495655_0056300 3300053083 Bacteria 1058
896 Ga0495595_0001351 3300053084 Bacteria 9525
897 Ga0495595_0037526 3300053084 Bacteria 2203
898 Ga0495619_0001695 3300053085 Bacteria 14587
899 Ga0500578_0079958 3300053086 Bacteria 2080
900 Ga0500643_000180 3300053087 Bacteria 61907
901 Ga0500581_063817 3300053089 Bacteria 1861
902 Ga0500647_0163083 3300053091 Bacteria 1033
903 Ga0500651_0060171 3300053093 Bacteria 2374
904 Ga0500566_0002520 3300053094 Bacteria 10882
905 Ga0500566_0003442 3300053094 Bacteria 9438
906 Ga0500566_0004614 3300053094 Bacteria 8202
907 Ga0500566_0069752 3300053094 Bacteria 1974
908 Ga0500566_0124447 3300053094 Bacteria 1386
909 Ga0500640_047183 3300053095 Bacteria 1888
910 Ga0500641_0005375 3300053096 Bacteria 4538
911 Ga0500641_0034658 3300053096 Bacteria 2010
912 Ga0500650_0011947 3300053098 Bacteria 3597
913 Ga0500650_0120960 3300053098 Bacteria 1220
914 Ga0500554_018078 3300053102 Bacteria 1897
915 Ga0500555_004651 3300053103 Bacteria 3897
916 Ga0500556_0000012 3300053104 Bacteria 250391
917 Ga0500556_0015578 3300053104 Bacteria 2348
918 Ga0500557_000046 3300053105 Bacteria 59508
919 Ga0500569_005217 3300053109 Bacteria 2782
920 Ga0500572_000471 3300053111 Bacteria 13998
921 Ga0500572_039656 3300053111 Bacteria 1359
922 Ga0500593_046853 3300053117 Bacteria 1926
923 Ga0500594_0009826 3300053118 Bacteria 2210
924 Ga0500595_000615 3300053119 Bacteria 21276
925 Ga0500595_005383 3300053119 Bacteria 5597
926 Ga0500607_090912 3300053121 Bacteria 1535
927 Ga0500608_027336 3300053122 Bacteria 2688
928 Ga0500608_101459 3300053122 Bacteria 1332
929 Ga0500614_021192 3300053123 Bacteria 1506
930 Ga0500614_021352 3300053123 Bacteria 1501
931 Ga0500617_099510 3300053124 Bacteria 1231
932 Ga0500618_006007 3300053125 Bacteria 3610
933 Ga0500642_0000013 3300053130 Bacteria 197927
934 Ga0500642_0000038 3300053130 Bacteria 98299
935 Ga0500642_0048445 3300053130 Bacteria 1866
936 Ga0500642_0130334 3300053130 Bacteria 1178
937 Ga0500652_001452 3300053131 Bacteria 7354
938 Ga0500559_0000713 3300053136 Bacteria 21844
939 Ga0500559_0001670 3300053136 Bacteria 12261
940 Ga0500559_0044946 3300053136 Bacteria 1932
941 Ga0500559_0072037 3300053136 Bacteria 1557
942 Ga0500568_0000676 3300053139 Bacteria 24605
943 Ga0500568_0006530 3300053139 Bacteria 5843
944 Ga0500568_0032956 3300053139 Bacteria 2128
945 Ga0500577_0005369 3300053142 Bacteria 3447
946 Ga0500603_000301 3300053150 Bacteria 12973
947 Ga0500603_007196 3300053150 Bacteria 2438
948 Ga0500616_0000035 3300053153 Bacteria 394242
949 Ga0500619_002756 3300053154 Bacteria 3456
950 Ga0500619_071265 3300053154 Bacteria 1156
951 Ga0500622_0005098 3300053156 Bacteria 7983
952 Ga0500622_0026880 3300053156 Bacteria 3034
953 Ga0500627_0132442 3300053158 Bacteria 1126
954 Ga0500630_088467 3300053159 Bacteria 1435
955 Ga0500634_0020483 3300053161 Bacteria 3576
956 Ga0500638_007258 3300053162 Bacteria 4622
957 Ga0500638_063301 3300053162 Bacteria 1775
958 Ga0500639_056134 3300053163 Bacteria 2039
959 Ga0500636_0001763 3300053177 Bacteria 11844
960 Ga0500636_0052765 3300053177 Bacteria 2387
961 Ga0500636_0069087 3300053177 Bacteria 2050
962 Ga0500636_0134346 3300053177 Bacteria 1375
963 Ga0500637_0000445 3300053178 Bacteria 15850
964 Ga0500637_0248781 3300053178 Bacteria 992
965 Ga0500625_003345 3300053729 Bacteria 6318
966 Ga0500645_019650 3300053730 Bacteria 2099
967 Ga0500656_004764 3300053732 Bacteria 1319
968 Ga0500596_006938 3300053735 Bacteria 1882
969 Ga0500601_000021 3300053737 Bacteria 37192
970 Ga0500661_000331 3300055283 Bacteria 8597
971 Ga0500661_009671 3300055283 Bacteria 1763
972 Ga0500661_011388 3300055283 Bacteria 1607
973 Ga0501082_0389011 3300060353 Bacteria 1217
974 Ga0466962_0076832 3300061719 Bacteria 1596

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044693 Ga0466961_0093578 Ga0466961_0093578_984_1832 278
2 3300047321 Ga0495676_0088078 Ga0495676_0088078_1418_2266 278
3 3300006038 Ga0075365_10070672 Ga0075365_100706722 280
4 3300025916 Ga0207663_10041046 Ga0207663_100410463 280
5 3300048915 Ga0496112_0000052 Ga0496112_0000052_62980_63885 280
6 3300050492 nmdc:mga0yw44_54077_c1 nmdc:mga0yw44_54077_c1_700_1632 280
7 3300009101 Ga0105247_10139172 Ga0105247_101391721 281
8 3300037466 Ga0395898_0265479 Ga0395898_0265479_412_1320 281
9 3300046543 Ga0495645_0171257 Ga0495645_0171257_342_1253 281
10 3300049581 Ga0501047_0408026 Ga0501047_0408026_65_976 281
11 3300049587 Ga0501071_0064618 Ga0501071_0064618_112_1029 282
12 3300009177 Ga0105248_10000001 Ga0105248_100000011167 283
13 3300013297 Ga0157378_10046086 Ga0157378_100460865 283
14 3300025941 Ga0207711_10000001 Ga0207711_10000001705 283
15 3300044658 Ga0466972_0000516 Ga0466972_0000516_3218_4153 283
16 3300044735 Ga0466968_0008321 Ga0466968_0008321_1891_2826 283
17 3300003203 JGI25406J46586_10000133 JGI25406J46586_1000013314 284
18 3300005344 Ga0070661_100039075 Ga0070661_1000390753 284
19 3300005985 Ga0081539_10000099 Ga0081539_1000009977 284
20 3300009101 Ga0105247_10380066 Ga0105247_103800661 284
21 3300028666 Ga0265336_10003128 Ga0265336_100031289 284
22 3300028800 Ga0265338_10000318 Ga0265338_100003186 284
23 3300029957 Ga0265324_10066346 Ga0265324_100663461 284
24 3300037418 Ga0395900_0404803 Ga0395900_0404803_360_1295 284
25 3300037471 Ga0395905_0004232 Ga0395905_0004232_13989_14924 284
26 3300044658 Ga0466972_0000179 Ga0466972_0000179_40022_40966 284
27 3300044735 Ga0466968_0044628 Ga0466968_0044628_106_1050 284
28 3300005842 Ga0068858_100648682 Ga0068858_1006486821 285
29 3300031247 Ga0265340_10001290 Ga0265340_100012904 285
30 3300046507 Ga0495606_0000357 Ga0495606_0000357_41015_41920 285
31 3300048926 Ga0496123_0155995 Ga0496123_0155995_276_1184 285
32 3300048927 Ga0496124_0045919 Ga0496124_0045919_1375_2283 285
33 3300037853 Ga0436364_1171946 Ga0436364_1171946_174_1052 286
34 3300046615 Ga0495656_0003804 Ga0495656_0003804_4136_5053 286
35 3300046691 Ga0495670_0049540 Ga0495670_0049540_1163_2062 286
36 3300049571 Ga0501034_0203159 Ga0501034_0203159_927_1841 286
37 3300053111 Ga0500572_000471 Ga0500572_000471_10226_11143 286
38 3300053136 Ga0500559_0000713 Ga0500559_0000713_2264_3181 286
39 3300005340 Ga0070689_100124563 Ga0070689_1001245632 287
40 3300005983 Ga0081540_1025136 Ga0081540_10251361 287
41 3300010375 Ga0105239_10151152 Ga0105239_101511524 287
42 3300014325 Ga0163163_10047767 Ga0163163_100477672 287
43 3300048903 Ga0496100_0295475 Ga0496100_0295475_21_944 287
44 3300048905 Ga0496102_0089716 Ga0496102_0089716_428_1351 287
45 3300048905 Ga0496102_0130542 Ga0496102_0130542_894_1820 287
46 3300048907 Ga0496104_0032765 Ga0496104_0032765_2984_3907 287
47 3300048909 Ga0496106_0105713 Ga0496106_0105713_685_1608 287
48 3300048911 Ga0496108_0219118 Ga0496108_0219118_532_1455 287
49 3300048915 Ga0496112_0015619 Ga0496112_0015619_251_1174 287
50 3300048916 Ga0496113_0132196 Ga0496113_0132196_711_1634 287
51 3300053098 Ga0500650_0120960 Ga0500650_0120960_147_1055 287
52 3300005347 Ga0070668_100206152 Ga0070668_1002061522 288
53 3300005455 Ga0070663_100227386 Ga0070663_1002273862 288
54 3300005616 Ga0068852_100064164 Ga0068852_1000641642 288
55 3300005617 Ga0068859_100640173 Ga0068859_1006401731 288
56 3300006038 Ga0075365_10056359 Ga0075365_100563593 288
57 3300006048 Ga0075363_100009873 Ga0075363_1000098733 288
58 3300006931 Ga0097620_100640191 Ga0097620_1006401911 288
59 3300009093 Ga0105240_10019367 Ga0105240_100193678 288
60 3300009551 Ga0105238_10003746 Ga0105238_100037466 288
61 3300009551 Ga0105238_10055299 Ga0105238_100552992 288
62 3300025297 Ga0209758_1003819 Ga0209758_10038196 288
63 3300025913 Ga0207695_10024485 Ga0207695_100244857 288
64 3300025915 Ga0207693_10042871 Ga0207693_100428714 288
65 3300025924 Ga0207694_10000156 Ga0207694_1000015634 288
66 3300025928 Ga0207700_10159011 Ga0207700_101590112 288
67 3300026067 Ga0207678_10029661 Ga0207678_100296614 288
68 3300026142 Ga0207698_10047385 Ga0207698_100473852 288
69 3300026142 Ga0207698_10073640 Ga0207698_100736402 288
70 3300028381 Ga0268264_10208803 Ga0268264_102088032 288
71 3300028786 Ga0307517_10000176 Ga0307517_10000176100 288
72 3300031507 Ga0307509_10022374 Ga0307509_100223741 288
73 3300031901 Ga0307406_10120093 Ga0307406_101200932 288
74 3300032126 Ga0307415_100105885 Ga0307415_1001058852 288
75 3300033180 Ga0307510_10037836 Ga0307510_100378367 288
76 3300046462 Ga0495651_0057001 Ga0495651_0057001_549_1457 288
77 3300046507 Ga0495606_0171829 Ga0495606_0171829_169_1077 288
78 3300046529 Ga0495652_0114790 Ga0495652_0114790_1186_2094 288
79 3300046557 Ga0495622_0065884 Ga0495622_0065884_693_1601 288
80 3300048914 Ga0496111_0175081 Ga0496111_0175081_53_961 288
81 3300048918 Ga0496115_0222510 Ga0496115_0222510_360_1286 288
82 3300048929 Ga0496126_0090319 Ga0496126_0090319_478_1386 288
83 3300050490 nmdc:mga03n38_448_c1 nmdc:mga03n38_448_c1_5463_6392 288
84 3300053154 Ga0500619_002756 Ga0500619_002756_451_1377 288
85 3300053730 Ga0500645_019650 Ga0500645_019650_1122_2033 288
86 3300005353 Ga0070669_100025831 Ga0070669_1000258315 289
87 3300005456 Ga0070678_100081554 Ga0070678_1000815543 289
88 3300005615 Ga0070702_100250351 Ga0070702_1002503512 289
89 3300005843 Ga0068860_100478164 Ga0068860_1004781641 289
90 3300005937 Ga0081455_10001281 Ga0081455_1000128127 289
91 3300005983 Ga0081540_1008353 Ga0081540_10083538 289
92 3300006038 Ga0075365_10034666 Ga0075365_100346662 289
93 3300006175 Ga0070712_100049612 Ga0070712_1000496124 289
94 3300006178 Ga0075367_10084503 Ga0075367_100845032 289
95 3300006195 Ga0075366_10024275 Ga0075366_100242751 289
96 3300006880 Ga0075429_100306272 Ga0075429_1003062721 289
97 3300011119 Ga0105246_10280480 Ga0105246_102804802 289
98 3300025901 Ga0207688_10065618 Ga0207688_100656182 289
99 3300025904 Ga0207647_10150183 Ga0207647_101501832 289
100 3300025907 Ga0207645_10194183 Ga0207645_101941832 289
101 3300025923 Ga0207681_10231181 Ga0207681_102311811 289
102 3300025935 Ga0207709_10041668 Ga0207709_100416684 289
103 3300025937 Ga0207669_10284843 Ga0207669_102848431 289
104 3300025938 Ga0207704_10035898 Ga0207704_100358983 289
105 3300025972 Ga0207668_10014836 Ga0207668_100148363 289
106 3300028379 Ga0268266_10052627 Ga0268266_100526273 289
107 3300028380 Ga0268265_10027240 Ga0268265_100272401 289
108 3300028786 Ga0307517_10176619 Ga0307517_101766191 289
109 3300028786 Ga0307517_10191175 Ga0307517_101911752 289
110 3300031995 Ga0307409_100224062 Ga0307409_1002240621 289
111 3300046452 Ga0495617_006222 Ga0495617_006222_2054_2965 289
112 3300046455 Ga0495603_0077189 Ga0495603_0077189_1016_1927 289
113 3300046460 Ga0495638_0030773 Ga0495638_0030773_206_1117 289
114 3300046473 Ga0495582_0171800 Ga0495582_0171800_52_972 289
115 3300046499 Ga0495594_0185398 Ga0495594_0185398_214_1125 289
116 3300046515 Ga0495620_0016755 Ga0495620_0016755_125_1036 289
117 3300046519 Ga0495632_0050040 Ga0495632_0050040_1093_2004 289
118 3300046524 Ga0495648_0160246 Ga0495648_0160246_102_1013 289
119 3300046674 Ga0495588_0022019 Ga0495588_0022019_2095_3006 289
120 3300046681 Ga0495647_0021966 Ga0495647_0021966_189_1100 289
121 3300046684 Ga0495669_0047010 Ga0495669_0047010_294_1205 289
122 3300046794 Ga0495589_0030502 Ga0495589_0030502_1455_2366 289
123 3300048909 Ga0496106_0030126 Ga0496106_0030126_3049_3960 289
124 3300048912 Ga0496109_0059912 Ga0496109_0059912_998_1909 289
125 3300048921 Ga0496118_0242480 Ga0496118_0242480_106_1017 289
126 3300048924 Ga0496121_0202247 Ga0496121_0202247_252_1163 289
127 3300048928 Ga0496125_0069968 Ga0496125_0069968_478_1389 289
128 3300048929 Ga0496126_0060475 Ga0496126_0060475_2332_3258 289
129 3300049586 Ga0501070_0185454 Ga0501070_0185454_70_990 289
130 3300050492 nmdc:mga0yw44_58599_c1 nmdc:mga0yw44_58599_c1_942_1853 289
131 3300050494 nmdc:mga06z11_50507_c1 nmdc:mga06z11_50507_c1_41_958 289
132 3300050507 nmdc:mga05p37_561866_c1 nmdc:mga05p37_561866_c1_57_974 289
133 3300050512 nmdc:mga0n895_146602_c1 nmdc:mga0n895_146602_c1_620_1531 289
134 3300053094 Ga0500566_0069752 Ga0500566_0069752_850_1773 289
135 3300053095 Ga0500640_047183 Ga0500640_047183_843_1766 289
136 3300053096 Ga0500641_0005375 Ga0500641_0005375_3477_4385 289
137 3300053111 Ga0500572_039656 Ga0500572_039656_270_1193 289
138 3300053122 Ga0500608_101459 Ga0500608_101459_99_1022 289
139 3300053123 Ga0500614_021192 Ga0500614_021192_333_1256 289
140 3300053136 Ga0500559_0044946 Ga0500559_0044946_161_1084 289
141 3300053150 Ga0500603_007196 Ga0500603_007196_1354_2277 289
142 3300053159 Ga0500630_088467 Ga0500630_088467_190_1113 289
143 3300053163 Ga0500639_056134 Ga0500639_056134_869_1792 289
144 3300053735 Ga0500596_006938 Ga0500596_006938_841_1764 289
145 3300005329 Ga0070683_100137127 Ga0070683_1001371271 290
146 3300005364 Ga0070673_100498952 Ga0070673_1004989521 290
147 3300005548 Ga0070665_100078112 Ga0070665_1000781122 290
148 3300005548 Ga0070665_100113165 Ga0070665_1001131653 290
149 3300005616 Ga0068852_100102292 Ga0068852_1001022923 290
150 3300006038 Ga0075365_10023866 Ga0075365_100238664 290
151 3300006178 Ga0075367_10026687 Ga0075367_100266871 290
152 3300006178 Ga0075367_10123004 Ga0075367_101230042 290
153 3300006353 Ga0075370_10120580 Ga0075370_101205801 290
154 3300009093 Ga0105240_10001197 Ga0105240_1000119726 290
155 3300009101 Ga0105247_10025196 Ga0105247_100251964 290
156 3300009551 Ga0105238_10142801 Ga0105238_101428013 290
157 3300013306 Ga0163162_10174231 Ga0163162_101742312 290
158 3300014326 Ga0157380_10632504 Ga0157380_106325041 290
159 3300025913 Ga0207695_10000012 Ga0207695_10000012714 290
160 3300025960 Ga0207651_10374639 Ga0207651_103746391 290
161 3300028800 Ga0265338_10000043 Ga0265338_1000004346 290
162 3300030521 Ga0307511_10103124 Ga0307511_101031242 290
163 3300031238 Ga0265332_10012204 Ga0265332_100122043 290
164 3300031241 Ga0265325_10000002 Ga0265325_10000002341 290
165 3300031249 Ga0265339_10000216 Ga0265339_1000021639 290
166 3300031595 Ga0265313_10001374 Ga0265313_1000137415 290
167 3300031616 Ga0307508_10124094 Ga0307508_101240942 290
168 3300031711 Ga0265314_10021331 Ga0265314_100213316 290
169 3300031730 Ga0307516_10032551 Ga0307516_100325514 290
170 3300031730 Ga0307516_10070586 Ga0307516_100705861 290
171 3300033179 Ga0307507_10073019 Ga0307507_100730193 290
172 3300035170 Ga0373943_0102631 Ga0373943_0102631_36_950 290
173 3300035692 Ga0373935_0020330 Ga0373935_0020330_1084_1998 290
174 3300035725 Ga0373947_0089965 Ga0373947_0089965_216_1130 290
175 3300037068 Ga0373925_0031042 Ga0373925_0031042_2947_3861 290
176 3300046462 Ga0495651_0046362 Ga0495651_0046362_1753_2667 290
177 3300046463 Ga0495653_0159104 Ga0495653_0159104_557_1471 290
178 3300046691 Ga0495670_0048377 Ga0495670_0048377_1166_2080 290
179 3300048927 Ga0496124_0025489 Ga0496124_0025489_1108_2022 290
180 3300049580 Ga0501046_0088041 Ga0501046_0088041_842_1750 290
181 3300049581 Ga0501047_0112245 Ga0501047_0112245_1522_2430 290
182 3300049585 Ga0501069_0147500 Ga0501069_0147500_71_985 290
183 3300049586 Ga0501070_0106083 Ga0501070_0106083_1220_2128 290
184 3300049742 Ga0501080_0032454 Ga0501080_0032454_2698_3606 290
185 3300050492 nmdc:mga0yw44_49348_c1 nmdc:mga0yw44_49348_c1_1469_2383 290
186 3300050494 nmdc:mga06z11_102721_c1 nmdc:mga06z11_102721_c1_36_950 290
187 3300050494 nmdc:mga06z11_16892_c1 nmdc:mga06z11_16892_c1_2225_3139 290
188 3300050495 nmdc:mga04h51_18626_c1 nmdc:mga04h51_18626_c1_991_1905 290
189 3300053094 Ga0500566_0124447 Ga0500566_0124447_86_1000 290
190 3300053136 Ga0500559_0072037 Ga0500559_0072037_360_1274 290
191 3300053177 Ga0500636_0069087 Ga0500636_0069087_441_1355 290
192 3300053178 Ga0500637_0248781 Ga0500637_0248781_30_944 290
193 3300025297 Ga0209758_1017145 Ga0209758_10171452 291
194 3300049581 Ga0501047_0142745 Ga0501047_0142745_352_1272 291
195 3300049823 Ga0501044_0078639 Ga0501044_0078639_1876_2796 291
196 3300005356 Ga0070674_100131017 Ga0070674_1001310172 292
197 3300031235 Ga0265330_10037649 Ga0265330_100376492 292
198 3300046615 Ga0495656_0037632 Ga0495656_0037632_766_1686 292
199 3300005616 Ga0068852_100052205 Ga0068852_1000522054 293
200 3300006941 Ga0099825_1033319 Ga0099825_10333191 293
201 3300006944 Ga0099823_1038597 Ga0099823_10385972 293
202 3300009093 Ga0105240_10061754 Ga0105240_100617543 293
203 3300009545 Ga0105237_10365773 Ga0105237_103657732 293
204 3300013104 Ga0157370_10042220 Ga0157370_100422202 293
205 3300013105 Ga0157369_10053866 Ga0157369_100538661 293
206 3300025913 Ga0207695_10211105 Ga0207695_102111052 293
207 3300026078 Ga0207702_10174808 Ga0207702_101748081 293
208 3300026142 Ga0207698_10133630 Ga0207698_101336301 293
209 3300027296 Ga0209389_1000016 Ga0209389_1000016154 293
210 3300027361 Ga0209489_100063 Ga0209489_100063112 293
211 3300027363 Ga0209700_100012 Ga0209700_100012155 293
212 3300031995 Ga0307409_100101192 Ga0307409_1001011921 293
213 3300037466 Ga0395898_0167326 Ga0395898_0167326_559_1467 293
214 3300046463 Ga0495653_0037943 Ga0495653_0037943_1448_2344 294
215 3300048924 Ga0496121_0140820 Ga0496121_0140820_149_1060 294
216 3300048927 Ga0496124_0124166 Ga0496124_0124166_875_1786 294
217 3300048929 Ga0496126_0027713 Ga0496126_0027713_3737_4645 294
218 3300049570 Ga0501033_0017000 Ga0501033_0017000_958_1878 294
219 3300049742 Ga0501080_0033915 Ga0501080_0033915_3706_4626 294
220 3300037471 Ga0395905_0194260 Ga0395905_0194260_463_1374 295
221 3300038443 Ga0395901_0242616 Ga0395901_0242616_40_951 295
222 3300049579 Ga0501043_0161140 Ga0501043_0161140_556_1476 295
223 3300003659 JGI25404J52841_10001741 JGI25404J52841_100017414 296
224 3300005548 Ga0070665_100198970 Ga0070665_1001989702 296
225 3300005937 Ga0081455_10022178 Ga0081455_100221788 296
226 3300005983 Ga0081540_1028243 Ga0081540_10282432 296
227 3300035695 Ga0373927_0034781 Ga0373927_0034781_70_984 296
228 3300037471 Ga0395905_0284546 Ga0395905_0284546_387_1301 296
229 3300048918 Ga0496115_0071871 Ga0496115_0071871_1220_2116 296
230 3300049580 Ga0501046_0134868 Ga0501046_0134868_835_1770 296
231 iso_pu_bacteria 2524023210 2524466323 296
232 iso_pu_bacteria 2728368998 2728749063 296
233 iso_pu_bacteria 2885383462 2885388866 296
234 iso_pu_bacteria 2903768456 2903772524 296
235 iso_pu_bacteria 2922361189 2922367452 296
236 iso_pu_bacteria 8016630954 8016637024 296
237 iso_pu_bacteria 8056681323 8056686053 296
238 3300053142 Ga0500577_0005369 Ga0500577_0005369_132_1031 297
239 iso_pu_bacteria 2513237096 2513655552 297
240 iso_pu_bacteria 2513237137 2513859765 297
241 iso_pu_bacteria 2513237145 2513916370 297
242 iso_pu_bacteria 2517572143 2517890015 297
243 iso_pu_bacteria 2524023228 2524534907 297
244 iso_pu_bacteria 2643221651 2644287124 297
245 iso_pu_bacteria 2667528175 2671120942 297
246 iso_pu_bacteria 2791355197 2793068005 297
247 iso_pu_bacteria 2791355199 2793080476 297
248 iso_pu_bacteria 2876808645 2876808729 297
249 iso_pu_bacteria 2879110137 2879111993 297
250 iso_pu_bacteria 2885374607 2885377201 297
251 iso_pu_bacteria 2904699407 2904710984 297
252 iso_pu_bacteria 2906610324 2906612219 297
253 iso_pu_bacteria 2906635258 2906638430 297
254 iso_pu_bacteria 2906660503 2906663285 297
255 iso_pu_bacteria 2908739725 2908740237 297
256 iso_pu_bacteria 2922425934 2922427077 297
257 iso_pu_bacteria 2935630451 2935633230 297
258 iso_pu_bacteria 2941507105 2941509468 297
259 iso_pu_bacteria 2941515067 2941517297 297
260 iso_pu_bacteria 2941523033 2941526750 297
261 iso_pu_bacteria 3005474847 3005476251 297
262 iso_pu_bacteria 8006933436 8006937568 297
263 iso_pu_bacteria 8006964411 8006965960 297
264 iso_pu_bacteria 8006973647 8006977597 297
265 iso_pu_bacteria 8006984368 8006989912 297
266 iso_pu_bacteria 8006994254 8006998268 297
267 iso_pu_bacteria 8019555841 8019561044 297
268 iso_pu_bacteria 8019565922 8019571133 297
269 3300049589 Ga0501073_0123849 Ga0501073_0123849_47_946 298
270 iso_pu_bacteria 2508501128 2509151229 298
271 iso_pu_bacteria 2513237141 2513887894 298
272 iso_pu_bacteria 2721755755 2723842653 298
273 iso_pu_bacteria 2903748898 2903754496 298
274 iso_pu_bacteria 2904690495 2904697650 298
275 iso_pu_bacteria 2908756301 2908757756 298
276 3300005336 Ga0070680_100244826 Ga0070680_1002448262 299
277 3300005530 Ga0070679_100170009 Ga0070679_1001700092 299
278 3300009545 Ga0105237_10252266 Ga0105237_102522662 299
279 3300013307 Ga0157372_10695279 Ga0157372_106952792 299
280 3300046512 Ga0495610_0135904 Ga0495610_0135904_99_1025 299
281 iso_pu_bacteria 2602042107 2603857728 299
282 iso_pu_bacteria 2874604998 2874606672 299
283 iso_pu_bacteria 2889033259 2889034051 299
284 iso_pu_bacteria 2893066018 2893068121 299
285 iso_pu_bacteria 2922386360 2922391442 299
286 iso_pu_bacteria 8056673599 8056677891 299
287 3300003659 JGI25404J52841_10002080 JGI25404J52841_100020802 300
288 3300003659 JGI25404J52841_10003832 JGI25404J52841_100038323 300
289 3300003659 JGI25404J52841_10033481 JGI25404J52841_100334811 300
290 3300005329 Ga0070683_100003434 Ga0070683_1000034348 300
291 3300005335 Ga0070666_10124556 Ga0070666_101245562 300
292 3300005336 Ga0070680_100086453 Ga0070680_1000864532 300
293 3300005336 Ga0070680_100227457 Ga0070680_1002274572 300
294 3300005344 Ga0070661_100128503 Ga0070661_1001285031 300
295 3300005356 Ga0070674_100068180 Ga0070674_1000681802 300
296 3300005434 Ga0070709_10006064 Ga0070709_100060644 300
297 3300005435 Ga0070714_100061439 Ga0070714_1000614394 300
298 3300005435 Ga0070714_100211711 Ga0070714_1002117113 300
299 3300005435 Ga0070714_100411043 Ga0070714_1004110431 300
300 3300005436 Ga0070713_100012380 Ga0070713_1000123806 300
301 3300005436 Ga0070713_100019302 Ga0070713_1000193021 300
302 3300005436 Ga0070713_100028548 Ga0070713_1000285482 300
303 3300005439 Ga0070711_100006314 Ga0070711_1000063148 300
304 3300005455 Ga0070663_100190268 Ga0070663_1001902682 300
305 3300005456 Ga0070678_100160737 Ga0070678_1001607372 300
306 3300005466 Ga0070685_10030369 Ga0070685_100303693 300
307 3300005530 Ga0070679_100111083 Ga0070679_1001110833 300
308 3300005535 Ga0070684_100010514 Ga0070684_1000105142 300
309 3300005535 Ga0070684_100335588 Ga0070684_1003355882 300
310 3300005539 Ga0068853_100272272 Ga0068853_1002722722 300
311 3300005719 Ga0068861_100046356 Ga0068861_1000463562 300
312 3300005937 Ga0081455_10038296 Ga0081455_100382963 300
313 3300005983 Ga0081540_1000593 Ga0081540_10005933 300
314 3300005983 Ga0081540_1004374 Ga0081540_10043749 300
315 3300005983 Ga0081540_1005482 Ga0081540_10054826 300
316 3300005983 Ga0081540_1006150 Ga0081540_10061502 300
317 3300005983 Ga0081540_1007526 Ga0081540_10075268 300
318 3300006028 Ga0070717_10025976 Ga0070717_100259763 300
319 3300006175 Ga0070712_100047857 Ga0070712_1000478572 300
320 3300006237 Ga0097621_100301754 Ga0097621_1003017542 300
321 3300006871 Ga0075434_100052099 Ga0075434_1000520993 300
322 3300006943 Ga0099822_1000157 Ga0099822_100015714 300
323 3300009093 Ga0105240_10084380 Ga0105240_100843802 300
324 3300009093 Ga0105240_10146948 Ga0105240_101469482 300
325 3300009093 Ga0105240_10411072 Ga0105240_104110721 300
326 3300009545 Ga0105237_10126193 Ga0105237_101261932 300
327 3300009551 Ga0105238_10092078 Ga0105238_100920783 300
328 3300009551 Ga0105238_10269200 Ga0105238_102692001 300
329 3300010375 Ga0105239_10026562 Ga0105239_100265628 300
330 3300010375 Ga0105239_10475588 Ga0105239_104755882 300
331 3300010375 Ga0105239_10749881 Ga0105239_107498811 300
332 3300013104 Ga0157370_10044446 Ga0157370_100444462 300
333 3300013105 Ga0157369_10016172 Ga0157369_100161728 300
334 3300013105 Ga0157369_10060994 Ga0157369_100609944 300
335 3300013307 Ga0157372_10045762 Ga0157372_100457625 300
336 3300013307 Ga0157372_10105931 Ga0157372_101059313 300
337 3300013308 Ga0157375_10123008 Ga0157375_101230082 300
338 3300014325 Ga0163163_10320384 Ga0163163_103203842 300
339 3300020082 Ga0206353_12034910 Ga0206353_120349102 300
340 3300025898 Ga0207692_10012181 Ga0207692_100121811 300
341 3300025906 Ga0207699_10034863 Ga0207699_100348631 300
342 3300025913 Ga0207695_10061763 Ga0207695_100617633 300
343 3300025913 Ga0207695_10099850 Ga0207695_100998502 300
344 3300025913 Ga0207695_10321474 Ga0207695_103214741 300
345 3300025914 Ga0207671_10168384 Ga0207671_101683842 300
346 3300025915 Ga0207693_10004353 Ga0207693_1000435312 300
347 3300025916 Ga0207663_10141865 Ga0207663_101418652 300
348 3300025917 Ga0207660_10173882 Ga0207660_101738822 300
349 3300025921 Ga0207652_10229266 Ga0207652_102292662 300
350 3300025924 Ga0207694_10231246 Ga0207694_102312462 300
351 3300025927 Ga0207687_10096865 Ga0207687_100968651 300
352 3300025928 Ga0207700_10081539 Ga0207700_100815392 300
353 3300025929 Ga0207664_10213791 Ga0207664_102137911 300
354 3300025931 Ga0207644_10360734 Ga0207644_103607341 300
355 3300025934 Ga0207686_10351896 Ga0207686_103518961 300
356 3300025935 Ga0207709_10026424 Ga0207709_100264242 300
357 3300025937 Ga0207669_10273263 Ga0207669_102732631 300
358 3300025938 Ga0207704_10136731 Ga0207704_101367312 300
359 3300025939 Ga0207665_10311213 Ga0207665_103112131 300
360 3300025940 Ga0207691_10202336 Ga0207691_102023361 300
361 3300025941 Ga0207711_10057836 Ga0207711_100578365 300
362 3300025944 Ga0207661_10002953 Ga0207661_100029537 300
363 3300025949 Ga0207667_10330572 Ga0207667_103305721 300
364 3300026041 Ga0207639_10212394 Ga0207639_102123942 300
365 3300026041 Ga0207639_10468715 Ga0207639_104687151 300
366 3300026116 Ga0207674_10072022 Ga0207674_100720222 300
367 3300026121 Ga0207683_10403190 Ga0207683_104031901 300
368 3300026142 Ga0207698_10073445 Ga0207698_100734452 300
369 3300027357 Ga0209589_1000005 Ga0209589_1000005421 300
370 3300027361 Ga0209489_100005 Ga0209489_100005421 300
371 3300027363 Ga0209700_100006 Ga0209700_100006421 300
372 3300031247 Ga0265340_10066728 Ga0265340_100667281 300
373 3300031249 Ga0265339_10001372 Ga0265339_100013721 300
374 3300031507 Ga0307509_10358074 Ga0307509_103580741 300
375 3300031616 Ga0307508_10046720 Ga0307508_100467206 300
376 3300031616 Ga0307508_10062521 Ga0307508_100625213 300
377 3300035083 Ga0373926_0005379 Ga0373926_0005379_407_1315 300
378 3300035086 Ga0373934_0128973 Ga0373934_0128973_19_927 300
379 3300035089 Ga0373944_0025210 Ga0373944_0025210_828_1736 300
380 3300035111 Ga0373923_0055799 Ga0373923_0055799_98_1006 300
381 3300035113 Ga0373936_0008199 Ga0373936_0008199_1076_1984 300
382 3300035113 Ga0373936_0044876 Ga0373936_0044876_172_1080 300
383 3300035116 Ga0373945_0030352 Ga0373945_0030352_688_1596 300
384 3300035117 Ga0373953_0030578 Ga0373953_0030578_473_1381 300
385 3300035120 Ga0373957_0045081 Ga0373957_0045081_674_1582 300
386 3300035170 Ga0373943_0022820 Ga0373943_0022820_391_1299 300
387 3300035171 Ga0373946_0016253 Ga0373946_0016253_1713_2621 300
388 3300035171 Ga0373946_0050038 Ga0373946_0050038_473_1381 300
389 3300035410 Ga0373924_0041013 Ga0373924_0041013_409_1317 300
390 3300035691 Ga0373931_0014148 Ga0373931_0014148_2009_2917 300
391 3300035692 Ga0373935_0002921 Ga0373935_0002921_6985_7893 300
392 3300035695 Ga0373927_0022088 Ga0373927_0022088_439_1347 300
393 3300035695 Ga0373927_0044280 Ga0373927_0044280_1224_2141 300
394 3300035695 Ga0373927_0103187 Ga0373927_0103187_719_1627 300
395 3300036401 Ga0373937_0022868 Ga0373937_0022868_2498_3406 300
396 3300036401 Ga0373937_0050675 Ga0373937_0050675_655_1563 300
397 3300037068 Ga0373925_0002335 Ga0373925_0002335_9114_10022 300
398 3300037068 Ga0373925_0037370 Ga0373925_0037370_1593_2501 300
399 3300037466 Ga0395898_0374522 Ga0395898_0374522_10_933 300
400 3300039437 Ga0436365_0186993 Ga0436365_0186993_167_1075 300
401 3300039437 Ga0436365_0279031 Ga0436365_0279031_1802_2710 300
402 3300039437 Ga0436365_1775413 Ga0436365_1775413_47_955 300
403 3300039438 Ga0436360_0435243 Ga0436360_0435243_104_1018 300
404 3300039438 Ga0436360_1271326 Ga0436360_1271326_160_1080 300
405 3300039450 Ga0436363_0341762 Ga0436363_0341762_70_993 300
406 3300039450 Ga0436363_0637508 Ga0436363_0637508_13_921 300
407 3300044694 Ga0466963_0219813 Ga0466963_0219813_74_982 300
408 3300045976 Ga0466967_0427634 Ga0466967_0427634_293_1201 300
409 3300046454 Ga0495592_0051399 Ga0495592_0051399_1317_2225 300
410 3300046454 Ga0495592_0167241 Ga0495592_0167241_140_1048 300
411 3300046455 Ga0495603_0000923 Ga0495603_0000923_5757_6665 300
412 3300046455 Ga0495603_0116984 Ga0495603_0116984_628_1536 300
413 3300046459 Ga0495629_0002400 Ga0495629_0002400_4073_4981 300
414 3300046459 Ga0495629_0033029 Ga0495629_0033029_1335_2243 300
415 3300046472 Ga0495580_0009257 Ga0495580_0009257_5574_6482 300
416 3300046472 Ga0495580_0010859 Ga0495580_0010859_1728_2636 300
417 3300046473 Ga0495582_0000283 Ga0495582_0000283_4799_5707 300
418 3300046475 Ga0495639_0004800 Ga0495639_0004800_4364_5272 300
419 3300046475 Ga0495639_0031638 Ga0495639_0031638_1081_1989 300
420 3300046476 Ga0495662_0001975 Ga0495662_0001975_9304_10212 300
421 3300046477 Ga0495664_0007158 Ga0495664_0007158_3416_4324 300
422 3300046477 Ga0495664_0013420 Ga0495664_0013420_2882_3790 300
423 3300046499 Ga0495594_0000509 Ga0495594_0000509_11464_12372 300
424 3300046514 Ga0495618_0281935 Ga0495618_0281935_27_935 300
425 3300046517 Ga0495630_0008393 Ga0495630_0008393_1322_2230 300
426 3300046517 Ga0495630_0018211 Ga0495630_0018211_907_1815 300
427 3300046526 Ga0495666_0044887 Ga0495666_0044887_363_1271 300
428 3300046529 Ga0495652_0040475 Ga0495652_0040475_813_1721 300
429 3300046529 Ga0495652_0146685 Ga0495652_0146685_275_1177 300
430 3300046531 Ga0495665_0000145 Ga0495665_0000145_19471_20379 300
431 3300046531 Ga0495665_0025922 Ga0495665_0025922_2130_3038 300
432 3300046533 Ga0495640_0007751 Ga0495640_0007751_4472_5380 300
433 3300046533 Ga0495640_0016865 Ga0495640_0016865_2723_3631 300
434 3300046543 Ga0495645_0001274 Ga0495645_0001274_7583_8491 300
435 3300046543 Ga0495645_0128833 Ga0495645_0128833_693_1595 300
436 3300046557 Ga0495622_0006137 Ga0495622_0006137_1072_1980 300
437 3300046559 Ga0495667_0066888 Ga0495667_0066888_1247_2155 300
438 3300046615 Ga0495656_0087813 Ga0495656_0087813_401_1309 300
439 3300046616 Ga0495668_0245267 Ga0495668_0245267_32_940 300
440 3300046642 Ga0495634_0001108 Ga0495634_0001108_5756_6664 300
441 3300046642 Ga0495634_0047491 Ga0495634_0047491_1621_2529 300
442 3300046663 Ga0495635_0009937 Ga0495635_0009937_5121_6029 300
443 3300046674 Ga0495588_0013234 Ga0495588_0013234_2581_3489 300
444 3300046678 Ga0495599_0168913 Ga0495599_0168913_162_1064 300
445 3300046680 Ga0495646_0021267 Ga0495646_0021267_1597_2505 300
446 3300046681 Ga0495647_0007604 Ga0495647_0007604_2537_3445 300
447 3300046683 Ga0495658_0000547 Ga0495658_0000547_172_1080 300
448 3300046683 Ga0495658_0035174 Ga0495658_0035174_43_951 300
449 3300046689 Ga0495613_0002250 Ga0495613_0002250_4366_5274 300
450 3300046690 Ga0495624_0005060 Ga0495624_0005060_6667_7575 300
451 3300046809 Ga0495600_0101812 Ga0495600_0101812_86_994 300
452 3300047315 Ga0495581_0000529 Ga0495581_0000529_8336_9244 300
453 3300047315 Ga0495581_0030657 Ga0495581_0030657_1760_2668 300
454 3300047317 Ga0495604_0049547 Ga0495604_0049547_42_950 300
455 3300047319 Ga0495674_0005462 Ga0495674_0005462_11207_12115 300
456 3300047319 Ga0495674_0032883 Ga0495674_0032883_1514_2422 300
457 3300047320 Ga0495672_0003965 Ga0495672_0003965_11300_12208 300
458 3300047321 Ga0495676_0092859 Ga0495676_0092859_1100_2008 300
459 3300047321 Ga0495676_0102774 Ga0495676_0102774_412_1320 300
460 3300047471 Ga0495684_0148877 Ga0495684_0148877_695_1603 300
461 3300047471 Ga0495684_0355267 Ga0495684_0355267_85_993 300
462 3300047673 Ga0495593_0000877 Ga0495593_0000877_4672_5580 300
463 3300047673 Ga0495593_0144698 Ga0495593_0144698_249_1157 300
464 3300048089 Ga0495614_0026282 Ga0495614_0026282_680_1588 300
465 3300048905 Ga0496102_0313522 Ga0496102_0313522_289_1197 300
466 3300048907 Ga0496104_0434562 Ga0496104_0434562_147_1055 300
467 3300048914 Ga0496111_0287847 Ga0496111_0287847_269_1177 300
468 3300048918 Ga0496115_0120672 Ga0496115_0120672_1238_2146 300
469 3300048920 Ga0496117_0089099 Ga0496117_0089099_387_1295 300
470 3300048921 Ga0496118_0188736 Ga0496118_0188736_140_1048 300
471 3300048922 Ga0496119_0069778 Ga0496119_0069778_98_1006 300
472 3300048924 Ga0496121_0000753 Ga0496121_0000753_3814_4722 300
473 3300048925 Ga0496122_0017207 Ga0496122_0017207_4085_4993 300
474 3300048929 Ga0496126_0004189 Ga0496126_0004189_3856_4764 300
475 3300048929 Ga0496126_0004375 Ga0496126_0004375_9057_9986 300
476 3300048929 Ga0496126_0010575 Ga0496126_0010575_1975_2883 300
477 3300048929 Ga0496126_0194172 Ga0496126_0194172_749_1657 300
478 3300048929 Ga0496126_0260069 Ga0496126_0260069_345_1253 300
479 3300049583 Ga0501067_0034503 Ga0501067_0034503_689_1597 300
480 3300049589 Ga0501073_0142649 Ga0501073_0142649_47_955 300
481 3300053077 Ga0495601_0150130 Ga0495601_0150130_449_1357 300
482 3300053078 Ga0495612_0074170 Ga0495612_0074170_380_1288 300
483 3300053080 Ga0500635_0084412 Ga0500635_0084412_79_987 300
484 3300053091 Ga0500647_0163083 Ga0500647_0163083_108_1016 300
485 3300053119 Ga0500595_005383 Ga0500595_005383_779_1687 300
486 3300053130 Ga0500642_0130334 Ga0500642_0130334_155_1063 300
487 3300061719 Ga0466962_0076832 Ga0466962_0076832_195_1103 300
488 iso_pu_bacteria 2513237092 2513624581 300
489 3300005327 Ga0070658_10120295 Ga0070658_101202952 301
490 3300005334 Ga0068869_100095218 Ga0068869_1000952183 301
491 3300005347 Ga0070668_100040165 Ga0070668_1000401651 301
492 3300005366 Ga0070659_100083479 Ga0070659_1000834792 301
493 3300005457 Ga0070662_100098106 Ga0070662_1000981062 301
494 3300005530 Ga0070679_100030709 Ga0070679_1000307094 301
495 3300005543 Ga0070672_100422676 Ga0070672_1004226761 301
496 3300005548 Ga0070665_100371102 Ga0070665_1003711022 301
497 3300005563 Ga0068855_100089780 Ga0068855_1000897804 301
498 3300005578 Ga0068854_100150709 Ga0068854_1001507092 301
499 3300005614 Ga0068856_100000046 Ga0068856_10000004643 301
500 3300005617 Ga0068859_100049211 Ga0068859_1000492113 301
501 3300005618 Ga0068864_100032861 Ga0068864_1000328614 301
502 3300005842 Ga0068858_100088777 Ga0068858_1000887772 301
503 3300005843 Ga0068860_100087140 Ga0068860_1000871403 301
504 3300005983 Ga0081540_1047939 Ga0081540_10479391 301
505 3300006038 Ga0075365_10191308 Ga0075365_101913082 301
506 3300006177 Ga0075362_10019479 Ga0075362_100194791 301
507 3300006931 Ga0097620_100049210 Ga0097620_1000492103 301
508 3300007788 Ga0099795_10043275 Ga0099795_100432752 301
509 3300009093 Ga0105240_10097953 Ga0105240_100979535 301
510 3300009545 Ga0105237_10664001 Ga0105237_106640011 301
511 3300010159 Ga0099796_10024147 Ga0099796_100241472 301
512 3300010375 Ga0105239_10079923 Ga0105239_100799233 301
513 3300011119 Ga0105246_10011337 Ga0105246_100113374 301
514 3300013104 Ga0157370_10049797 Ga0157370_100497973 301
515 3300013105 Ga0157369_10329069 Ga0157369_103290692 301
516 3300013296 Ga0157374_10439642 Ga0157374_104396421 301
517 3300014326 Ga0157380_10587038 Ga0157380_105870381 301
518 3300017792 Ga0163161_10211273 Ga0163161_102112732 301
519 3300025912 Ga0207707_10118209 Ga0207707_101182094 301
520 3300025922 Ga0207646_10031950 Ga0207646_100319505 301
521 3300025925 Ga0207650_10467272 Ga0207650_104672721 301
522 3300025928 Ga0207700_10383268 Ga0207700_103832681 301
523 3300025933 Ga0207706_10095886 Ga0207706_100958862 301
524 3300025939 Ga0207665_10081997 Ga0207665_100819972 301
525 3300025949 Ga0207667_10221883 Ga0207667_102218833 301
526 3300025972 Ga0207668_10010865 Ga0207668_100108652 301
527 3300025972 Ga0207668_10278070 Ga0207668_102780701 301
528 3300026067 Ga0207678_10064611 Ga0207678_100646113 301
529 3300026067 Ga0207678_10104230 Ga0207678_101042302 301
530 3300026067 Ga0207678_10200944 Ga0207678_102009442 301
531 3300026078 Ga0207702_10000014 Ga0207702_10000014129 301
532 3300026116 Ga0207674_10397060 Ga0207674_103970601 301
533 3300028573 Ga0265334_10037206 Ga0265334_100372062 301
534 3300031235 Ga0265330_10043356 Ga0265330_100433562 301
535 3300031238 Ga0265332_10118906 Ga0265332_101189061 301
536 3300031241 Ga0265325_10010610 Ga0265325_100106101 301
537 3300031249 Ga0265339_10033300 Ga0265339_100333002 301
538 3300031711 Ga0265314_10007706 Ga0265314_100077068 301
539 3300031711 Ga0265314_10050084 Ga0265314_100500842 301
540 3300031712 Ga0265342_10023757 Ga0265342_100237572 301
541 3300031712 Ga0265342_10163634 Ga0265342_101636342 301
542 3300031730 Ga0307516_10020012 Ga0307516_100200124 301
543 3300033180 Ga0307510_10024013 Ga0307510_100240133 301
544 3300033442 Ga0315911_1000005 Ga0315911_1000005424 301
545 3300035086 Ga0373934_0002178 Ga0373934_0002178_2776_3687 301
546 3300035086 Ga0373934_0056678 Ga0373934_0056678_295_1206 301
547 3300035111 Ga0373923_0001946 Ga0373923_0001946_3007_3918 301
548 3300035118 Ga0373954_0002355 Ga0373954_0002355_5132_6043 301
549 3300035119 Ga0373956_0002239 Ga0373956_0002239_5536_6447 301
550 3300035120 Ga0373957_0000527 Ga0373957_0000527_6208_7119 301
551 3300035172 Ga0373955_0000535 Ga0373955_0000535_12692_13603 301
552 3300035410 Ga0373924_0004005 Ga0373924_0004005_1168_2079 301
553 3300035691 Ga0373931_0086136 Ga0373931_0086136_412_1323 301
554 3300035724 Ga0373933_0002165 Ga0373933_0002165_8602_9513 301
555 3300036401 Ga0373937_0033007 Ga0373937_0033007_3709_4620 301
556 3300037418 Ga0395900_0082356 Ga0395900_0082356_1625_2536 301
557 3300038443 Ga0395901_0400194 Ga0395901_0400194_340_1251 301
558 3300041413 Ga0439465_0064341 Ga0439465_0064341_221_1132 301
559 3300046454 Ga0495592_0021832 Ga0495592_0021832_2742_3653 301
560 3300046455 Ga0495603_0008603 Ga0495603_0008603_285_1205 301
561 3300046457 Ga0495590_0116036 Ga0495590_0116036_25_936 301
562 3300046459 Ga0495629_0001841 Ga0495629_0001841_7568_8479 301
563 3300046462 Ga0495651_0101608 Ga0495651_0101608_1151_2062 301
564 3300046463 Ga0495653_0004149 Ga0495653_0004149_9870_10781 301
565 3300046514 Ga0495618_0032005 Ga0495618_0032005_2362_3273 301
566 3300046529 Ga0495652_0016077 Ga0495652_0016077_4474_5385 301
567 3300046533 Ga0495640_0182539 Ga0495640_0182539_205_1116 301
568 3300046559 Ga0495667_0033824 Ga0495667_0033824_1323_2234 301
569 3300046642 Ga0495634_0009918 Ga0495634_0009918_4896_5807 301
570 3300046648 Ga0495611_0123558 Ga0495611_0123558_10_921 301
571 3300046663 Ga0495635_0002477 Ga0495635_0002477_6552_7463 301
572 3300046665 Ga0495661_0167179 Ga0495661_0167179_205_1116 301
573 3300046675 Ga0495657_0060429 Ga0495657_0060429_78_989 301
574 3300046679 Ga0495623_0010731 Ga0495623_0010731_3711_4622 301
575 3300046680 Ga0495646_0049099 Ga0495646_0049099_1596_2507 301
576 3300046809 Ga0495600_0027802 Ga0495600_0027802_1423_2334 301
577 3300047317 Ga0495604_0040425 Ga0495604_0040425_1324_2235 301
578 3300047319 Ga0495674_0012072 Ga0495674_0012072_2658_3569 301
579 3300047322 Ga0495680_0012571 Ga0495680_0012571_2284_3195 301
580 3300047471 Ga0495684_0001145 Ga0495684_0001145_13932_14843 301
581 3300047472 Ga0495686_0090735 Ga0495686_0090735_78_989 301
582 3300047673 Ga0495593_0000526 Ga0495593_0000526_13515_14426 301
583 3300048088 Ga0495602_0009427 Ga0495602_0009427_6387_7298 301
584 3300048905 Ga0496102_0077517 Ga0496102_0077517_887_1798 301
585 3300048907 Ga0496104_0017315 Ga0496104_0017315_5185_6096 301
586 3300048907 Ga0496104_0025169 Ga0496104_0025169_3412_4323 301
587 3300048908 Ga0496105_0124309 Ga0496105_0124309_455_1366 301
588 3300048909 Ga0496106_0328558 Ga0496106_0328558_28_939 301
589 3300048911 Ga0496108_0000392 Ga0496108_0000392_16091_17002 301
590 3300048912 Ga0496109_0000509 Ga0496109_0000509_7281_8192 301
591 3300048912 Ga0496109_0059361 Ga0496109_0059361_2372_3283 301
592 3300048913 Ga0496110_0002823 Ga0496110_0002823_6284_7195 301
593 3300048914 Ga0496111_0053075 Ga0496111_0053075_975_1886 301
594 3300048915 Ga0496112_0001604 Ga0496112_0001604_14876_15787 301
595 3300048915 Ga0496112_0097025 Ga0496112_0097025_1095_2006 301
596 3300048916 Ga0496113_0146761 Ga0496113_0146761_106_1017 301
597 3300048918 Ga0496115_0054399 Ga0496115_0054399_1270_2181 301
598 3300048924 Ga0496121_0002265 Ga0496121_0002265_8104_9021 301
599 3300048924 Ga0496121_0113253 Ga0496121_0113253_684_1598 301
600 3300048929 Ga0496126_0003779 Ga0496126_0003779_7910_8827 301
601 3300049569 Ga0501032_0111388 Ga0501032_0111388_667_1575 301
602 3300049822 Ga0501035_0346193 Ga0501035_0346193_248_1156 301
603 3300050491 nmdc:mga00v17_192244_c1 nmdc:mga00v17_192244_c1_127_1038 301
604 3300050516 nmdc:mga0sz30_28196_c1 nmdc:mga0sz30_28196_c1_131_1042 301
605 3300053077 Ga0495601_0026489 Ga0495601_0026489_1339_2250 301
606 3300053084 Ga0495595_0001351 Ga0495595_0001351_2511_3422 301
607 3300053085 Ga0495619_0001695 Ga0495619_0001695_7700_8611 301
608 3300053124 Ga0500617_099510 Ga0500617_099510_47_958 301
609 3300053150 Ga0500603_000301 Ga0500603_000301_11974_12894 301
610 iso_pu_bacteria 2857509624 2857514599 301
611 iso_pu_bacteria 2857524615 2857527101 301
612 iso_pu_bacteria 2919073203 2919078215 301
613 3300003203 JGI25406J46586_10001255 JGI25406J46586_100012557 302
614 3300005329 Ga0070683_100034098 Ga0070683_1000340982 302
615 3300005336 Ga0070680_100008274 Ga0070680_1000082746 302
616 3300005457 Ga0070662_100427618 Ga0070662_1004276181 302
617 3300005458 Ga0070681_10080393 Ga0070681_100803933 302
618 3300005467 Ga0070706_100058712 Ga0070706_1000587123 302
619 3300005467 Ga0070706_100361878 Ga0070706_1003618782 302
620 3300005530 Ga0070679_100139229 Ga0070679_1001392293 302
621 3300005535 Ga0070684_100001737 Ga0070684_1000017378 302
622 3300005539 Ga0068853_100001167 Ga0068853_1000011676 302
623 3300005563 Ga0068855_100024736 Ga0068855_1000247365 302
624 3300005563 Ga0068855_100253725 Ga0068855_1002537251 302
625 3300005577 Ga0068857_100008553 Ga0068857_1000085536 302
626 3300005834 Ga0068851_10006569 Ga0068851_100065693 302
627 3300005937 Ga0081455_10005322 Ga0081455_1000532212 302
628 3300005937 Ga0081455_10071810 Ga0081455_100718103 302
629 3300005985 Ga0081539_10000540 Ga0081539_1000054012 302
630 3300005985 Ga0081539_10024335 Ga0081539_100243351 302
631 3300009093 Ga0105240_10082281 Ga0105240_100822811 302
632 3300009545 Ga0105237_10043361 Ga0105237_100433612 302
633 3300009551 Ga0105238_10006431 Ga0105238_100064319 302
634 3300010375 Ga0105239_10019170 Ga0105239_100191707 302
635 3300013104 Ga0157370_10047747 Ga0157370_100477476 302
636 3300013105 Ga0157369_10004737 Ga0157369_100047376 302
637 3300013105 Ga0157369_10305283 Ga0157369_103052832 302
638 3300025909 Ga0207705_10015948 Ga0207705_100159486 302
639 3300025910 Ga0207684_10028686 Ga0207684_100286863 302
640 3300025910 Ga0207684_10276110 Ga0207684_102761102 302
641 3300025912 Ga0207707_10001530 Ga0207707_100015308 302
642 3300025913 Ga0207695_10053040 Ga0207695_100530401 302
643 3300025914 Ga0207671_10012099 Ga0207671_100120997 302
644 3300025914 Ga0207671_10039297 Ga0207671_100392972 302
645 3300025917 Ga0207660_10001829 Ga0207660_1000182912 302
646 3300025919 Ga0207657_10010330 Ga0207657_1001033011 302
647 3300025920 Ga0207649_10054349 Ga0207649_100543492 302
648 3300025921 Ga0207652_10006474 Ga0207652_100064748 302
649 3300025944 Ga0207661_10340895 Ga0207661_103408951 302
650 3300025949 Ga0207667_10008657 Ga0207667_100086578 302
651 3300026041 Ga0207639_10005343 Ga0207639_100053438 302
652 3300026088 Ga0207641_10287131 Ga0207641_102871311 302
653 3300026116 Ga0207674_10013973 Ga0207674_100139737 302
654 3300027907 Ga0207428_10253237 Ga0207428_102532371 302
655 3300028379 Ga0268266_10103489 Ga0268266_101034892 302
656 3300028379 Ga0268266_10283478 Ga0268266_102834782 302
657 3300031507 Ga0307509_10135413 Ga0307509_101354132 302
658 3300031616 Ga0307508_10123051 Ga0307508_101230513 302
659 3300031616 Ga0307508_10155675 Ga0307508_101556752 302
660 3300031730 Ga0307516_10082172 Ga0307516_100821721 302
661 3300031730 Ga0307516_10112661 Ga0307516_101126612 302
662 3300033180 Ga0307510_10247799 Ga0307510_102477992 302
663 3300033544 Ga0316215_1002400 Ga0316215_10024001 302
664 3300035170 Ga0373943_0092610 Ga0373943_0092610_90_1004 302
665 3300035172 Ga0373955_0258799 Ga0373955_0258799_28_942 302
666 3300035692 Ga0373935_0023018 Ga0373935_0023018_2020_2934 302
667 3300035695 Ga0373927_0005026 Ga0373927_0005026_2686_3609 302
668 3300035695 Ga0373927_0012684 Ga0373927_0012684_4646_5560 302
669 3300035695 Ga0373927_0031199 Ga0373927_0031199_200_1114 302
670 3300035724 Ga0373933_0000017 Ga0373933_0000017_13865_14779 302
671 3300035725 Ga0373947_0066854 Ga0373947_0066854_318_1232 302
672 3300035725 Ga0373947_0323785 Ga0373947_0323785_88_1002 302
673 3300036459 Ga0372808_012313 Ga0372808_012313_118_1032 302
674 3300046455 Ga0495603_0028744 Ga0495603_0028744_524_1438 302
675 3300046459 Ga0495629_0116831 Ga0495629_0116831_391_1305 302
676 3300046463 Ga0495653_0034694 Ga0495653_0034694_85_999 302
677 3300046472 Ga0495580_0030671 Ga0495580_0030671_172_1086 302
678 3300046475 Ga0495639_0043363 Ga0495639_0043363_716_1630 302
679 3300046475 Ga0495639_0110306 Ga0495639_0110306_137_1051 302
680 3300046477 Ga0495664_0091912 Ga0495664_0091912_487_1401 302
681 3300046511 Ga0495608_0066765 Ga0495608_0066765_536_1450 302
682 3300046517 Ga0495630_0130835 Ga0495630_0130835_465_1379 302
683 3300046543 Ga0495645_0008376 Ga0495645_0008376_5807_6721 302
684 3300046559 Ga0495667_0102445 Ga0495667_0102445_27_941 302
685 3300046674 Ga0495588_0028524 Ga0495588_0028524_378_1292 302
686 3300046678 Ga0495599_0014179 Ga0495599_0014179_907_1821 302
687 3300046679 Ga0495623_0045628 Ga0495623_0045628_769_1683 302
688 3300046690 Ga0495624_0259508 Ga0495624_0259508_62_976 302
689 3300046810 Ga0495660_0105137 Ga0495660_0105137_490_1398 302
690 3300047322 Ga0495680_0066707 Ga0495680_0066707_749_1663 302
691 3300048904 Ga0496101_0103181 Ga0496101_0103181_666_1583 302
692 3300048906 Ga0496103_0047232 Ga0496103_0047232_1332_2246 302
693 3300048909 Ga0496106_0010776 Ga0496106_0010776_3298_4212 302
694 3300048917 Ga0496114_0301961 Ga0496114_0301961_47_961 302
695 3300048920 Ga0496117_0009803 Ga0496117_0009803_2312_3226 302
696 3300048921 Ga0496118_0004079 Ga0496118_0004079_9280_10194 302
697 3300048924 Ga0496121_0001173 Ga0496121_0001173_23558_24472 302
698 3300048924 Ga0496121_0003552 Ga0496121_0003552_13322_14236 302
699 3300048927 Ga0496124_0002443 Ga0496124_0002443_4683_5597 302
700 3300048929 Ga0496126_0030836 Ga0496126_0030836_812_1726 302
701 3300050511 nmdc:mga08y16_635823_c1 nmdc:mga08y16_635823_c1_108_1022 302
702 3300053084 Ga0495595_0037526 Ga0495595_0037526_359_1273 302
703 3300053177 Ga0500636_0134346 Ga0500636_0134346_382_1296 302
704 3300053737 Ga0500601_000021 Ga0500601_000021_36197_37114 302
705 3300060353 Ga0501082_0389011 Ga0501082_0389011_36_959 302
706 iso_pu_bacteria 2842038055 2842041853 302
707 iso_pu_bacteria 2842045827 2842049896 302
708 iso_pu_bacteria 2935883170 2935887075 302
709 3300005435 Ga0070714_100021573 Ga0070714_1000215732 303
710 3300005436 Ga0070713_100068744 Ga0070713_1000687443 303
711 3300005437 Ga0070710_10021944 Ga0070710_100219441 303
712 3300005439 Ga0070711_100015903 Ga0070711_1000159035 303
713 3300006028 Ga0070717_10019892 Ga0070717_100198923 303
714 3300006163 Ga0070715_10004432 Ga0070715_100044321 303
715 3300006173 Ga0070716_100024043 Ga0070716_1000240434 303
716 3300006175 Ga0070712_100035302 Ga0070712_1000353023 303
717 3300006186 Ga0075369_10014471 Ga0075369_100144712 303
718 3300025295 Ga0209564_1000503 Ga0209564_100050343 303
719 3300025295 Ga0209564_1017199 Ga0209564_10171992 303
720 3300025898 Ga0207692_10000264 Ga0207692_100002644 303
721 3300025905 Ga0207685_10018555 Ga0207685_100185551 303
722 3300025906 Ga0207699_10007722 Ga0207699_100077226 303
723 3300025915 Ga0207693_10021458 Ga0207693_100214585 303
724 3300025916 Ga0207663_10003268 Ga0207663_100032687 303
725 3300025928 Ga0207700_10025918 Ga0207700_100259183 303
726 3300025929 Ga0207664_10037088 Ga0207664_100370883 303
727 3300025939 Ga0207665_10004886 Ga0207665_1000488610 303
728 3300046557 Ga0495622_0018451 Ga0495622_0018451_1190_2137 303
729 3300047472 Ga0495686_0049064 Ga0495686_0049064_236_1153 303
730 3300048919 Ga0496116_0001611 Ga0496116_0001611_4702_5622 303
731 3300048921 Ga0496118_0025358 Ga0496118_0025358_1700_2647 303
732 3300048925 Ga0496122_0080711 Ga0496122_0080711_848_1768 303
733 3300048927 Ga0496124_0167621 Ga0496124_0167621_34_981 303
734 3300048928 Ga0496125_0005975 Ga0496125_0005975_14_934 303
735 3300050491 nmdc:mga00v17_43859_c2 nmdc:mga00v17_43859_c2_39_986 303
736 3300050496 nmdc:mga07m45_217547_c1 nmdc:mga07m45_217547_c1_133_1080 303
737 3300053094 Ga0500566_0002520 Ga0500566_0002520_7875_8822 303
738 3300053102 Ga0500554_018078 Ga0500554_018078_641_1588 303
739 3300053117 Ga0500593_046853 Ga0500593_046853_683_1615 303
740 3300053122 Ga0500608_027336 Ga0500608_027336_279_1226 303
741 3300053125 Ga0500618_006007 Ga0500618_006007_125_1072 303
742 3300053136 Ga0500559_0001670 Ga0500559_0001670_2865_3812 303
743 3300053177 Ga0500636_0001763 Ga0500636_0001763_1476_2423 303
744 iso_pu_bacteria 2507262055 2507512030 303
745 iso_pu_bacteria 2508501009 2508545690 303
746 iso_pu_bacteria 2508501042 2508694512 303
747 iso_pu_bacteria 2511231028 2511401326 303
748 iso_pu_bacteria 2513237092 2513625205 303
749 iso_pu_bacteria 2513237095 2513650056 303
750 iso_pu_bacteria 2513237102 2513704028 303
751 iso_pu_bacteria 2513237104 2513720200 303
752 iso_pu_bacteria 2513237139 2513874337 303
753 iso_pu_bacteria 2513237161 2514016831 303
754 iso_pu_bacteria 2515154112 2515624557 303
755 iso_pu_bacteria 2517093001 2517104510 303
756 iso_pu_bacteria 2524023205 2524438473 303
757 iso_pu_bacteria 2617270735 2617353129 303
758 iso_pu_bacteria 2617270741 2617374543 303
759 iso_pu_bacteria 2744054633 2745078368 303
760 iso_pu_bacteria 2791355196 2793059473 303
761 iso_pu_bacteria 2802429603 2805916104 303
762 iso_pu_bacteria 2816332527 2818242956 303
763 iso_pu_bacteria 2824600985 2824604496 303
764 iso_pu_bacteria 2824609381 2824614963 303
765 iso_pu_bacteria 2824617872 2824624323 303
766 iso_pu_bacteria 2824626560 2824633096 303
767 iso_pu_bacteria 2824635225 2824643546 303
768 iso_pu_bacteria 2824653114 2824657514 303
769 iso_pu_bacteria 2824671348 2824673993 303
770 iso_pu_bacteria 2824687955 2824691264 303
771 iso_pu_bacteria 2824696289 2824701375 303
772 iso_pu_bacteria 2824704595 2824712716 303
773 iso_pu_bacteria 2824723954 2824732013 303
774 iso_pu_bacteria 2824746037 2824750682 303
775 iso_pu_bacteria 2824753945 2824761574 303
776 iso_pu_bacteria 2824763712 2824772116 303
777 iso_pu_bacteria 2824773399 2824778325 303
778 iso_pu_bacteria 2838122688 2838128548 303
779 iso_pu_bacteria 2841941048 2841942404 303
780 iso_pu_bacteria 2841949485 2841953250 303
781 iso_pu_bacteria 2841957949 2841960780 303
782 iso_pu_bacteria 2841966195 2841973861 303
783 iso_pu_bacteria 2841974524 2841982926 303
784 iso_pu_bacteria 2841983080 2841984421 303
785 iso_pu_bacteria 2844315083 2844321261 303
786 iso_pu_bacteria 2847930680 2847932154 303
787 iso_pu_bacteria 2847939898 2847943384 303
788 iso_pu_bacteria 2849076700 2849077107 303
789 iso_pu_bacteria 2874590934 2874595796 303
790 iso_pu_bacteria 2874612657 2874614931 303
791 iso_pu_bacteria 2874620515 2874624158 303
792 iso_pu_bacteria 2874628541 2874630396 303
793 iso_pu_bacteria 2874645413 2874651572 303
794 iso_pu_bacteria 2876761206 2876767581 303
795 iso_pu_bacteria 2876771140 2876775993 303
796 iso_pu_bacteria 2876818435 2876821201 303
797 iso_pu_bacteria 2879074833 2879080082 303
798 iso_pu_bacteria 2879083081 2879089439 303
799 iso_pu_bacteria 2879127579 2879132688 303
800 iso_pu_bacteria 2879142872 2879146473 303
801 iso_pu_bacteria 2881364244 2881367533 303
802 iso_pu_bacteria 2885366525 2885374580 303
803 iso_pu_bacteria 2885409591 2885414041 303
804 iso_pu_bacteria 2888378607 2888387551 303
805 iso_pu_bacteria 2888388044 2888391648 303
806 iso_pu_bacteria 2888419890 2888426774 303
807 iso_pu_bacteria 2903727486 2903728683 303
808 iso_pu_bacteria 2904666416 2904670869 303
809 iso_pu_bacteria 2904711408 2904713843 303
810 iso_pu_bacteria 2906602504 2906607875 303
811 iso_pu_bacteria 2906626472 2906634861 303
812 iso_pu_bacteria 2906643746 2906645726 303
813 iso_pu_bacteria 2908775508 2908777023 303
814 iso_pu_bacteria 2922393267 2922393414 303
815 iso_pu_bacteria 2929615660 2929619970 303
816 iso_pu_bacteria 2929624759 2929629282 303
817 iso_pu_bacteria 2932794094 2932796736 303
818 iso_pu_bacteria 2932801729 2932802484 303
819 iso_pu_bacteria 2933577622 2933581888 303
820 iso_pu_bacteria 2935608549 2935613324 303
821 iso_pu_bacteria 2935648319 2935653798 303
822 iso_pu_bacteria 2935656913 2935662547 303
823 iso_pu_bacteria 2935675223 2935683059 303
824 iso_pu_bacteria 2935684952 2935689229 303
825 iso_pu_bacteria 2935694250 2935697512 303
826 iso_pu_bacteria 2935713505 2935720175 303
827 iso_pu_bacteria 2935722832 2935728208 303
828 iso_pu_bacteria 2935732158 2935737195 303
829 iso_pu_bacteria 2935741537 2935746744 303
830 iso_pu_bacteria 2935750917 2935757711 303
831 iso_pu_bacteria 2935769743 2935776374 303
832 iso_pu_bacteria 2935777560 2935784365 303
833 iso_pu_bacteria 2935785616 2935792401 303
834 iso_pu_bacteria 2935793552 2935800564 303
835 iso_pu_bacteria 2935819856 2935824822 303
836 iso_pu_bacteria 2935847175 2935852042 303
837 iso_pu_bacteria 2935908558 2935911390 303
838 iso_pu_bacteria 2935916978 2935920923 303
839 iso_pu_bacteria 2935926038 2935928419 303
840 iso_pu_bacteria 2935934488 2935938064 303
841 iso_pu_bacteria 2935942939 2935945346 303
842 iso_pu_bacteria 2935951376 2935954148 303
843 iso_pu_bacteria 2935959822 2935965972 303
844 iso_pu_bacteria 2935967501 2935971584 303
845 iso_pu_bacteria 2935975950 2935979980 303
846 iso_pu_bacteria 2935984226 2935989408 303
847 iso_pu_bacteria 2936011229 2936016805 303
848 iso_pu_bacteria 2936019824 2936025438 303
849 iso_pu_bacteria 2936028420 2936034324 303
850 iso_pu_bacteria 2936046547 2936052381 303
851 iso_pu_bacteria 2936055302 2936060662 303
852 iso_pu_bacteria 2940556831 2940563467 303
853 iso_pu_bacteria 2941531003 2941531832 303
854 iso_pu_bacteria 3005483717 3005485876 303
855 iso_pu_bacteria 3005506211 3005506744 303
856 iso_pu_bacteria 3005587118 3005588867 303
857 iso_pu_bacteria 3005594810 3005601593 303
858 iso_pu_bacteria 3005710791 3005717327 303
859 iso_pu_bacteria 3005718088 3005724284 303
860 iso_pu_bacteria 8016522445 8016525024 303
861 iso_pu_bacteria 8016539877 8016542888 303
862 iso_pu_bacteria 8016548790 8016550401 303
863 iso_pu_bacteria 8016557553 8016558815 303
864 iso_pu_bacteria 8016566248 8016568279 303
865 iso_pu_bacteria 8016583857 8016587802 303
866 iso_pu_bacteria 8016595262 8016596783 303
867 iso_pu_bacteria 8016603502 8016607673 303
868 iso_pu_bacteria 8016613128 8016619465 303
869 iso_pu_bacteria 8019530166 8019538270 303
870 iso_pu_bacteria 8019538911 8019541707 303
871 iso_pu_bacteria 8019547302 8019549079 303
872 iso_pu_bacteria 8019619141 8019623980 303
873 iso_pu_bacteria 8019638758 8019641583 303
874 iso_pu_bacteria 8019648815 8019653498 303
875 iso_pu_bacteria 8019668869 8019675493 303
876 iso_pu_bacteria 8019678201 8019680606 303
877 iso_pu_bacteria 8019687851 8019695156 303
878 iso_pu_bacteria 8055742211 8055750278 303
879 iso_pu_bacteria 8056967851 8056976057 303
880 3300005439 Ga0070711_100005721 Ga0070711_1000057214 304
881 3300006175 Ga0070712_100055917 Ga0070712_1000559172 304
882 3300007788 Ga0099795_10021931 Ga0099795_100219312 304
883 3300025915 Ga0207693_10005579 Ga0207693_100055792 304
884 3300025916 Ga0207663_10022584 Ga0207663_100225845 304
885 3300027512 Ga0209179_1005840 Ga0209179_10058402 304
886 3300031250 Ga0265331_10030896 Ga0265331_100308962 304
887 3300031711 Ga0265314_10016415 Ga0265314_100164154 304
888 3300031712 Ga0265342_10009595 Ga0265342_100095956 304
889 3300035692 Ga0373935_0301426 Ga0373935_0301426_130_1050 304
890 3300035724 Ga0373933_0179788 Ga0373933_0179788_283_1209 304
891 3300044656 Ga0466969_0082551 Ga0466969_0082551_552_1478 304
892 3300044684 Ga0466966_0277528 Ga0466966_0277528_53_979 304
893 3300046690 Ga0495624_0210755 Ga0495624_0210755_86_1006 304
894 3300048903 Ga0496100_0035991 Ga0496100_0035991_1163_2083 304
895 3300048918 Ga0496115_0307171 Ga0496115_0307171_27_947 304
896 3300048929 Ga0496126_0090527 Ga0496126_0090527_776_1702 304
897 3300049569 Ga0501032_0018727 Ga0501032_0018727_179_1114 304
898 3300049570 Ga0501033_0009531 Ga0501033_0009531_4256_5191 304
899 3300049570 Ga0501033_0106691 Ga0501033_0106691_461_1378 304
900 3300049572 Ga0501036_0030784 Ga0501036_0030784_637_1572 304
901 3300049573 Ga0501037_0009620 Ga0501037_0009620_1933_2868 304
902 3300049574 Ga0501038_0024403 Ga0501038_0024403_4052_4987 304
903 3300049574 Ga0501038_0280951 Ga0501038_0280951_262_1197 304
904 3300049575 Ga0501039_0005003 Ga0501039_0005003_7527_8462 304
905 3300049575 Ga0501039_0285832 Ga0501039_0285832_306_1241 304
906 3300049579 Ga0501043_0015306 Ga0501043_0015306_462_1397 304
907 3300049580 Ga0501046_0079087 Ga0501046_0079087_1559_2494 304
908 3300049584 Ga0501068_0038894 Ga0501068_0038894_1664_2581 304
909 3300049822 Ga0501035_0009729 Ga0501035_0009729_609_1544 304
910 3300049822 Ga0501035_0206728 Ga0501035_0206728_715_1632 304
911 3300049822 Ga0501035_0338831 Ga0501035_0338831_24_959 304
912 3300049823 Ga0501044_0027655 Ga0501044_0027655_1112_2047 304
913 3300049823 Ga0501044_0181031 Ga0501044_0181031_779_1696 304
914 3300049823 Ga0501044_0287163 Ga0501044_0287163_23_940 304
915 iso_pu_bacteria 2528768022 2528850234 304
916 iso_pu_bacteria 2824661429 2824669389 304
917 iso_pu_bacteria 2879099564 2879106445 304
918 iso_pu_bacteria 2932784394 2932789590 304
919 iso_pu_bacteria 2932809354 2932814903 304
920 iso_pu_bacteria 2932818245 2932824241 304
921 iso_pu_bacteria 2932828146 2932834032 304
922 iso_pu_bacteria 2935616580 2935623578 304
923 iso_pu_bacteria 2935638405 2935644965 304
924 iso_pu_bacteria 2935665750 2935672014 304
925 iso_pu_bacteria 2935703347 2935711089 304
926 iso_pu_bacteria 2935760218 2935764090 304
927 iso_pu_bacteria 2935801545 2935808678 304
928 iso_pu_bacteria 2935810662 2935817475 304
929 iso_pu_bacteria 2935827899 2935834189 304
930 iso_pu_bacteria 2935837841 2935844791 304
931 iso_pu_bacteria 2935855204 2935861815 304
932 iso_pu_bacteria 2935864058 2935868549 304
933 iso_pu_bacteria 2935873716 2935879323 304
934 iso_pu_bacteria 2935992306 2935998510 304
935 iso_pu_bacteria 2936002035 2936009030 304
936 iso_pu_bacteria 2936037263 2936044272 304
937 iso_pu_bacteria 2941538514 2941545314 304
938 iso_pu_bacteria 8016511872 8016519313 304
939 iso_pu_bacteria 8016622563 8016630139 304
940 iso_pu_bacteria 8017057580 8017066202 304
941 iso_pu_bacteria 8019597564 8019605236 304
942 iso_pu_bacteria 8019608314 8019613312 304
943 iso_pu_bacteria 8019659431 8019665975 304
944 3300013297 Ga0157378_10015652 Ga0157378_100156523 305
945 3300021361 Ga0213872_10049871 Ga0213872_100498712 305
946 3300031911 Ga0307412_10056255 Ga0307412_100562552 305
947 3300039437 Ga0436365_1460691 Ga0436365_1460691_696_1619 305
948 3300039447 Ga0436361_1059134 Ga0436361_1059134_709_1626 305
949 3300046460 Ga0495638_0011310 Ga0495638_0011310_2394_3320 305
950 3300046514 Ga0495618_0048943 Ga0495618_0048943_1444_2370 305
951 3300046616 Ga0495668_0063059 Ga0495668_0063059_50_976 305
952 3300046674 Ga0495588_0010104 Ga0495588_0010104_1578_2504 305
953 3300046689 Ga0495613_0091415 Ga0495613_0091415_1141_2085 305
954 3300048088 Ga0495602_0028167 Ga0495602_0028167_114_1058 305
955 3300048903 Ga0496100_0181902 Ga0496100_0181902_444_1370 305
956 3300048914 Ga0496111_0127085 Ga0496111_0127085_49_993 305
957 3300048920 Ga0496117_0115666 Ga0496117_0115666_442_1368 305
958 3300048921 Ga0496118_0025336 Ga0496118_0025336_3987_4913 305
959 3300048922 Ga0496119_0099593 Ga0496119_0099593_357_1283 305
960 3300048923 Ga0496120_0072926 Ga0496120_0072926_352_1278 305
961 3300048924 Ga0496121_0028031 Ga0496121_0028031_132_1058 305
962 3300048924 Ga0496121_0158898 Ga0496121_0158898_662_1585 305
963 3300048924 Ga0496121_0196284 Ga0496121_0196284_279_1202 305
964 3300048925 Ga0496122_0041692 Ga0496122_0041692_735_1661 305
965 3300048928 Ga0496125_0002962 Ga0496125_0002962_7921_8847 305
966 3300048928 Ga0496125_0084233 Ga0496125_0084233_238_1161 305
967 3300048929 Ga0496126_0033750 Ga0496126_0033750_2911_3834 305
968 3300048929 Ga0496126_0109600 Ga0496126_0109600_1356_2282 305
969 3300048929 Ga0496126_0186119 Ga0496126_0186119_301_1224 305
970 3300050492 nmdc:mga0yw44_215840_c1 nmdc:mga0yw44_215840_c1_178_1104 305
971 3300053089 Ga0500581_063817 Ga0500581_063817_493_1419 305
972 3300053093 Ga0500651_0060171 Ga0500651_0060171_919_1845 305
973 3300053094 Ga0500566_0004614 Ga0500566_0004614_1076_1999 305
974 3300053096 Ga0500641_0034658 Ga0500641_0034658_874_1827 305
975 3300053098 Ga0500650_0011947 Ga0500650_0011947_2411_3364 305
976 3300053104 Ga0500556_0000012 Ga0500556_0000012_67825_68751 305
977 3300053118 Ga0500594_0009826 Ga0500594_0009826_28_954 305
978 3300053119 Ga0500595_000615 Ga0500595_000615_17969_18892 305
979 3300053130 Ga0500642_0000013 Ga0500642_0000013_142696_143622 305
980 3300053131 Ga0500652_001452 Ga0500652_001452_3503_4456 305
981 3300053139 Ga0500568_0000676 Ga0500568_0000676_11770_12696 305
982 3300053139 Ga0500568_0006530 Ga0500568_0006530_4810_5733 305
983 3300053153 Ga0500616_0000035 Ga0500616_0000035_325665_326591 305
984 3300053156 Ga0500622_0005098 Ga0500622_0005098_605_1531 305
985 3300053161 Ga0500634_0020483 Ga0500634_0020483_2506_3432 305
986 3300053162 Ga0500638_063301 Ga0500638_063301_366_1289 305
987 3300053177 Ga0500636_0052765 Ga0500636_0052765_263_1186 305
988 3300053178 Ga0500637_0000445 Ga0500637_0000445_2472_3395 305
989 3300055283 Ga0500661_000331 Ga0500661_000331_4183_5106 305
990 3300025304 Ga0209257_1026694 Ga0209257_10266942 306
991 3300037418 Ga0395900_0399946 Ga0395900_0399946_22_951 306
992 3300037466 Ga0395898_0037345 Ga0395898_0037345_2173_3102 306
993 3300037471 Ga0395905_0238834 Ga0395905_0238834_711_1640 306
994 3300041443 Ga0451789_1107124 Ga0451789_1107124_105_1037 306
995 3300046524 Ga0495648_0001411 Ga0495648_0001411_7996_8925 306
996 3300048927 Ga0496124_0120736 Ga0496124_0120736_282_1214 306
997 3300048928 Ga0496125_0000099 Ga0496125_0000099_28600_29529 306
998 3300049569 Ga0501032_0066426 Ga0501032_0066426_44_988 306
999 3300049570 Ga0501033_0133335 Ga0501033_0133335_399_1343 306
1000 3300049572 Ga0501036_0160400 Ga0501036_0160400_326_1270 306
1001 3300049580 Ga0501046_0035855 Ga0501046_0035855_170_1114 306
1002 3300049581 Ga0501047_0395420 Ga0501047_0395420_132_1076 306
1003 3300049582 Ga0501048_0144768 Ga0501048_0144768_294_1238 306
1004 3300050496 nmdc:mga07m45_17174_c1 nmdc:mga07m45_17174_c1_2579_3526 306
1005 iso_pu_bacteria 8019629233 8019638053 306
1006 3300003215 JGI25153J46596_10000371 JGI25153J46596_1000037115 307
1007 3300003215 JGI25153J46596_10019202 JGI25153J46596_100192023 307
1008 3300003354 JGI25160J50197_1017605 JGI25160J50197_10176052 307
1009 3300003762 Ga0055542_1006371 Ga0055542_10063712 307
1010 3300003794 Ga0055531_10005980 Ga0055531_100059804 307
1011 3300004625 Ga0055543_1005948 Ga0055543_10059482 307
1012 3300005262 Ga0065165_1001685 Ga0065165_100168515 307
1013 3300005262 Ga0065165_1004072 Ga0065165_10040724 307
1014 3300005262 Ga0065165_1011137 Ga0065165_10111374 307
1015 3300005338 Ga0068868_100446864 Ga0068868_1004468641 307
1016 3300005355 Ga0070671_100062828 Ga0070671_1000628283 307
1017 3300005455 Ga0070663_100078602 Ga0070663_1000786022 307
1018 3300005455 Ga0070663_100097511 Ga0070663_1000975111 307
1019 3300005539 Ga0068853_100075816 Ga0068853_1000758163 307
1020 3300006186 Ga0075369_10081319 Ga0075369_100813192 307
1021 3300006195 Ga0075366_10015948 Ga0075366_100159483 307
1022 3300006943 Ga0099822_1041031 Ga0099822_10410312 307
1023 3300009093 Ga0105240_10658832 Ga0105240_106588322 307
1024 3300009545 Ga0105237_10082171 Ga0105237_100821715 307
1025 3300011119 Ga0105246_10151539 Ga0105246_101515391 307
1026 3300013104 Ga0157370_10249774 Ga0157370_102497742 307
1027 3300013308 Ga0157375_10812339 Ga0157375_108123391 307
1028 3300014325 Ga0163163_10006013 Ga0163163_100060133 307
1029 3300021320 Ga0214544_1000003 Ga0214544_1000003542 307
1030 3300021321 Ga0214542_1000022 Ga0214542_1000022112 307
1031 3300021324 Ga0214545_1000010 Ga0214545_100001071 307
1032 3300021327 Ga0214543_1000035 Ga0214543_1000035112 307
1033 3300025230 Ga0209563_105359 Ga0209563_1053593 307
1034 3300025253 Ga0209677_105299 Ga0209677_1052992 307
1035 3300025254 Ga0209148_1000335 Ga0209148_100033569 307
1036 3300025261 Ga0209233_1025811 Ga0209233_10258112 307
1037 3300025272 Ga0209455_1002543 Ga0209455_10025438 307
1038 3300025295 Ga0209564_1005823 Ga0209564_10058234 307
1039 3300025295 Ga0209564_1009493 Ga0209564_10094934 307
1040 3300025297 Ga0209758_1000106 Ga0209758_100010656 307
1041 3300025297 Ga0209758_1000344 Ga0209758_100034432 307
1042 3300025297 Ga0209758_1001326 Ga0209758_100132622 307
1043 3300025297 Ga0209758_1002294 Ga0209758_100229410 307
1044 3300025297 Ga0209758_1009962 Ga0209758_10099624 307
1045 3300025299 Ga0209256_1004815 Ga0209256_10048151 307
1046 3300025302 Ga0207426_1000440 Ga0207426_100044056 307
1047 3300025302 Ga0207426_1017585 Ga0207426_10175853 307
1048 3300025303 Ga0209051_1039340 Ga0209051_10393402 307
1049 3300025304 Ga0209257_1000819 Ga0209257_100081931 307
1050 3300025304 Ga0209257_1007500 Ga0209257_10075006 307
1051 3300025304 Ga0209257_1019000 Ga0209257_10190002 307
1052 3300025903 Ga0207680_10057239 Ga0207680_100572393 307
1053 3300025907 Ga0207645_10250729 Ga0207645_102507291 307
1054 3300025911 Ga0207654_10088868 Ga0207654_100888681 307
1055 3300025913 Ga0207695_10265528 Ga0207695_102655282 307
1056 3300025923 Ga0207681_10448473 Ga0207681_104484731 307
1057 3300025926 Ga0207659_10404086 Ga0207659_104040861 307
1058 3300025941 Ga0207711_10181659 Ga0207711_101816592 307
1059 3300026067 Ga0207678_10137534 Ga0207678_101375343 307
1060 3300026088 Ga0207641_10230313 Ga0207641_102303132 307
1061 3300027296 Ga0209389_1000027 Ga0209389_10000277 307
1062 3300027357 Ga0209589_1000031 Ga0209589_100003119 307
1063 3300027361 Ga0209489_100057 Ga0209489_100057128 307
1064 3300027866 Ga0209813_10030980 Ga0209813_100309802 307
1065 3300028380 Ga0268265_10103699 Ga0268265_101036991 307
1066 3300033179 Ga0307507_10274482 Ga0307507_102744821 307
1067 3300033180 Ga0307510_10007730 Ga0307510_100077309 307
1068 3300037418 Ga0395900_0001282 Ga0395900_0001282_20953_21903 307
1069 3300037466 Ga0395898_0048844 Ga0395898_0048844_1254_2204 307
1070 3300037471 Ga0395905_0290637 Ga0395905_0290637_437_1372 307
1071 3300037853 Ga0436364_1108748 Ga0436364_1108748_297_1229 307
1072 3300038443 Ga0395901_0006277 Ga0395901_0006277_3251_4201 307
1073 3300039437 Ga0436365_1461183 Ga0436365_1461183_38_970 307
1074 3300044684 Ga0466966_0005539 Ga0466966_0005539_4576_5511 307
1075 3300044693 Ga0466961_0000023 Ga0466961_0000023_2610_3545 307
1076 3300044901 Ga0466960_0052665 Ga0466960_0052665_426_1361 307
1077 3300045049 Ga0466959_0003727 Ga0466959_0003727_4245_5180 307
1078 3300046454 Ga0495592_0041663 Ga0495592_0041663_571_1506 307
1079 3300046460 Ga0495638_0001078 Ga0495638_0001078_14239_15174 307
1080 3300046462 Ga0495651_0044231 Ga0495651_0044231_876_1811 307
1081 3300046462 Ga0495651_0100123 Ga0495651_0100123_565_1500 307
1082 3300046477 Ga0495664_0003810 Ga0495664_0003810_6371_7306 307
1083 3300046507 Ga0495606_0010827 Ga0495606_0010827_5602_6537 307
1084 3300046512 Ga0495610_0058580 Ga0495610_0058580_31_966 307
1085 3300046512 Ga0495610_0058888 Ga0495610_0058888_835_1770 307
1086 3300046522 Ga0495643_0108152 Ga0495643_0108152_282_1217 307
1087 3300046524 Ga0495648_0006902 Ga0495648_0006902_4906_5841 307
1088 3300046533 Ga0495640_0132101 Ga0495640_0132101_315_1250 307
1089 3300046536 Ga0495587_0052290 Ga0495587_0052290_555_1490 307
1090 3300046543 Ga0495645_0013988 Ga0495645_0013988_462_1397 307
1091 3300046678 Ga0495599_0005563 Ga0495599_0005563_5622_6557 307
1092 3300046679 Ga0495623_0002992 Ga0495623_0002992_5395_6330 307
1093 3300046680 Ga0495646_0059363 Ga0495646_0059363_548_1483 307
1094 3300046689 Ga0495613_0083138 Ga0495613_0083138_839_1774 307
1095 3300046690 Ga0495624_0069921 Ga0495624_0069921_787_1722 307
1096 3300046809 Ga0495600_0040834 Ga0495600_0040834_956_1891 307
1097 3300047317 Ga0495604_0192898 Ga0495604_0192898_44_979 307
1098 3300047321 Ga0495676_0301025 Ga0495676_0301025_119_1054 307
1099 3300047322 Ga0495680_0001426 Ga0495680_0001426_19583_20518 307
1100 3300047444 Ga0495675_0032501 Ga0495675_0032501_1991_2926 307
1101 3300047472 Ga0495686_0069990 Ga0495686_0069990_11_946 307
1102 3300047472 Ga0495686_0086150 Ga0495686_0086150_878_1813 307
1103 3300048088 Ga0495602_0007749 Ga0495602_0007749_4501_5436 307
1104 3300048088 Ga0495602_0199354 Ga0495602_0199354_315_1250 307
1105 3300048906 Ga0496103_0232495 Ga0496103_0232495_166_1101 307
1106 3300048907 Ga0496104_0125233 Ga0496104_0125233_183_1118 307
1107 3300048907 Ga0496104_0194668 Ga0496104_0194668_370_1305 307
1108 3300048912 Ga0496109_0021350 Ga0496109_0021350_1889_2824 307
1109 3300048914 Ga0496111_0274136 Ga0496111_0274136_89_1024 307
1110 3300048916 Ga0496113_0110381 Ga0496113_0110381_372_1307 307
1111 3300048918 Ga0496115_0048409 Ga0496115_0048409_77_1012 307
1112 3300048921 Ga0496118_0149747 Ga0496118_0149747_247_1182 307
1113 3300048922 Ga0496119_0034621 Ga0496119_0034621_2334_3269 307
1114 3300048922 Ga0496119_0081165 Ga0496119_0081165_149_1084 307
1115 3300048929 Ga0496126_0054808 Ga0496126_0054808_2658_3593 307
1116 3300050492 nmdc:mga0yw44_97579_c1 nmdc:mga0yw44_97579_c1_831_1766 307
1117 3300050495 nmdc:mga04h51_18332_c1 nmdc:mga04h51_18332_c1_743_1678 307
1118 3300050496 nmdc:mga07m45_17807_c1 nmdc:mga07m45_17807_c1_596_1531 307
1119 3300050516 nmdc:mga0sz30_108426_c1 nmdc:mga0sz30_108426_c1_82_1017 307
1120 3300050516 nmdc:mga0sz30_46160_c1 nmdc:mga0sz30_46160_c1_837_1772 307
1121 3300053083 Ga0495655_0056300 Ga0495655_0056300_28_963 307
1122 3300053086 Ga0500578_0079958 Ga0500578_0079958_995_1930 307
1123 3300053087 Ga0500643_000180 Ga0500643_000180_34717_35652 307
1124 3300053094 Ga0500566_0003442 Ga0500566_0003442_940_1875 307
1125 3300053103 Ga0500555_004651 Ga0500555_004651_1527_2462 307
1126 3300053104 Ga0500556_0015578 Ga0500556_0015578_520_1455 307
1127 3300053105 Ga0500557_000046 Ga0500557_000046_16233_17168 307
1128 3300053109 Ga0500569_005217 Ga0500569_005217_17_952 307
1129 3300053121 Ga0500607_090912 Ga0500607_090912_483_1418 307
1130 3300053123 Ga0500614_021352 Ga0500614_021352_185_1120 307
1131 3300053130 Ga0500642_0000038 Ga0500642_0000038_67297_68232 307
1132 3300053130 Ga0500642_0048445 Ga0500642_0048445_322_1257 307
1133 3300053139 Ga0500568_0032956 Ga0500568_0032956_1064_1999 307
1134 3300053154 Ga0500619_071265 Ga0500619_071265_87_1022 307
1135 3300053156 Ga0500622_0026880 Ga0500622_0026880_1529_2464 307
1136 3300053158 Ga0500627_0132442 Ga0500627_0132442_149_1084 307
1137 3300053162 Ga0500638_007258 Ga0500638_007258_3015_3950 307
1138 3300053729 Ga0500625_003345 Ga0500625_003345_3054_3989 307
1139 3300053732 Ga0500656_004764 Ga0500656_004764_65_1000 307
1140 3300055283 Ga0500661_009671 Ga0500661_009671_449_1384 307
1141 3300055283 Ga0500661_011388 Ga0500661_011388_111_1046 307
1142 3300003354 JGI25160J50197_1000678 JGI25160J50197_100067813 308
1143 3300005578 Ga0068854_100175380 Ga0068854_1001753802 308
1144 3300006353 Ga0075370_10082434 Ga0075370_100824342 308
1145 3300009093 Ga0105240_10004093 Ga0105240_1000409315 308
1146 3300009098 Ga0105245_10095059 Ga0105245_100950593 308
1147 3300009174 Ga0105241_10084517 Ga0105241_100845172 308
1148 3300009545 Ga0105237_10008240 Ga0105237_100082403 308
1149 3300010375 Ga0105239_10023758 Ga0105239_100237587 308
1150 3300025302 Ga0207426_1000819 Ga0207426_100081914 308
1151 3300025913 Ga0207695_10000123 Ga0207695_10000123179 308
1152 3300025914 Ga0207671_10002081 Ga0207671_1000208115 308
1153 3300025927 Ga0207687_10285179 Ga0207687_102851791 308
1154 3300025935 Ga0207709_10022456 Ga0207709_100224561 308
1155 3300025981 Ga0207640_10340937 Ga0207640_103409371 308
1156 3300044706 Ga0466964_0017912 Ga0466964_0017912_1075_2013 308
1157 3300044735 Ga0466968_0083121 Ga0466968_0083121_458_1396 308
1158 3300044765 Ga0466970_0067980 Ga0466970_0067980_623_1561 308
1159 3300046557 Ga0495622_0025034 Ga0495622_0025034_1218_2156 308
1160 3300046674 Ga0495588_0023760 Ga0495588_0023760_1350_2288 308
1161 3300048907 Ga0496104_0041576 Ga0496104_0041576_1100_2038 308
1162 3300048908 Ga0496105_0044074 Ga0496105_0044074_151_1089 308
1163 3300048916 Ga0496113_0035965 Ga0496113_0035965_1037_1975 308
1164 3300048919 Ga0496116_0068609 Ga0496116_0068609_79_1017 308
1165 3300048924 Ga0496121_0011996 Ga0496121_0011996_8007_8945 308
1166 3300001979 JGI24740J21852_10003240 JGI24740J21852_100032406 313
1167 3300001989 JGI24739J22299_10001701 JGI24739J22299_100017014 313
1168 3300005455 Ga0070663_100129356 Ga0070663_1001293562 313
1169 3300005539 Ga0068853_100005211 Ga0068853_1000052117 313
1170 3300005539 Ga0068853_100081100 Ga0068853_1000811002 313
1171 3300005563 Ga0068855_100006609 Ga0068855_10000660913 313
1172 3300005577 Ga0068857_100009553 Ga0068857_1000095534 313
1173 3300005577 Ga0068857_100088595 Ga0068857_1000885953 313
1174 3300005578 Ga0068854_100003740 Ga0068854_1000037402 313
1175 3300005614 Ga0068856_100211995 Ga0068856_1002119953 313
1176 3300005834 Ga0068851_10000375 Ga0068851_1000037515 313
1177 3300009093 Ga0105240_10008326 Ga0105240_100083265 313
1178 3300009093 Ga0105240_10021579 Ga0105240_100215797 313
1179 3300009174 Ga0105241_10009544 Ga0105241_100095444 313
1180 3300009551 Ga0105238_10003767 Ga0105238_100037678 313
1181 3300009551 Ga0105238_10006093 Ga0105238_100060939 313
1182 3300010375 Ga0105239_10033754 Ga0105239_100337542 313
1183 3300010375 Ga0105239_10174356 Ga0105239_101743562 313
1184 3300025321 Ga0207656_10001607 Ga0207656_100016074 313
1185 3300025904 Ga0207647_10005180 Ga0207647_100051809 313
1186 3300025911 Ga0207654_10000212 Ga0207654_100002126 313
1187 3300025913 Ga0207695_10002042 Ga0207695_100020429 313
1188 3300025924 Ga0207694_10000826 Ga0207694_1000082610 313
1189 3300025949 Ga0207667_10005117 Ga0207667_100051176 313
1190 3300025949 Ga0207667_10320446 Ga0207667_103204462 313
1191 3300026041 Ga0207639_10010313 Ga0207639_100103134 313
1192 3300026078 Ga0207702_10000003 Ga0207702_1000000387 313
1193 3300026078 Ga0207702_10024157 Ga0207702_100241574 313
1194 3300026116 Ga0207674_10002259 Ga0207674_1000225917 313
1195 3300026116 Ga0207674_10034505 Ga0207674_100345054 313
1196 3300026142 Ga0207698_10050515 Ga0207698_100505154 313

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00126

HTH_1

Bacterial regulatory helix-turn-helix protein, lysR family

7

66

0.97

PF03466

LysR_substrate

LysR substrate binding domain

143

284

0.95

PF03466

LysR_substrate

LysR substrate binding domain

90

145

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
7trv-assembly1.cif.gz_B crystal structure of the dna-binding domain of the lysr family transcriptional regulator yfba from yersinia pestis 0.9657 4 85
7trv-assembly1.cif.gz_A crystal structure of the dna-binding domain of the lysr family transcriptional regulator yfba from yersinia pestis 0.9367 1 85
4pzj-assembly1.cif.gz_A-2 1.60 angstrom resolution crystal structure of a transcriptional regulator of the lysr family from eggerthella lenta dsm 2243 0.9044 4 73
5x0n-assembly3.cif.gz_F regulatory domain of variant c227s aphb from vibrio vulnificus 0.9036 95 294
4ihs-assembly1.cif.gz_A crystal structure of benm_dbd/catb site 1 dna complex 0.8964 5 92
ID Description Score Start End Superfamily
af_P30864_1_87_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9574 7 88 1.10.10.10
af_P67662_3_85_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.957 7 85 1.10.10.10
af_P37682_6_92_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.954 5 88 1.10.10.10
3fzvC01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9515 7 77 1.10.10.10
3hhgB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9456 5 88 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A5F0LPX3-F1-model_v4 LysR family transcriptional regulator 0.9307 165 305
AF-A0A5R1NF86-F1-model_v4 deleted 0.9295 5 77
AF-A0A658JMP9-F1-model_v4 deleted 0.9259 2 83
AF-U6ZXM9-F1-model_v4 deleted 0.9234 125 296
AF-A0A850QN73-F1-model_v4 LysR family transcriptional regulator 0.922 99 294 GO:0003700
GO:0006351
GO:0043565

Feature Viewer

pLDDT pTM Quality
85.59 0.64 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map