metagRoot

F491508

General Info

Members	Datasets	Scaffolds	Average Seq Length
1195	620	1027	160

Family's Representative Sequence

Representative Sequence	3300009011\|Ga0105251_10000655\|Ga0105251_1000065521
Length	188
Sequence	LRDNQLSYVALRVLCNAKETEGEEKMPSFDIVSEVDLQEVRNAVENATREVESRFDFRNVEASFELNEKNETIKVLSESDFQINQLLDILRAKLLKRGIEGSSIEVPDEFVHSGKTWFVDAKLKQGIESATQKKIVKLIKDSKLKVQAQIQGEEIRVTGKARDDLQAVMALVRGGDLGQPFQFKNFRD

Samples

	Sample ID	Description	Type	Environment
1	2511231002	Polaromonas sp. CF318	Isolate	Rhizosphere
2	2511231025	Pantoea sp. YR343	Isolate	Rhizosphere
3	2511231035	Pantoea sp. GM01	Isolate	Rhizosphere
4	2513020051	Variovorax sp. CF313	Isolate	Rhizosphere
5	2547132181	Kosakonia sacchari SP1	Isolate	Stem
6	2547132374	Acidovorax radicis N35	Isolate	Unclassified
7	2554235234	Klebsiella michiganensis SA2	Isolate	Unclassified
8	2561511199	Enterobacter sp. R4-368	Isolate	Nodule
9	2585427591	Rahnella aquatilis OV744	Isolate	Rhizosphere
10	2585427592	Rahnella aquatilis OV588	Isolate	Rhizosphere
11	2599185169	Klebsiella quasipneumoniae NFPP35	Isolate	Rhizoplane
12	2599185214	Variovorax sp. NFACC26	Isolate	Rhizoplane
13	2599185226	Variovorax sp. NFACC27	Isolate	Rhizoplane
14	2599185227	Variovorax sp. NFACC28	Isolate	Rhizoplane
15	2599185229	Variovorax sp. NFACC29	Isolate	Endosphere
16	2599185299	Pantoea ananatis NFR11	Isolate	Rhizoplane
17	2600255254	Klebsiella quasipneumoniae NFIX15	Isolate	Rhizoplane
18	2600255255	Klebsiella quasipneumoniae NFIX23	Isolate	Rhizoplane
19	2600255256	Enterobacter sp. NFIX08	Isolate	Rhizoplane
20	2600255257	Enterobacter sp. NFIX03	Isolate	Rhizoplane
21	2600255280	Klebsiella quasipneumoniae NFIX42	Isolate	Rhizoplane
22	2600255281	Klebsiella quasipneumoniae NFIX43	Isolate	Rhizoplane
23	2600255287	Klebsiella quasipneumoniae NFIX11	Isolate	Rhizoplane
24	2600255288	Klebsiella quasipneumoniae NFIX14	Isolate	Rhizoplane
25	2600255289	Klebsiella quasipneumoniae NFIX16	Isolate	Rhizoplane
26	2600255290	Klebsiella quasipneumoniae NFIX17	Isolate	Rhizoplane
27	2600255291	Klebsiella quasipneumoniae NFIX19	Isolate	Rhizoplane
28	2600255298	Klebsiella quasipneumoniae NFIX21	Isolate	Rhizoplane
29	2600255299	Klebsiella quasipneumoniae NFIX22	Isolate	Rhizoplane
30	2600255300	Klebsiella quasipneumoniae NFIX30	Isolate	Rhizoplane
31	2600255301	Klebsiella quasipneumoniae NFIX33	Isolate	Rhizoplane
32	2600255302	Klebsiella quasipneumoniae NFIX35	Isolate	Rhizoplane
33	2600255303	Klebsiella quasipneumoniae NFIX36	Isolate	Rhizoplane
34	2600255304	Klebsiella quasipneumoniae NFIX37	Isolate	Rhizoplane
35	2600255305	Klebsiella quasipneumoniae NFIX41	Isolate	Rhizoplane
36	2600255306	Klebsiella quasipneumoniae NFIX44	Isolate	Rhizoplane
37	2600255307	Klebsiella quasipneumoniae NFIX56	Isolate	Rhizoplane
38	2600255309	Klebsiella sp. NFIX53	Isolate	Rhizoplane
39	2600255310	Enterobacter sp. NFIX06	Isolate	Rhizoplane
40	2600255311	Enterobacter sp. NFIX04	Isolate	Rhizoplane
41	2600255392	Klebsiella quasipneumoniae NFIX54	Isolate	Rhizoplane
42	2602042046	Enterobacter sp. NFIX09	Isolate	Rhizoplane
43	2602042047	Enterobacter sp. NFIX59	Isolate	Rhizoplane
44	2602042052	Klebsiella quasipneumoniae NFIX18	Isolate	Rhizoplane
45	2602042053	Klebsiella quasipneumoniae NFIX12	Isolate	Rhizoplane
46	2602042066	Enterobacter sp. NFIX45	Isolate	Rhizoplane
47	2602042067	Enterobacter sp. NFIX58	Isolate	Rhizoplane
48	2602042103	Klebsiella quasipneumoniae NFIX29	Isolate	Rhizoplane
49	2602042104	Klebsiella quasipneumoniae NFIX26	Isolate	Rhizoplane
50	2602042105	Klebsiella quasipneumoniae NFIX25	Isolate	Rhizoplane
51	2602042106	Klebsiella quasipneumoniae NFIX13	Isolate	Rhizoplane
52	2602042109	Klebsiella aerogenes NFIX39	Isolate	Rhizoplane
53	2602042110	Klebsiella quasipneumoniae NFIX40	Isolate	Rhizoplane
54	2602042111	Klebsiella quasipneumoniae NFIX20	Isolate	Rhizoplane
55	2603880178	Klebsiella quasipneumoniae NFIX34	Isolate	Rhizoplane
56	2603880184	Klebsiella quasipneumoniae NFIX27	Isolate	Rhizoplane
57	2603880202	Klebsiella quasipneumoniae NFIX38	Isolate	Rhizoplane
58	2603880211	Klebsiella quasipneumoniae NFIX24	Isolate	Rhizoplane
59	2609459761	Enterobacter sp. NFR05	Isolate	Rhizoplane
60	2643221570	Acidovorax sp. Root568	Isolate	Unclassified
61	2643221613	Oerskovia sp. Root22	Isolate	Unclassified
62	2643221628	Variovorax sp. Root318D1	Isolate	Unclassified
63	2643221658	Variovorax sp. Root411	Isolate	Unclassified
64	2643221672	Variovorax sp. Root434	Isolate	Unclassified
65	2643221683	Variovorax sp. Root473	Isolate	Unclassified
66	2643221721	Oerskovia sp. Root918	Isolate	Unclassified
67	2648501693	Pantoea ananatis B1-9	Isolate	Rhizosphere
68	2667528172	Enterobacteriaceae bacterium NFIX31	Isolate	Rhizoplane
69	2667528173	Rahnella sp. NFIX50	Isolate	Rhizoplane
70	2671180115	Cedecea sp. NFIX57	Isolate	Rhizoplane
71	2675903046	Klebsiella quasipneumoniae NFIX52	Isolate	Rhizoplane
72	2681812866	Enterobacter asburiae NFIX55	Isolate	Rhizoplane
73	2681812869	Enterobacter ludwigii NFPP41	Isolate	Rhizoplane
74	2684622997	Pantoea ananatis NFIX48	Isolate	Rhizoplane
75	2706794495	Dickeya zeae ZJU1202	Isolate	Unclassified
76	2711768156	Atlantibacter hermannii DDE1	Isolate	Unclassified
77	2738541277	Variovorax sp. GV051	Isolate	Unclassified
78	2738541307	Variovorax sp. GV008	Isolate	Unclassified
79	2738543019	Variovorax sp. GV040	Isolate	Unclassified
80	2751185917	Enterobacter sp. HK169	Isolate	Unclassified
81	2765235842	Enterobacter ludwigii AA4	Isolate	Unclassified
82	2772190666	Serratia surfactantfaciens YD25	Isolate	Unclassified
83	2775506706	Enterobacter asburiae 1216	Isolate	Unclassified
84	2791354903	Mangrovibacter phragmitis MP23	Isolate	Unclassified
85	2791355010	Kosakonia pseudosacchari NN143	Isolate	Unclassified
86	2791355275	Enterobacter sp. Sa187	Isolate	Unclassified
87	2808606414	Pantoea sp. SJZ147	Isolate	Rhizosphere
88	2811995292	Kosakonia oryzae Ola 51	Isolate	Unclassified
89	2814123068	Kosakonia radicincitans GXGL-4A	Isolate	Rhizosphere
90	2818991446	Variovorax sp. 1180	Isolate	Unclassified
91	2821118458	Enterobacter asburiae 609	Isolate	Unclassified
92	2823373977	Enterobacter ludwigii NCR3	Isolate	Rhizosphere
93	2831265667	Variovorax guangxiensis DSM 27352	Isolate	Rhizosphere
94	2838054893	Variovorax guangxiensis 34/80	Isolate	Nodule
95	2842677519	Variovorax sp. R-72495	Isolate	Unclassified
96	2842733646	Variovorax sp. R-72446	Isolate	Unclassified
97	2842747753	Variovorax sp. R-72060	Isolate	Unclassified
98	2844425489	Enterobacter cloacae SBP-8	Isolate	Rhizosphere
99	2846540461	Photorhabdus luminescens HIM3	Isolate	Rhizosphere
100	2847085930	Erwinia persicina B64	Isolate	Bulb
101	2847797336	Pantoea ananatis NN08200	Isolate	Unclassified
102	2854601825	Dickeya dianthicola SS70	Isolate	Stem Tuber
103	2876601092	Pantoea endophytica 596	Isolate	Unclassified
104	2881101125	Ramlibacter rhizophilus CCTCC AB2015357	Isolate	Rhizosphere
105	2884086401	Kluyvera sp. PO2S7	Isolate	Rhizosphere
106	2885192300	Variovorax sp. MHTC-1	Isolate	Rhizosphere
107	2885198086	Variovorax sp. 679	Isolate	Unclassified
108	2885211737	Variovorax sp. 553	Isolate	Unclassified
109	2888366609	Serratia sp. NGAS9	Isolate	Rhizosphere
110	2891670763	Buttiauxella sp. B2	Isolate	Rhizosphere
111	2894023352	Diaphorobacter ruginosibacter DSM 27467	Isolate	Nodule
112	2899924645	Variovorax sp. 369	Isolate	Unclassified
113	2904449895	Variovorax sp. 1763	Isolate	Rhizosphere
114	2904456579	Variovorax sp. 2002	Isolate	Unclassified
115	2904474040	Rahnella aquatilis 4485	Isolate	Rhizosphere
116	2904513164	Klebsiella variicola 1431	Isolate	Rhizosphere
117	2904541872	Variovorax sp. 1615	Isolate	Rhizosphere
118	2919108558	Klebsiella sp. 1400	Isolate	Rhizosphere
119	2919150387	Rahnella aceris 1817	Isolate	Unclassified
120	2919462493	Variovorax sp. 3319	Isolate	Rhizosphere
121	2923634449	Enterobacter kobei SLBN-76	Isolate	Rhizosphere
122	2927143783	Rahnella sp. 2050	Isolate	Unclassified
123	2927833300	Enterobacter sp. SLBN-59	Isolate	Rhizosphere
124	2928037797	Variovorax sp. 1126	Isolate	Unclassified
125	2928044640	Variovorax sp. 1128	Isolate	Unclassified
126	2928051484	Variovorax sp. 1133	Isolate	Unclassified
127	2928064002	Variovorax sp. 1140	Isolate	Rhizosphere
128	2928070936	Variovorax gossypii 1167	Isolate	Unclassified
129	2928084124	Variovorax paradoxus 1218	Isolate	Unclassified
130	2929160207	Variovorax sp. R-72349 Hybrid assembly	Isolate	Unclassified
131	2929520902	Variovorax beijingensis 502	Isolate	Unclassified
132	2935625433	Kosakonia sp. 1610	Isolate	Rhizosphere
133	2935890801	Oerskovia enterophila 3230	Isolate	Rhizosphere
134	2937539931	Pantoea sp. LS15	Isolate	Unclassified
135	2937967321	Serratia sp. YC16	Isolate	Unclassified
136	2939568625	Lelliottia sp. 489	Isolate	Rhizosphere
137	2939573065	Citrobacter sp. 506	Isolate	Rhizosphere
138	2939602548	Pantoea dispersa 1175	Isolate	Rhizosphere
139	2939607340	Leclercia sp. 1548	Isolate	Rhizosphere
140	2939617950	Kosakonia cowanii 2056	Isolate	Rhizosphere
141	2939642701	Lelliottia nimipressuralis 2756	Isolate	Rhizosphere
142	2945874760	Phytobacter diazotrophicus UAEU22	Isolate	Rhizosphere
143	2945909444	Variovorax sp. CRF3-Va-1 W1I1	Isolate	Rhizosphere
144	2945945610	Variovorax paradoxus W1I18	Isolate	Rhizosphere
145	2945972063	Variovorax paradoxus W2I8	Isolate	Rhizosphere
146	2945984333	Variovorax sp. W2I14	Isolate	Rhizosphere
147	2954767861	Variovorax sp. TBS-050B	Isolate	Rhizosphere
148	2969079654	Klebsiella variicola E57-7	Isolate	Unclassified
149	2971820967	Klebsiella sp. MPUS7	Isolate	Rhizosphere
150	2974310843	Enterobacter sp. SORGH_AS 287	Isolate	Unclassified
151	2974320154	Acidovorax wautersii SORGH_AS 335	Isolate	Unclassified
152	2974435778	Kosakonia cowanii SORGH_AS 304	Isolate	Unclassified
153	2984494565	Pantoea ananatis SORGH_AS197	Isolate	Aerial Root
154	2990261002	Pantoea ananatis SORGH_AS213	Isolate	Aerial Root
155	2990710928	Acidovorax delafieldii SLBN-75	Isolate	Rhizosphere
156	3000376612	Enterobacteriaceae bacterium 4M9	Isolate	Rhizosphere
157	3300000549	Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled	Metagenome	Rhizosphere
158	3300001979	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6	Metagenome	Rhizosphere
159	3300001989	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5	Metagenome	Rhizosphere
160	3300002705	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS	Metagenome	Unclassified
161	3300002738	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA	Metagenome	Unclassified
162	3300002739	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA	Metagenome	Endosphere
163	3300002741	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL	Metagenome	Unclassified
164	3300002771	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB	Metagenome	Endosphere
165	3300002772	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS	Metagenome	Endosphere
166	3300002773	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS	Metagenome	Endosphere
167	3300002774	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA	Metagenome	Endosphere
168	3300002987	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB	Metagenome	Endosphere
169	3300003187	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB	Metagenome	Endosphere
170	3300003215	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF	Metagenome	Endosphere
171	3300003316	Sugarcane root Sample L1	Metagenome	Unclassified
172	3300003320	Sugarcane root Sample H2	Metagenome	Unclassified
173	3300003354	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS	Metagenome	Endosphere
174	3300003374	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF	Metagenome	Endosphere
175	3300003578	Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Unclassified
176	3300003751	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2	Metagenome	Endosphere
177	3300003752	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2	Metagenome	Endosphere
178	3300003756	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2	Metagenome	Endosphere
179	3300003759	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2	Metagenome	Endosphere
180	3300003761	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2	Metagenome	Endosphere
181	3300003762	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2	Metagenome	Endosphere
182	3300003771	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2	Metagenome	Endosphere
183	3300003773	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2	Metagenome	Endosphere
184	3300003775	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2	Metagenome	Endosphere
185	3300003781	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2	Metagenome	Endosphere
186	3300003784	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2	Metagenome	Endosphere
187	3300003790	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2	Metagenome	Endosphere
188	3300003791	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2	Metagenome	Endosphere
189	3300003792	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2	Metagenome	Endosphere
190	3300003794	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2	Metagenome	Endosphere
191	3300003841	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2	Metagenome	Endosphere
192	3300003856	Agave microbial communities from Guanajuato, Mexico - At.Am.rz	Metagenome	Rhizosphere
193	3300004625	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2	Metagenome	Endosphere
194	3300005262	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3)	Metagenome	Endosphere
195	3300005288	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
196	3300005289	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2)	Metagenome	Rhizosphere
197	3300005295	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2)	Metagenome	Rhizosphere
198	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
199	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
200	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
201	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
202	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
203	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
204	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
205	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
206	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
207	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
208	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
209	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
210	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
211	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
212	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
213	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
214	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
215	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
216	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
217	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
218	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
219	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
220	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
221	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
222	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
223	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
224	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
225	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
226	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
227	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
228	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
229	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
230	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
231	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
232	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
233	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
234	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
235	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
236	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
237	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
238	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
239	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
240	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
241	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
242	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
243	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
244	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
245	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
246	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
247	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
248	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
249	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
250	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
251	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
252	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
253	3300006042	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3	Metagenome	Endosphere
254	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
255	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
256	3300006058	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1	Metagenome	Rhizosphere
257	3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Metagenome	Rhizosphere
258	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
259	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
260	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
261	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
262	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
263	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
264	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
265	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
266	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
267	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
268	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
269	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
270	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
271	3300006946	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG	Metagenome	Nodule
272	3300006948	Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15	Metagenome	Nodule
273	3300009011	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG	Metagenome	Rhizosphere
274	3300009036	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG	Metagenome	Rhizosphere
275	3300009092	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG	Metagenome	Rhizosphere
276	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
277	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
278	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
279	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
280	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
281	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
282	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
283	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
284	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
285	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
286	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
287	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
288	3300012502	Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610	Metagenome	Rhizosphere
289	3300012513	Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510	Metagenome	Rhizosphere
290	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
291	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
292	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
293	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
294	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
295	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
296	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
297	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
298	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
299	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
300	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
301	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
302	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
303	3300015261	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG	Metagenome	Rhizosphere
304	3300015262	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG	Metagenome	Rhizosphere
305	3300015265	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG	Metagenome	Rhizosphere
306	3300015679	Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08	Metagenome	Unclassified
307	3300015680	Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03	Metagenome	Rhizosphere
308	3300015685	Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12	Metagenome	Unclassified
309	3300015687	Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08	Metagenome	Rhizosphere
310	3300015689	Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02	Metagenome	Rhizosphere
311	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
312	3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Metagenome	Unclassified
313	3300025206	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2)	Metagenome	Unclassified
314	3300025207	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2)	Metagenome	Endosphere
315	3300025208	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2)	Metagenome	Endosphere
316	3300025224	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
317	3300025225	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
318	3300025226	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
319	3300025228	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
320	3300025229	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
321	3300025230	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
322	3300025231	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
323	3300025233	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2)	Metagenome	Endosphere
324	3300025242	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
325	3300025245	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3)	Metagenome	Endosphere
326	3300025246	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2)	Metagenome	Unclassified
327	3300025250	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2)	Metagenome	Unclassified
328	3300025253	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
329	3300025254	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
330	3300025256	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2)	Metagenome	Unclassified
331	3300025258	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3)	Metagenome	Endosphere
332	3300025261	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2)	Metagenome	Endosphere
333	3300025263	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3)	Metagenome	Endosphere
334	3300025273	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3)	Metagenome	Endosphere
335	3300025284	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2)	Metagenome	Endosphere
336	3300025291	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3)	Metagenome	Endosphere
337	3300025292	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
338	3300025294	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2)	Metagenome	Endosphere
339	3300025295	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3)	Metagenome	Endosphere
340	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
341	3300025298	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
342	3300025299	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3)	Metagenome	Endosphere
343	3300025302	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
344	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
345	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
346	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
347	3300025711	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
348	3300025728	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
349	3300025735	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
350	3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
351	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
352	3300025905	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
353	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
354	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
355	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
356	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
357	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
358	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
359	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
360	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
361	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
362	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
363	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
364	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
365	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
366	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
367	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
368	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
369	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
370	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
371	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
372	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
373	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
374	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
375	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
376	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
377	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
378	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
379	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
380	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
381	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
382	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
383	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
384	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
385	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
386	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
387	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
388	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
389	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
390	3300027111	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2)	Metagenome	Nodule
391	3300027312	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2)	Metagenome	Rhizosphere
392	3300027526	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2)	Metagenome	Rhizosphere
393	3300027666	Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2)	Metagenome	Nodule
394	3300027866	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2)	Metagenome	Endosphere
395	3300027876	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
396	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
397	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
398	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
399	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
400	3300030500	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3)	Metagenome	Rhizosphere
401	3300030522	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM	Metagenome	Unclassified
402	3300030731	Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3	Metagenome	Rhizosphere
403	3300030732	Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1	Metagenome	Rhizosphere
404	3300030733	Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2	Metagenome	Rhizosphere
405	3300030735	Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4	Metagenome	Rhizosphere
406	3300030736	Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6	Metagenome	Rhizosphere
407	3300030742	Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9	Metagenome	Rhizosphere
408	3300030744	Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7	Metagenome	Rhizosphere
409	3300030745	Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8	Metagenome	Rhizosphere
410	3300031251	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG	Metagenome	Rhizosphere
411	3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Metagenome	Unclassified
412	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
413	3300031616	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM	Metagenome	Unclassified
414	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
415	3300031730	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM	Metagenome	Unclassified
416	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
417	3300031733	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1	Metagenome	Rhizosphere
418	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
419	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
420	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
421	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
422	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
423	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
424	3300032133	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA	Metagenome	Rhizosphere
425	3300034818	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3	Metagenome	Rhizosphere
426	3300035086	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4	Metagenome	Rhizosphere
427	3300035172	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3	Metagenome	Rhizosphere
428	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
429	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
430	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
431	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
432	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
433	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
434	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
435	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
436	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
437	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
438	3300038725	Seagrass microbial communities from Seahorse Key, FL, USA - HV0818	Metagenome	Unclassified
439	3300038726	Seagrass microbial communities from Seahorse Key, FL, USA - TH0319	Metagenome	Unclassified
440	3300038727	Seagrass microbial communities from Seahorse Key, FL, USA - TV0818	Metagenome	Unclassified
441	3300038735	Seagrass microbial communities from Seahorse Key, FL, USA - SH0319	Metagenome	Unclassified
442	3300038741	Seagrass microbial communities from Seahorse Key, FL, USA - SV0818	Metagenome	Unclassified
443	3300038742	Seagrass microbial communities from Seahorse Key, FL, USA - SH0818	Metagenome	Unclassified
444	3300039062	Seagrass microbial communities from Seahorse Key, FL, USA - HH0818	Metagenome	Unclassified
445	3300039093	Seagrass microbial communities from Seahorse Key, FL, USA - TH0818	Metagenome	Unclassified
446	3300039110	Seagrass microbial communities from Seahorse Key, FL, USA - SV0319	Metagenome	Unclassified
447	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
448	3300041404	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272	Metagenome	Rhizosphere
449	3300041405	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414	Metagenome	Rhizosphere
450	3300041406	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284	Metagenome	Rhizosphere
451	3300041407	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416	Metagenome	Rhizosphere
452	3300041410	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596	Metagenome	Rhizosphere
453	3300041411	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708	Metagenome	Rhizosphere
454	3300041413	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839	Metagenome	Rhizosphere
455	3300041451	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG	Metagenome	Rhizoplane
456	3300041452	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG	Metagenome	Rhizoplane
457	3300041456	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG	Metagenome	Rhizoplane
458	3300041458	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG	Metagenome	Rhizoplane
459	3300041486	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG	Metagenome	Rhizoplane
460	3300041494	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG	Metagenome	Unclassified
461	3300041496	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG	Metagenome	Unclassified
462	3300041498	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG	Metagenome	Unclassified
463	3300041507	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG	Metagenome	Unclassified
464	3300041512	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG	Metagenome	Unclassified
465	3300042002	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616	Metagenome	Rhizosphere
466	3300042004	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619	Metagenome	Rhizosphere
467	3300042006	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437	Metagenome	Rhizosphere
468	3300042007	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290	Metagenome	Rhizosphere
469	3300042010	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431	Metagenome	Rhizosphere
470	3300042014	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275	Metagenome	Rhizosphere
471	3300042015	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287	Metagenome	Rhizosphere
472	3300042131	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130	Metagenome	Rhizosphere
473	3300042133	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134	Metagenome	Rhizosphere
474	3300042134	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126	Metagenome	Rhizosphere
475	3300042145	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581	Metagenome	Rhizosphere
476	3300042156	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593	Metagenome	Rhizosphere
477	3300042184	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630	Metagenome	Rhizosphere
478	3300042435	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613	Metagenome	Rhizosphere
479	3300042439	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363	Metagenome	Rhizosphere
480	3300042531	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253	Metagenome	Rhizosphere
481	3300042876	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED	Metagenome	Rhizosphere
482	3300044673	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED	Metagenome	Rhizosphere
483	3300044683	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R	Metagenome	Rhizosphere
484	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
485	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
486	3300046458	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere	Metagenome	Rhizosphere
487	3300046471	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere	Metagenome	Rhizosphere
488	3300046475	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere	Metagenome	Rhizosphere
489	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
490	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
491	3300046513	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere	Metagenome	Rhizosphere
492	3300046515	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere	Metagenome	Rhizosphere
493	3300046518	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere	Metagenome	Rhizosphere
494	3300046520	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere	Metagenome	Rhizosphere
495	3300046525	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere	Metagenome	Rhizosphere
496	3300046528	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere	Metagenome	Rhizosphere
497	3300046530	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere	Metagenome	Rhizosphere
498	3300046539	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere	Metagenome	Rhizosphere
499	3300046542	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere	Metagenome	Rhizosphere
500	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
501	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
502	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
503	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
504	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
505	3300046664	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere	Metagenome	Rhizosphere
506	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
507	3300046678	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere	Metagenome	Rhizosphere
508	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
509	3300046684	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere	Metagenome	Rhizosphere
510	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
511	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
512	3300046692	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere	Metagenome	Rhizosphere
513	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
514	3300046810	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere	Metagenome	Rhizosphere
515	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
516	3300047318	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere	Metagenome	Rhizosphere
517	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
518	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
519	3300047445	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere	Metagenome	Rhizosphere
520	3300047446	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere	Metagenome	Rhizosphere
521	3300047447	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere	Metagenome	Rhizosphere
522	3300047470	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere	Metagenome	Rhizosphere
523	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
524	3300048089	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere	Metagenome	Rhizosphere
525	3300048090	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere	Metagenome	Rhizosphere
526	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
527	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
528	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
529	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
530	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
531	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
532	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
533	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
534	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
535	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
536	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
537	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
538	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
539	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
540	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
541	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
542	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
543	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
544	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
545	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
546	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
547	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
548	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
549	3300049533	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
550	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
551	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
552	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
553	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
554	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
555	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
556	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
557	3300049577	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02	Metagenome	Rhizosphere
558	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
559	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
560	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
561	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
562	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
563	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
564	3300049658	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought	Metagenome	Rhizosphere
565	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
566	3300049759	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought	Metagenome	Rhizosphere
567	3300049762	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control	Metagenome	Rhizosphere
568	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
569	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
570	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
571	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
572	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
573	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
574	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
575	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
576	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
577	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
578	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
579	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
580	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
581	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
582	3300053087	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere	Metagenome	Endosphere
583	3300053088	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere	Metagenome	Endosphere
584	3300053093	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere	Metagenome	Endosphere
585	3300053096	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere	Metagenome	Endosphere
586	3300053098	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere	Metagenome	Endosphere
587	3300053103	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere	Metagenome	Endosphere
588	3300053110	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere	Metagenome	Endosphere
589	3300053111	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere	Metagenome	Endosphere
590	3300053117	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere	Metagenome	Endosphere
591	3300053118	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere	Metagenome	Endosphere
592	3300053120	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere	Metagenome	Endosphere
593	3300053121	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere	Metagenome	Endosphere
594	3300053122	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere	Metagenome	Endosphere
595	3300053128	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere	Metagenome	Endosphere
596	3300053129	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere	Metagenome	Endosphere
597	3300053133	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere	Metagenome	Endosphere
598	3300053134	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere	Metagenome	Endosphere
599	3300053139	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere	Metagenome	Endosphere
600	3300053141	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere	Metagenome	Endosphere
601	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
602	3300053158	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere	Metagenome	Endosphere
603	3300053161	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere	Metagenome	Endosphere
604	3300053162	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere	Metagenome	Endosphere
605	3300053730	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere	Metagenome	Endosphere
606	3300059424	Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810	Metagenome	Rhizosphere
607	3300059426	Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810	Metagenome	Rhizosphere
608	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere
609	8004592986	Serratia sp. S119	Isolate	Unclassified
610	8015394850	Serratia sp. PGPR-27	Isolate	Rhizosphere
611	8016733728	Pantoea sp. SORGH_AS 659	Isolate	Unclassified
612	8018221730	Enterobacter sp. CM29	Isolate	Unclassified
613	8018405270	Enterobacter sp. 198	Isolate	Rhizosphere
614	8019499862	Kluyvera sp. 1366	Isolate	Rhizosphere
615	8019504834	Atlantibacter hermannii 1903	Isolate	Rhizosphere
616	8054844752	Dryocola boscaweniae H18W14	Isolate	Rhizosphere
617	8054849141	Dryocola clanedunensis H11S18	Isolate	Rhizosphere
618	8055087960	Silvania hatchlandensis H19S6	Isolate	Rhizosphere
619	8055092621	Silvania confinis H4N4	Isolate	Rhizosphere
620	8055097453	Leclercia tamurae H6W5	Isolate	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	85.77
Metatranscriptomes	0.17
Isolates	14.06

Biome Distribution

Category	Percentage (%)
Aerial Root	0.17
Bulb	0.08
Endosphere	20.08
Nodule	2.01
Rhizoplane	6.53
Rhizosphere	53.97
Stem	0.08
Stem Tuber	0.08
Unclassified	16.99

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	LJQas_1034856	3300000549	Bacteria	591
2	JGI24740J21852_10005401	3300001979	Bacteria	5411
3	JGI24739J22299_10000371	3300001989	Bacteria	15419
4	JGI24739J22299_10066941	3300001989	Bacteria	1124
5	JGI25156J39149_1000006	3300002705	Bacteria	261778
6	JGI25154J39366_1000015	3300002738	Bacteria	261778
7	JGI25158J39367_1009640	3300002739	Bacteria	1320
8	JGI25157J39369_1000016	3300002741	Bacteria	192349
9	JGI25163J39215_1000015	3300002771	Bacteria	83621
10	JGI25164J39214_1000009	3300002772	Bacteria	303437
11	JGI25152J39213_1000247	3300002773	Bacteria	36275
12	JGI25152J39213_1010251	3300002773	Bacteria	2161
13	JGI25152J39213_1040354	3300002773	Bacteria	659
14	JGI25150J39212_1006400	3300002774	Bacteria	2431
15	JGI25150J39212_1033517	3300002774	Bacteria	696
16	JGI25159J45721_1002274	3300002987	Bacteria	7402
17	JGI25159J45721_1004021	3300002987	Bacteria	5005
18	JGI25159J45721_1007675	3300002987	Bacteria	3061
19	JGI25159J45721_1042309	3300002987	Bacteria	659
20	JGI25151J46595_10001341	3300003187	Bacteria	17127
21	JGI25151J46595_10002241	3300003187	Bacteria	11884
22	JGI25151J46595_10121615	3300003187	Bacteria	664
23	JGI25151J46595_10122716	3300003187	Bacteria	659
24	JGI25153J46596_10103805	3300003215	Bacteria	664
25	JGI25153J46596_10104726	3300003215	Bacteria	659
26	rootH1_10041552	3300003316	Bacteria	2767
27	rootH2_10015620	3300003320	Bacteria	27832
28	rootH2_10204329	3300003320	Bacteria	1233
29	JGI25160J50197_1000689	3300003354	Bacteria	18663
30	JGI25160J50197_1004293	3300003354	Bacteria	6179
31	JGI25160J50197_1071856	3300003354	Bacteria	659
32	JGI25161J50226_1000008	3300003374	Bacteria	239245
33	JGI25161J50226_1003987	3300003374	Bacteria	3203
34	Ga0006562J51391_1065511	3300003578	Bacteria	2580
35	Ga0055538_1000005	3300003751	Bacteria	575218
36	Ga0055539_1000007	3300003752	Bacteria	575218
37	Ga0055533_1000009	3300003756	Bacteria	575218
38	Ga0055525_1000010	3300003759	Bacteria	575218
39	Ga0055535_1000341	3300003761	Bacteria	46538
40	Ga0055542_1000369	3300003762	Bacteria	46540
41	Ga0055526_1077009	3300003771	Bacteria	659
42	Ga0055526_1077043	3300003771	Bacteria	659
43	Ga0055537_1000383	3300003773	Bacteria	29757
44	Ga0055537_1000571	3300003773	Bacteria	20677
45	Ga0055537_1016463	3300003773	Bacteria	1249
46	Ga0055537_1032709	3300003773	Bacteria	659
47	Ga0055524_1000107	3300003775	Bacteria	100962
48	Ga0055524_1072261	3300003775	Bacteria	659
49	Ga0055524_1072326	3300003775	Bacteria	659
50	Ga0055536_1005732	3300003781	Bacteria	5985
51	Ga0055536_1006667	3300003781	Bacteria	5316
52	Ga0055536_1014563	3300003781	Bacteria	2749
53	Ga0055536_1024408	3300003781	Bacteria	1751
54	Ga0055534_1000064	3300003784	Bacteria	81486
55	Ga0055534_1000807	3300003784	Bacteria	14526
56	Ga0055534_1008960	3300003784	Bacteria	2216
57	Ga0055534_1043103	3300003784	Bacteria	659
58	Ga0055528_1001212	3300003790	Bacteria	16526
59	Ga0055528_1002261	3300003790	Bacteria	10462
60	Ga0055528_1048134	3300003790	Bacteria	884
61	Ga0055528_1066962	3300003790	Bacteria	659
62	Ga0055530_10000121	3300003791	Bacteria	67516
63	Ga0055530_10001020	3300003791	Bacteria	22404
64	Ga0055530_10043619	3300003791	Bacteria	1080
65	Ga0055530_10067953	3300003791	Bacteria	776
66	Ga0055540_1000021	3300003792	Bacteria	208733
67	Ga0055540_1000998	3300003792	Bacteria	18251
68	Ga0055540_1001724	3300003792	Bacteria	12582
69	Ga0055531_10000774	3300003794	Bacteria	26616
70	Ga0055531_10001925	3300003794	Bacteria	14520
71	Ga0055531_10034970	3300003794	Bacteria	1583
72	Ga0055531_10088297	3300003794	Bacteria	664
73	Ga0055531_10088330	3300003794	Bacteria	664
74	Ga0055541_1000005	3300003841	Bacteria	575218
75	Ga0058692_1000273	3300003856	Bacteria	27572
76	Ga0058692_1000837	3300003856	Bacteria	12201
77	Ga0058692_1001543	3300003856	Bacteria	8386
78	Ga0058692_1012570	3300003856	Bacteria	2000
79	Ga0058692_1013773	3300003856	Bacteria	1872
80	Ga0058692_1015486	3300003856	Bacteria	1716
81	Ga0058692_1021950	3300003856	Bacteria	1319
82	Ga0058692_1030107	3300003856	Bacteria	1033
83	Ga0058692_1055994	3300003856	Bacteria	637
84	Ga0058692_1061328	3300003856	Bacteria	592
85	Ga0055543_1000259	3300004625	Bacteria	39835
86	Ga0055543_1005988	3300004625	Bacteria	3016
87	Ga0065165_1106018	3300005262	Bacteria	697
88	Ga0065165_1106019	3300005262	Bacteria	697
89	Ga0065714_10006432	3300005288	Bacteria	3292
90	Ga0065714_10036053	3300005288	Bacteria	805
91	Ga0065714_10147566	3300005288	Bacteria	1127
92	Ga0065714_10198596	3300005288	Bacteria	901
93	Ga0065704_10000373	3300005289	Bacteria	25770
94	Ga0065704_10002947	3300005289	Bacteria	4509
95	Ga0065704_10003359	3300005289	Bacteria	5093
96	Ga0065704_10086203	3300005289	Bacteria	3144
97	Ga0065704_10173751	3300005289	Bacteria	1263
98	Ga0065704_10265154	3300005289	Bacteria	956
99	Ga0065704_10382892	3300005289	Bacteria	771
100	Ga0065704_10397543	3300005289	Bacteria	755
101	Ga0065707_10024013	3300005295	Bacteria	1981
102	Ga0065707_10085471	3300005295	Bacteria	6131
103	Ga0065707_10471474	3300005295	Bacteria	754
104	Ga0070658_10076029	3300005327	Bacteria	2754
105	Ga0070658_10106764	3300005327	Bacteria	2317
106	Ga0070676_11056819	3300005328	Bacteria	612
107	Ga0070690_100000490	3300005330	Bacteria	19854
108	Ga0070670_102067117	3300005331	Bacteria	525
109	Ga0068869_100298079	3300005334	Bacteria	1301
110	Ga0068869_100757332	3300005334	Bacteria	832
111	Ga0070666_10612714	3300005335	Bacteria	795
112	Ga0070680_100012882	3300005336	Bacteria	6504
113	Ga0070682_101087090	3300005337	Bacteria	669
114	Ga0070689_100000090	3300005340	Bacteria	52338
115	Ga0070691_10080390	3300005341	Bacteria	1595
116	Ga0070687_100003928	3300005343	Bacteria	5851
117	Ga0070692_10342903	3300005345	Bacteria	926
118	Ga0070669_100006496	3300005353	Bacteria	8419
119	Ga0070675_100395113	3300005354	Bacteria	1233
120	Ga0070674_100172446	3300005356	Bacteria	1650
121	Ga0070674_101397771	3300005356	Bacteria	627
122	Ga0070673_100515758	3300005364	Bacteria	1083
123	Ga0070688_100000135	3300005365	Bacteria	39766
124	Ga0070659_100081428	3300005366	Bacteria	2585
125	Ga0070667_100044575	3300005367	Bacteria	3726
126	Ga0070701_10000541	3300005438	Bacteria	13039
127	Ga0070701_10271493	3300005438	Bacteria	1032
128	Ga0070701_10518508	3300005438	Bacteria	777
129	Ga0070700_100000257	3300005441	Bacteria	28570
130	Ga0070700_100746363	3300005441	Bacteria	783
131	Ga0070694_100150646	3300005444	Bacteria	1698
132	Ga0070694_100170258	3300005444	Bacteria	1604
133	Ga0070694_100493100	3300005444	Bacteria	974
134	Ga0070708_100261424	3300005445	Bacteria	1627
135	Ga0070708_100479233	3300005445	Bacteria	1174
136	Ga0070678_100205947	3300005456	Bacteria	1627
137	Ga0070678_100265015	3300005456	Bacteria	1447
138	Ga0070678_100531475	3300005456	Bacteria	1042
139	Ga0070681_10011448	3300005458	Bacteria	8780
140	Ga0070681_10208715	3300005458	Bacteria	1870
141	Ga0068867_100024615	3300005459	Bacteria	4314
142	Ga0068867_100748536	3300005459	Bacteria	867
143	Ga0070685_10000073	3300005466	Bacteria	59457
144	Ga0070706_100116317	3300005467	Bacteria	2491
145	Ga0070707_100000018	3300005468	Bacteria	137542
146	Ga0070707_100422731	3300005468	Bacteria	1293
147	Ga0070707_100563342	3300005468	Bacteria	1101
148	Ga0070698_100961742	3300005471	Bacteria	800
149	Ga0070699_100035566	3300005518	Bacteria	4305
150	Ga0070679_100075124	3300005530	Bacteria	3370
151	Ga0070679_100589071	3300005530	Bacteria	1055
152	Ga0070697_100021498	3300005536	Bacteria	5112
153	Ga0070697_100123355	3300005536	Bacteria	2168
154	Ga0068853_100048018	3300005539	Bacteria	3664
155	Ga0068853_100225302	3300005539	Bacteria	1713
156	Ga0068853_100294865	3300005539	Bacteria	1498
157	Ga0070672_100019919	3300005543	Bacteria	4882
158	Ga0070672_100154685	3300005543	Bacteria	1899
159	Ga0070686_100000283	3300005544	Bacteria	34170
160	Ga0070686_100007285	3300005544	Bacteria	6166
161	Ga0070695_100071493	3300005545	Bacteria	2272
162	Ga0070695_100088959	3300005545	Bacteria	2057
163	Ga0070696_100376392	3300005546	Bacteria	1105
164	Ga0070665_100001635	3300005548	Bacteria	25828
165	Ga0070665_100101538	3300005548	Bacteria	2880
166	Ga0070665_100117432	3300005548	Bacteria	2663
167	Ga0070665_100800176	3300005548	Bacteria	956
168	Ga0070704_100150596	3300005549	Bacteria	1829
169	Ga0070704_100278825	3300005549	Bacteria	1384
170	Ga0070704_100426773	3300005549	Bacteria	1136
171	Ga0068855_100166340	3300005563	Bacteria	2500
172	Ga0070664_100011226	3300005564	Bacteria	7266
173	Ga0068857_100000003	3300005577	Bacteria	174630
174	Ga0068857_100460713	3300005577	Bacteria	1190
175	Ga0068857_100666647	3300005577	Bacteria	987
176	Ga0068857_101152028	3300005577	Bacteria	750
177	Ga0068854_100166731	3300005578	Bacteria	1710
178	Ga0070702_100064536	3300005615	Bacteria	2142
179	Ga0068852_100397179	3300005616	Bacteria	1356
180	Ga0068859_100002744	3300005617	Bacteria	17847
181	Ga0068859_101202668	3300005617	Bacteria	835
182	Ga0068864_101149177	3300005618	Bacteria	774
183	Ga0068866_10146916	3300005718	Bacteria	1361
184	Ga0068861_100464330	3300005719	Bacteria	1137
185	Ga0068851_10033080	3300005834	Bacteria	2575
186	Ga0068851_10056079	3300005834	Bacteria	2009
187	Ga0068858_100614400	3300005842	Bacteria	1055
188	Ga0068860_100271946	3300005843	Bacteria	1654
189	Ga0068862_100076125	3300005844	Bacteria	2904
190	Ga0075365_10164876	3300006038	Bacteria	1545
191	Ga0075368_10139417	3300006042	Bacteria	1010
192	Ga0075363_100020333	3300006048	Bacteria	3328
193	Ga0075363_100412330	3300006048	Bacteria	795
194	Ga0075364_10006787	3300006051	Bacteria	6751
195	Ga0075364_10022055	3300006051	Bacteria	4018
196	Ga0075364_10030545	3300006051	Bacteria	3459
197	Ga0075364_10043647	3300006051	Bacteria	2915
198	Ga0075364_10093401	3300006051	Bacteria	1998
199	Ga0075364_10215119	3300006051	Bacteria	1303
200	Ga0075364_10726303	3300006051	Bacteria	678
201	Ga0075432_10044569	3300006058	Bacteria	1555
202	Ga0075432_10072557	3300006058	Bacteria	1238
203	Ga0070715_10066960	3300006163	Bacteria	1594
204	Ga0070715_10081830	3300006163	Bacteria	1467
205	Ga0070716_100017352	3300006173	Bacteria	3731
206	Ga0070716_100096018	3300006173	Bacteria	1806
207	Ga0075362_10113148	3300006177	Bacteria	1279
208	Ga0075362_10123882	3300006177	Bacteria	1225
209	Ga0075362_10149471	3300006177	Bacteria	1120
210	Ga0075367_10282227	3300006178	Bacteria	1044
211	Ga0075369_10151699	3300006186	Bacteria	1060
212	Ga0075369_10454454	3300006186	Bacteria	607
213	Ga0075366_10012790	3300006195	Bacteria	4769
214	Ga0075366_10037042	3300006195	Bacteria	2878
215	Ga0075366_10261847	3300006195	Bacteria	1056
216	Ga0075366_10412504	3300006195	Bacteria	831
217	Ga0097621_100191556	3300006237	Bacteria	1771
218	Ga0097621_100191801	3300006237	Bacteria	1770
219	Ga0097621_100470807	3300006237	Bacteria	1134
220	Ga0097621_100810396	3300006237	Bacteria	868
221	Ga0075370_10000147	3300006353	Bacteria	24004
222	Ga0075370_10001537	3300006353	Bacteria	10082
223	Ga0075370_10001621	3300006353	Bacteria	9937
224	Ga0075370_10008851	3300006353	Bacteria	5198
225	Ga0075370_10016233	3300006353	Bacteria	4004
226	Ga0075370_10204719	3300006353	Bacteria	1164
227	Ga0068871_100114998	3300006358	Bacteria	2267
228	Ga0068871_100137739	3300006358	Bacteria	2074
229	Ga0068871_100845110	3300006358	Bacteria	846
230	Ga0068871_101193010	3300006358	Bacteria	714
231	Ga0075430_100029694	3300006846	Bacteria	4640
232	Ga0075433_10596727	3300006852	Bacteria	970
233	Ga0068865_100308975	3300006881	Bacteria	1268
234	Ga0068865_100553970	3300006881	Bacteria	966
235	Ga0075436_100039269	3300006914	Bacteria	3267
236	Ga0097620_100002744	3300006931	Bacteria	17847
237	Ga0097620_101202564	3300006931	Bacteria	835
238	Ga0079104_1000157	3300006946	Bacteria	96925
239	Ga0079104_1000166	3300006946	Bacteria	94027
240	Ga0079104_1000675	3300006946	Bacteria	31832
241	Ga0079104_1001269	3300006946	Bacteria	17510
242	Ga0079104_1001919	3300006946	Bacteria	12487
243	Ga0079104_1004419	3300006946	Bacteria	6040
244	Ga0079104_1004671	3300006946	Bacteria	5744
245	Ga0079104_1011223	3300006946	Bacteria	2893
246	Ga0079104_1016897	3300006946	Bacteria	2115
247	Ga0079104_1027535	3300006946	Bacteria	1456
248	Ga0099826_10001427	3300006948	Bacteria	14324
249	Ga0099826_10147807	3300006948	Bacteria	1348
250	Ga0105251_10000655	3300009011	Bacteria	31924
251	Ga0105251_10000827	3300009011	Bacteria	27696
252	Ga0105251_10001660	3300009011	Bacteria	18793
253	Ga0105244_10000794	3300009036	Bacteria	26882
254	Ga0105244_10001531	3300009036	Bacteria	18448
255	Ga0105244_10001979	3300009036	Bacteria	15829
256	Ga0105244_10002142	3300009036	Bacteria	15151
257	Ga0105244_10004253	3300009036	Bacteria	9936
258	Ga0105244_10007926	3300009036	Bacteria	6693
259	Ga0105244_10015095	3300009036	Bacteria	4440
260	Ga0105244_10018133	3300009036	Bacteria	3959
261	Ga0105244_10027412	3300009036	Bacteria	3070
262	Ga0105244_10072093	3300009036	Bacteria	1721
263	Ga0105244_10079452	3300009036	Bacteria	1625
264	Ga0105244_10448503	3300009036	Bacteria	593
265	Ga0105250_10000025	3300009092	Bacteria	215424
266	Ga0105250_10000930	3300009092	Bacteria	17232
267	Ga0105250_10003075	3300009092	Bacteria	8044
268	Ga0105250_10018145	3300009092	Bacteria	2853
269	Ga0105250_10055414	3300009092	Bacteria	1591
270	Ga0105240_10244040	3300009093	Bacteria	2081
271	Ga0105245_10013798	3300009098	Bacteria	7037
272	Ga0114129_10024726	3300009147	Bacteria	8514
273	Ga0105243_10007332	3300009148	Bacteria	8479
274	Ga0105243_10007581	3300009148	Bacteria	8340
275	Ga0105243_10021519	3300009148	Bacteria	4896
276	Ga0105243_10042085	3300009148	Bacteria	3575
277	Ga0105243_10552863	3300009148	Bacteria	1100
278	Ga0105241_11420349	3300009174	Bacteria	665
279	Ga0105242_10220212	3300009176	Bacteria	1696
280	Ga0105242_11452511	3300009176	Bacteria	715
281	Ga0105248_10000232	3300009177	Bacteria	63931
282	Ga0105248_10229223	3300009177	Bacteria	2091
283	Ga0105248_11949232	3300009177	Bacteria	667
284	Ga0105237_10163985	3300009545	Bacteria	2221
285	Ga0105238_10182798	3300009551	Bacteria	2073
286	Ga0105238_10224253	3300009551	Bacteria	1856
287	Ga0105238_10491246	3300009551	Bacteria	1227
288	Ga0105249_11507611	3300009553	Bacteria	745
289	Ga0105249_11740228	3300009553	Bacteria	696
290	Ga0105239_10681570	3300010375	Bacteria	1175
291	Ga0105239_11499098	3300010375	Bacteria	779
292	Ga0105239_11515834	3300010375	Bacteria	775
293	Ga0105246_10079314	3300011119	Bacteria	2334
294	Ga0105246_10368339	3300011119	Bacteria	1183
295	Ga0105246_10676973	3300011119	Bacteria	901
296	Ga0157347_1001600	3300012502	Bacteria	1809
297	Ga0157326_1004291	3300012513	Bacteria	1497
298	Ga0157373_10005828	3300013100	Bacteria	9222
299	Ga0157373_10005842	3300013100	Bacteria	9211
300	Ga0157373_10028132	3300013100	Bacteria	4056
301	Ga0157373_10121413	3300013100	Bacteria	1836
302	Ga0157373_10128147	3300013100	Bacteria	1784
303	Ga0157373_10176428	3300013100	Bacteria	1504
304	Ga0157373_10501558	3300013100	Bacteria	877
305	Ga0157371_10000801	3300013102	Bacteria	36070
306	Ga0157371_10001284	3300013102	Bacteria	26476
307	Ga0157371_10001379	3300013102	Bacteria	25462
308	Ga0157371_10044980	3300013102	Bacteria	3143
309	Ga0157371_10147224	3300013102	Bacteria	1679
310	Ga0157371_10245893	3300013102	Bacteria	1287
311	Ga0157370_10000104	3300013104	Bacteria	96846
312	Ga0157370_10010891	3300013104	Bacteria	9551
313	Ga0157370_10014616	3300013104	Bacteria	8021
314	Ga0157369_10051975	3300013105	Bacteria	4434
315	Ga0157369_10057750	3300013105	Bacteria	4185
316	Ga0157369_10470336	3300013105	Bacteria	1301
317	Ga0157369_12004484	3300013105	Bacteria	587
318	Ga0157374_10579531	3300013296	Bacteria	1131
319	Ga0157378_10124268	3300013297	Bacteria	2382
320	Ga0157378_10469896	3300013297	Bacteria	1251
321	Ga0163162_10467255	3300013306	Bacteria	1393
322	Ga0163162_10585982	3300013306	Bacteria	1242
323	Ga0157372_10000569	3300013307	Bacteria	40510
324	Ga0157372_10003569	3300013307	Bacteria	16740
325	Ga0157372_10526690	3300013307	Bacteria	1378
326	Ga0157375_10363808	3300013308	Bacteria	1613
327	Ga0157375_10540276	3300013308	Bacteria	1328
328	Ga0157375_10866747	3300013308	Bacteria	1049
329	Ga0157375_11501453	3300013308	Bacteria	795
330	Ga0157375_11618836	3300013308	Bacteria	766
331	Ga0157380_10001779	3300014326	Bacteria	14234
332	Ga0157380_10010603	3300014326	Bacteria	6631
333	Ga0157380_10365263	3300014326	Bacteria	1356
334	Ga0157380_11710622	3300014326	Bacteria	687
335	Ga0182008_10001867	3300014497	Bacteria	13708
336	Ga0182008_10005963	3300014497	Bacteria	6868
337	Ga0182008_10024094	3300014497	Bacteria	3101
338	Ga0182008_10043627	3300014497	Bacteria	2232
339	Ga0157379_10274229	3300014968	Bacteria	1534
340	Ga0157376_10165933	3300014969	Bacteria	2006
341	Ga0157376_10171279	3300014969	Bacteria	1977
342	Ga0157376_10654558	3300014969	Bacteria	1051
343	Ga0157376_11507206	3300014969	Bacteria	705
344	Ga0182006_1000020	3300015261	Bacteria	285318
345	Ga0182006_1002593	3300015261	Bacteria	9774
346	Ga0182006_1014674	3300015261	Bacteria	3373
347	Ga0182006_1026409	3300015261	Bacteria	2377
348	Ga0182006_1111041	3300015261	Bacteria	962
349	Ga0182007_10001595	3300015262	Bacteria	12054
350	Ga0182007_10006343	3300015262	Bacteria	5086
351	Ga0182005_1254609	3300015265	Bacteria	544
352	Ga0183366_1001	3300015679	Bacteria	2743932
353	Ga0183370_1001	3300015680	Bacteria	2743932
354	Ga0183369_1001	3300015685	Bacteria	2743932
355	Ga0183368_1001	3300015687	Bacteria	2743932
356	Ga0183360_12777	3300015689	Bacteria	669
357	Ga0163161_10000732	3300017792	Bacteria	25846
358	Ga0163161_10014146	3300017792	Bacteria	5557
359	Ga0163161_10040092	3300017792	Bacteria	3363
360	Ga0163161_10126946	3300017792	Bacteria	1921
361	Ga0163161_10473385	3300017792	Bacteria	1016
362	Ga0163161_10483683	3300017792	Bacteria	1005
363	Ga0163161_11092024	3300017792	Bacteria	685
364	Ga0213876_10000025	3300021384	Bacteria	236747
365	Ga0209435_100010	3300025206	Bacteria	475373
366	Ga0209760_100057	3300025207	Bacteria	99434
367	Ga0209436_103123	3300025208	Bacteria	4552
368	Ga0209436_108739	3300025208	Bacteria	1987
369	Ga0209784_100001	3300025224	Bacteria	3600592
370	Ga0209566_100001	3300025225	Bacteria	3600765
371	Ga0209674_100002	3300025226	Bacteria	3600592
372	Ga0209672_101495	3300025228	Bacteria	8171
373	Ga0209147_100506	3300025229	Bacteria	22679
374	Ga0209563_100008	3300025230	Bacteria	1554545
375	Ga0207427_100002	3300025231	Bacteria	1355321
376	Ga0209437_100007	3300025233	Bacteria	938377
377	Ga0209258_100133	3300025242	Bacteria	174846
378	Ga0207425_1004293	3300025245	Bacteria	4320
379	Ga0207425_1018823	3300025245	Bacteria	1494
380	Ga0207425_1052418	3300025245	Bacteria	740
381	Ga0209646_1000001	3300025246	Bacteria	3092932
382	Ga0209026_1000001	3300025250	Bacteria	1228671
383	Ga0209677_100004	3300025253	Bacteria	1554545
384	Ga0209148_1000361	3300025254	Bacteria	57663
385	Ga0209759_1000001	3300025256	Bacteria	2799452
386	Ga0209129_1000015	3300025258	Bacteria	487967
387	Ga0209129_1000033	3300025258	Bacteria	336894
388	Ga0209129_1001468	3300025258	Bacteria	13112
389	Ga0209129_1034136	3300025258	Bacteria	834
390	Ga0209129_1045335	3300025258	Bacteria	684
391	Ga0209233_1003997	3300025261	Bacteria	5110
392	Ga0209565_1000088	3300025263	Bacteria	151644
393	Ga0209565_1000102	3300025263	Bacteria	127545
394	Ga0209565_1000953	3300025263	Bacteria	15084
395	Ga0209565_1001197	3300025263	Bacteria	12378
396	Ga0209673_1000064	3300025273	Bacteria	254712
397	Ga0209673_1000189	3300025273	Bacteria	123470
398	Ga0209673_1001735	3300025273	Bacteria	18328
399	Ga0209673_1002549	3300025273	Bacteria	12446
400	Ga0209673_1063108	3300025273	Bacteria	915
401	Ga0209130_1000186	3300025284	Bacteria	87096
402	Ga0209130_1000401	3300025284	Bacteria	47425
403	Ga0209130_1000885	3300025284	Bacteria	24420
404	Ga0209130_1019597	3300025284	Bacteria	1564
405	Ga0209675_1000036	3300025291	Bacteria	254712
406	Ga0209675_1000503	3300025291	Bacteria	29292
407	Ga0209675_1000807	3300025291	Bacteria	20635
408	Ga0209675_1002829	3300025291	Bacteria	8647
409	Ga0209675_1021217	3300025291	Bacteria	1736
410	Ga0209675_1061568	3300025291	Bacteria	740
411	Ga0209676_1000069	3300025292	Bacteria	312462
412	Ga0209676_1000111	3300025292	Bacteria	213411
413	Ga0209676_1001516	3300025292	Bacteria	21147
414	Ga0209676_1006618	3300025292	Bacteria	5664
415	Ga0209676_1032960	3300025292	Bacteria	1550
416	Ga0209676_1034617	3300025292	Bacteria	1491
417	Ga0209025_1000424	3300025294	Bacteria	83948
418	Ga0209025_1001578	3300025294	Bacteria	28809
419	Ga0209025_1005626	3300025294	Bacteria	10115
420	Ga0209025_1006898	3300025294	Bacteria	8657
421	Ga0209025_1010062	3300025294	Bacteria	6471
422	Ga0209025_1012138	3300025294	Bacteria	5566
423	Ga0209025_1036798	3300025294	Bacteria	2185
424	Ga0209025_1059275	3300025294	Bacteria	1446
425	Ga0209025_1069592	3300025294	Bacteria	1257
426	Ga0209564_1000070	3300025295	Bacteria	303126
427	Ga0209564_1000964	3300025295	Bacteria	36352
428	Ga0209564_1001104	3300025295	Bacteria	31907
429	Ga0209564_1001141	3300025295	Bacteria	31135
430	Ga0209758_1000027	3300025297	Bacteria	549650
431	Ga0209758_1114402	3300025297	Bacteria	740
432	Ga0209050_1000023	3300025298	Bacteria	537172
433	Ga0209050_1000111	3300025298	Bacteria	213411
434	Ga0209050_1000571	3300025298	Bacteria	59772
435	Ga0209050_1005156	3300025298	Bacteria	8371
436	Ga0209050_1026709	3300025298	Bacteria	1924
437	Ga0209256_1000003	3300025299	Bacteria	1661127
438	Ga0209256_1000047	3300025299	Bacteria	314709
439	Ga0209256_1000903	3300025299	Bacteria	36352
440	Ga0207426_1000115	3300025302	Bacteria	227423
441	Ga0207426_1000742	3300025302	Bacteria	36678
442	Ga0207426_1002400	3300025302	Bacteria	12070
443	Ga0209051_1000017	3300025303	Bacteria	537172
444	Ga0209051_1000046	3300025303	Bacteria	296424
445	Ga0209051_1000344	3300025303	Bacteria	69935
446	Ga0209051_1000609	3300025303	Bacteria	41505
447	Ga0209051_1001576	3300025303	Bacteria	18805
448	Ga0209051_1042625	3300025303	Bacteria	1602
449	Ga0209051_1114277	3300025303	Bacteria	698
450	Ga0209257_1000041	3300025304	Bacteria	537172
451	Ga0209257_1000344	3300025304	Bacteria	96578
452	Ga0209257_1002876	3300025304	Bacteria	16025
453	Ga0209257_1008281	3300025304	Bacteria	5966
454	Ga0207656_10052850	3300025321	Bacteria	1761
455	Ga0207656_10062035	3300025321	Bacteria	1642
456	Ga0207696_1000003	3300025711	Bacteria	860639
457	Ga0207696_1000007	3300025711	Bacteria	578417
458	Ga0207696_1000313	3300025711	Bacteria	54096
459	Ga0207696_1000544	3300025711	Bacteria	30471
460	Ga0207696_1001363	3300025711	Bacteria	13406
461	Ga0207696_1029836	3300025711	Bacteria	1662
462	Ga0207696_1068956	3300025711	Bacteria	986
463	Ga0207655_1000001	3300025728	Bacteria	1866413
464	Ga0207655_1000087	3300025728	Bacteria	205876
465	Ga0207655_1000226	3300025728	Bacteria	94688
466	Ga0207655_1001858	3300025728	Bacteria	18229
467	Ga0207655_1003596	3300025728	Bacteria	11459
468	Ga0207655_1004364	3300025728	Bacteria	10059
469	Ga0207655_1005538	3300025728	Bacteria	8563
470	Ga0207655_1008382	3300025728	Bacteria	6570
471	Ga0207655_1014005	3300025728	Bacteria	4564
472	Ga0207655_1014687	3300025728	Bacteria	4407
473	Ga0207655_1031027	3300025728	Bacteria	2472
474	Ga0207655_1060351	3300025728	Bacteria	1470
475	Ga0207655_1089255	3300025728	Bacteria	1089
476	Ga0207655_1095435	3300025728	Bacteria	1037
477	Ga0207713_1000005	3300025735	Bacteria	649958
478	Ga0207713_1000021	3300025735	Bacteria	353108
479	Ga0207713_1000038	3300025735	Bacteria	247609
480	Ga0207713_1003843	3300025735	Bacteria	10041
481	Ga0207713_1005130	3300025735	Bacteria	8288
482	Ga0207713_1015383	3300025735	Bacteria	3930
483	Ga0207713_1024100	3300025735	Bacteria	2845
484	Ga0207713_1049801	3300025735	Bacteria	1677
485	Ga0207682_10127055	3300025893	Bacteria	1136
486	Ga0207647_10138490	3300025904	Bacteria	1427
487	Ga0207685_10007822	3300025905	Bacteria	3006
488	Ga0207685_10202705	3300025905	Bacteria	933
489	Ga0207699_10754714	3300025906	Bacteria	714
490	Ga0207645_10840712	3300025907	Bacteria	624
491	Ga0207705_10101310	3300025909	Bacteria	2118
492	Ga0207705_10405923	3300025909	Bacteria	1054
493	Ga0207707_10031381	3300025912	Bacteria	4650
494	Ga0207707_10136948	3300025912	Bacteria	2141
495	Ga0207695_10210151	3300025913	Bacteria	1857
496	Ga0207671_10057853	3300025914	Bacteria	2874
497	Ga0207660_10012848	3300025917	Bacteria	5482
498	Ga0207662_10086290	3300025918	Bacteria	1923
499	Ga0207662_10335922	3300025918	Bacteria	1011
500	Ga0207652_10045490	3300025921	Bacteria	3743
501	Ga0207646_10000072	3300025922	Bacteria	141756
502	Ga0207646_10128438	3300025922	Bacteria	2280
503	Ga0207694_10220509	3300025924	Bacteria	1547
504	Ga0207706_10030940	3300025933	Bacteria	4772
505	Ga0207706_10324153	3300025933	Bacteria	1340
506	Ga0207686_10019967	3300025934	Bacteria	3821
507	Ga0207686_10673769	3300025934	Bacteria	820
508	Ga0207709_10000963	3300025935	Bacteria	21558
509	Ga0207709_10002945	3300025935	Bacteria	10387
510	Ga0207709_10016461	3300025935	Bacteria	4110
511	Ga0207709_10023689	3300025935	Bacteria	3497
512	Ga0207709_10042289	3300025935	Bacteria	2740
513	Ga0207670_10000032	3300025936	Bacteria	112426
514	Ga0207669_10257729	3300025937	Bacteria	1303
515	Ga0207669_10284903	3300025937	Bacteria	1248
516	Ga0207704_10035550	3300025938	Bacteria	2856
517	Ga0207704_10333248	3300025938	Bacteria	1175
518	Ga0207665_10046067	3300025939	Bacteria	2921
519	Ga0207665_10501768	3300025939	Bacteria	937
520	Ga0207691_10061522	3300025940	Bacteria	3410
521	Ga0207711_10008574	3300025941	Bacteria	8550
522	Ga0207711_10883696	3300025941	Bacteria	831
523	Ga0207689_10298413	3300025942	Bacteria	1335
524	Ga0207689_10737986	3300025942	Bacteria	831
525	Ga0207679_10014954	3300025945	Bacteria	5114
526	Ga0207667_10174808	3300025949	Bacteria	2207
527	Ga0207651_10691400	3300025960	Bacteria	898
528	Ga0207712_10391951	3300025961	Bacteria	1165
529	Ga0207668_10290412	3300025972	Bacteria	1345
530	Ga0207668_10593732	3300025972	Bacteria	964
531	Ga0207658_10128854	3300025986	Bacteria	2030
532	Ga0207658_10138429	3300025986	Bacteria	1966
533	Ga0207703_10406348	3300026035	Bacteria	1264
534	Ga0207639_10182283	3300026041	Bacteria	1787
535	Ga0207639_10204041	3300026041	Bacteria	1697
536	Ga0207639_10255329	3300026041	Bacteria	1531
537	Ga0207678_10453155	3300026067	Bacteria	1115
538	Ga0207708_10000413	3300026075	Bacteria	33516
539	Ga0207708_10683484	3300026075	Bacteria	876
540	Ga0207702_11198596	3300026078	Bacteria	753
541	Ga0207641_11335578	3300026088	Bacteria	718
542	Ga0207648_10008263	3300026089	Bacteria	10106
543	Ga0207648_11245734	3300026089	Bacteria	699
544	Ga0207674_10002103	3300026116	Bacteria	25211
545	Ga0207674_10066465	3300026116	Bacteria	3632
546	Ga0207674_10098280	3300026116	Bacteria	2911
547	Ga0207675_101796629	3300026118	Bacteria	632
548	Ga0207683_10050827	3300026121	Bacteria	3631
549	Ga0207683_10224158	3300026121	Bacteria	1713
550	Ga0209281_1000001	3300027111	Bacteria	1933496
551	Ga0209281_1000021	3300027111	Bacteria	541033
552	Ga0209281_1000041	3300027111	Bacteria	347825
553	Ga0209281_1000075	3300027111	Bacteria	267114
554	Ga0209281_1000093	3300027111	Bacteria	240724
555	Ga0209281_1000254	3300027111	Bacteria	105570
556	Ga0209281_1001594	3300027111	Bacteria	12274
557	Ga0209281_1001816	3300027111	Bacteria	10631
558	Ga0209371_1000001	3300027312	Bacteria	2771503
559	Ga0209371_1000026	3300027312	Bacteria	449205
560	Ga0209371_1000104	3300027312	Bacteria	148080
561	Ga0209371_1000117	3300027312	Bacteria	134858
562	Ga0209371_1000146	3300027312	Bacteria	115378
563	Ga0209371_1000705	3300027312	Bacteria	28306
564	Ga0209371_1001777	3300027312	Bacteria	13522
565	Ga0209371_1004678	3300027312	Bacteria	5816
566	Ga0209371_1006595	3300027312	Bacteria	4260
567	Ga0209371_1006917	3300027312	Bacteria	4081
568	Ga0209371_1013741	3300027312	Bacteria	2253
569	Ga0209371_1033238	3300027312	Bacteria	1103
570	Ga0209371_1038835	3300027312	Bacteria	979
571	Ga0209371_1043301	3300027312	Bacteria	901
572	Ga0209968_1022728	3300027526	Bacteria	1024
573	Ga0209282_1000865	3300027666	Bacteria	15655
574	Ga0209813_10160704	3300027866	Bacteria	810
575	Ga0209974_10011634	3300027876	Bacteria	2953
576	Ga0268266_10000084	3300028379	Bacteria	201874
577	Ga0268265_10231755	3300028380	Bacteria	1623
578	Ga0268265_11803010	3300028380	Bacteria	618
579	Ga0268264_10232847	3300028381	Bacteria	1702
580	Ga0307515_10004876	3300028794	Bacteria	27436
581	Ga0307515_10314636	3300028794	Bacteria	1237
582	Ga0268256_1000001	3300030500	Bacteria	2771065
583	Ga0268256_1000003	3300030500	Bacteria	1289401
584	Ga0268256_1000017	3300030500	Bacteria	600718
585	Ga0268256_1000117	3300030500	Bacteria	115176
586	Ga0268256_1000604	3300030500	Bacteria	28306
587	Ga0268256_1001561	3300030500	Bacteria	13437
588	Ga0268256_1003368	3300030500	Bacteria	7251
589	Ga0268256_1004439	3300030500	Bacteria	5816
590	Ga0268256_1012516	3300030500	Bacteria	2620
591	Ga0268256_1012912	3300030500	Bacteria	2559
592	Ga0268256_1019300	3300030500	Bacteria	1870
593	Ga0268256_1028958	3300030500	Bacteria	1360
594	Ga0268256_1037766	3300030500	Bacteria	1103
595	Ga0268256_1044123	3300030500	Bacteria	979
596	Ga0307512_10151814	3300030522	Bacteria	1383
597	Ga0316177_1199377	3300030731	Bacteria	3499
598	Ga0316176_1085736	3300030732	Bacteria	1215
599	Ga0316176_1190235	3300030732	Bacteria	931
600	Ga0314311_1117136	3300030733	Bacteria	1367
601	Ga0316178_1180757	3300030735	Bacteria	761
602	Ga0316180_1104604	3300030736	Bacteria	2131
603	Ga0316183_1024186	3300030742	Bacteria	1899
604	Ga0316183_1099097	3300030742	Bacteria	657
605	Ga0316181_1067199	3300030744	Bacteria	3996
606	Ga0316181_1200809	3300030744	Bacteria	614
607	Ga0316181_1206391	3300030744	Bacteria	1105
608	Ga0316182_1067857	3300030745	Bacteria	1450
609	Ga0316182_1114148	3300030745	Bacteria	820
610	Ga0265327_10004992	3300031251	Bacteria	11381
611	Ga0265327_10158551	3300031251	Bacteria	1047
612	Ga0307513_10085877	3300031456	Bacteria	3228
613	Ga0307408_100005734	3300031548	Bacteria	8275
614	Ga0307408_100135183	3300031548	Bacteria	1928
615	Ga0307408_100144703	3300031548	Bacteria	1869
616	Ga0307408_100231855	3300031548	Bacteria	1512
617	Ga0307508_10410972	3300031616	Bacteria	945
618	Ga0265314_10067108	3300031711	Bacteria	2418
619	Ga0307516_10016377	3300031730	Bacteria	7754
620	Ga0307405_10058285	3300031731	Bacteria	2429
621	Ga0307405_10099762	3300031731	Bacteria	1944
622	Ga0307405_10282796	3300031731	Bacteria	1249
623	Ga0316577_10388970	3300031733	Bacteria	792
624	Ga0307406_10124978	3300031901	Bacteria	1795
625	Ga0307406_11111633	3300031901	Bacteria	683
626	Ga0307406_11494119	3300031901	Bacteria	594
627	Ga0307406_11875082	3300031901	Bacteria	534
628	Ga0307412_10006128	3300031911	Bacteria	6776
629	Ga0307412_10014115	3300031911	Bacteria	4703
630	Ga0307412_10232427	3300031911	Bacteria	1420
631	Ga0307412_10333632	3300031911	Bacteria	1211
632	Ga0307412_10644750	3300031911	Bacteria	903
633	Ga0307412_11869218	3300031911	Bacteria	553
634	Ga0307409_100778066	3300031995	Bacteria	963
635	Ga0307409_101006114	3300031995	Bacteria	852
636	Ga0307416_100086454	3300032002	Bacteria	2673
637	Ga0307416_100175639	3300032002	Bacteria	2000
638	Ga0307416_100215460	3300032002	Bacteria	1836
639	Ga0307414_10134096	3300032004	Bacteria	1927
640	Ga0307414_10744156	3300032004	Bacteria	890
641	Ga0307411_10066307	3300032005	Bacteria	2425
642	Ga0307411_10142249	3300032005	Bacteria	1770
643	Ga0307411_10379265	3300032005	Bacteria	1162
644	Ga0316583_10014588	3300032133	Bacteria	2832
645	Ga0373950_0048289	3300034818	Bacteria	831
646	Ga0373934_0352033	3300035086	Bacteria	613
647	Ga0373955_0123144	3300035172	Bacteria	1509
648	Ga0373935_0450464	3300035692	Bacteria	930
649	Ga0373935_0586735	3300035692	Bacteria	814
650	Ga0373935_0982382	3300035692	Bacteria	627
651	Ga0373933_0030586	3300035724	Bacteria	3118
652	Ga0373933_0155026	3300035724	Bacteria	1452
653	Ga0373947_0145613	3300035725	Bacteria	1523
654	Ga0373947_0799819	3300035725	Bacteria	644
655	Ga0373937_0040815	3300036401	Bacteria	4231
656	Ga0373937_0144639	3300036401	Bacteria	2225
657	Ga0373925_0194663	3300037068	Bacteria	1610
658	Ga0373925_1033848	3300037068	Bacteria	676
659	Ga0395899_0076269	3300037312	Bacteria	2447
660	Ga0395899_0116097	3300037312	Bacteria	1921
661	Ga0395900_0059363	3300037418	Bacteria	3937
662	Ga0395900_1249769	3300037418	Bacteria	657
663	Ga0395898_0092344	3300037466	Bacteria	2911
664	Ga0395905_0073746	3300037471	Bacteria	3199
665	Ga0395901_0261376	3300038443	Bacteria	1801
666	Ga0395901_0531034	3300038443	Bacteria	1194
667	Ga0400484_02508	3300038725	Bacteria	13345
668	Ga0400484_04287	3300038725	Bacteria	14642
669	Ga0400490_03454	3300038726	Bacteria	16050
670	Ga0400490_11410	3300038726	Bacteria	7924
671	Ga0400490_23331	3300038726	Bacteria	12896
672	Ga0400490_53058	3300038726	Bacteria	4264
673	Ga0400490_58419	3300038726	Bacteria	8141
674	Ga0400491_10453	3300038727	Bacteria	3642
675	Ga0400485_05571	3300038735	Bacteria	2132
676	Ga0400485_19140	3300038735	Bacteria	107256
677	Ga0400485_21767	3300038735	Bacteria	1544
678	Ga0400488_29806	3300038741	Bacteria	2564
679	Ga0400488_33920	3300038741	Unclassified	4062
680	Ga0400488_34747	3300038741	Bacteria	7587
681	Ga0400488_39496	3300038741	Bacteria	3507
682	Ga0400488_57055	3300038741	Bacteria	6358
683	Ga0400486_02256	3300038742	Bacteria	123491
684	Ga0400486_02707	3300038742	Bacteria	3898
685	Ga0400486_22467	3300038742	Bacteria	1519
686	Ga0400483_004489	3300039062	Bacteria	3503
687	Ga0400483_020413	3300039062	Bacteria	15133
688	Ga0400483_048196	3300039062	Bacteria	1307
689	Ga0400483_061370	3300039062	Bacteria	11563
690	Ga0400483_072698	3300039062	Bacteria	2337
691	Ga0400483_082901	3300039062	Bacteria	4142
692	Ga0400483_171467	3300039062	Bacteria	2322
693	Ga0400483_195769	3300039062	Bacteria	6086
694	Ga0400483_222618	3300039062	Bacteria	1066
695	Ga0400483_226644	3300039062	Bacteria	7110
696	Ga0400483_254298	3300039062	Bacteria	23676
697	Ga0400483_272990	3300039062	Bacteria	5784
698	Ga0400489_32607	3300039093	Bacteria	2581
699	Ga0400487_19579	3300039110	Bacteria	116630
700	Ga0400487_62873	3300039110	Bacteria	12609
701	Ga0436365_1279401	3300039437	Bacteria	294819
702	Ga0439436_0002501	3300041404	Bacteria	5531
703	Ga0439436_0009176	3300041404	Bacteria	3034
704	Ga0439438_000020	3300041405	Bacteria	111381
705	Ga0439439_0002820	3300041406	Bacteria	3750
706	Ga0439439_0032276	3300041406	Bacteria	1337
707	Ga0439447_008336	3300041407	Bacteria	3215
708	Ga0439447_068696	3300041407	Bacteria	826
709	Ga0439461_0005954	3300041410	Bacteria	2107
710	Ga0439466_0013654	3300041411	Bacteria	2971
711	Ga0439466_0031442	3300041411	Bacteria	1815
712	Ga0439465_0003308	3300041413	Bacteria	5263
713	Ga0451791_0346089	3300041451	Bacteria	867
714	Ga0451791_1851378	3300041451	Bacteria	927
715	Ga0451793_0805557	3300041452	Bacteria	687
716	Ga0451795_0364027	3300041456	Bacteria	1151
717	Ga0451798_0398128	3300041458	Bacteria	766
718	Ga0451807_2010214	3300041486	Bacteria	908
719	Ga0451807_2487469	3300041486	Bacteria	771
720	Ga0451837_0022599	3300041494	Bacteria	871
721	Ga0451839_0023251	3300041496	Bacteria	1310
722	Ga0451839_1172020	3300041496	Bacteria	741
723	Ga0451841_1240371	3300041498	Bacteria	2193
724	Ga0451851_0478896	3300041507	Bacteria	1539
725	Ga0451851_0676229	3300041507	Bacteria	1041
726	Ga0451853_0894343	3300041512	Bacteria	802
727	Ga0439442_005589	3300042002	Bacteria	2514
728	Ga0439442_007621	3300042002	Bacteria	2181
729	Ga0439445_0015605	3300042004	Bacteria	1862
730	Ga0439432_001051	3300042006	Bacteria	10486
731	Ga0439432_001742	3300042006	Bacteria	8137
732	Ga0439432_027746	3300042006	Bacteria	1846
733	Ga0439432_050037	3300042006	Bacteria	1305
734	Ga0439449_0000699	3300042007	Bacteria	12822
735	Ga0439449_0010768	3300042007	Bacteria	3451
736	Ga0439449_0036338	3300042007	Bacteria	1833
737	Ga0439449_0067653	3300042007	Bacteria	1317
738	Ga0439449_0085239	3300042007	Bacteria	1165
739	Ga0439452_000003	3300042010	Bacteria	942815
740	Ga0439452_000017	3300042010	Bacteria	324897
741	Ga0439452_000027	3300042010	Bacteria	206086
742	Ga0439452_000033	3300042010	Bacteria	178345
743	Ga0439452_000380	3300042010	Bacteria	26638
744	Ga0439452_001990	3300042010	Bacteria	7821
745	Ga0439452_004879	3300042010	Bacteria	4402
746	Ga0439452_005876	3300042010	Bacteria	3906
747	Ga0439457_004309	3300042014	Bacteria	3736
748	Ga0439457_007023	3300042014	Bacteria	2720
749	Ga0439462_0010819	3300042015	Bacteria	2315
750	Ga0439462_0018960	3300042015	Bacteria	1789
751	Ga0450894_001501	3300042131	Bacteria	3320
752	Ga0450896_021061	3300042133	Bacteria	957
753	Ga0450898_003065	3300042134	Bacteria	2370
754	Ga0450906_007115	3300042145	Bacteria	2221
755	Ga0439446_0040380	3300042156	Bacteria	1373
756	Ga0450908_004294	3300042184	Bacteria	2749
757	Ga0439434_0004348	3300042435	Bacteria	4144
758	Ga0439434_0006299	3300042435	Bacteria	3461
759	Ga0439464_0009404	3300042439	Bacteria	2573
760	Ga0450918_002310	3300042531	Bacteria	3606
761	Ga0451577_0360685	3300042876	Bacteria	1318
762	Ga0453683_0018577	3300044673	Bacteria	4462
763	Ga0453683_0282081	3300044673	Bacteria	1061
764	Ga0453683_0295169	3300044673	Bacteria	1036
765	Ga0466965_0291012	3300044683	Bacteria	884
766	Ga0466957_0081224	3300044842	Bacteria	2019
767	Ga0451576_0012525	3300045051	Bacteria	9521
768	Ga0495591_000028	3300046458	Bacteria	182419
769	Ga0495591_000400	3300046458	Bacteria	36303
770	Ga0495650_0000016	3300046471	Bacteria	554693
771	Ga0495650_0000205	3300046471	Bacteria	128197
772	Ga0495650_0086204	3300046471	Bacteria	1202
773	Ga0495639_0004727	3300046475	Bacteria	5855
774	Ga0495594_0002812	3300046499	Bacteria	9038
775	Ga0495610_0013658	3300046512	Bacteria	4816
776	Ga0495616_0001807	3300046513	Bacteria	14509
777	Ga0495620_0012871	3300046515	Bacteria	4300
778	Ga0495620_0034478	3300046515	Bacteria	2286
779	Ga0495631_0001107	3300046518	Bacteria	16736
780	Ga0495637_0011316	3300046520	Bacteria	4291
781	Ga0495637_0032063	3300046520	Bacteria	2318
782	Ga0495663_0015540	3300046525	Bacteria	2144
783	Ga0495642_0012170	3300046528	Bacteria	3315
784	Ga0495654_0000032	3300046530	Bacteria	205780
785	Ga0495654_0080254	3300046530	Bacteria	1531
786	Ga0495654_0102468	3300046530	Bacteria	1316
787	Ga0495621_0003254	3300046539	Bacteria	4464
788	Ga0495621_0097936	3300046539	Bacteria	1113
789	Ga0495597_0000053	3300046542	Bacteria	95455
790	Ga0495645_0128011	3300046543	Bacteria	1782
791	Ga0495656_0000042	3300046615	Bacteria	62167
792	Ga0495656_0026358	3300046615	Bacteria	2313
793	Ga0495656_0082198	3300046615	Bacteria	1456
794	Ga0495668_0076083	3300046616	Bacteria	1843
795	Ga0495625_0000292	3300046660	Bacteria	77369
796	Ga0495625_0015183	3300046660	Bacteria	6112
797	Ga0495625_0060870	3300046660	Bacteria	2673
798	Ga0495625_0096360	3300046660	Bacteria	2038
799	Ga0495635_0035556	3300046663	Bacteria	3454
800	Ga0495659_0264136	3300046664	Bacteria	720
801	Ga0495588_0032656	3300046674	Bacteria	2624
802	Ga0495588_0055894	3300046674	Bacteria	2037
803	Ga0495588_0079411	3300046674	Bacteria	1712
804	Ga0495588_0084865	3300046674	Bacteria	1655
805	Ga0495599_0279480	3300046678	Bacteria	1012
806	Ga0495658_0315510	3300046683	Bacteria	990
807	Ga0495658_0443929	3300046683	Bacteria	828
808	Ga0495669_0037735	3300046684	Bacteria	2139
809	Ga0495624_0088241	3300046690	Bacteria	1915
810	Ga0495624_0482250	3300046690	Bacteria	742
811	Ga0495670_0139089	3300046691	Bacteria	1269
812	Ga0495671_0000735	3300046692	Bacteria	23606
813	Ga0495600_0682373	3300046809	Bacteria	619
814	Ga0495660_0000007	3300046810	Bacteria	485295
815	Ga0495581_0018478	3300047315	Bacteria	4050
816	Ga0495636_0096360	3300047318	Bacteria	1290
817	Ga0495672_0000027	3300047320	Bacteria	325651
818	Ga0495676_0035241	3300047321	Bacteria	4187
819	Ga0495676_0279302	3300047321	Bacteria	1131
820	Ga0495677_0107658	3300047445	Bacteria	1058
821	Ga0495677_0154958	3300047445	Bacteria	883
822	Ga0495679_000019	3300047446	Bacteria	231072
823	Ga0495685_129169	3300047447	Bacteria	827
824	Ga0495681_0141812	3300047470	Bacteria	1014
825	Ga0495593_0023102	3300047673	Bacteria	3459
826	Ga0495614_0007335	3300048089	Bacteria	4911
827	Ga0495615_0002882	3300048090	Bacteria	2816
828	Ga0495615_0005659	3300048090	Bacteria	2262
829	Ga0496100_1032960	3300048903	Bacteria	647
830	Ga0496101_0000312	3300048904	Bacteria	33697
831	Ga0496101_0034397	3300048904	Bacteria	3578
832	Ga0496102_0098618	3300048905	Bacteria	2711
833	Ga0496104_0001737	3300048907	Bacteria	18812
834	Ga0496104_0016743	3300048907	Bacteria	6665
835	Ga0496104_0427454	3300048907	Bacteria	1236
836	Ga0496105_0026299	3300048908	Bacteria	4746
837	Ga0496106_0042441	3300048909	Bacteria	3411
838	Ga0496107_0559655	3300048910	Bacteria	846
839	Ga0496109_0608066	3300048912	Bacteria	1029
840	Ga0496109_0758754	3300048912	Bacteria	908
841	Ga0496110_0106959	3300048913	Bacteria	2510
842	Ga0496111_0055644	3300048914	Bacteria	2862
843	Ga0496113_0301475	3300048916	Bacteria	1283
844	Ga0496114_0104648	3300048917	Bacteria	2420
845	Ga0496116_0000054	3300048919	Bacteria	289010
846	Ga0496116_0000222	3300048919	Bacteria	106214
847	Ga0496116_0001374	3300048919	Bacteria	27477
848	Ga0496116_0003616	3300048919	Bacteria	15203
849	Ga0496116_0005691	3300048919	Bacteria	11463
850	Ga0496116_0019803	3300048919	Bacteria	5138
851	Ga0496116_0025043	3300048919	Bacteria	4397
852	Ga0496116_0034066	3300048919	Bacteria	3601
853	Ga0496116_0075943	3300048919	Bacteria	2107
854	Ga0496116_0321967	3300048919	Bacteria	723
855	Ga0496117_0000212	3300048920	Bacteria	112241
856	Ga0496117_0003590	3300048920	Bacteria	17899
857	Ga0496117_0009882	3300048920	Bacteria	8784
858	Ga0496117_0011795	3300048920	Bacteria	7783
859	Ga0496117_0012896	3300048920	Bacteria	7327
860	Ga0496117_0014834	3300048920	Bacteria	6686
861	Ga0496117_0050000	3300048920	Bacteria	2967
862	Ga0496117_0144561	3300048920	Bacteria	1418
863	Ga0496118_0007529	3300048921	Bacteria	11504
864	Ga0496118_0013584	3300048921	Bacteria	7686
865	Ga0496118_0054249	3300048921	Bacteria	3037
866	Ga0496118_0054558	3300048921	Bacteria	3025
867	Ga0496118_0092886	3300048921	Bacteria	2069
868	Ga0496118_0122385	3300048921	Bacteria	1692
869	Ga0496118_0147475	3300048921	Bacteria	1478
870	Ga0496119_0000062	3300048922	Bacteria	171150
871	Ga0496119_0000078	3300048922	Bacteria	140556
872	Ga0496119_0001296	3300048922	Bacteria	30892
873	Ga0496119_0003948	3300048922	Bacteria	15021
874	Ga0496119_0004778	3300048922	Bacteria	13299
875	Ga0496119_0005638	3300048922	Bacteria	11889
876	Ga0496119_0005640	3300048922	Bacteria	11888
877	Ga0496119_0024909	3300048922	Bacteria	4193
878	Ga0496119_0029043	3300048922	Bacteria	3760
879	Ga0496119_0178025	3300048922	Bacteria	1117
880	Ga0496120_0000009	3300048923	Bacteria	386727
881	Ga0496120_0000265	3300048923	Bacteria	87441
882	Ga0496120_0001771	3300048923	Bacteria	24313
883	Ga0496120_0002766	3300048923	Bacteria	17084
884	Ga0496120_0003019	3300048923	Bacteria	15937
885	Ga0496120_0005166	3300048923	Bacteria	10540
886	Ga0496120_0016058	3300048923	Bacteria	4908
887	Ga0496120_0020055	3300048923	Bacteria	4259
888	Ga0496120_0024374	3300048923	Bacteria	3774
889	Ga0496120_0276711	3300048923	Bacteria	777
890	Ga0496121_0012828	3300048924	Bacteria	9070
891	Ga0496121_0038903	3300048924	Bacteria	4202
892	Ga0496121_0106905	3300048924	Bacteria	2144
893	Ga0496122_0000013	3300048925	Bacteria	501039
894	Ga0496122_0000145	3300048925	Bacteria	165864
895	Ga0496122_0000450	3300048925	Bacteria	85686
896	Ga0496122_0000925	3300048925	Bacteria	53549
897	Ga0496122_0002833	3300048925	Bacteria	23772
898	Ga0496122_0019764	3300048925	Bacteria	6136
899	Ga0496122_0042799	3300048925	Bacteria	3557
900	Ga0496122_0128658	3300048925	Bacteria	1615
901	Ga0496123_0000010	3300048926	Bacteria	501039
902	Ga0496123_0000176	3300048926	Bacteria	130010
903	Ga0496123_0000281	3300048926	Bacteria	100416
904	Ga0496123_0002523	3300048926	Bacteria	22467
905	Ga0496123_0002705	3300048926	Bacteria	21301
906	Ga0496123_0003026	3300048926	Bacteria	19380
907	Ga0496123_0017984	3300048926	Bacteria	5655
908	Ga0496123_0023107	3300048926	Bacteria	4769
909	Ga0496123_0157365	3300048926	Bacteria	1216
910	Ga0496124_0000010	3300048927	Bacteria	595157
911	Ga0496124_0000122	3300048927	Bacteria	161741
912	Ga0496124_0022345	3300048927	Bacteria	5799
913	Ga0496124_0023295	3300048927	Bacteria	5655
914	Ga0496124_0036058	3300048927	Bacteria	4319
915	Ga0496124_0055432	3300048927	Bacteria	3350
916	Ga0496124_0068091	3300048927	Bacteria	2960
917	Ga0496124_0099924	3300048927	Bacteria	2352
918	Ga0496124_0103461	3300048927	Bacteria	2303
919	Ga0496124_0128800	3300048927	Bacteria	2013
920	Ga0496124_0167568	3300048927	Bacteria	1705
921	Ga0496125_0000019	3300048928	Bacteria	474989
922	Ga0496125_0000413	3300048928	Bacteria	79797
923	Ga0496125_0008018	3300048928	Bacteria	11151
924	Ga0496125_0011475	3300048928	Bacteria	8858
925	Ga0496125_0023106	3300048928	Bacteria	5751
926	Ga0496125_0198002	3300048928	Bacteria	1319
927	Ga0496126_0000975	3300048929	Bacteria	49068
928	Ga0496126_0003059	3300048929	Bacteria	21675
929	Ga0496126_0006169	3300048929	Bacteria	13418
930	Ga0496126_0039228	3300048929	Bacteria	4396
931	Ga0496126_0045894	3300048929	Bacteria	4012
932	Ga0496126_0142232	3300048929	Bacteria	2064
933	Ga0496126_0159487	3300048929	Bacteria	1928
934	Ga0496126_0725667	3300048929	Bacteria	770
935	Ga0501317_067326	3300049533	Bacteria	598
936	Ga0501031_0003705	3300049568	Bacteria	9831
937	Ga0501031_0492714	3300049568	Bacteria	790
938	Ga0501032_0023813	3300049569	Bacteria	4228
939	Ga0501034_0078571	3300049571	Bacteria	3304
940	Ga0501037_0004572	3300049573	Bacteria	10057
941	Ga0501037_0063245	3300049573	Bacteria	2698
942	Ga0501037_0092255	3300049573	Bacteria	2190
943	Ga0501038_0038135	3300049574	Bacteria	4209
944	Ga0501039_1053791	3300049575	Bacteria	631
945	Ga0501040_0178297	3300049576	Bacteria	1506
946	Ga0501041_0207923	3300049577	Bacteria	1227
947	Ga0501042_0009983	3300049578	Bacteria	6347
948	Ga0501042_0010383	3300049578	Bacteria	6241
949	Ga0501046_0028555	3300049580	Bacteria	4542
950	Ga0501048_0048495	3300049582	Bacteria	3029
951	Ga0501068_0974329	3300049584	Bacteria	559
952	Ga0501072_0761287	3300049588	Bacteria	759
953	Ga0501076_0023853	3300049592	Bacteria	4720
954	Ga0501211_013205	3300049658	Bacteria	821
955	Ga0501079_0115728	3300049741	Bacteria	2084
956	Ga0501262_001212	3300049759	Bacteria	2918
957	Ga0501265_000061	3300049762	Bacteria	8817
958	Ga0501035_0211524	3300049822	Bacteria	1659
959	Ga0501035_0520275	3300049822	Bacteria	977
960	Ga0501044_0665080	3300049823	Bacteria	929
961	nmdc:mga03683_114048_c1	3300050489	Bacteria	1197
962	nmdc:mga03683_299661_c1	3300050489	Bacteria	754
963	nmdc:mga03683_391800_c1	3300050489	Bacteria	662
964	nmdc:mga03683_515932_c1	3300050489	Bacteria	580
965	nmdc:mga03n38_10292_c1	3300050490	Bacteria	3433
966	nmdc:mga03n38_311900_c1	3300050490	Bacteria	847
967	nmdc:mga03n38_396573_c1	3300050490	Bacteria	759
968	nmdc:mga00v17_179097_c1	3300050491	Bacteria	1368
969	nmdc:mga00v17_214816_c1	3300050491	Bacteria	1245
970	nmdc:mga00v17_24927_c1	3300050491	Bacteria	3472
971	nmdc:mga00v17_453977_c1	3300050491	Bacteria	832
972	nmdc:mga00v17_9935_c1	3300050491	Bacteria	5177
973	nmdc:mga0yw44_108596_c1	3300050492	Bacteria	1776
974	nmdc:mga0yw44_996993_c1	3300050492	Bacteria	567
975	nmdc:mga0k408_123357_c1	3300050493	Bacteria	1535
976	nmdc:mga0k408_140962_c1	3300050493	Bacteria	1434
977	nmdc:mga0k408_15702_c1	3300050493	Bacteria	4192
978	nmdc:mga0k408_2422_c1	3300050493	Bacteria	6328
979	nmdc:mga0k408_71739_c1	3300050493	Bacteria	2022
980	nmdc:mga0k408_75849_c1	3300050493	Bacteria	1965
981	nmdc:mga06z11_127155_c1	3300050494	Bacteria	1427
982	nmdc:mga06z11_76629_c1	3300050494	Bacteria	1783
983	nmdc:mga07m45_12087_c1	3300050496	Bacteria	4555
984	nmdc:mga07m45_144304_c1	3300050496	Bacteria	1379
985	nmdc:mga07m45_17177_c1	3300050496	Bacteria	3881
986	nmdc:mga07m45_182614_c1	3300050496	Bacteria	1220
987	nmdc:mga07m45_61819_c1	3300050496	Bacteria	2122
988	nmdc:mga07m45_679_c1	3300050496	Bacteria	14453
989	nmdc:mga07m45_9696_c1	3300050496	Bacteria	5005
990	nmdc:mga05p37_32994_c2	3300050507	Bacteria	5270
991	nmdc:mga0qj67_40085_c1	3300050509	Bacteria	3681
992	nmdc:mga0a205_541352_c1	3300050515	Bacteria	1020
993	nmdc:mga0sz30_20000_c1	3300050516	Bacteria	2696
994	Ga0495619_0086645	3300053085	Bacteria	2117
995	Ga0495619_0164432	3300053085	Bacteria	1533
996	Ga0500643_048836	3300053087	Bacteria	1215
997	Ga0500644_0001337	3300053088	Bacteria	6623
998	Ga0500651_0000060	3300053093	Bacteria	71500
999	Ga0500651_0203613	3300053093	Bacteria	1167
1000	Ga0500641_0041501	3300053096	Bacteria	1862
1001	Ga0500650_0195607	3300053098	Bacteria	922
1002	Ga0500555_048355	3300053103	Bacteria	1169
1003	Ga0500555_107347	3300053103	Bacteria	705
1004	Ga0500571_000072	3300053110	Bacteria	31639
1005	Ga0500572_062198	3300053111	Bacteria	1137
1006	Ga0500593_000274	3300053117	Bacteria	21119
1007	Ga0500594_0002589	3300053118	Bacteria	3929
1008	Ga0500597_029480	3300053120	Bacteria	2247
1009	Ga0500607_001318	3300053121	Bacteria	22603
1010	Ga0500608_006152	3300053122	Bacteria	4857
1011	Ga0500626_064851	3300053128	Bacteria	1630
1012	Ga0500628_035094	3300053129	Bacteria	1113
1013	Ga0500628_174850	3300053129	Bacteria	611
1014	Ga0500655_000073	3300053133	Bacteria	26840
1015	Ga0500658_0010338	3300053134	Bacteria	3440
1016	Ga0500568_0000566	3300053139	Bacteria	27162
1017	Ga0500574_000263	3300053141	Bacteria	6398
1018	Ga0500616_0103361	3300053153	Bacteria	1388
1019	Ga0500627_0000611	3300053158	Bacteria	9530
1020	Ga0500634_0088121	3300053161	Bacteria	1582
1021	Ga0500638_025339	3300053162	Bacteria	2835
1022	Ga0500645_000551	3300053730	Bacteria	24776
1023	Ga0500645_002609	3300053730	Bacteria	7900
1024	Ga0500645_021563	3300053730	Bacteria	1988
1025	Ga0590075_038972	3300059424	Bacteria	1213
1026	Ga0590077_044379	3300059426	Bacteria	992
1027	Ga0530510_0411760	3300061734	Bacteria	1020

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300005289	Ga0065704_10382892	Ga0065704_103828921	132
2	3300006051	Ga0075364_10030545	Ga0075364_100305452	132
3	3300050491	nmdc:mga00v17_24927_c1	nmdc:mga00v17_24927_c1_2811_3296	132
4	3300038742	Ga0400486_22467	Ga0400486_22467_1099_1506	133
5	3300037068	Ga0373925_1033848	Ga0373925_1033848_18_473	134
6	3300041456	Ga0451795_0364027	Ga0451795_0364027_432_917	139
7	3300005438	Ga0070701_10000541	Ga0070701_100005417	140
8	3300005544	Ga0070686_100000283	Ga0070686_1000002831	140
9	3300035086	Ga0373934_0352033	Ga0373934_0352033_128_583	140
10	3300035724	Ga0373933_0155026	Ga0373933_0155026_985_1440	140
11	3300041451	Ga0451791_0346089	Ga0451791_0346089_93_578	140
12	3300041486	Ga0451807_2487469	Ga0451807_2487469_82_567	140
13	3300041494	Ga0451837_0022599	Ga0451837_0022599_63_548	140
14	3300050489	nmdc:mga03683_391800_c1	nmdc:mga03683_391800_c1_10_495	140
15	3300041496	Ga0451839_0023251	Ga0451839_0023251_792_1277	141
16	3300041507	Ga0451851_0478896	Ga0451851_0478896_821_1306	141
17	3300053129	Ga0500628_174850	Ga0500628_174850_93_578	141
18	3300049578	Ga0501042_0009983	Ga0501042_0009983_2620_3174	142
19	3300053096	Ga0500641_0041501	Ga0500641_0041501_190_675	142
20	3300053103	Ga0500555_107347	Ga0500555_107347_71_556	142
21	3300053730	Ga0500645_021563	Ga0500645_021563_289_774	142
22	3300061734	Ga0530510_0411760	Ga0530510_0411760_254_901	142
23	3300002705	JGI25156J39149_1000006	JGI25156J39149_1000006105	143
24	3300002738	JGI25154J39366_1000015	JGI25154J39366_1000015141	143
25	3300002741	JGI25157J39369_1000016	JGI25157J39369_100001676	143
26	3300002987	JGI25159J45721_1002274	JGI25159J45721_10022745	143
27	3300002987	JGI25159J45721_1004021	JGI25159J45721_10040212	143
28	3300003354	JGI25160J50197_1000689	JGI25160J50197_100068919	143
29	3300003374	JGI25161J50226_1000008	JGI25161J50226_1000008237	143
30	3300003773	Ga0055537_1000383	Ga0055537_10003839	143
31	3300003775	Ga0055524_1000107	Ga0055524_1000107100	143
32	3300003781	Ga0055536_1014563	Ga0055536_10145632	143
33	3300003784	Ga0055534_1000807	Ga0055534_10008072	143
34	3300003790	Ga0055528_1001212	Ga0055528_100121212	143
35	3300003791	Ga0055530_10000121	Ga0055530_1000012157	143
36	3300003791	Ga0055530_10043619	Ga0055530_100436192	143
37	3300003792	Ga0055540_1000021	Ga0055540_1000021201	143
38	3300004625	Ga0055543_1000259	Ga0055543_10002595	143
39	3300005458	Ga0070681_10208715	Ga0070681_102087152	143
40	3300005530	Ga0070679_100075124	Ga0070679_1000751243	143
41	3300005719	Ga0068861_100464330	Ga0068861_1004643302	143
42	3300006051	Ga0075364_10093401	Ga0075364_100934013	143
43	3300006195	Ga0075366_10261847	Ga0075366_102618472	143
44	3300006353	Ga0075370_10204719	Ga0075370_102047192	143
45	3300006948	Ga0099826_10147807	Ga0099826_101478072	143
46	3300012513	Ga0157326_1004291	Ga0157326_10042912	143
47	3300014326	Ga0157380_11710622	Ga0157380_117106221	143
48	3300025206	Ga0209435_100010	Ga0209435_100010115	143
49	3300025208	Ga0209436_108739	Ga0209436_1087391	143
50	3300025245	Ga0207425_1018823	Ga0207425_10188232	143
51	3300025246	Ga0209646_1000001	Ga0209646_10000012027	143
52	3300025250	Ga0209026_1000001	Ga0209026_1000001682	143
53	3300025256	Ga0209759_1000001	Ga0209759_10000011658	143
54	3300025258	Ga0209129_1034136	Ga0209129_10341362	143
55	3300025263	Ga0209565_1000102	Ga0209565_100010225	143
56	3300025263	Ga0209565_1000953	Ga0209565_10009539	143
57	3300025273	Ga0209673_1000189	Ga0209673_100018990	143
58	3300025284	Ga0209130_1000186	Ga0209130_100018690	143
59	3300025284	Ga0209130_1000401	Ga0209130_100040110	143
60	3300025291	Ga0209675_1000503	Ga0209675_100050321	143
61	3300025291	Ga0209675_1002829	Ga0209675_10028295	143
62	3300025292	Ga0209676_1000069	Ga0209676_100006997	143
63	3300025292	Ga0209676_1006618	Ga0209676_10066186	143
64	3300025294	Ga0209025_1006898	Ga0209025_10068988	143
65	3300025294	Ga0209025_1012138	Ga0209025_10121387	143
66	3300025294	Ga0209025_1059275	Ga0209025_10592752	143
67	3300025294	Ga0209025_1069592	Ga0209025_10695922	143
68	3300025295	Ga0209564_1001104	Ga0209564_100110421	143
69	3300025295	Ga0209564_1001141	Ga0209564_100114123	143
70	3300025298	Ga0209050_1000023	Ga0209050_1000023272	143
71	3300025298	Ga0209050_1005156	Ga0209050_10051564	143
72	3300025298	Ga0209050_1026709	Ga0209050_10267092	143
73	3300025299	Ga0209256_1000003	Ga0209256_1000003989	143
74	3300025302	Ga0207426_1002400	Ga0207426_10024009	143
75	3300025303	Ga0209051_1000017	Ga0209051_1000017272	143
76	3300025304	Ga0209257_1000041	Ga0209257_1000041272	143
77	3300025304	Ga0209257_1008281	Ga0209257_10082813	143
78	3300025912	Ga0207707_10136948	Ga0207707_101369482	143
79	3300025921	Ga0207652_10045490	Ga0207652_100454904	143
80	3300026041	Ga0207639_10182283	Ga0207639_101822833	143
81	3300031548	Ga0307408_100005734	Ga0307408_1000057347	143
82	3300031901	Ga0307406_10124978	Ga0307406_101249782	143
83	3300041486	Ga0451807_2010214	Ga0451807_2010214_123_608	143
84	3300050493	nmdc:mga0k408_123357_c1	nmdc:mga0k408_123357_c1_838_1323	143
85	3300053088	Ga0500644_0001337	Ga0500644_0001337_773_1258	143
86	3300053098	Ga0500650_0195607	Ga0500650_0195607_161_646	143
87	3300053117	Ga0500593_000274	Ga0500593_000274_7672_8157	143
88	3300053730	Ga0500645_000551	Ga0500645_000551_14516_15001	143
89	3300053730	Ga0500645_002609	Ga0500645_002609_7202_7687	143
90	3300005615	Ga0070702_100064536	Ga0070702_1000645362	144
91	3300006173	Ga0070716_100017352	Ga0070716_1000173525	144
92	3300006358	Ga0068871_101193010	Ga0068871_1011930101	144
93	3300006914	Ga0075436_100039269	Ga0075436_1000392694	144
94	3300013297	Ga0157378_10124268	Ga0157378_101242683	144
95	3300025939	Ga0207665_10046067	Ga0207665_100460673	144
96	3300031901	Ga0307406_11111633	Ga0307406_111116332	144
97	3300044683	Ga0466965_0291012	Ga0466965_0291012_200_697	144
98	3300050496	nmdc:mga07m45_144304_c1	nmdc:mga07m45_144304_c1_200_685	144
99	3300031711	Ga0265314_10067108	Ga0265314_100671083	145
100	3300044673	Ga0453683_0018577	Ga0453683_0018577_1412_1897	145
101	3300045051	Ga0451576_0012525	Ga0451576_0012525_3343_3828	145
102	3300035692	Ga0373935_0450464	Ga0373935_0450464_377_874	146
103	3300035692	Ga0373935_0586735	Ga0373935_0586735_22_477	146
104	3300035692	Ga0373935_0982382	Ga0373935_0982382_94_591	146
105	3300037068	Ga0373925_0194663	Ga0373925_0194663_91_588	146
106	3300005337	Ga0070682_101087090	Ga0070682_1010870901	147
107	3300010375	Ga0105239_11499098	Ga0105239_114990981	147
108	3300003187	JGI25151J46595_10002241	JGI25151J46595_1000224113	148
109	3300042010	Ga0439452_001990	Ga0439452_001990_2052_2510	148
110	3300005530	Ga0070679_100589071	Ga0070679_1005890712	149
111	3300013105	Ga0157369_10057750	Ga0157369_100577504	149
112	3300038735	Ga0400485_21767	Ga0400485_21767_1071_1526	149
113	3300049576	Ga0501040_0178297	Ga0501040_0178297_10_465	149
114	3300005471	Ga0070698_100961742	Ga0070698_1009617422	150
115	3300006173	Ga0070716_100096018	Ga0070716_1000960181	150
116	3300006881	Ga0068865_100553970	Ga0068865_1005539702	150
117	3300013308	Ga0157375_10540276	Ga0157375_105402762	150
118	3300014969	Ga0157376_10654558	Ga0157376_106545581	150
119	3300025905	Ga0207685_10202705	Ga0207685_102027051	150
120	3300025922	Ga0207646_10128438	Ga0207646_101284381	150
121	3300025939	Ga0207665_10501768	Ga0207665_105017681	150
122	3300035724	Ga0373933_0030586	Ga0373933_0030586_447_944	150
123	3300035725	Ga0373947_0145613	Ga0373947_0145613_534_1031	150
124	3300035725	Ga0373947_0799819	Ga0373947_0799819_130_627	150
125	3300036401	Ga0373937_0040815	Ga0373937_0040815_495_992	150
126	3300036401	Ga0373937_0144639	Ga0373937_0144639_309_806	150
127	3300046539	Ga0495621_0097936	Ga0495621_0097936_157_609	150
128	3300046690	Ga0495624_0482250	Ga0495624_0482250_189_686	150
129	3300047315	Ga0495581_0018478	Ga0495581_0018478_1969_2466	150
130	3300048912	Ga0496109_0758754	Ga0496109_0758754_306_791	150
131	3300005330	Ga0070690_100000490	Ga0070690_10000049020	151
132	3300005340	Ga0070689_100000090	Ga0070689_10000009031	151
133	3300005341	Ga0070691_10080390	Ga0070691_100803902	151
134	3300005343	Ga0070687_100003928	Ga0070687_1000039282	151
135	3300005365	Ga0070688_100000135	Ga0070688_10000013534	151
136	3300005441	Ga0070700_100000257	Ga0070700_10000025723	151
137	3300005444	Ga0070694_100170258	Ga0070694_1001702582	151
138	3300005459	Ga0068867_100024615	Ga0068867_1000246153	151
139	3300005466	Ga0070685_10000073	Ga0070685_1000007345	151
140	3300005468	Ga0070707_100563342	Ga0070707_1005633421	151
141	3300005518	Ga0070699_100035566	Ga0070699_1000355662	151
142	3300005536	Ga0070697_100123355	Ga0070697_1001233552	151
143	3300005549	Ga0070704_100150596	Ga0070704_1001505961	151
144	3300005549	Ga0070704_100278825	Ga0070704_1002788251	151
145	3300005617	Ga0068859_100002744	Ga0068859_1000027442	151
146	3300005718	Ga0068866_10146916	Ga0068866_101469163	151
147	3300005842	Ga0068858_100614400	Ga0068858_1006144002	151
148	3300005843	Ga0068860_100271946	Ga0068860_1002719462	151
149	3300006931	Ga0097620_100002744	Ga0097620_1000027442	151
150	3300009148	Ga0105243_10552863	Ga0105243_105528631	151
151	3300009177	Ga0105248_10000232	Ga0105248_1000023258	151
152	3300009551	Ga0105238_10491246	Ga0105238_104912462	151
153	3300013297	Ga0157378_10469896	Ga0157378_104698961	151
154	3300013308	Ga0157375_10866747	Ga0157375_108667471	151
155	3300014326	Ga0157380_10010603	Ga0157380_100106037	151
156	3300017792	Ga0163161_11092024	Ga0163161_110920241	151
157	3300025918	Ga0207662_10086290	Ga0207662_100862901	151
158	3300025934	Ga0207686_10019967	Ga0207686_100199673	151
159	3300025936	Ga0207670_10000032	Ga0207670_1000003249	151
160	3300025938	Ga0207704_10035550	Ga0207704_100355502	151
161	3300025941	Ga0207711_10008574	Ga0207711_100085745	151
162	3300026035	Ga0207703_10406348	Ga0207703_104063482	151
163	3300026075	Ga0207708_10000413	Ga0207708_1000041318	151
164	3300026089	Ga0207648_10008263	Ga0207648_100082633	151
165	3300028381	Ga0268264_10232847	Ga0268264_102328472	151
166	3300035172	Ga0373955_0123144	Ga0373955_0123144_645_1142	151
167	3300003794	Ga0055531_10000774	Ga0055531_1000077422	152
168	3300005295	Ga0065707_10471474	Ga0065707_104714741	152
169	3300028380	Ga0268265_11803010	Ga0268265_118030101	152
170	3300059424	Ga0590075_038972	Ga0590075_038972_151_636	152
171	3300005295	Ga0065707_10024013	Ga0065707_100240132	153
172	3300005334	Ga0068869_100757332	Ga0068869_1007573322	153
173	3300005438	Ga0070701_10271493	Ga0070701_102714932	153
174	3300005438	Ga0070701_10518508	Ga0070701_105185082	153
175	3300005544	Ga0070686_100007285	Ga0070686_1000072853	153
176	3300005546	Ga0070696_100376392	Ga0070696_1003763921	153
177	3300006048	Ga0075363_100412330	Ga0075363_1004123302	153
178	3300006177	Ga0075362_10113148	Ga0075362_101131482	153
179	3300006353	Ga0075370_10000147	Ga0075370_100001475	153
180	3300009176	Ga0105242_11452511	Ga0105242_114525111	153
181	3300013296	Ga0157374_10579531	Ga0157374_105795311	153
182	3300013308	Ga0157375_11618836	Ga0157375_116188361	153
183	3300014326	Ga0157380_10365263	Ga0157380_103652632	153
184	3300025933	Ga0207706_10324153	Ga0207706_103241532	153
185	3300025942	Ga0207689_10737986	Ga0207689_107379861	153
186	3300026088	Ga0207641_11335578	Ga0207641_113355781	153
187	3300030744	Ga0316181_1200809	Ga0316181_12008091	153
188	3300031548	Ga0307408_100144703	Ga0307408_1001447032	153
189	3300031731	Ga0307405_10099762	Ga0307405_100997623	153
190	3300031911	Ga0307412_10014115	Ga0307412_100141153	153
191	3300032002	Ga0307416_100175639	Ga0307416_1001756392	153
192	3300041404	Ga0439436_0002501	Ga0439436_0002501_1126_1611	153
193	3300041406	Ga0439439_0032276	Ga0439439_0032276_614_1099	153
194	3300041411	Ga0439466_0013654	Ga0439466_0013654_1047_1532	153
195	3300042004	Ga0439445_0015605	Ga0439445_0015605_269_754	153
196	3300042007	Ga0439449_0010768	Ga0439449_0010768_1770_2255	153
197	3300042010	Ga0439452_004879	Ga0439452_004879_1744_2229	153
198	3300042014	Ga0439457_007023	Ga0439457_007023_540_1025	153
199	3300042015	Ga0439462_0010819	Ga0439462_0010819_834_1319	153
200	3300042131	Ga0450894_001501	Ga0450894_001501_1718_2203	153
201	3300042133	Ga0450896_021061	Ga0450896_021061_208_693	153
202	3300042134	Ga0450898_003065	Ga0450898_003065_786_1271	153
203	3300042184	Ga0450908_004294	Ga0450908_004294_1467_1952	153
204	3300044673	Ga0453683_0295169	Ga0453683_0295169_167_664	153
205	3300046683	Ga0495658_0315510	Ga0495658_0315510_87_584	153
206	3300050490	nmdc:mga03n38_396573_c1	nmdc:mga03n38_396573_c1_123_608	153
207	3300050493	nmdc:mga0k408_140962_c1	nmdc:mga0k408_140962_c1_47_532	153
208	3300050493	nmdc:mga0k408_71739_c1	nmdc:mga0k408_71739_c1_473_958	153
209	3300050496	nmdc:mga07m45_182614_c1	nmdc:mga07m45_182614_c1_60_545	153
210	3300005295	Ga0065707_10085471	Ga0065707_100854717	154
211	3300005336	Ga0070680_100012882	Ga0070680_1000128823	154
212	3300005345	Ga0070692_10342903	Ga0070692_103429032	154
213	3300005467	Ga0070706_100116317	Ga0070706_1001163172	154
214	3300005468	Ga0070707_100000018	Ga0070707_100000018116	154
215	3300005536	Ga0070697_100021498	Ga0070697_1000214982	154
216	3300005545	Ga0070695_100071493	Ga0070695_1000714932	154
217	3300005549	Ga0070704_100426773	Ga0070704_1004267732	154
218	3300005617	Ga0068859_101202668	Ga0068859_1012026681	154
219	3300006163	Ga0070715_10066960	Ga0070715_100669602	154
220	3300006237	Ga0097621_100191801	Ga0097621_1001918012	154
221	3300006358	Ga0068871_100114998	Ga0068871_1001149982	154
222	3300006931	Ga0097620_101202564	Ga0097620_1012025641	154
223	3300014969	Ga0157376_10165933	Ga0157376_101659332	154
224	3300025905	Ga0207685_10007822	Ga0207685_100078223	154
225	3300025906	Ga0207699_10754714	Ga0207699_107547141	154
226	3300025917	Ga0207660_10012848	Ga0207660_100128484	154
227	3300025922	Ga0207646_10000072	Ga0207646_10000072118	154
228	3300025934	Ga0207686_10673769	Ga0207686_106737691	154
229	3300026089	Ga0207648_11245734	Ga0207648_112457341	154
230	3300027526	Ga0209968_1022728	Ga0209968_10227281	154
231	3300027876	Ga0209974_10011634	Ga0209974_100116341	154
232	3300034818	Ga0373950_0048289	Ga0373950_0048289_186_683	154
233	3300042007	Ga0439449_0085239	Ga0439449_0085239_420_905	154
234	3300042435	Ga0439434_0004348	Ga0439434_0004348_3647_4132	154
235	3300046663	Ga0495635_0035556	Ga0495635_0035556_1740_2237	154
236	3300047321	Ga0495676_0279302	Ga0495676_0279302_555_1052	154
237	3300053085	Ga0495619_0086645	Ga0495619_0086645_621_1118	154
238	3300005331	Ga0070670_102067117	Ga0070670_1020671171	155
239	3300005459	Ga0068867_100748536	Ga0068867_1007485361	155
240	3300006846	Ga0075430_100029694	Ga0075430_1000296943	155
241	3300014497	Ga0182008_10005963	Ga0182008_100059634	155
242	3300015689	Ga0183360_12777	Ga0183360_127771	155
243	3300030732	Ga0316176_1190235	Ga0316176_11902352	155
244	3300031251	Ga0265327_10004992	Ga0265327_100049927	155
245	3300031901	Ga0307406_11494119	Ga0307406_114941191	155
246	3300031911	Ga0307412_10333632	Ga0307412_103336322	155
247	3300041404	Ga0439436_0009176	Ga0439436_0009176_2044_2529	155
248	3300041406	Ga0439439_0002820	Ga0439439_0002820_111_596	155
249	3300041407	Ga0439447_068696	Ga0439447_068696_221_706	155
250	3300041410	Ga0439461_0005954	Ga0439461_0005954_624_1109	155
251	3300041411	Ga0439466_0031442	Ga0439466_0031442_834_1319	155
252	3300041413	Ga0439465_0003308	Ga0439465_0003308_947_1432	155
253	3300042002	Ga0439442_005589	Ga0439442_005589_1344_1829	155
254	3300042006	Ga0439432_001742	Ga0439432_001742_2506_2991	155
255	3300042007	Ga0439449_0000699	Ga0439449_0000699_6666_7151	155
256	3300042010	Ga0439452_005876	Ga0439452_005876_989_1474	155
257	3300042014	Ga0439457_004309	Ga0439457_004309_154_639	155
258	3300042015	Ga0439462_0018960	Ga0439462_0018960_105_590	155
259	3300042156	Ga0439446_0040380	Ga0439446_0040380_266_751	155
260	3300049584	Ga0501068_0974329	Ga0501068_0974329_11_484	155
261	3300050509	nmdc:mga0qj67_40085_c1	nmdc:mga0qj67_40085_c1_1254_1751	155
262	iso_pu_bacteria	2511231025	2511379440	155
263	iso_pu_bacteria	2511231035	2511433895	155
264	iso_pu_bacteria	2547132181	2547697604	155
265	iso_pu_bacteria	2554235234	2555259462	155
266	iso_pu_bacteria	2561511199	2562466249	155
267	iso_pu_bacteria	2585427591	2585826716	155
268	iso_pu_bacteria	2585427592	2585831358	155
269	iso_pu_bacteria	2599185169	2599412041	155
270	iso_pu_bacteria	2599185299	2599927063	155
271	iso_pu_bacteria	2600255254	2601525219	155
272	iso_pu_bacteria	2600255255	2601530406	155
273	iso_pu_bacteria	2600255256	2601531709	155
274	iso_pu_bacteria	2600255257	2601537081	155
275	iso_pu_bacteria	2600255280	2601616990	155
276	iso_pu_bacteria	2600255281	2601621663	155
277	iso_pu_bacteria	2600255287	2601644925	155
278	iso_pu_bacteria	2600255288	2601650613	155
279	iso_pu_bacteria	2600255289	2601654987	155
280	iso_pu_bacteria	2600255290	2601660346	155
281	iso_pu_bacteria	2600255291	2601665105	155
282	iso_pu_bacteria	2600255298	2601697720	155
283	iso_pu_bacteria	2600255299	2601703108	155
284	iso_pu_bacteria	2600255300	2601708193	155
285	iso_pu_bacteria	2600255301	2601713286	155
286	iso_pu_bacteria	2600255302	2601718546	155
287	iso_pu_bacteria	2600255303	2601723269	155
288	iso_pu_bacteria	2600255304	2601728221	155
289	iso_pu_bacteria	2600255305	2601733494	155
290	iso_pu_bacteria	2600255306	2601738205	155
291	iso_pu_bacteria	2600255307	2601742328	155
292	iso_pu_bacteria	2600255309	2601753542	155
293	iso_pu_bacteria	2600255310	2601755427	155
294	iso_pu_bacteria	2600255311	2601760794	155
295	iso_pu_bacteria	2600255392	2602020071	155
296	iso_pu_bacteria	2602042046	2603639162	155
297	iso_pu_bacteria	2602042047	2603643620	155
298	iso_pu_bacteria	2602042052	2603661901	155
299	iso_pu_bacteria	2602042053	2603666799	155
300	iso_pu_bacteria	2602042066	2603700203	155
301	iso_pu_bacteria	2602042067	2603704193	155
302	iso_pu_bacteria	2602042103	2603840607	155
303	iso_pu_bacteria	2602042104	2603845731	155
304	iso_pu_bacteria	2602042105	2603850804	155
305	iso_pu_bacteria	2602042106	2603855824	155
306	iso_pu_bacteria	2602042109	2603866353	155
307	iso_pu_bacteria	2602042110	2603873405	155
308	iso_pu_bacteria	2602042111	2603877545	155
309	iso_pu_bacteria	2603880178	2606050633	155
310	iso_pu_bacteria	2603880184	2606071231	155
311	iso_pu_bacteria	2603880202	2606148317	155
312	iso_pu_bacteria	2603880211	2606178474	155
313	iso_pu_bacteria	2609459761	2609912518	155
314	iso_pu_bacteria	2648501693	2650895591	155
315	iso_pu_bacteria	2667528172	2671102169	155
316	iso_pu_bacteria	2667528173	2671108453	155
317	iso_pu_bacteria	2671180115	2671585314	155
318	iso_pu_bacteria	2675903046	2676407059	155
319	iso_pu_bacteria	2681812866	2681995954	155
320	iso_pu_bacteria	2681812869	2682008972	155
321	iso_pu_bacteria	2684622997	2686355805	155
322	iso_pu_bacteria	2706794495	2707099998	155
323	iso_pu_bacteria	2711768156	2712472782	155
324	iso_pu_bacteria	2751185917	2753854868	155
325	iso_pu_bacteria	2765235842	2765587734	155
326	iso_pu_bacteria	2772190666	2772437568	155
327	iso_pu_bacteria	2775506706	2775541867	155
328	iso_pu_bacteria	2791354903	2791924540	155
329	iso_pu_bacteria	2791355010	2792313669	155
330	iso_pu_bacteria	2791355275	2793406593	155
331	iso_pu_bacteria	2808606414	2809124612	155
332	iso_pu_bacteria	2811995292	2813730205	155
333	iso_pu_bacteria	2814123068	2814697796	155
334	iso_pu_bacteria	2821118458	2821118648	155
335	iso_pu_bacteria	2823373977	2823377150	155
336	iso_pu_bacteria	2844425489	2844426421	155
337	iso_pu_bacteria	2846540461	2846541439	155
338	iso_pu_bacteria	2847085930	2847088774	155
339	iso_pu_bacteria	2847797336	2847800922	155
340	iso_pu_bacteria	2854601825	2854602619	155
341	iso_pu_bacteria	2876601092	2876601311	155
342	iso_pu_bacteria	2884086401	2884090102	155
343	iso_pu_bacteria	2888366609	2888367587	155
344	iso_pu_bacteria	2891670763	2891674870	155
345	iso_pu_bacteria	2904474040	2904474875	155
346	iso_pu_bacteria	2904513164	2904515055	155
347	iso_pu_bacteria	2919108558	2919109902	155
348	iso_pu_bacteria	2919150387	2919151221	155
349	iso_pu_bacteria	2923634449	2923638283	155
350	iso_pu_bacteria	2927143783	2927146095	155
351	iso_pu_bacteria	2927833300	2927835280	155
352	iso_pu_bacteria	2935625433	2935629685	155
353	iso_pu_bacteria	2937539931	2937542843	155
354	iso_pu_bacteria	2937967321	2937972103	155
355	iso_pu_bacteria	2939568625	2939570762	155
356	iso_pu_bacteria	2939573065	2939574930	155
357	iso_pu_bacteria	2939602548	2939603071	155
358	iso_pu_bacteria	2939607340	2939610827	155
359	iso_pu_bacteria	2939617950	2939622289	155
360	iso_pu_bacteria	2939642701	2939644868	155
361	iso_pu_bacteria	2945874760	2945879379	155
362	iso_pu_bacteria	2969079654	2969083772	155
363	iso_pu_bacteria	2971820967	2971825244	155
364	iso_pu_bacteria	2974310843	2974313334	155
365	iso_pu_bacteria	2974435778	2974437322	155
366	iso_pu_bacteria	2984494565	2984495578	155
367	iso_pu_bacteria	2990261002	2990264275	155
368	iso_pu_bacteria	3000376612	3000380194	155
369	iso_pu_bacteria	8004592986	8004594274	155
370	iso_pu_bacteria	8015394850	8015398866	155
371	iso_pu_bacteria	8016733728	8016736932	155
372	iso_pu_bacteria	8018221730	8018222404	155
373	iso_pu_bacteria	8018405270	8018406556	155
374	iso_pu_bacteria	8019499862	8019502140	155
375	iso_pu_bacteria	8019504834	8019508648	155
376	iso_pu_bacteria	8054844752	8054845356	155
377	iso_pu_bacteria	8054849141	8054851077	155
378	iso_pu_bacteria	8055087960	8055089975	155
379	iso_pu_bacteria	8055092621	8055096440	155
380	iso_pu_bacteria	8055097453	8055101386	155
381	3300005441	Ga0070700_100746363	Ga0070700_1007463631	156
382	3300005444	Ga0070694_100493100	Ga0070694_1004931001	156
383	3300009177	Ga0105248_11949232	Ga0105248_119492322	156
384	3300026075	Ga0207708_10683484	Ga0207708_106834841	156
385	3300001979	JGI24740J21852_10005401	JGI24740J21852_100054013	157
386	3300044673	Ga0453683_0282081	Ga0453683_0282081_123_620	157
387	3300046499	Ga0495594_0002812	Ga0495594_0002812_4813_5310	157
388	3300053085	Ga0495619_0164432	Ga0495619_0164432_172_669	157
389	iso_pu_bacteria	2511231002	2511244014	157
390	iso_pu_bacteria	2513020051	2513230192	157
391	iso_pu_bacteria	2547132374	2548501117	157
392	iso_pu_bacteria	2599185214	2599625397	157
393	iso_pu_bacteria	2599185226	2599673151	157
394	iso_pu_bacteria	2599185227	2599682821	157
395	iso_pu_bacteria	2599185229	2599694759	157
396	iso_pu_bacteria	2643221570	2643866822	157
397	iso_pu_bacteria	2643221628	2644162076	157
398	iso_pu_bacteria	2643221658	2644328290	157
399	iso_pu_bacteria	2643221672	2644397587	157
400	iso_pu_bacteria	2643221683	2644464386	157
401	iso_pu_bacteria	2738541277	2738718451	157
402	iso_pu_bacteria	2738541307	2738882910	157
403	iso_pu_bacteria	2738543019	2739281638	157
404	iso_pu_bacteria	2818991446	2819602741	157
405	iso_pu_bacteria	2831265667	2831268338	157
406	iso_pu_bacteria	2838054893	2838060519	157
407	iso_pu_bacteria	2842677519	2842679209	157
408	iso_pu_bacteria	2842733646	2842735422	157
409	iso_pu_bacteria	2842747753	2842749027	157
410	iso_pu_bacteria	2881101125	2881103761	157
411	iso_pu_bacteria	2885192300	2885193477	157
412	iso_pu_bacteria	2885198086	2885198135	157
413	iso_pu_bacteria	2885211737	2885212484	157
414	iso_pu_bacteria	2894023352	2894026058	157
415	iso_pu_bacteria	2899924645	2899928852	157
416	iso_pu_bacteria	2904449895	2904452178	157
417	iso_pu_bacteria	2904456579	2904458678	157
418	iso_pu_bacteria	2904541872	2904549450	157
419	iso_pu_bacteria	2919462493	2919466229	157
420	iso_pu_bacteria	2928037797	2928043212	157
421	iso_pu_bacteria	2928044640	2928051089	157
422	iso_pu_bacteria	2928051484	2928058691	157
423	iso_pu_bacteria	2928064002	2928066077	157
424	iso_pu_bacteria	2928070936	2928078101	157
425	iso_pu_bacteria	2928084124	2928088004	157
426	iso_pu_bacteria	2929160207	2929164819	157
427	iso_pu_bacteria	2929520902	2929523282	157
428	iso_pu_bacteria	2945909444	2945910568	157
429	iso_pu_bacteria	2945945610	2945946460	157
430	iso_pu_bacteria	2945972063	2945976079	157
431	iso_pu_bacteria	2945984333	2945987355	157
432	iso_pu_bacteria	2954767861	2954771258	157
433	iso_pu_bacteria	2974320154	2974323869	157
434	iso_pu_bacteria	2990710928	2990712778	157
435	3300031733	Ga0316577_10388970	Ga0316577_103889701	158
436	3300032133	Ga0316583_10014588	Ga0316583_100145883	158
437	3300038725	Ga0400484_02508	Ga0400484_02508_10_492	158
438	3300038725	Ga0400484_04287	Ga0400484_04287_3620_4102	158
439	3300038726	Ga0400490_03454	Ga0400490_03454_9763_10245	158
440	3300038726	Ga0400490_11410	Ga0400490_11410_276_758	158
441	3300038726	Ga0400490_23331	Ga0400490_23331_10397_10879	158
442	3300038726	Ga0400490_53058	Ga0400490_53058_2773_3255	158
443	3300038726	Ga0400490_58419	Ga0400490_58419_2573_3055	158
444	3300038727	Ga0400491_10453	Ga0400491_10453_251_733	158
445	3300038735	Ga0400485_05571	Ga0400485_05571_787_1269	158
446	3300038735	Ga0400485_19140	Ga0400485_19140_30364_30846	158
447	3300038741	Ga0400488_29806	Ga0400488_29806_1613_2095	158
448	3300038741	Ga0400488_33920	Ga0400488_33920_898_1380	158
449	3300038741	Ga0400488_34747	Ga0400488_34747_2971_3453	158
450	3300038741	Ga0400488_39496	Ga0400488_39496_2094_2576	158
451	3300038741	Ga0400488_57055	Ga0400488_57055_2206_2688	158
452	3300038742	Ga0400486_02256	Ga0400486_02256_61433_61915	158
453	3300038742	Ga0400486_02707	Ga0400486_02707_2967_3449	158
454	3300039062	Ga0400483_004489	Ga0400483_004489_2699_3181	158
455	3300039062	Ga0400483_020413	Ga0400483_020413_8756_9238	158
456	3300039062	Ga0400483_048196	Ga0400483_048196_662_1144	158
457	3300039062	Ga0400483_061370	Ga0400483_061370_7528_8010	158
458	3300039062	Ga0400483_072698	Ga0400483_072698_1316_1798	158
459	3300039062	Ga0400483_082901	Ga0400483_082901_1669_2151	158
460	3300039062	Ga0400483_171467	Ga0400483_171467_1361_1843	158
461	3300039062	Ga0400483_195769	Ga0400483_195769_3039_3521	158
462	3300039062	Ga0400483_222618	Ga0400483_222618_334_816	158
463	3300039062	Ga0400483_226644	Ga0400483_226644_1852_2334	158
464	3300039062	Ga0400483_254298	Ga0400483_254298_19850_20332	158
465	3300039062	Ga0400483_272990	Ga0400483_272990_1682_2164	158
466	3300039093	Ga0400489_32607	Ga0400489_32607_1427_1909	158
467	3300039110	Ga0400487_19579	Ga0400487_19579_111271_111753	158
468	3300039110	Ga0400487_62873	Ga0400487_62873_6101_6583	158
469	iso_pu_bacteria	2643221613	2644082436	158
470	iso_pu_bacteria	2643221721	2644666941	158
471	iso_pu_bacteria	2935890801	2935892166	158
472	3300001989	JGI24739J22299_10000371	JGI24739J22299_100003714	159
473	3300002771	JGI25163J39215_1000015	JGI25163J39215_10000153	159
474	3300002772	JGI25164J39214_1000009	JGI25164J39214_100000975	159
475	3300002773	JGI25152J39213_1000247	JGI25152J39213_100024721	159
476	3300003320	rootH2_10015620	rootH2_100156205	159
477	3300003320	rootH2_10204329	rootH2_102043292	159
478	3300003751	Ga0055538_1000005	Ga0055538_1000005216	159
479	3300003752	Ga0055539_1000007	Ga0055539_1000007216	159
480	3300003756	Ga0055533_1000009	Ga0055533_1000009216	159
481	3300003759	Ga0055525_1000010	Ga0055525_1000010216	159
482	3300003841	Ga0055541_1000005	Ga0055541_1000005349	159
483	3300003856	Ga0058692_1000273	Ga0058692_10002736	159
484	3300003856	Ga0058692_1000837	Ga0058692_10008374	159
485	3300003856	Ga0058692_1001543	Ga0058692_10015435	159
486	3300003856	Ga0058692_1012570	Ga0058692_10125702	159
487	3300003856	Ga0058692_1013773	Ga0058692_10137731	159
488	3300003856	Ga0058692_1015486	Ga0058692_10154861	159
489	3300003856	Ga0058692_1021950	Ga0058692_10219501	159
490	3300003856	Ga0058692_1030107	Ga0058692_10301072	159
491	3300003856	Ga0058692_1055994	Ga0058692_10559941	159
492	3300003856	Ga0058692_1061328	Ga0058692_10613281	159
493	3300005289	Ga0065704_10000373	Ga0065704_1000037310	159
494	3300005289	Ga0065704_10002947	Ga0065704_100029473	159
495	3300005289	Ga0065704_10003359	Ga0065704_100033592	159
496	3300005289	Ga0065704_10086203	Ga0065704_100862033	159
497	3300005289	Ga0065704_10173751	Ga0065704_101737512	159
498	3300005548	Ga0070665_100001635	Ga0070665_10000163511	159
499	3300005548	Ga0070665_100117432	Ga0070665_1001174322	159
500	3300005577	Ga0068857_100000003	Ga0068857_100000003144	159
501	3300005834	Ga0068851_10033080	Ga0068851_100330803	159
502	3300006051	Ga0075364_10006787	Ga0075364_100067875	159
503	3300006051	Ga0075364_10043647	Ga0075364_100436473	159
504	3300006051	Ga0075364_10215119	Ga0075364_102151192	159
505	3300006195	Ga0075366_10037042	Ga0075366_100370422	159
506	3300006946	Ga0079104_1000157	Ga0079104_100015782	159
507	3300006946	Ga0079104_1000166	Ga0079104_100016615	159
508	3300006946	Ga0079104_1000675	Ga0079104_100067517	159
509	3300006946	Ga0079104_1001269	Ga0079104_100126919	159
510	3300006946	Ga0079104_1001919	Ga0079104_100191912	159
511	3300006946	Ga0079104_1004419	Ga0079104_10044193	159
512	3300006946	Ga0079104_1004671	Ga0079104_10046714	159
513	3300006946	Ga0079104_1011223	Ga0079104_10112231	159
514	3300006946	Ga0079104_1027535	Ga0079104_10275352	159
515	3300009011	Ga0105251_10000655	Ga0105251_1000065521	159
516	3300009011	Ga0105251_10000827	Ga0105251_100008273	159
517	3300009011	Ga0105251_10001660	Ga0105251_100016606	159
518	3300009036	Ga0105244_10000794	Ga0105244_1000079418	159
519	3300009036	Ga0105244_10001531	Ga0105244_100015314	159
520	3300009036	Ga0105244_10001979	Ga0105244_100019798	159
521	3300009036	Ga0105244_10002142	Ga0105244_100021424	159
522	3300009036	Ga0105244_10007926	Ga0105244_100079261	159
523	3300009036	Ga0105244_10015095	Ga0105244_100150955	159
524	3300009036	Ga0105244_10018133	Ga0105244_100181332	159
525	3300009036	Ga0105244_10027412	Ga0105244_100274124	159
526	3300009036	Ga0105244_10072093	Ga0105244_100720933	159
527	3300009036	Ga0105244_10079452	Ga0105244_100794522	159
528	3300009036	Ga0105244_10448503	Ga0105244_104485031	159
529	3300009092	Ga0105250_10000025	Ga0105250_1000002521	159
530	3300009092	Ga0105250_10000930	Ga0105250_1000093018	159
531	3300009092	Ga0105250_10003075	Ga0105250_100030752	159
532	3300009092	Ga0105250_10018145	Ga0105250_100181452	159
533	3300009092	Ga0105250_10055414	Ga0105250_100554142	159
534	3300009148	Ga0105243_10007581	Ga0105243_100075814	159
535	3300009177	Ga0105248_10229223	Ga0105248_102292232	159
536	3300011119	Ga0105246_10676973	Ga0105246_106769731	159
537	3300013100	Ga0157373_10005828	Ga0157373_100058283	159
538	3300013100	Ga0157373_10005842	Ga0157373_100058428	159
539	3300013100	Ga0157373_10121413	Ga0157373_101214132	159
540	3300013100	Ga0157373_10128147	Ga0157373_101281472	159
541	3300013102	Ga0157371_10000801	Ga0157371_100008012	159
542	3300013102	Ga0157371_10001284	Ga0157371_1000128423	159
543	3300013102	Ga0157371_10001379	Ga0157371_100013798	159
544	3300013102	Ga0157371_10147224	Ga0157371_101472241	159
545	3300013102	Ga0157371_10245893	Ga0157371_102458932	159
546	3300013104	Ga0157370_10000104	Ga0157370_1000010410	159
547	3300013104	Ga0157370_10010891	Ga0157370_100108917	159
548	3300013105	Ga0157369_10470336	Ga0157369_104703362	159
549	3300013306	Ga0163162_10467255	Ga0163162_104672552	159
550	3300013306	Ga0163162_10585982	Ga0163162_105859821	159
551	3300013307	Ga0157372_10000569	Ga0157372_1000056920	159
552	3300013307	Ga0157372_10003569	Ga0157372_1000356918	159
553	3300015261	Ga0182006_1000020	Ga0182006_1000020121	159
554	3300015679	Ga0183366_1001	Ga0183366_1001170	159
555	3300015680	Ga0183370_1001	Ga0183370_1001170	159
556	3300015685	Ga0183369_1001	Ga0183369_1001170	159
557	3300015687	Ga0183368_1001	Ga0183368_1001170	159
558	3300017792	Ga0163161_10040092	Ga0163161_100400922	159
559	3300017792	Ga0163161_10483683	Ga0163161_104836831	159
560	3300021384	Ga0213876_10000025	Ga0213876_10000025157	159
561	3300025207	Ga0209760_100057	Ga0209760_10005788	159
562	3300025224	Ga0209784_100001	Ga0209784_100001759	159
563	3300025225	Ga0209566_100001	Ga0209566_100001759	159
564	3300025226	Ga0209674_100002	Ga0209674_100002759	159
565	3300025230	Ga0209563_100008	Ga0209563_100008762	159
566	3300025231	Ga0207427_100002	Ga0207427_100002517	159
567	3300025233	Ga0209437_100007	Ga0209437_100007214	159
568	3300025245	Ga0207425_1004293	Ga0207425_10042933	159
569	3300025253	Ga0209677_100004	Ga0209677_100004762	159
570	3300025258	Ga0209129_1000015	Ga0209129_1000015136	159
571	3300025261	Ga0209233_1003997	Ga0209233_10039972	159
572	3300025321	Ga0207656_10052850	Ga0207656_100528502	159
573	3300025711	Ga0207696_1000003	Ga0207696_1000003249	159
574	3300025711	Ga0207696_1000007	Ga0207696_1000007391	159
575	3300025711	Ga0207696_1000313	Ga0207696_10003131	159
576	3300025711	Ga0207696_1000544	Ga0207696_100054422	159
577	3300025711	Ga0207696_1001363	Ga0207696_10013634	159
578	3300025711	Ga0207696_1029836	Ga0207696_10298361	159
579	3300025711	Ga0207696_1068956	Ga0207696_10689563	159
580	3300025728	Ga0207655_1000001	Ga0207655_1000001142	159
581	3300025728	Ga0207655_1000087	Ga0207655_1000087137	159
582	3300025728	Ga0207655_1000226	Ga0207655_100022670	159
583	3300025728	Ga0207655_1003596	Ga0207655_100359610	159
584	3300025728	Ga0207655_1004364	Ga0207655_10043644	159
585	3300025728	Ga0207655_1005538	Ga0207655_10055389	159
586	3300025728	Ga0207655_1008382	Ga0207655_10083822	159
587	3300025728	Ga0207655_1014005	Ga0207655_10140056	159
588	3300025728	Ga0207655_1014687	Ga0207655_10146872	159
589	3300025728	Ga0207655_1031027	Ga0207655_10310272	159
590	3300025728	Ga0207655_1060351	Ga0207655_10603512	159
591	3300025728	Ga0207655_1089255	Ga0207655_10892552	159
592	3300025728	Ga0207655_1095435	Ga0207655_10954352	159
593	3300025735	Ga0207713_1000005	Ga0207713_1000005529	159
594	3300025735	Ga0207713_1000021	Ga0207713_1000021322	159
595	3300025735	Ga0207713_1000038	Ga0207713_1000038190	159
596	3300025735	Ga0207713_1003843	Ga0207713_10038433	159
597	3300025735	Ga0207713_1005130	Ga0207713_10051307	159
598	3300025735	Ga0207713_1015383	Ga0207713_10153833	159
599	3300025735	Ga0207713_1024100	Ga0207713_10241004	159
600	3300025735	Ga0207713_1049801	Ga0207713_10498012	159
601	3300025935	Ga0207709_10023689	Ga0207709_100236892	159
602	3300025935	Ga0207709_10042289	Ga0207709_100422891	159
603	3300025941	Ga0207711_10883696	Ga0207711_108836961	159
604	3300026116	Ga0207674_10002103	Ga0207674_1000210323	159
605	3300027111	Ga0209281_1000001	Ga0209281_10000011711	159
606	3300027111	Ga0209281_1000021	Ga0209281_1000021391	159
607	3300027111	Ga0209281_1000041	Ga0209281_10000414	159
608	3300027111	Ga0209281_1000075	Ga0209281_1000075147	159
609	3300027111	Ga0209281_1000093	Ga0209281_100009379	159
610	3300027111	Ga0209281_1000254	Ga0209281_1000254103	159
611	3300027111	Ga0209281_1001594	Ga0209281_10015943	159
612	3300027111	Ga0209281_1001816	Ga0209281_10018168	159
613	3300027312	Ga0209371_1000001	Ga0209371_1000001126	159
614	3300027312	Ga0209371_1000026	Ga0209371_1000026175	159
615	3300027312	Ga0209371_1000104	Ga0209371_10001044	159
616	3300027312	Ga0209371_1000117	Ga0209371_100011743	159
617	3300027312	Ga0209371_1000146	Ga0209371_100014623	159
618	3300027312	Ga0209371_1000705	Ga0209371_100070517	159
619	3300027312	Ga0209371_1001777	Ga0209371_10017772	159
620	3300027312	Ga0209371_1004678	Ga0209371_10046784	159
621	3300027312	Ga0209371_1006595	Ga0209371_10065951	159
622	3300027312	Ga0209371_1006917	Ga0209371_10069174	159
623	3300027312	Ga0209371_1013741	Ga0209371_10137411	159
624	3300027312	Ga0209371_1033238	Ga0209371_10332382	159
625	3300027312	Ga0209371_1038835	Ga0209371_10388351	159
626	3300027312	Ga0209371_1043301	Ga0209371_10433011	159
627	3300028379	Ga0268266_10000084	Ga0268266_10000084187	159
628	3300030500	Ga0268256_1000001	Ga0268256_10000012515	159
629	3300030500	Ga0268256_1000003	Ga0268256_1000003175	159
630	3300030500	Ga0268256_1000017	Ga0268256_1000017260	159
631	3300030500	Ga0268256_1000117	Ga0268256_100011793	159
632	3300030500	Ga0268256_1000604	Ga0268256_100060414	159
633	3300030500	Ga0268256_1001561	Ga0268256_10015612	159
634	3300030500	Ga0268256_1003368	Ga0268256_10033685	159
635	3300030500	Ga0268256_1004439	Ga0268256_10044394	159
636	3300030500	Ga0268256_1012516	Ga0268256_10125163	159
637	3300030500	Ga0268256_1012912	Ga0268256_10129122	159
638	3300030500	Ga0268256_1019300	Ga0268256_10193002	159
639	3300030500	Ga0268256_1028958	Ga0268256_10289582	159
640	3300030500	Ga0268256_1037766	Ga0268256_10377662	159
641	3300030500	Ga0268256_1044123	Ga0268256_10441232	159
642	3300039437	Ga0436365_1279401	Ga0436365_1279401_217585_218076	159
643	3300041405	Ga0439438_000020	Ga0439438_000020_86232_86723	159
644	3300041407	Ga0439447_008336	Ga0439447_008336_779_1270	159
645	3300041507	Ga0451851_0676229	Ga0451851_0676229_54_545	159
646	3300042006	Ga0439432_001051	Ga0439432_001051_2573_3064	159
647	3300042006	Ga0439432_027746	Ga0439432_027746_321_845	159
648	3300042006	Ga0439432_050037	Ga0439432_050037_542_1033	159
649	3300042010	Ga0439452_000003	Ga0439452_000003_830735_831226	159
650	3300042010	Ga0439452_000017	Ga0439452_000017_157614_158138	159
651	3300042010	Ga0439452_000027	Ga0439452_000027_147914_148405	159
652	3300042010	Ga0439452_000033	Ga0439452_000033_9666_10175	159
653	3300042010	Ga0439452_000380	Ga0439452_000380_13375_13884	159
654	3300042439	Ga0439464_0009404	Ga0439464_0009404_590_1081	159
655	3300046458	Ga0495591_000028	Ga0495591_000028_144617_145141	159
656	3300046458	Ga0495591_000400	Ga0495591_000400_25285_25776	159
657	3300046471	Ga0495650_0000016	Ga0495650_0000016_468462_468953	159
658	3300046471	Ga0495650_0000205	Ga0495650_0000205_121572_122081	159
659	3300046471	Ga0495650_0086204	Ga0495650_0086204_213_779	159
660	3300046520	Ga0495637_0032063	Ga0495637_0032063_1359_1850	159
661	3300046530	Ga0495654_0000032	Ga0495654_0000032_82138_82662	159
662	3300046542	Ga0495597_0000053	Ga0495597_0000053_2086_2577	159
663	3300046616	Ga0495668_0076083	Ga0495668_0076083_465_989	159
664	3300046660	Ga0495625_0015183	Ga0495625_0015183_5320_5871	159
665	3300046810	Ga0495660_0000007	Ga0495660_0000007_399063_399554	159
666	3300047320	Ga0495672_0000027	Ga0495672_0000027_217547_218098	159
667	3300047446	Ga0495679_000019	Ga0495679_000019_13388_13939	159
668	3300047470	Ga0495681_0141812	Ga0495681_0141812_480_971	159
669	3300048903	Ga0496100_1032960	Ga0496100_1032960_12_536	159
670	3300048904	Ga0496101_0000312	Ga0496101_0000312_17233_17757	159
671	3300048907	Ga0496104_0001737	Ga0496104_0001737_16016_16507	159
672	3300048907	Ga0496104_0427454	Ga0496104_0427454_200_766	159
673	3300048919	Ga0496116_0000054	Ga0496116_0000054_48660_49151	159
674	3300048919	Ga0496116_0000222	Ga0496116_0000222_97204_97728	159
675	3300048919	Ga0496116_0001374	Ga0496116_0001374_9013_9504	159
676	3300048919	Ga0496116_0003616	Ga0496116_0003616_71_562	159
677	3300048919	Ga0496116_0005691	Ga0496116_0005691_9002_9511	159
678	3300048919	Ga0496116_0019803	Ga0496116_0019803_3664_4155	159
679	3300048919	Ga0496116_0025043	Ga0496116_0025043_1714_2205	159
680	3300048919	Ga0496116_0075943	Ga0496116_0075943_773_1297	159
681	3300048920	Ga0496117_0000212	Ga0496117_0000212_102919_103443	159
682	3300048920	Ga0496117_0009882	Ga0496117_0009882_7708_8199	159
683	3300048920	Ga0496117_0011795	Ga0496117_0011795_6887_7378	159
684	3300048920	Ga0496117_0012896	Ga0496117_0012896_1954_2463	159
685	3300048920	Ga0496117_0014834	Ga0496117_0014834_4380_4904	159
686	3300048920	Ga0496117_0144561	Ga0496117_0144561_273_764	159
687	3300048921	Ga0496118_0007529	Ga0496118_0007529_1213_1704	159
688	3300048921	Ga0496118_0013584	Ga0496118_0013584_6887_7378	159
689	3300048921	Ga0496118_0054558	Ga0496118_0054558_1951_2460	159
690	3300048921	Ga0496118_0092886	Ga0496118_0092886_1192_1758	159
691	3300048921	Ga0496118_0147475	Ga0496118_0147475_869_1393	159
692	3300048922	Ga0496119_0000062	Ga0496119_0000062_85352_85843	159
693	3300048922	Ga0496119_0000078	Ga0496119_0000078_12675_13166	159
694	3300048922	Ga0496119_0001296	Ga0496119_0001296_2437_2928	159
695	3300048922	Ga0496119_0003948	Ga0496119_0003948_3081_3647	159
696	3300048922	Ga0496119_0004778	Ga0496119_0004778_1018_1509	159
697	3300048922	Ga0496119_0005638	Ga0496119_0005638_1673_2164	159
698	3300048922	Ga0496119_0005640	Ga0496119_0005640_1673_2164	159
699	3300048922	Ga0496119_0024909	Ga0496119_0024909_3669_4178	159
700	3300048922	Ga0496119_0029043	Ga0496119_0029043_2868_3359	159
701	3300048922	Ga0496119_0178025	Ga0496119_0178025_12_536	159
702	3300048923	Ga0496120_0000009	Ga0496120_0000009_127003_127494	159
703	3300048923	Ga0496120_0000265	Ga0496120_0000265_13442_13933	159
704	3300048923	Ga0496120_0001771	Ga0496120_0001771_10818_11342	159
705	3300048923	Ga0496120_0002766	Ga0496120_0002766_14921_15412	159
706	3300048923	Ga0496120_0003019	Ga0496120_0003019_1673_2164	159
707	3300048923	Ga0496120_0005166	Ga0496120_0005166_8049_8540	159
708	3300048923	Ga0496120_0016058	Ga0496120_0016058_1923_2432	159
709	3300048923	Ga0496120_0020055	Ga0496120_0020055_3061_3627	159
710	3300048923	Ga0496120_0024374	Ga0496120_0024374_2463_2954	159
711	3300048923	Ga0496120_0276711	Ga0496120_0276711_73_564	159
712	3300048924	Ga0496121_0012828	Ga0496121_0012828_6611_7120	159
713	3300048924	Ga0496121_0038903	Ga0496121_0038903_503_994	159
714	3300048925	Ga0496122_0000013	Ga0496122_0000013_446862_447353	159
715	3300048925	Ga0496122_0000145	Ga0496122_0000145_11434_11925	159
716	3300048925	Ga0496122_0000925	Ga0496122_0000925_9003_9512	159
717	3300048925	Ga0496122_0002833	Ga0496122_0002833_3457_3948	159
718	3300048925	Ga0496122_0019764	Ga0496122_0019764_1126_1617	159
719	3300048925	Ga0496122_0042799	Ga0496122_0042799_2375_2884	159
720	3300048926	Ga0496123_0000010	Ga0496123_0000010_53687_54178	159
721	3300048926	Ga0496123_0000281	Ga0496123_0000281_14366_14857	159
722	3300048926	Ga0496123_0002523	Ga0496123_0002523_15006_15497	159
723	3300048926	Ga0496123_0002705	Ga0496123_0002705_3470_3961	159
724	3300048926	Ga0496123_0003026	Ga0496123_0003026_9869_10378	159
725	3300048926	Ga0496123_0017984	Ga0496123_0017984_2961_3485	159
726	3300048926	Ga0496123_0023107	Ga0496123_0023107_1900_2391	159
727	3300048927	Ga0496124_0000010	Ga0496124_0000010_230337_230828	159
728	3300048927	Ga0496124_0000122	Ga0496124_0000122_14564_15055	159
729	3300048927	Ga0496124_0023295	Ga0496124_0023295_799_1323	159
730	3300048927	Ga0496124_0036058	Ga0496124_0036058_3471_3995	159
731	3300048927	Ga0496124_0068091	Ga0496124_0068091_512_1021	159
732	3300048927	Ga0496124_0103461	Ga0496124_0103461_1169_1678	159
733	3300048927	Ga0496124_0128800	Ga0496124_0128800_1456_1980	159
734	3300048928	Ga0496125_0000019	Ga0496125_0000019_388681_389172	159
735	3300048928	Ga0496125_0000413	Ga0496125_0000413_3746_4255	159
736	3300048928	Ga0496125_0011475	Ga0496125_0011475_7242_7733	159
737	3300048929	Ga0496126_0000975	Ga0496126_0000975_43_534	159
738	3300048929	Ga0496126_0003059	Ga0496126_0003059_14924_15415	159
739	3300048929	Ga0496126_0006169	Ga0496126_0006169_5239_5805	159
740	3300048929	Ga0496126_0039228	Ga0496126_0039228_2884_3375	159
741	3300048929	Ga0496126_0045894	Ga0496126_0045894_1951_2460	159
742	3300048929	Ga0496126_0159487	Ga0496126_0159487_577_1086	159
743	3300048929	Ga0496126_0725667	Ga0496126_0725667_34_525	159
744	3300050491	nmdc:mga00v17_179097_c1	nmdc:mga00v17_179097_c1_591_1100	159
745	3300050491	nmdc:mga00v17_214816_c1	nmdc:mga00v17_214816_c1_166_690	159
746	3300050491	nmdc:mga00v17_453977_c1	nmdc:mga00v17_453977_c1_91_582	159
747	3300005444	Ga0070694_100150646	Ga0070694_1001506462	160
748	3300005445	Ga0070708_100479233	Ga0070708_1004792332	160
749	3300005458	Ga0070681_10011448	Ga0070681_100114487	160
750	3300005545	Ga0070695_100088959	Ga0070695_1000889593	160
751	3300006852	Ga0075433_10596727	Ga0075433_105967272	160
752	3300009147	Ga0114129_10024726	Ga0114129_100247262	160
753	3300009176	Ga0105242_10220212	Ga0105242_102202121	160
754	3300009553	Ga0105249_11740228	Ga0105249_117402281	160
755	3300013308	Ga0157375_11501453	Ga0157375_115014532	160
756	3300014326	Ga0157380_10001779	Ga0157380_100017796	160
757	3300025912	Ga0207707_10031381	Ga0207707_100313813	160
758	3300042876	Ga0451577_0360685	Ga0451577_0360685_280_777	160
759	3300046664	Ga0495659_0264136	Ga0495659_0264136_160_657	160
760	3300049568	Ga0501031_0003705	Ga0501031_0003705_1656_2153	160
761	3300049568	Ga0501031_0492714	Ga0501031_0492714_228_725	160
762	3300049569	Ga0501032_0023813	Ga0501032_0023813_1137_1634	160
763	3300049571	Ga0501034_0078571	Ga0501034_0078571_424_921	160
764	3300049573	Ga0501037_0004572	Ga0501037_0004572_1139_1663	160
765	3300049573	Ga0501037_0092255	Ga0501037_0092255_10_507	160
766	3300049574	Ga0501038_0038135	Ga0501038_0038135_2279_2776	160
767	3300049575	Ga0501039_1053791	Ga0501039_1053791_95_592	160
768	3300049577	Ga0501041_0207923	Ga0501041_0207923_614_1111	160
769	3300049578	Ga0501042_0010383	Ga0501042_0010383_143_640	160
770	3300049580	Ga0501046_0028555	Ga0501046_0028555_3889_4386	160
771	3300049582	Ga0501048_0048495	Ga0501048_0048495_616_1113	160
772	3300049588	Ga0501072_0761287	Ga0501072_0761287_51_548	160
773	3300049592	Ga0501076_0023853	Ga0501076_0023853_1988_2485	160
774	3300049741	Ga0501079_0115728	Ga0501079_0115728_962_1459	160
775	3300049762	Ga0501265_000061	Ga0501265_000061_5961_6458	160
776	3300049822	Ga0501035_0520275	Ga0501035_0520275_435_932	160
777	3300050507	nmdc:mga05p37_32994_c2	nmdc:mga05p37_32994_c2_835_1350	160
778	3300050515	nmdc:mga0a205_541352_c1	nmdc:mga0a205_541352_c1_161_676	160
779	3300059426	Ga0590077_044379	Ga0590077_044379_233_799	160
780	3300000549	LJQas_1034856	LJQas_10348561	161
781	3300001989	JGI24739J22299_10066941	JGI24739J22299_100669412	161
782	3300002739	JGI25158J39367_1009640	JGI25158J39367_10096401	161
783	3300002773	JGI25152J39213_1010251	JGI25152J39213_10102511	161
784	3300002773	JGI25152J39213_1040354	JGI25152J39213_10403541	161
785	3300002774	JGI25150J39212_1006400	JGI25150J39212_10064003	161
786	3300002774	JGI25150J39212_1033517	JGI25150J39212_10335171	161
787	3300002987	JGI25159J45721_1007675	JGI25159J45721_10076752	161
788	3300002987	JGI25159J45721_1042309	JGI25159J45721_10423091	161
789	3300003187	JGI25151J46595_10001341	JGI25151J46595_1000134116	161
790	3300003187	JGI25151J46595_10121615	JGI25151J46595_101216151	161
791	3300003187	JGI25151J46595_10122716	JGI25151J46595_101227161	161
792	3300003215	JGI25153J46596_10103805	JGI25153J46596_101038051	161
793	3300003215	JGI25153J46596_10104726	JGI25153J46596_101047261	161
794	3300003316	rootH1_10041552	rootH1_100415524	161
795	3300003354	JGI25160J50197_1004293	JGI25160J50197_10042934	161
796	3300003354	JGI25160J50197_1071856	JGI25160J50197_10718561	161
797	3300003374	JGI25161J50226_1003987	JGI25161J50226_10039871	161
798	3300003578	Ga0006562J51391_1065511	Ga0006562J51391_10655112	161
799	3300003761	Ga0055535_1000341	Ga0055535_100034110	161
800	3300003762	Ga0055542_1000369	Ga0055542_100036932	161
801	3300003771	Ga0055526_1077009	Ga0055526_10770091	161
802	3300003771	Ga0055526_1077043	Ga0055526_10770431	161
803	3300003773	Ga0055537_1000571	Ga0055537_10005718	161
804	3300003773	Ga0055537_1016463	Ga0055537_10164632	161
805	3300003773	Ga0055537_1032709	Ga0055537_10327091	161
806	3300003775	Ga0055524_1072261	Ga0055524_10722611	161
807	3300003775	Ga0055524_1072326	Ga0055524_10723261	161
808	3300003781	Ga0055536_1005732	Ga0055536_10057326	161
809	3300003781	Ga0055536_1006667	Ga0055536_10066671	161
810	3300003781	Ga0055536_1024408	Ga0055536_10244081	161
811	3300003784	Ga0055534_1000064	Ga0055534_100006410	161
812	3300003784	Ga0055534_1008960	Ga0055534_10089604	161
813	3300003784	Ga0055534_1043103	Ga0055534_10431031	161
814	3300003790	Ga0055528_1002261	Ga0055528_10022615	161
815	3300003790	Ga0055528_1048134	Ga0055528_10481342	161
816	3300003790	Ga0055528_1066962	Ga0055528_10669621	161
817	3300003791	Ga0055530_10001020	Ga0055530_100010209	161
818	3300003791	Ga0055530_10067953	Ga0055530_100679531	161
819	3300003792	Ga0055540_1000998	Ga0055540_10009984	161
820	3300003792	Ga0055540_1001724	Ga0055540_100172410	161
821	3300003794	Ga0055531_10001925	Ga0055531_100019257	161
822	3300003794	Ga0055531_10034970	Ga0055531_100349702	161
823	3300003794	Ga0055531_10088297	Ga0055531_100882971	161
824	3300003794	Ga0055531_10088330	Ga0055531_100883301	161
825	3300004625	Ga0055543_1005988	Ga0055543_10059881	161
826	3300005262	Ga0065165_1106018	Ga0065165_11060181	161
827	3300005262	Ga0065165_1106019	Ga0065165_11060191	161
828	3300005288	Ga0065714_10006432	Ga0065714_100064322	161
829	3300005288	Ga0065714_10036053	Ga0065714_100360531	161
830	3300005288	Ga0065714_10147566	Ga0065714_101475662	161
831	3300005288	Ga0065714_10198596	Ga0065714_101985962	161
832	3300005289	Ga0065704_10265154	Ga0065704_102651542	161
833	3300005289	Ga0065704_10397543	Ga0065704_103975432	161
834	3300005327	Ga0070658_10076029	Ga0070658_100760293	161
835	3300005327	Ga0070658_10106764	Ga0070658_101067643	161
836	3300005328	Ga0070676_11056819	Ga0070676_110568191	161
837	3300005334	Ga0068869_100298079	Ga0068869_1002980792	161
838	3300005335	Ga0070666_10612714	Ga0070666_106127141	161
839	3300005353	Ga0070669_100006496	Ga0070669_1000064961	161
840	3300005354	Ga0070675_100395113	Ga0070675_1003951132	161
841	3300005356	Ga0070674_100172446	Ga0070674_1001724463	161
842	3300005356	Ga0070674_101397771	Ga0070674_1013977711	161
843	3300005364	Ga0070673_100515758	Ga0070673_1005157582	161
844	3300005366	Ga0070659_100081428	Ga0070659_1000814285	161
845	3300005367	Ga0070667_100044575	Ga0070667_1000445752	161
846	3300005445	Ga0070708_100261424	Ga0070708_1002614241	161
847	3300005456	Ga0070678_100205947	Ga0070678_1002059473	161
848	3300005456	Ga0070678_100265015	Ga0070678_1002650152	161
849	3300005456	Ga0070678_100531475	Ga0070678_1005314752	161
850	3300005468	Ga0070707_100422731	Ga0070707_1004227312	161
851	3300005539	Ga0068853_100048018	Ga0068853_1000480184	161
852	3300005539	Ga0068853_100225302	Ga0068853_1002253022	161
853	3300005539	Ga0068853_100294865	Ga0068853_1002948652	161
854	3300005543	Ga0070672_100019919	Ga0070672_1000199193	161
855	3300005543	Ga0070672_100154685	Ga0070672_1001546853	161
856	3300005548	Ga0070665_100101538	Ga0070665_1001015383	161
857	3300005548	Ga0070665_100800176	Ga0070665_1008001762	161
858	3300005563	Ga0068855_100166340	Ga0068855_1001663402	161
859	3300005564	Ga0070664_100011226	Ga0070664_1000112266	161
860	3300005577	Ga0068857_100460713	Ga0068857_1004607132	161
861	3300005577	Ga0068857_100666647	Ga0068857_1006666472	161
862	3300005577	Ga0068857_101152028	Ga0068857_1011520281	161
863	3300005578	Ga0068854_100166731	Ga0068854_1001667313	161
864	3300005616	Ga0068852_100397179	Ga0068852_1003971792	161
865	3300005618	Ga0068864_101149177	Ga0068864_1011491772	161
866	3300005834	Ga0068851_10056079	Ga0068851_100560792	161
867	3300005844	Ga0068862_100076125	Ga0068862_1000761252	161
868	3300006038	Ga0075365_10164876	Ga0075365_101648762	161
869	3300006042	Ga0075368_10139417	Ga0075368_101394172	161
870	3300006048	Ga0075363_100020333	Ga0075363_1000203334	161
871	3300006051	Ga0075364_10022055	Ga0075364_100220554	161
872	3300006051	Ga0075364_10726303	Ga0075364_107263032	161
873	3300006058	Ga0075432_10044569	Ga0075432_100445691	161
874	3300006058	Ga0075432_10072557	Ga0075432_100725572	161
875	3300006163	Ga0070715_10081830	Ga0070715_100818302	161
876	3300006177	Ga0075362_10123882	Ga0075362_101238822	161
877	3300006177	Ga0075362_10149471	Ga0075362_101494712	161
878	3300006178	Ga0075367_10282227	Ga0075367_102822271	161
879	3300006186	Ga0075369_10151699	Ga0075369_101516992	161
880	3300006186	Ga0075369_10454454	Ga0075369_104544542	161
881	3300006195	Ga0075366_10012790	Ga0075366_100127905	161
882	3300006195	Ga0075366_10412504	Ga0075366_104125042	161
883	3300006237	Ga0097621_100191556	Ga0097621_1001915562	161
884	3300006237	Ga0097621_100470807	Ga0097621_1004708072	161
885	3300006237	Ga0097621_100810396	Ga0097621_1008103962	161
886	3300006353	Ga0075370_10001537	Ga0075370_1000153711	161
887	3300006353	Ga0075370_10001621	Ga0075370_100016214	161
888	3300006353	Ga0075370_10008851	Ga0075370_100088512	161
889	3300006353	Ga0075370_10016233	Ga0075370_100162333	161
890	3300006358	Ga0068871_100137739	Ga0068871_1001377392	161
891	3300006358	Ga0068871_100845110	Ga0068871_1008451102	161
892	3300006881	Ga0068865_100308975	Ga0068865_1003089752	161
893	3300006946	Ga0079104_1016897	Ga0079104_10168973	161
894	3300006948	Ga0099826_10001427	Ga0099826_100014273	161
895	3300009036	Ga0105244_10004253	Ga0105244_100042534	161
896	3300009093	Ga0105240_10244040	Ga0105240_102440402	161
897	3300009098	Ga0105245_10013798	Ga0105245_100137983	161
898	3300009148	Ga0105243_10007332	Ga0105243_100073324	161
899	3300009148	Ga0105243_10021519	Ga0105243_100215194	161
900	3300009148	Ga0105243_10042085	Ga0105243_100420854	161
901	3300009174	Ga0105241_11420349	Ga0105241_114203492	161
902	3300009545	Ga0105237_10163985	Ga0105237_101639853	161
903	3300009551	Ga0105238_10182798	Ga0105238_101827982	161
904	3300009551	Ga0105238_10224253	Ga0105238_102242532	161
905	3300009553	Ga0105249_11507611	Ga0105249_115076111	161
906	3300010375	Ga0105239_10681570	Ga0105239_106815702	161
907	3300010375	Ga0105239_11515834	Ga0105239_115158341	161
908	3300011119	Ga0105246_10079314	Ga0105246_100793142	161
909	3300011119	Ga0105246_10368339	Ga0105246_103683391	161
910	3300012502	Ga0157347_1001600	Ga0157347_10016003	161
911	3300013100	Ga0157373_10028132	Ga0157373_100281324	161
912	3300013100	Ga0157373_10176428	Ga0157373_101764283	161
913	3300013100	Ga0157373_10501558	Ga0157373_105015582	161
914	3300013102	Ga0157371_10044980	Ga0157371_100449804	161
915	3300013104	Ga0157370_10014616	Ga0157370_1001461610	161
916	3300013105	Ga0157369_10051975	Ga0157369_100519757	161
917	3300013105	Ga0157369_12004484	Ga0157369_120044841	161
918	3300013307	Ga0157372_10526690	Ga0157372_105266902	161
919	3300013308	Ga0157375_10363808	Ga0157375_103638082	161
920	3300014497	Ga0182008_10001867	Ga0182008_100018678	161
921	3300014497	Ga0182008_10024094	Ga0182008_100240943	161
922	3300014497	Ga0182008_10043627	Ga0182008_100436273	161
923	3300014968	Ga0157379_10274229	Ga0157379_102742292	161
924	3300014969	Ga0157376_10171279	Ga0157376_101712792	161
925	3300014969	Ga0157376_11507206	Ga0157376_115072061	161
926	3300015261	Ga0182006_1002593	Ga0182006_10025934	161
927	3300015261	Ga0182006_1014674	Ga0182006_10146743	161
928	3300015261	Ga0182006_1026409	Ga0182006_10264092	161
929	3300015261	Ga0182006_1111041	Ga0182006_11110412	161
930	3300015262	Ga0182007_10001595	Ga0182007_1000159513	161
931	3300015262	Ga0182007_10006343	Ga0182007_100063433	161
932	3300015265	Ga0182005_1254609	Ga0182005_12546091	161
933	3300017792	Ga0163161_10000732	Ga0163161_1000073216	161
934	3300017792	Ga0163161_10014146	Ga0163161_100141468	161
935	3300017792	Ga0163161_10126946	Ga0163161_101269462	161
936	3300017792	Ga0163161_10473385	Ga0163161_104733852	161
937	3300025208	Ga0209436_103123	Ga0209436_1031236	161
938	3300025228	Ga0209672_101495	Ga0209672_1014954	161
939	3300025229	Ga0209147_100506	Ga0209147_1005064	161
940	3300025242	Ga0209258_100133	Ga0209258_10013331	161
941	3300025245	Ga0207425_1052418	Ga0207425_10524181	161
942	3300025254	Ga0209148_1000361	Ga0209148_100036131	161
943	3300025258	Ga0209129_1000033	Ga0209129_100003331	161
944	3300025258	Ga0209129_1001468	Ga0209129_100146811	161
945	3300025258	Ga0209129_1045335	Ga0209129_10453351	161
946	3300025263	Ga0209565_1000088	Ga0209565_100008842	161
947	3300025263	Ga0209565_1001197	Ga0209565_10011977	161
948	3300025273	Ga0209673_1000064	Ga0209673_1000064129	161
949	3300025273	Ga0209673_1001735	Ga0209673_100173517	161
950	3300025273	Ga0209673_1002549	Ga0209673_10025494	161
951	3300025273	Ga0209673_1063108	Ga0209673_10631081	161
952	3300025284	Ga0209130_1000885	Ga0209130_100088518	161
953	3300025284	Ga0209130_1019597	Ga0209130_10195973	161
954	3300025291	Ga0209675_1000036	Ga0209675_1000036129	161
955	3300025291	Ga0209675_1000807	Ga0209675_100080720	161
956	3300025291	Ga0209675_1021217	Ga0209675_10212171	161
957	3300025291	Ga0209675_1061568	Ga0209675_10615682	161
958	3300025292	Ga0209676_1000111	Ga0209676_100011153	161
959	3300025292	Ga0209676_1001516	Ga0209676_100151612	161
960	3300025292	Ga0209676_1032960	Ga0209676_10329603	161
961	3300025292	Ga0209676_1034617	Ga0209676_10346171	161
962	3300025294	Ga0209025_1000424	Ga0209025_100042452	161
963	3300025294	Ga0209025_1001578	Ga0209025_100157823	161
964	3300025294	Ga0209025_1005626	Ga0209025_10056264	161
965	3300025294	Ga0209025_1010062	Ga0209025_10100624	161
966	3300025294	Ga0209025_1036798	Ga0209025_10367982	161
967	3300025295	Ga0209564_1000070	Ga0209564_1000070269	161
968	3300025295	Ga0209564_1000964	Ga0209564_100096431	161
969	3300025297	Ga0209758_1000027	Ga0209758_100002731	161
970	3300025297	Ga0209758_1114402	Ga0209758_11144021	161
971	3300025298	Ga0209050_1000111	Ga0209050_1000111139	161
972	3300025298	Ga0209050_1000571	Ga0209050_100057111	161
973	3300025299	Ga0209256_1000047	Ga0209256_1000047281	161
974	3300025299	Ga0209256_1000903	Ga0209256_100090331	161
975	3300025302	Ga0207426_1000115	Ga0207426_1000115193	161
976	3300025302	Ga0207426_1000742	Ga0207426_100074231	161
977	3300025303	Ga0209051_1000046	Ga0209051_1000046202	161
978	3300025303	Ga0209051_1000344	Ga0209051_100034429	161
979	3300025303	Ga0209051_1000609	Ga0209051_100060927	161
980	3300025303	Ga0209051_1001576	Ga0209051_100157613	161
981	3300025303	Ga0209051_1042625	Ga0209051_10426253	161
982	3300025303	Ga0209051_1114277	Ga0209051_11142772	161
983	3300025304	Ga0209257_1000344	Ga0209257_100034413	161
984	3300025304	Ga0209257_1002876	Ga0209257_100287612	161
985	3300025321	Ga0207656_10062035	Ga0207656_100620352	161
986	3300025728	Ga0207655_1001858	Ga0207655_100185813	161
987	3300025893	Ga0207682_10127055	Ga0207682_101270552	161
988	3300025904	Ga0207647_10138490	Ga0207647_101384902	161
989	3300025907	Ga0207645_10840712	Ga0207645_108407121	161
990	3300025909	Ga0207705_10101310	Ga0207705_101013102	161
991	3300025909	Ga0207705_10405923	Ga0207705_104059232	161
992	3300025913	Ga0207695_10210151	Ga0207695_102101512	161
993	3300025914	Ga0207671_10057853	Ga0207671_100578532	161
994	3300025918	Ga0207662_10335922	Ga0207662_103359221	161
995	3300025924	Ga0207694_10220509	Ga0207694_102205092	161
996	3300025933	Ga0207706_10030940	Ga0207706_100309403	161
997	3300025935	Ga0207709_10000963	Ga0207709_100009637	161
998	3300025935	Ga0207709_10002945	Ga0207709_100029455	161
999	3300025935	Ga0207709_10016461	Ga0207709_100164614	161
1000	3300025937	Ga0207669_10257729	Ga0207669_102577292	161
1001	3300025937	Ga0207669_10284903	Ga0207669_102849032	161
1002	3300025938	Ga0207704_10333248	Ga0207704_103332481	161
1003	3300025940	Ga0207691_10061522	Ga0207691_100615226	161
1004	3300025942	Ga0207689_10298413	Ga0207689_102984132	161
1005	3300025945	Ga0207679_10014954	Ga0207679_100149544	161
1006	3300025949	Ga0207667_10174808	Ga0207667_101748082	161
1007	3300025960	Ga0207651_10691400	Ga0207651_106914002	161
1008	3300025961	Ga0207712_10391951	Ga0207712_103919512	161
1009	3300025972	Ga0207668_10290412	Ga0207668_102904122	161
1010	3300025972	Ga0207668_10593732	Ga0207668_105937321	161
1011	3300025986	Ga0207658_10128854	Ga0207658_101288542	161
1012	3300025986	Ga0207658_10138429	Ga0207658_101384292	161
1013	3300026041	Ga0207639_10204041	Ga0207639_102040412	161
1014	3300026041	Ga0207639_10255329	Ga0207639_102553292	161
1015	3300026067	Ga0207678_10453155	Ga0207678_104531551	161
1016	3300026078	Ga0207702_11198596	Ga0207702_111985961	161
1017	3300026116	Ga0207674_10066465	Ga0207674_100664655	161
1018	3300026116	Ga0207674_10098280	Ga0207674_100982805	161
1019	3300026118	Ga0207675_101796629	Ga0207675_1017966291	161
1020	3300026121	Ga0207683_10050827	Ga0207683_100508272	161
1021	3300026121	Ga0207683_10224158	Ga0207683_102241582	161
1022	3300027666	Ga0209282_1000865	Ga0209282_10008654	161
1023	3300027866	Ga0209813_10160704	Ga0209813_101607042	161
1024	3300028380	Ga0268265_10231755	Ga0268265_102317552	161
1025	3300028794	Ga0307515_10004876	Ga0307515_1000487618	161
1026	3300028794	Ga0307515_10314636	Ga0307515_103146362	161
1027	3300030522	Ga0307512_10151814	Ga0307512_101518142	161
1028	3300030731	Ga0316177_1199377	Ga0316177_11993773	161
1029	3300030732	Ga0316176_1085736	Ga0316176_10857362	161
1030	3300030733	Ga0314311_1117136	Ga0314311_11171363	161
1031	3300030735	Ga0316178_1180757	Ga0316178_11807571	161
1032	3300030736	Ga0316180_1104604	Ga0316180_11046044	161
1033	3300030742	Ga0316183_1024186	Ga0316183_10241862	161
1034	3300030742	Ga0316183_1099097	Ga0316183_10990971	161
1035	3300030744	Ga0316181_1067199	Ga0316181_10671996	161
1036	3300030744	Ga0316181_1206391	Ga0316181_12063912	161
1037	3300030745	Ga0316182_1067857	Ga0316182_10678572	161
1038	3300030745	Ga0316182_1114148	Ga0316182_11141481	161
1039	3300031251	Ga0265327_10158551	Ga0265327_101585512	161
1040	3300031456	Ga0307513_10085877	Ga0307513_100858772	161
1041	3300031548	Ga0307408_100135183	Ga0307408_1001351832	161
1042	3300031548	Ga0307408_100231855	Ga0307408_1002318552	161
1043	3300031616	Ga0307508_10410972	Ga0307508_104109721	161
1044	3300031730	Ga0307516_10016377	Ga0307516_100163779	161
1045	3300031731	Ga0307405_10058285	Ga0307405_100582853	161
1046	3300031731	Ga0307405_10282796	Ga0307405_102827962	161
1047	3300031901	Ga0307406_11875082	Ga0307406_118750821	161
1048	3300031911	Ga0307412_10006128	Ga0307412_100061287	161
1049	3300031911	Ga0307412_10232427	Ga0307412_102324273	161
1050	3300031911	Ga0307412_10644750	Ga0307412_106447501	161
1051	3300031911	Ga0307412_11869218	Ga0307412_118692181	161
1052	3300031995	Ga0307409_100778066	Ga0307409_1007780662	161
1053	3300031995	Ga0307409_101006114	Ga0307409_1010061142	161
1054	3300032002	Ga0307416_100086454	Ga0307416_1000864542	161
1055	3300032002	Ga0307416_100215460	Ga0307416_1002154603	161
1056	3300032004	Ga0307414_10134096	Ga0307414_101340962	161
1057	3300032004	Ga0307414_10744156	Ga0307414_107441562	161
1058	3300032005	Ga0307411_10066307	Ga0307411_100663073	161
1059	3300032005	Ga0307411_10142249	Ga0307411_101422492	161
1060	3300032005	Ga0307411_10379265	Ga0307411_103792652	161
1061	3300037312	Ga0395899_0076269	Ga0395899_0076269_538_1023	161
1062	3300037312	Ga0395899_0116097	Ga0395899_0116097_1067_1552	161
1063	3300037418	Ga0395900_0059363	Ga0395900_0059363_881_1366	161
1064	3300037418	Ga0395900_1249769	Ga0395900_1249769_153_638	161
1065	3300037466	Ga0395898_0092344	Ga0395898_0092344_840_1325	161
1066	3300037471	Ga0395905_0073746	Ga0395905_0073746_174_659	161
1067	3300038443	Ga0395901_0261376	Ga0395901_0261376_551_1036	161
1068	3300038443	Ga0395901_0531034	Ga0395901_0531034_130_615	161
1069	3300041451	Ga0451791_1851378	Ga0451791_1851378_430_915	161
1070	3300041452	Ga0451793_0805557	Ga0451793_0805557_48_533	161
1071	3300041458	Ga0451798_0398128	Ga0451798_0398128_259_744	161
1072	3300041496	Ga0451839_1172020	Ga0451839_1172020_174_659	161
1073	3300041498	Ga0451841_1240371	Ga0451841_1240371_360_845	161
1074	3300041512	Ga0451853_0894343	Ga0451853_0894343_251_736	161
1075	3300042002	Ga0439442_007621	Ga0439442_007621_178_663	161
1076	3300042007	Ga0439449_0036338	Ga0439449_0036338_861_1346	161
1077	3300042007	Ga0439449_0067653	Ga0439449_0067653_541_1026	161
1078	3300042145	Ga0450906_007115	Ga0450906_007115_553_1038	161
1079	3300042435	Ga0439434_0006299	Ga0439434_0006299_2013_2498	161
1080	3300042531	Ga0450918_002310	Ga0450918_002310_1499_1984	161
1081	3300044842	Ga0466957_0081224	Ga0466957_0081224_352_837	161
1082	3300046475	Ga0495639_0004727	Ga0495639_0004727_5181_5666	161
1083	3300046512	Ga0495610_0013658	Ga0495610_0013658_725_1210	161
1084	3300046513	Ga0495616_0001807	Ga0495616_0001807_11909_12394	161
1085	3300046515	Ga0495620_0012871	Ga0495620_0012871_945_1430	161
1086	3300046515	Ga0495620_0034478	Ga0495620_0034478_758_1243	161
1087	3300046518	Ga0495631_0001107	Ga0495631_0001107_13384_13869	161
1088	3300046520	Ga0495637_0011316	Ga0495637_0011316_3626_4111	161
1089	3300046525	Ga0495663_0015540	Ga0495663_0015540_355_840	161
1090	3300046528	Ga0495642_0012170	Ga0495642_0012170_328_813	161
1091	3300046530	Ga0495654_0080254	Ga0495654_0080254_409_894	161
1092	3300046530	Ga0495654_0102468	Ga0495654_0102468_311_796	161
1093	3300046539	Ga0495621_0003254	Ga0495621_0003254_1725_2210	161
1094	3300046543	Ga0495645_0128011	Ga0495645_0128011_882_1442	161
1095	3300046615	Ga0495656_0000042	Ga0495656_0000042_55811_56296	161
1096	3300046615	Ga0495656_0026358	Ga0495656_0026358_1398_1883	161
1097	3300046615	Ga0495656_0082198	Ga0495656_0082198_338_823	161
1098	3300046660	Ga0495625_0000292	Ga0495625_0000292_66501_66986	161
1099	3300046660	Ga0495625_0060870	Ga0495625_0060870_2058_2543	161
1100	3300046660	Ga0495625_0096360	Ga0495625_0096360_911_1396	161
1101	3300046674	Ga0495588_0032656	Ga0495588_0032656_158_643	161
1102	3300046674	Ga0495588_0055894	Ga0495588_0055894_698_1183	161
1103	3300046674	Ga0495588_0079411	Ga0495588_0079411_923_1408	161
1104	3300046674	Ga0495588_0084865	Ga0495588_0084865_298_783	161
1105	3300046678	Ga0495599_0279480	Ga0495599_0279480_386_871	161
1106	3300046683	Ga0495658_0443929	Ga0495658_0443929_301_786	161
1107	3300046684	Ga0495669_0037735	Ga0495669_0037735_534_1019	161
1108	3300046690	Ga0495624_0088241	Ga0495624_0088241_1011_1496	161
1109	3300046691	Ga0495670_0139089	Ga0495670_0139089_546_1031	161
1110	3300046692	Ga0495671_0000735	Ga0495671_0000735_5453_5938	161
1111	3300046809	Ga0495600_0682373	Ga0495600_0682373_85_570	161
1112	3300047318	Ga0495636_0096360	Ga0495636_0096360_597_1082	161
1113	3300047321	Ga0495676_0035241	Ga0495676_0035241_2159_2644	161
1114	3300047445	Ga0495677_0107658	Ga0495677_0107658_215_700	161
1115	3300047445	Ga0495677_0154958	Ga0495677_0154958_53_538	161
1116	3300047447	Ga0495685_129169	Ga0495685_129169_55_540	161
1117	3300047673	Ga0495593_0023102	Ga0495593_0023102_520_1005	161
1118	3300048089	Ga0495614_0007335	Ga0495614_0007335_2474_2959	161
1119	3300048090	Ga0495615_0002882	Ga0495615_0002882_1299_1784	161
1120	3300048090	Ga0495615_0005659	Ga0495615_0005659_655_1140	161
1121	3300048904	Ga0496101_0034397	Ga0496101_0034397_963_1448	161
1122	3300048905	Ga0496102_0098618	Ga0496102_0098618_1052_1537	161
1123	3300048907	Ga0496104_0016743	Ga0496104_0016743_1292_1777	161
1124	3300048908	Ga0496105_0026299	Ga0496105_0026299_2909_3394	161
1125	3300048909	Ga0496106_0042441	Ga0496106_0042441_2125_2610	161
1126	3300048910	Ga0496107_0559655	Ga0496107_0559655_305_790	161
1127	3300048912	Ga0496109_0608066	Ga0496109_0608066_478_963	161
1128	3300048913	Ga0496110_0106959	Ga0496110_0106959_1420_1905	161
1129	3300048914	Ga0496111_0055644	Ga0496111_0055644_1603_2088	161
1130	3300048916	Ga0496113_0301475	Ga0496113_0301475_500_985	161
1131	3300048917	Ga0496114_0104648	Ga0496114_0104648_644_1129	161
1132	3300048919	Ga0496116_0034066	Ga0496116_0034066_2282_2767	161
1133	3300048919	Ga0496116_0321967	Ga0496116_0321967_177_662	161
1134	3300048920	Ga0496117_0003590	Ga0496117_0003590_1108_1593	161
1135	3300048920	Ga0496117_0050000	Ga0496117_0050000_448_933	161
1136	3300048921	Ga0496118_0054249	Ga0496118_0054249_1380_1865	161
1137	3300048921	Ga0496118_0122385	Ga0496118_0122385_210_695	161
1138	3300048924	Ga0496121_0106905	Ga0496121_0106905_277_762	161
1139	3300048925	Ga0496122_0000450	Ga0496122_0000450_8734_9219	161
1140	3300048925	Ga0496122_0128658	Ga0496122_0128658_1021_1506	161
1141	3300048926	Ga0496123_0000176	Ga0496123_0000176_42356_42841	161
1142	3300048926	Ga0496123_0157365	Ga0496123_0157365_673_1158	161
1143	3300048927	Ga0496124_0022345	Ga0496124_0022345_3914_4399	161
1144	3300048927	Ga0496124_0055432	Ga0496124_0055432_120_605	161
1145	3300048927	Ga0496124_0099924	Ga0496124_0099924_900_1385	161
1146	3300048927	Ga0496124_0167568	Ga0496124_0167568_673_1158	161
1147	3300048928	Ga0496125_0008018	Ga0496125_0008018_4728_5213	161
1148	3300048928	Ga0496125_0023106	Ga0496125_0023106_866_1351	161
1149	3300048928	Ga0496125_0198002	Ga0496125_0198002_37_522	161
1150	3300048929	Ga0496126_0142232	Ga0496126_0142232_417_902	161
1151	3300049533	Ga0501317_067326	Ga0501317_067326_16_501	161
1152	3300049573	Ga0501037_0063245	Ga0501037_0063245_2101_2586	161
1153	3300049658	Ga0501211_013205	Ga0501211_013205_157_642	161
1154	3300049759	Ga0501262_001212	Ga0501262_001212_1877_2362	161
1155	3300049822	Ga0501035_0211524	Ga0501035_0211524_87_572	161
1156	3300049823	Ga0501044_0665080	Ga0501044_0665080_94_579	161
1157	3300050489	nmdc:mga03683_114048_c1	nmdc:mga03683_114048_c1_84_569	161
1158	3300050489	nmdc:mga03683_299661_c1	nmdc:mga03683_299661_c1_144_629	161
1159	3300050489	nmdc:mga03683_515932_c1	nmdc:mga03683_515932_c1_49_534	161
1160	3300050490	nmdc:mga03n38_10292_c1	nmdc:mga03n38_10292_c1_268_753	161
1161	3300050490	nmdc:mga03n38_311900_c1	nmdc:mga03n38_311900_c1_249_734	161
1162	3300050491	nmdc:mga00v17_9935_c1	nmdc:mga00v17_9935_c1_1698_2183	161
1163	3300050492	nmdc:mga0yw44_108596_c1	nmdc:mga0yw44_108596_c1_1141_1626	161
1164	3300050492	nmdc:mga0yw44_996993_c1	nmdc:mga0yw44_996993_c1_44_529	161
1165	3300050493	nmdc:mga0k408_15702_c1	nmdc:mga0k408_15702_c1_2946_3431	161
1166	3300050493	nmdc:mga0k408_2422_c1	nmdc:mga0k408_2422_c1_3269_3754	161
1167	3300050493	nmdc:mga0k408_75849_c1	nmdc:mga0k408_75849_c1_489_974	161
1168	3300050494	nmdc:mga06z11_127155_c1	nmdc:mga06z11_127155_c1_531_1016	161
1169	3300050494	nmdc:mga06z11_76629_c1	nmdc:mga06z11_76629_c1_574_1059	161
1170	3300050496	nmdc:mga07m45_12087_c1	nmdc:mga07m45_12087_c1_3233_3718	161
1171	3300050496	nmdc:mga07m45_17177_c1	nmdc:mga07m45_17177_c1_1638_2123	161
1172	3300050496	nmdc:mga07m45_61819_c1	nmdc:mga07m45_61819_c1_772_1257	161
1173	3300050496	nmdc:mga07m45_679_c1	nmdc:mga07m45_679_c1_13295_13780	161
1174	3300050496	nmdc:mga07m45_9696_c1	nmdc:mga07m45_9696_c1_2617_3102	161
1175	3300050516	nmdc:mga0sz30_20000_c1	nmdc:mga0sz30_20000_c1_526_1011	161
1176	3300053087	Ga0500643_048836	Ga0500643_048836_319_804	161
1177	3300053093	Ga0500651_0000060	Ga0500651_0000060_48216_48701	161
1178	3300053093	Ga0500651_0203613	Ga0500651_0203613_403_888	161
1179	3300053103	Ga0500555_048355	Ga0500555_048355_298_783	161
1180	3300053110	Ga0500571_000072	Ga0500571_000072_14536_15021	161
1181	3300053111	Ga0500572_062198	Ga0500572_062198_406_891	161
1182	3300053118	Ga0500594_0002589	Ga0500594_0002589_2924_3409	161
1183	3300053120	Ga0500597_029480	Ga0500597_029480_1584_2069	161
1184	3300053121	Ga0500607_001318	Ga0500607_001318_19314_19799	161
1185	3300053122	Ga0500608_006152	Ga0500608_006152_1322_1807	161
1186	3300053128	Ga0500626_064851	Ga0500626_064851_884_1369	161
1187	3300053129	Ga0500628_035094	Ga0500628_035094_269_754	161
1188	3300053133	Ga0500655_000073	Ga0500655_000073_17544_18029	161
1189	3300053134	Ga0500658_0010338	Ga0500658_0010338_2770_3255	161
1190	3300053139	Ga0500568_0000566	Ga0500568_0000566_15061_15546	161
1191	3300053141	Ga0500574_000263	Ga0500574_000263_3482_3967	161
1192	3300053153	Ga0500616_0103361	Ga0500616_0103361_71_556	161
1193	3300053158	Ga0500627_0000611	Ga0500627_0000611_210_695	161
1194	3300053161	Ga0500634_0088121	Ga0500634_0088121_642_1127	161
1195	3300053162	Ga0500638_025339	Ga0500638_025339_637_1122	161

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04461

DUF520

Protein of unknown function (DUF520)

27

187

1 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
5b7w-assembly2.cif.gz_B	crystal structure of the yajq-family protein xc_3703 from xanthomonas campestris pv.campestris	0.8947	1	161
1in0-assembly2.cif.gz_B	yajq protein (hi1034)	0.8936	2	161
1in0-assembly2.cif.gz_B	yajq protein (hi1034)	0.8835	2	161
4pwu-assembly2.cif.gz_C	crystal structure of a modulator protein mzra (kpn_03524) from klebsiella pneumoniae subsp. pneumoniae mgh 78578 at 2.45 a resolution	0.7157	99	156
2n2u-assembly1.cif.gz_A	solution nmr structure of de novo designed ferredoxin fold protein sfr3, northeast structural genomics consortium (nesg) target or358	0.7107	101	158

ID	Description	Score	Start	End	Superfamily
1in0B01	Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;	0.9591	99	161	3.30.70.860
1in0A02	Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;YajQ-like, domain 2	0.9228	9	96	3.30.70.990
af_P9WFK9_11_96_3.30.70.990	Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;YajQ-like, domain 2	0.9092	11	93	3.30.70.990
5b7wB02	Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;YajQ-like, domain 2	0.9076	9	98	3.30.70.990
5b7wB02	Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;YajQ-like, domain 2	0.8982	9	98	3.30.70.990

ID	Description	Score	Start	End	GO Terms
AF-A0A259DGR8-F1-model_v4	YajQ family cyclic di-GMP-binding protein	0.9978	99	161	GO:0000166 GO:0005829
AF-A0A0F2IX68-F1-model_v4	deleted	0.9956	101	161
AF-A0A520FJA4-F1-model_v4	DUF520 family protein	0.9917	99	161	GO:0000166 GO:0005829
AF-U5N5A1-F1-model_v4	UPF0234 protein Cenrod_0406	0.9872	1	161	GO:0000166 GO:0005829
AF-A0A520G4M7-F1-model_v4	YajQ family cyclic di-GMP-binding protein	0.9803	1	131	GO:0000166 GO:0005829

Feature Viewer

pLDDT	pTM	Quality
96.47	0.85	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F491508

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF04461

DUF520

Protein of unknown function (DUF520)

27

187

1

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map