metagRoot

F491443

General Info

Members	Datasets	Scaffolds	Average Seq Length
1190	448	2380	245

Family's Representative Sequence

Representative Sequence	3300005471\|Ga0070698_100295511\|Ga0070698_1002955111
Length	302
Sequence	MPGTQSSLRRLRKLVCVPGIHAFLCCDKDVDGRDTSAFTRIFRRAIPGHDAAGWATPMSPDPTPIEPLVAVEDVHTYYGKSHILHGVSLVVGKGEVVGLLGRNGVGKSTTLKTIMGLVHPSEGKVLLEGKPIASFPAHKLARLGIGYVPEDRRIFRLLTVMENLRTGLDRHGVSETRKQELLDKVFAYFPVLAERRSQAGGTLSGGEQQMLAIARAMMLEPKIILLDEPTEGLMPRMVSQIREIIDVLHKEGVAILLVEQNVPLTLAASQRVYIMEKGAVRHHCAASELNVNDPIIQQYLGV

Samples

	Sample ID	Description	Type	Environment
1	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
2	2209111006	Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1	Metagenome	Rhizosphere
3	3300000042	Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young	Metagenome	Rhizosphere
4	3300000043	Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere	Metagenome	Rhizosphere
5	3300000044	Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old	Metagenome	Rhizosphere
6	3300000652	Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA	Metagenome	Rhizosphere
7	3300001977	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5	Metagenome	Rhizosphere
8	3300001978	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6	Metagenome	Rhizosphere
9	3300001989	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5	Metagenome	Rhizosphere
10	3300001990	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3	Metagenome	Rhizosphere
11	3300002070	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4	Metagenome	Rhizosphere
12	3300002073	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4	Metagenome	Rhizosphere
13	3300002074	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1	Metagenome	Rhizosphere
14	3300002075	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4	Metagenome	Rhizosphere
15	3300002076	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3	Metagenome	Rhizosphere
16	3300002077	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3	Metagenome	Rhizosphere
17	3300002126	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5	Metagenome	Rhizosphere
18	3300002155	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7	Metagenome	Rhizosphere
19	3300002244	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1	Metagenome	Rhizosphere
20	3300003215	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF	Metagenome	Endosphere
21	3300003371	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM	Metagenome	Rhizosphere
22	3300003911	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
23	3300005276	Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1	Metagenome	Rhizosphere
24	3300005290	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3)	Metagenome	Rhizosphere
25	3300005293	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
26	3300005295	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2)	Metagenome	Rhizosphere
27	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
28	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
29	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
30	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
31	3300005333	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG	Metagenome	Rhizosphere
32	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
33	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
34	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
35	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
36	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
37	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
38	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
39	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
40	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
41	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
42	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
43	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
44	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
45	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
46	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
47	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
48	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
49	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
50	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
51	3300005406	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG	Metagenome	Rhizosphere
52	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
53	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
54	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
55	3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Metagenome	Rhizosphere
56	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
57	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
58	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
59	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
60	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
61	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
62	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
63	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
64	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
65	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
66	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
67	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
68	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
69	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
70	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
71	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
72	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
73	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
74	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
75	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
76	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
77	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
78	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
79	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
80	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
81	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
82	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
83	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
84	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
85	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
86	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
87	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
88	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
89	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
90	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
91	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
92	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
93	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
94	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
95	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
96	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
97	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
98	3300005981	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1	Metagenome	Rhizosphere
99	3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
100	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
101	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
102	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
103	3300006042	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3	Metagenome	Endosphere
104	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
105	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
106	3300006058	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1	Metagenome	Rhizosphere
107	3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Metagenome	Rhizosphere
108	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
109	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
110	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
111	3300006194	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1	Metagenome	Rhizosphere
112	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
113	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
114	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
115	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
116	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
117	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
118	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
119	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
120	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
121	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
122	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
123	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
124	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
125	3300007265	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1	Metagenome	Rhizosphere
126	3300007788	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2	Metagenome	Rhizosphere
127	3300009011	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG	Metagenome	Rhizosphere
128	3300009036	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG	Metagenome	Rhizosphere
129	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
130	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
131	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
132	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
133	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
134	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
135	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
136	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
137	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
138	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
139	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
140	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
141	3300010159	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3	Metagenome	Rhizosphere
142	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
143	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
144	3300012481	Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610	Metagenome	Rhizosphere
145	3300012507	Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610	Metagenome	Rhizosphere
146	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
147	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
148	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
149	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
150	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
151	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
152	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
153	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
154	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
155	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
156	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
157	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
158	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
159	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
160	3300015262	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG	Metagenome	Rhizosphere
161	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
162	3300021358	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3	Metagenome	Rhizosphere
163	3300021441	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1	Metagenome	Rhizosphere
164	3300024225	Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5	Metagenome	Rhizosphere
165	3300024227	Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4	Metagenome	Rhizosphere
166	3300025271	Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2)	Metagenome	Rhizosphere
167	3300025290	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2)	Metagenome	Rhizosphere
168	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
169	3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2)	Metagenome	Rhizosphere
170	3300025885	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
171	3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
172	3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
173	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
174	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
175	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
176	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
177	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
178	3300025905	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
179	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
180	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
181	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
182	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
183	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
184	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
185	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
186	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
187	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
188	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
189	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
190	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
191	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
192	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
193	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
194	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
195	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
196	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
197	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
198	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
199	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
200	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
201	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
202	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
203	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
204	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
205	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
206	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
207	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
208	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
209	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
210	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
211	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
212	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
213	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
214	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
215	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
216	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
217	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
218	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
219	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
220	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
221	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
222	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
223	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
224	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
225	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
226	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
227	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
228	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
229	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
230	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
231	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
232	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
233	3300027360	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2)	Metagenome	Rhizosphere
234	3300027364	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2)	Metagenome	Rhizosphere
235	3300027378	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2)	Metagenome	Rhizosphere
236	3300027395	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2)	Metagenome	Rhizosphere
237	3300027424	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
238	3300027526	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2)	Metagenome	Rhizosphere
239	3300027543	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2)	Metagenome	Rhizosphere
240	3300027552	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2)	Metagenome	Rhizosphere
241	3300027614	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2)	Metagenome	Rhizosphere
242	3300027617	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2)	Metagenome	Rhizosphere
243	3300027665	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
244	3300027671	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2)	Metagenome	Rhizosphere
245	3300027682	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2)	Metagenome	Rhizosphere
246	3300027695	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2)	Metagenome	Rhizosphere
247	3300027717	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
248	3300027876	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
249	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
250	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
251	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
252	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
253	3300028556	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG	Metagenome	Rhizosphere
254	3300030763	Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
255	3300031090	Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
256	3300031241	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG	Metagenome	Rhizosphere
257	3300031249	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG	Metagenome	Rhizosphere
258	3300031344	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG	Metagenome	Rhizosphere
259	3300031595	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG	Metagenome	Rhizosphere
260	3300031691	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA	Metagenome	Rhizosphere
261	3300031712	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG	Metagenome	Rhizosphere
262	3300034816	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3	Metagenome	Rhizosphere
263	3300034817	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1	Metagenome	Rhizosphere
264	3300034819	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1	Metagenome	Rhizosphere
265	3300034820	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2	Metagenome	Rhizosphere
266	3300034957	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2	Metagenome	Rhizosphere
267	3300035083	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17	Metagenome	Rhizosphere
268	3300035084	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1	Metagenome	Rhizosphere
269	3300035085	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2	Metagenome	Rhizosphere
270	3300035088	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4	Metagenome	Rhizosphere
271	3300035089	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2	Metagenome	Rhizosphere
272	3300035090	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2	Metagenome	Rhizosphere
273	3300035092	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11	Metagenome	Rhizosphere
274	3300035111	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11	Metagenome	Rhizosphere
275	3300035112	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16	Metagenome	Rhizosphere
276	3300035113	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12	Metagenome	Rhizosphere
277	3300035114	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3	Metagenome	Rhizosphere
278	3300035115	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11	Metagenome	Rhizosphere
279	3300035116	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3	Metagenome	Rhizosphere
280	3300035117	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1	Metagenome	Rhizosphere
281	3300035118	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2	Metagenome	Rhizosphere
282	3300035119	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4	Metagenome	Rhizosphere
283	3300035120	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5	Metagenome	Rhizosphere
284	3300035121	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3	Metagenome	Rhizosphere
285	3300035170	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1	Metagenome	Rhizosphere
286	3300035171	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4	Metagenome	Rhizosphere
287	3300035172	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3	Metagenome	Rhizosphere
288	3300035207	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16	Metagenome	Rhizosphere
289	3300035241	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4	Metagenome	Rhizosphere
290	3300035242	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11	Metagenome	Rhizosphere
291	3300035410	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12	Metagenome	Rhizosphere
292	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
293	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
294	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
295	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
296	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
297	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
298	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
299	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
300	3300037853	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2	Metagenome	Unclassified
301	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
302	3300038698	Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15	Metagenome	Rhizosphere
303	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
304	3300039438	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2	Metagenome	Rhizosphere
305	3300039447	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2	Metagenome	Rhizosphere
306	3300039453	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2	Metagenome	Rhizosphere
307	3300042016	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357	Metagenome	Rhizosphere
308	3300042125	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472	Metagenome	Rhizosphere
309	3300042144	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89	Metagenome	Rhizosphere
310	3300042157	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210	Metagenome	Rhizosphere
311	3300042436	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520	Metagenome	Rhizosphere
312	3300042438	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533	Metagenome	Rhizosphere
313	3300042439	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363	Metagenome	Rhizosphere
314	3300042461	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366	Metagenome	Rhizosphere
315	3300042876	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED	Metagenome	Rhizosphere
316	3300044673	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED	Metagenome	Rhizosphere
317	3300044712	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED	Metagenome	Rhizosphere
318	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
319	3300045836	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R	Metagenome	Rhizosphere
320	3300046452	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere	Metagenome	Rhizosphere
321	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
322	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
323	3300046458	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere	Metagenome	Rhizosphere
324	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
325	3300046461	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere	Metagenome	Rhizosphere
326	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
327	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
328	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
329	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
330	3300046475	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere	Metagenome	Rhizosphere
331	3300046476	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere	Metagenome	Rhizosphere
332	3300046477	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere	Metagenome	Rhizosphere
333	3300046491	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere	Metagenome	Rhizosphere
334	3300046492	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere	Metagenome	Rhizosphere
335	3300046501	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere	Metagenome	Rhizosphere
336	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
337	3300046514	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere	Metagenome	Rhizosphere
338	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
339	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
340	3300046520	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere	Metagenome	Rhizosphere
341	3300046523	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere	Metagenome	Rhizosphere
342	3300046525	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere	Metagenome	Rhizosphere
343	3300046526	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere	Metagenome	Rhizosphere
344	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
345	3300046531	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere	Metagenome	Rhizosphere
346	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
347	3300046535	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere	Metagenome	Rhizosphere
348	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
349	3300046537	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere	Metagenome	Rhizosphere
350	3300046538	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere	Metagenome	Rhizosphere
351	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
352	3300046557	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere	Metagenome	Rhizosphere
353	3300046558	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere	Metagenome	Rhizosphere
354	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
355	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
356	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
357	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
358	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
359	3300046664	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere	Metagenome	Rhizosphere
360	3300046665	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere	Metagenome	Rhizosphere
361	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
362	3300046678	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere	Metagenome	Rhizosphere
363	3300046679	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere	Metagenome	Rhizosphere
364	3300046680	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere	Metagenome	Rhizosphere
365	3300046681	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere	Metagenome	Rhizosphere
366	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
367	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
368	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
369	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
370	3300046794	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere	Metagenome	Rhizosphere
371	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
372	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
373	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
374	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
375	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
376	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
377	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
378	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
379	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
380	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
381	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
382	3300048089	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere	Metagenome	Rhizosphere
383	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
384	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
385	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
386	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
387	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
388	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
389	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
390	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
391	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
392	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
393	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
394	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
395	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
396	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
397	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
398	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
399	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
400	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
401	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
402	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
403	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
404	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
405	3300049577	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02	Metagenome	Rhizosphere
406	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
407	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
408	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
409	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
410	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
411	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
412	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
413	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
414	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
415	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
416	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
417	3300049591	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03	Metagenome	Rhizosphere
418	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
419	3300049593	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02	Metagenome	Rhizosphere
420	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
421	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
422	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
423	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
424	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
425	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
426	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
427	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
428	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
429	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
430	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
431	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
432	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
433	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
434	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
435	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
436	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
437	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
438	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
439	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
440	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
441	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
442	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
443	3300053078	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere	Metagenome	Rhizosphere
444	3300053084	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere	Metagenome	Rhizosphere
445	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
446	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
447	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
448	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	99.83
Metatranscriptomes	0.17
Isolates	0

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	2.1
Nodule	0
Rhizoplane	6.97
Rhizosphere	90.67
Stem	0
Stem Tuber	0
Unclassified	0

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	Ga0070698_100295511	3300005471	Bacteria	1551
2	2214600498	2209111006	Bacteria	5406
3	ARSoilYngRDRAFT_c00160	3300000042	Bacteria	11561
4	ARcpr5yngRDRAFT_c000030	3300000043	Bacteria	23301
5	ARSoilOldRDRAFT_c000033	3300000044	Bacteria	30681
6	ARCol0yngRDRAFT_1000078	3300000652	Bacteria	18395
7	JGI24746J21847_1010903	3300001977	Bacteria	1341
8	JGI24747J21853_1007940	3300001978	Bacteria	1029
9	JGI24739J22299_10002387	3300001989	Bacteria	7244
10	JGI24737J22298_10002611	3300001990	Bacteria	6375
11	JGI24750J21931_1000579	3300002070	Bacteria	5590
12	JGI24745J21846_1000593	3300002073	Bacteria	3249
13	JGI24748J21848_1004750	3300002074	Bacteria	1564
14	JGI24738J21930_10000453	3300002075	Bacteria	11626
15	JGI24749J21850_1004751	3300002076	Bacteria	1903
16	JGI24744J21845_10008958	3300002077	Bacteria	2057
17	JGI24035J26624_1000356	3300002126	Bacteria	4312
18	JGI24033J26618_1002015	3300002155	Bacteria	2042
19	JGI24742J22300_10000426	3300002244	Bacteria	6220
20	JGI25153J46596_10001355	3300003215	Bacteria	14656
21	JGI26145J50221_1004715	3300003371	Bacteria	1110
22	JGI25405J52794_10000335	3300003911	Bacteria	6547
23	Ga0065717_1002042	3300005276	Bacteria	3314
24	Ga0065712_10002685	3300005290	Bacteria	12949
25	Ga0065715_10005190	3300005293	Bacteria	10244
26	Ga0065715_10092065	3300005293	Bacteria	5355
27	Ga0065715_10095212	3300005293	Bacteria	4138
28	Ga0065707_10101569	3300005295	Bacteria	2835
29	Ga0070676_10002407	3300005328	Bacteria	9583
30	Ga0070676_10007057	3300005328	Bacteria	6013
31	Ga0070676_10125464	3300005328	Bacteria	1617
32	Ga0070683_100004780	3300005329	Bacteria	11211
33	Ga0070690_100000577	3300005330	Bacteria	18482
34	Ga0070690_100140473	3300005330	Bacteria	1639
35	Ga0070670_100012134	3300005331	Bacteria	7370
36	Ga0070670_100026119	3300005331	Bacteria	5027
37	Ga0070677_10000943	3300005333	Bacteria	9437
38	Ga0068869_100000679	3300005334	Bacteria	19236
39	Ga0068869_100000973	3300005334	Bacteria	16672
40	Ga0070680_100017320	3300005336	Bacteria	5678
41	Ga0070680_100055396	3300005336	Bacteria	3240
42	Ga0070680_100062248	3300005336	Bacteria	3055
43	Ga0070680_100185423	3300005336	Bacteria	1753
44	Ga0070682_100000467	3300005337	Bacteria	25434
45	Ga0070682_100002906	3300005337	Bacteria	9504
46	Ga0068868_100000892	3300005338	Bacteria	20293
47	Ga0068868_100062551	3300005338	Bacteria	2950
48	Ga0070660_100000369	3300005339	Bacteria	30058
49	Ga0070660_100003390	3300005339	Bacteria	10962
50	Ga0070689_100002855	3300005340	Bacteria	11357
51	Ga0070689_100033685	3300005340	Bacteria	3904
52	Ga0070689_100117634	3300005340	Bacteria	2120
53	Ga0070689_100334453	3300005340	Bacteria	1267
54	Ga0070691_10001992	3300005341	Bacteria	9004
55	Ga0070691_10014721	3300005341	Bacteria	3590
56	Ga0070687_100000895	3300005343	Bacteria	10044
57	Ga0070687_100008379	3300005343	Bacteria	4377
58	Ga0070661_100000449	3300005344	Bacteria	31415
59	Ga0070661_100000804	3300005344	Bacteria	22558
60	Ga0070692_10000830	3300005345	Bacteria	10335
61	Ga0070692_10009315	3300005345	Bacteria	4426
62	Ga0070668_100005596	3300005347	Bacteria	9317
63	Ga0070668_100127963	3300005347	Bacteria	2036
64	Ga0070668_100142910	3300005347	Bacteria	1930
65	Ga0070669_100010788	3300005353	Bacteria	6485
66	Ga0070675_100007817	3300005354	Bacteria	8286
67	Ga0070675_100007876	3300005354	Bacteria	8256
68	Ga0070675_100679722	3300005354	Bacteria	937
69	Ga0070671_100000144	3300005355	Bacteria	46097
70	Ga0070671_100028902	3300005355	Bacteria	4568
71	Ga0070674_100003771	3300005356	Bacteria	8557
72	Ga0070674_100070743	3300005356	Bacteria	2466
73	Ga0070674_100104546	3300005356	Bacteria	2069
74	Ga0070673_100007016	3300005364	Bacteria	7385
75	Ga0070673_100029612	3300005364	Bacteria	4085
76	Ga0070673_100054584	3300005364	Bacteria	3143
77	Ga0070673_100174210	3300005364	Bacteria	1838
78	Ga0070673_100485165	3300005364	Bacteria	1116
79	Ga0070688_100011365	3300005365	Bacteria	4945
80	Ga0070688_100031244	3300005365	Bacteria	3202
81	Ga0070688_100243715	3300005365	Bacteria	1277
82	Ga0070659_100004686	3300005366	Bacteria	9759
83	Ga0070659_100005098	3300005366	Bacteria	9424
84	Ga0070667_100003448	3300005367	Bacteria	13475
85	Ga0070667_100100919	3300005367	Bacteria	2492
86	Ga0070703_10046906	3300005406	Bacteria	1367
87	Ga0070709_10292929	3300005434	Bacteria	1186
88	Ga0070714_100024062	3300005435	Bacteria	5010
89	Ga0070714_100154613	3300005435	Bacteria	2070
90	Ga0070714_100175469	3300005435	Bacteria	1947
91	Ga0070714_100251988	3300005435	Bacteria	1633
92	Ga0070713_100014908	3300005436	Bacteria	5786
93	Ga0070713_100029068	3300005436	Bacteria	4372
94	Ga0070713_100125280	3300005436	Bacteria	2258
95	Ga0070713_100139308	3300005436	Bacteria	2147
96	Ga0070713_100291677	3300005436	Bacteria	1499
97	Ga0070713_100678771	3300005436	Bacteria	983
98	Ga0070710_10019293	3300005437	Bacteria	3521
99	Ga0070710_10071882	3300005437	Bacteria	1996
100	Ga0070710_10117706	3300005437	Bacteria	1604
101	Ga0070710_10306704	3300005437	Bacteria	1038
102	Ga0070701_10000951	3300005438	Bacteria	10493
103	Ga0070701_10258902	3300005438	Bacteria	1054
104	Ga0070711_100463897	3300005439	Bacteria	1039
105	Ga0070705_100000292	3300005440	Bacteria	29837
106	Ga0070705_100003034	3300005440	Bacteria	8286
107	Ga0070705_100343491	3300005440	Bacteria	1086
108	Ga0070700_100001925	3300005441	Bacteria	10503
109	Ga0070694_100001870	3300005444	Bacteria	12458
110	Ga0070694_100003035	3300005444	Bacteria	10000
111	Ga0070694_100004146	3300005444	Bacteria	8713
112	Ga0070694_100006591	3300005444	Bacteria	7055
113	Ga0070694_100036734	3300005444	Bacteria	3246
114	Ga0070708_100108366	3300005445	Bacteria	2551
115	Ga0070708_100161751	3300005445	Bacteria	2086
116	Ga0070708_100252916	3300005445	Bacteria	1655
117	Ga0070708_100281624	3300005445	Bacteria	1565
118	Ga0070708_100451638	3300005445	Bacteria	1213
119	Ga0070708_100458932	3300005445	Bacteria	1202
120	Ga0070663_100003836	3300005455	Bacteria	8749
121	Ga0070663_100008331	3300005455	Bacteria	6370
122	Ga0070663_100092786	3300005455	Bacteria	2239
123	Ga0070678_100010321	3300005456	Bacteria	5698
124	Ga0070678_100014729	3300005456	Bacteria	4945
125	Ga0070678_100082297	3300005456	Bacteria	2443
126	Ga0070662_100009476	3300005457	Bacteria	6370
127	Ga0070662_100010201	3300005457	Bacteria	6160
128	Ga0070662_100011706	3300005457	Bacteria	5790
129	Ga0070662_100079907	3300005457	Bacteria	2433
130	Ga0070681_10012385	3300005458	Bacteria	8458
131	Ga0070681_10049870	3300005458	Bacteria	4178
132	Ga0070681_10069132	3300005458	Bacteria	3498
133	Ga0070681_10292449	3300005458	Bacteria	1539
134	Ga0068867_100011042	3300005459	Bacteria	6370
135	Ga0068867_100070341	3300005459	Bacteria	2616
136	Ga0068867_100597464	3300005459	Bacteria	962
137	Ga0070685_10025949	3300005466	Bacteria	3227
138	Ga0070685_10099271	3300005466	Bacteria	1775
139	Ga0070706_100029875	3300005467	Bacteria	5020
140	Ga0070706_100041402	3300005467	Bacteria	4253
141	Ga0070706_100126534	3300005467	Bacteria	2383
142	Ga0070706_100315025	3300005467	Bacteria	1459
143	Ga0070706_100325006	3300005467	Bacteria	1434
144	Ga0070707_100034910	3300005468	Bacteria	4795
145	Ga0070707_100261558	3300005468	Bacteria	1683
146	Ga0070698_100010422	3300005471	Bacteria	9924
147	Ga0070698_100049507	3300005471	Bacteria	4288
148	Ga0070698_100068558	3300005471	Bacteria	3564
149	Ga0070698_100262767	3300005471	Bacteria	1658
150	Ga0070698_100300648	3300005471	Bacteria	1535
151	Ga0070699_100005647	3300005518	Bacteria	10954
152	Ga0070699_100007440	3300005518	Bacteria	9530
153	Ga0070699_100073025	3300005518	Bacteria	2985
154	Ga0070679_100019238	3300005530	Bacteria	6636
155	Ga0070679_100039784	3300005530	Bacteria	4674
156	Ga0070684_100001753	3300005535	Bacteria	15811
157	Ga0070684_100042779	3300005535	Bacteria	3912
158	Ga0070684_100074944	3300005535	Bacteria	2984
159	Ga0070684_100527461	3300005535	Bacteria	1095
160	Ga0070697_100012191	3300005536	Bacteria	6733
161	Ga0070697_100024096	3300005536	Bacteria	4844
162	Ga0070697_100165450	3300005536	Bacteria	1870
163	Ga0070697_100229202	3300005536	Bacteria	1584
164	Ga0070697_100285542	3300005536	Bacteria	1416
165	Ga0070697_100296413	3300005536	Bacteria	1390
166	Ga0068853_100005560	3300005539	Bacteria	9891
167	Ga0068853_100005853	3300005539	Bacteria	9685
168	Ga0068853_100016265	3300005539	Bacteria	6121
169	Ga0070672_100012405	3300005543	Bacteria	5981
170	Ga0070686_100000086	3300005544	Bacteria	65438
171	Ga0070686_100005092	3300005544	Bacteria	7256
172	Ga0070686_100056253	3300005544	Bacteria	2522
173	Ga0070695_100002332	3300005545	Bacteria	10891
174	Ga0070695_100003402	3300005545	Bacteria	9305
175	Ga0070695_100007717	3300005545	Bacteria	6370
176	Ga0070695_100011294	3300005545	Bacteria	5341
177	Ga0070696_100004489	3300005546	Bacteria	9315
178	Ga0070696_100011694	3300005546	Bacteria	5882
179	Ga0070693_100000164	3300005547	Bacteria	30801
180	Ga0070693_100002732	3300005547	Bacteria	8124
181	Ga0070693_100104282	3300005547	Bacteria	1733
182	Ga0070665_100065324	3300005548	Bacteria	3650
183	Ga0070704_100000280	3300005549	Bacteria	22434
184	Ga0070704_100005441	3300005549	Bacteria	7416
185	Ga0068855_100004461	3300005563	Bacteria	17109
186	Ga0068855_100027435	3300005563	Bacteria	6811
187	Ga0068855_100063461	3300005563	Bacteria	4311
188	Ga0070664_100008530	3300005564	Bacteria	8286
189	Ga0070664_100044537	3300005564	Bacteria	3747
190	Ga0070664_100188364	3300005564	Bacteria	1837
191	Ga0068857_100019723	3300005577	Bacteria	5922
192	Ga0068857_100037351	3300005577	Bacteria	4302
193	Ga0068857_100068077	3300005577	Bacteria	3170
194	Ga0068857_100357896	3300005577	Bacteria	1353
195	Ga0068854_100000497	3300005578	Bacteria	23919
196	Ga0068854_100003207	3300005578	Bacteria	10203
197	Ga0068856_100010687	3300005614	Bacteria	8918
198	Ga0068856_100015657	3300005614	Bacteria	7331
199	Ga0068856_100104855	3300005614	Bacteria	2821
200	Ga0070702_100102886	3300005615	Bacteria	1755
201	Ga0070702_100103222	3300005615	Bacteria	1753
202	Ga0068859_100009076	3300005617	Bacteria	10044
203	Ga0068859_100018036	3300005617	Bacteria	7092
204	Ga0068859_100054157	3300005617	Bacteria	4034
205	Ga0068859_100149718	3300005617	Bacteria	2410
206	Ga0068864_100001754	3300005618	Bacteria	17838
207	Ga0068864_100002526	3300005618	Bacteria	15117
208	Ga0068864_100258653	3300005618	Bacteria	1619
209	Ga0068864_100594321	3300005618	Bacteria	1073
210	Ga0068866_10001865	3300005718	Bacteria	8828
211	Ga0068866_10096029	3300005718	Bacteria	1625
212	Ga0068866_10233314	3300005718	Bacteria	1117
213	Ga0068866_10422942	3300005718	Bacteria	865
214	Ga0068861_100007774	3300005719	Bacteria	7366
215	Ga0068861_100012371	3300005719	Bacteria	5950
216	Ga0068861_100034303	3300005719	Bacteria	3752
217	Ga0068861_100050762	3300005719	Bacteria	3146
218	Ga0068870_10000419	3300005840	Bacteria	15983
219	Ga0068870_10018600	3300005840	Bacteria	3357
220	Ga0068863_100000340	3300005841	Bacteria	47641
221	Ga0068863_100068996	3300005841	Bacteria	3343
222	Ga0068863_100794089	3300005841	Bacteria	944
223	Ga0068858_100009413	3300005842	Bacteria	9322
224	Ga0068860_100033304	3300005843	Bacteria	4945
225	Ga0068860_100121656	3300005843	Bacteria	2500
226	Ga0068860_100408896	3300005843	Bacteria	1343
227	Ga0068860_100723324	3300005843	Bacteria	1006
228	Ga0068862_100006116	3300005844	Bacteria	10017
229	Ga0068862_100056602	3300005844	Bacteria	3360
230	Ga0068862_100061701	3300005844	Bacteria	3223
231	Ga0068862_100066392	3300005844	Bacteria	3109
232	Ga0081455_10000007	3300005937	Bacteria	269394
233	Ga0081455_10000371	3300005937	Bacteria	59407
234	Ga0081455_10000788	3300005937	Bacteria	40708
235	Ga0081455_10004553	3300005937	Bacteria	15475
236	Ga0081455_10053071	3300005937	Bacteria	3465
237	Ga0081455_10179750	3300005937	Bacteria	1603
238	Ga0081538_10014227	3300005981	Bacteria	6242
239	Ga0081538_10024923	3300005981	Bacteria	4242
240	Ga0081540_1000604	3300005983	Bacteria	34243
241	Ga0081540_1006112	3300005983	Bacteria	8845
242	Ga0081540_1038399	3300005983	Bacteria	2524
243	Ga0081540_1048502	3300005983	Bacteria	2126
244	Ga0081539_10103808	3300005985	Bacteria	1444
245	Ga0070717_10006270	3300006028	Bacteria	8734
246	Ga0070717_10050726	3300006028	Bacteria	3411
247	Ga0070717_10131111	3300006028	Bacteria	2155
248	Ga0070717_10147315	3300006028	Bacteria	2034
249	Ga0075365_10004953	3300006038	Bacteria	7125
250	Ga0075368_10030244	3300006042	Bacteria	2096
251	Ga0075363_100005500	3300006048	Bacteria	5646
252	Ga0075364_10014387	3300006051	Bacteria	4888
253	Ga0075432_10008949	3300006058	Bacteria	3413
254	Ga0075432_10017928	3300006058	Bacteria	2414
255	Ga0070715_10020204	3300006163	Bacteria	2565
256	Ga0070715_10025480	3300006163	Bacteria	2343
257	Ga0070716_100007236	3300006173	Bacteria	5458
258	Ga0070712_100000165	3300006175	Bacteria	35992
259	Ga0070712_100023832	3300006175	Bacteria	4047
260	Ga0070712_100229762	3300006175	Bacteria	1473
261	Ga0075367_10004355	3300006178	Bacteria	6900
262	Ga0075367_10025883	3300006178	Bacteria	3321
263	Ga0075367_10299599	3300006178	Bacteria	1012
264	Ga0075427_10000264	3300006194	Bacteria	5650
265	Ga0075366_10000798	3300006195	Bacteria	15087
266	Ga0075366_10176076	3300006195	Bacteria	1299
267	Ga0097621_100000880	3300006237	Bacteria	21059
268	Ga0068871_100006040	3300006358	Bacteria	8523
269	Ga0075428_100001723	3300006844	Bacteria	23380
270	Ga0075428_100001793	3300006844	Bacteria	22956
271	Ga0075428_100207998	3300006844	Bacteria	2115
272	Ga0075428_100847627	3300006844	Bacteria	970
273	Ga0075430_100000201	3300006846	Bacteria	40551
274	Ga0075430_100541015	3300006846	Bacteria	961
275	Ga0075431_100000136	3300006847	Bacteria	49311
276	Ga0075431_100000260	3300006847	Bacteria	40551
277	Ga0075431_100003907	3300006847	Bacteria	14506
278	Ga0075431_100080417	3300006847	Bacteria	3365
279	Ga0075431_100240301	3300006847	Bacteria	1843
280	Ga0075431_100558217	3300006847	Bacteria	1132
281	Ga0075431_100686189	3300006847	Bacteria	1002
282	Ga0075433_10000007	3300006852	Bacteria	75995
283	Ga0075433_10003530	3300006852	Bacteria	12068
284	Ga0075433_10060197	3300006852	Bacteria	3324
285	Ga0075433_10174811	3300006852	Bacteria	1911
286	Ga0075433_10208705	3300006852	Bacteria	1736
287	Ga0075433_10309771	3300006852	Bacteria	1397
288	Ga0075434_100000091	3300006871	Bacteria	49489
289	Ga0075434_100000906	3300006871	Bacteria	23754
290	Ga0075434_100005057	3300006871	Bacteria	11975
291	Ga0075434_100009491	3300006871	Bacteria	9075
292	Ga0075434_100011355	3300006871	Bacteria	8398
293	Ga0075434_100018407	3300006871	Bacteria	6749
294	Ga0075434_100049464	3300006871	Bacteria	4174
295	Ga0075434_100057453	3300006871	Bacteria	3867
296	Ga0075434_100367589	3300006871	Bacteria	1459
297	Ga0075429_100001265	3300006880	Bacteria	20558
298	Ga0075429_100016285	3300006880	Bacteria	6443
299	Ga0075429_100086888	3300006880	Bacteria	2725
300	Ga0075429_100149213	3300006880	Bacteria	2047
301	Ga0075429_100525994	3300006880	Bacteria	1036
302	Ga0075429_100562336	3300006880	Bacteria	999
303	Ga0068865_100000615	3300006881	Bacteria	20013
304	Ga0068865_100028289	3300006881	Bacteria	3709
305	Ga0068865_100189338	3300006881	Bacteria	1590
306	Ga0075436_100056293	3300006914	Bacteria	2716
307	Ga0075436_100069732	3300006914	Bacteria	2429
308	Ga0075436_100071440	3300006914	Bacteria	2400
309	Ga0075436_100127816	3300006914	Bacteria	1781
310	Ga0097620_100009075	3300006931	Bacteria	10044
311	Ga0097620_100018036	3300006931	Bacteria	7092
312	Ga0097620_100054155	3300006931	Bacteria	4034
313	Ga0097620_100149712	3300006931	Bacteria	2410
314	Ga0075435_100019064	3300007076	Bacteria	5230
315	Ga0075435_100021393	3300007076	Bacteria	4974
316	Ga0075435_100055471	3300007076	Bacteria	3200
317	Ga0075435_100064394	3300007076	Bacteria	2979
318	Ga0075435_100114925	3300007076	Bacteria	2240
319	Ga0099794_10015829	3300007265	Bacteria	3336
320	Ga0099794_10016829	3300007265	Bacteria	3248
321	Ga0099795_10001258	3300007788	Bacteria	5382
322	Ga0099795_10022044	3300007788	Bacteria	2098
323	Ga0099795_10039387	3300007788	Bacteria	1673
324	Ga0105251_10033916	3300009011	Bacteria	2530
325	Ga0105244_10030527	3300009036	Bacteria	2868
326	Ga0105240_10412816	3300009093	Bacteria	1518
327	Ga0105240_10737020	3300009093	Bacteria	1072
328	Ga0111539_10000405	3300009094	Bacteria	53738
329	Ga0111539_10001412	3300009094	Bacteria	31985
330	Ga0111539_10006123	3300009094	Bacteria	15530
331	Ga0111539_10017112	3300009094	Bacteria	8974
332	Ga0111539_10021963	3300009094	Bacteria	7844
333	Ga0111539_10024531	3300009094	Bacteria	7397
334	Ga0111539_10046377	3300009094	Bacteria	5198
335	Ga0111539_10139297	3300009094	Bacteria	2841
336	Ga0111539_10196446	3300009094	Bacteria	2353
337	Ga0111539_10564188	3300009094	Bacteria	1326
338	Ga0111539_11000407	3300009094	Bacteria	972
339	Ga0105245_10480528	3300009098	Bacteria	1256
340	Ga0105245_10556393	3300009098	Bacteria	1169
341	Ga0105247_10059134	3300009101	Bacteria	2372
342	Ga0114129_10002465	3300009147	Bacteria	25697
343	Ga0114129_10005016	3300009147	Bacteria	18630
344	Ga0114129_10017987	3300009147	Bacteria	10065
345	Ga0114129_10042614	3300009147	Bacteria	6389
346	Ga0114129_10056719	3300009147	Bacteria	5484
347	Ga0114129_10076569	3300009147	Bacteria	4657
348	Ga0114129_10095950	3300009147	Bacteria	4106
349	Ga0114129_10116521	3300009147	Bacteria	3681
350	Ga0114129_10640753	3300009147	Bacteria	1373
351	Ga0114129_11066263	3300009147	Bacteria	1014
352	Ga0105243_10006356	3300009148	Bacteria	9125
353	Ga0105243_10007677	3300009148	Bacteria	8286
354	Ga0105241_10000966	3300009174	Bacteria	21742
355	Ga0105241_10013233	3300009174	Bacteria	6047
356	Ga0105241_10021798	3300009174	Bacteria	4740
357	Ga0105242_10007702	3300009176	Bacteria	8286
358	Ga0105242_10060261	3300009176	Bacteria	3117
359	Ga0105242_10360610	3300009176	Bacteria	1345
360	Ga0105248_10004655	3300009177	Bacteria	15184
361	Ga0105248_10033947	3300009177	Bacteria	5702
362	Ga0105237_10109379	3300009545	Bacteria	2756
363	Ga0105238_10087827	3300009551	Bacteria	3096
364	Ga0105238_10205378	3300009551	Bacteria	1946
365	Ga0105249_10010100	3300009553	Bacteria	8286
366	Ga0105249_10556502	3300009553	Bacteria	1198
367	Ga0099796_10001221	3300010159	Bacteria	5021
368	Ga0105239_10233362	3300010375	Bacteria	2064
369	Ga0105239_10287367	3300010375	Bacteria	1852
370	Ga0105246_10001908	3300011119	Bacteria	12559
371	Ga0105246_10269447	3300011119	Bacteria	1360
372	Ga0157320_1001105	3300012481	Bacteria	1292
373	Ga0157342_1008840	3300012507	Bacteria	1004
374	Ga0157373_10000304	3300013100	Bacteria	39700
375	Ga0157373_10094883	3300013100	Bacteria	2100
376	Ga0157373_10104592	3300013100	Bacteria	1991
377	Ga0157371_10011884	3300013102	Bacteria	6681
378	Ga0157371_10014045	3300013102	Bacteria	6060
379	Ga0157369_10052048	3300013105	Bacteria	4431
380	Ga0157369_10241243	3300013105	Bacteria	1888
381	Ga0157374_10010364	3300013296	Bacteria	8018
382	Ga0157374_10139586	3300013296	Bacteria	2352
383	Ga0157378_10009964	3300013297	Bacteria	8286
384	Ga0163162_10301764	3300013306	Bacteria	1733
385	Ga0163162_10417278	3300013306	Bacteria	1474
386	Ga0163162_10553230	3300013306	Bacteria	1279
387	Ga0163162_10672629	3300013306	Bacteria	1158
388	Ga0157372_10005468	3300013307	Bacteria	13497
389	Ga0157372_10027038	3300013307	Bacteria	6246
390	Ga0157372_10029929	3300013307	Bacteria	5950
391	Ga0157372_10422015	3300013307	Bacteria	1554
392	Ga0157375_10007981	3300013308	Bacteria	9268
393	Ga0157375_10207089	3300013308	Bacteria	2118
394	Ga0157375_10655146	3300013308	Bacteria	1206
395	Ga0163163_10420666	3300014325	Bacteria	1395
396	Ga0157380_10004902	3300014326	Bacteria	9325
397	Ga0157380_10012253	3300014326	Bacteria	6212
398	Ga0182008_10086320	3300014497	Bacteria	1545
399	Ga0157377_10002529	3300014745	Bacteria	8107
400	Ga0157379_10000036	3300014968	Bacteria	81888
401	Ga0157379_10148517	3300014968	Bacteria	2114
402	Ga0157376_10027787	3300014969	Bacteria	4489
403	Ga0157376_10327419	3300014969	Bacteria	1459
404	Ga0182007_10046967	3300015262	Bacteria	1429
405	Ga0163161_10006198	3300017792	Bacteria	8286
406	Ga0163161_10181149	3300017792	Bacteria	1615
407	Ga0213873_10011019	3300021358	Bacteria	1923
408	Ga0213871_10023420	3300021441	Bacteria	1555
409	Ga0224572_1031445	3300024225	Bacteria	1012
410	Ga0228598_1023872	3300024227	Bacteria	1204
411	Ga0207666_1000147	3300025271	Bacteria	11003
412	Ga0207673_1001066	3300025290	Bacteria	2956
413	Ga0209758_1000158	3300025297	Bacteria	156129
414	Ga0207697_10004223	3300025315	Bacteria	6903
415	Ga0207697_10026228	3300025315	Bacteria	2383
416	Ga0207653_10003233	3300025885	Bacteria	5150
417	Ga0207653_10024585	3300025885	Bacteria	1923
418	Ga0207682_10001723	3300025893	Bacteria	10024
419	Ga0207692_10010637	3300025898	Bacteria	3886
420	Ga0207692_10015380	3300025898	Bacteria	3366
421	Ga0207692_10083257	3300025898	Bacteria	1716
422	Ga0207642_10001921	3300025899	Bacteria	6411
423	Ga0207642_10036165	3300025899	Bacteria	2117
424	Ga0207642_10253154	3300025899	Bacteria	1000
425	Ga0207710_10004857	3300025900	Bacteria	5828
426	Ga0207710_10010654	3300025900	Bacteria	3871
427	Ga0207688_10000167	3300025901	Bacteria	28809
428	Ga0207688_10115311	3300025901	Bacteria	1563
429	Ga0207688_10204115	3300025901	Bacteria	1186
430	Ga0207680_10032909	3300025903	Bacteria	2952
431	Ga0207647_10000681	3300025904	Bacteria	26676
432	Ga0207685_10011851	3300025905	Bacteria	2639
433	Ga0207685_10028109	3300025905	Bacteria	1976
434	Ga0207685_10182106	3300025905	Bacteria	975
435	Ga0207699_10001769	3300025906	Bacteria	10200
436	Ga0207699_10042955	3300025906	Bacteria	2623
437	Ga0207699_10250920	3300025906	Bacteria	1219
438	Ga0207645_10000076	3300025907	Bacteria	70294
439	Ga0207645_10005140	3300025907	Bacteria	9571
440	Ga0207645_10109303	3300025907	Bacteria	1789
441	Ga0207643_10000227	3300025908	Bacteria	39423
442	Ga0207643_10004063	3300025908	Bacteria	7870
443	Ga0207684_10011632	3300025910	Bacteria	7686
444	Ga0207684_10013663	3300025910	Bacteria	7015
445	Ga0207684_10125212	3300025910	Bacteria	2205
446	Ga0207684_10158900	3300025910	Bacteria	1946
447	Ga0207684_10246191	3300025910	Bacteria	1542
448	Ga0207654_10003427	3300025911	Bacteria	8018
449	Ga0207654_10011317	3300025911	Bacteria	4551
450	Ga0207707_10000357	3300025912	Bacteria	48036
451	Ga0207707_10016807	3300025912	Bacteria	6375
452	Ga0207707_10072185	3300025912	Bacteria	3009
453	Ga0207671_10035659	3300025914	Bacteria	3690
454	Ga0207693_10001566	3300025915	Bacteria	20200
455	Ga0207693_10031005	3300025915	Bacteria	4223
456	Ga0207693_10031776	3300025915	Bacteria	4172
457	Ga0207693_10051273	3300025915	Bacteria	3239
458	Ga0207693_10097296	3300025915	Bacteria	2308
459	Ga0207693_10287449	3300025915	Bacteria	1288
460	Ga0207663_10025337	3300025916	Bacteria	3428
461	Ga0207663_10031129	3300025916	Bacteria	3155
462	Ga0207663_10403707	3300025916	Bacteria	1046
463	Ga0207663_10430563	3300025916	Bacteria	1014
464	Ga0207663_10552353	3300025916	Bacteria	900
465	Ga0207660_10001252	3300025917	Bacteria	17011
466	Ga0207660_10001661	3300025917	Bacteria	14915
467	Ga0207662_10000195	3300025918	Bacteria	28315
468	Ga0207662_10004491	3300025918	Bacteria	7344
469	Ga0207662_10114795	3300025918	Bacteria	1682
470	Ga0207657_10000417	3300025919	Bacteria	45146
471	Ga0207657_10012031	3300025919	Bacteria	8558
472	Ga0207657_10085483	3300025919	Bacteria	2642
473	Ga0207649_10000944	3300025920	Bacteria	18174
474	Ga0207649_10036871	3300025920	Bacteria	2949
475	Ga0207649_10234865	3300025920	Bacteria	1313
476	Ga0207652_10003410	3300025921	Bacteria	13119
477	Ga0207646_10017807	3300025922	Bacteria	6636
478	Ga0207646_10042685	3300025922	Bacteria	4073
479	Ga0207646_10190243	3300025922	Bacteria	1854
480	Ga0207681_10004024	3300025923	Bacteria	9118
481	Ga0207681_10054101	3300025923	Bacteria	2728
482	Ga0207681_10401905	3300025923	Bacteria	1107
483	Ga0207694_10291247	3300025924	Bacteria	1343
484	Ga0207650_10011209	3300025925	Bacteria	6165
485	Ga0207650_10024424	3300025925	Bacteria	4296
486	Ga0207650_10026959	3300025925	Bacteria	4107
487	Ga0207659_10001128	3300025926	Bacteria	15843
488	Ga0207659_10341397	3300025926	Bacteria	1240
489	Ga0207659_10373382	3300025926	Bacteria	1188
490	Ga0207687_10006293	3300025927	Bacteria	7850
491	Ga0207687_10129621	3300025927	Bacteria	1899
492	Ga0207700_10000389	3300025928	Bacteria	25605
493	Ga0207700_10003921	3300025928	Bacteria	8691
494	Ga0207700_10038715	3300025928	Bacteria	3463
495	Ga0207700_10046114	3300025928	Bacteria	3221
496	Ga0207700_10121906	3300025928	Bacteria	2115
497	Ga0207700_10233453	3300025928	Bacteria	1565
498	Ga0207700_10302709	3300025928	Bacteria	1381
499	Ga0207700_10627162	3300025928	Bacteria	958
500	Ga0207664_10035366	3300025929	Bacteria	3854
501	Ga0207664_10307940	3300025929	Bacteria	1395
502	Ga0207664_10324595	3300025929	Bacteria	1358
503	Ga0207664_10452393	3300025929	Bacteria	1146
504	Ga0207664_10524968	3300025929	Bacteria	1061
505	Ga0207644_10017054	3300025931	Bacteria	4897
506	Ga0207644_10043334	3300025931	Bacteria	3193
507	Ga0207690_10003172	3300025932	Bacteria	9870
508	Ga0207690_10097585	3300025932	Bacteria	2091
509	Ga0207706_10010273	3300025933	Bacteria	8558
510	Ga0207706_10019755	3300025933	Bacteria	6059
511	Ga0207706_10088588	3300025933	Bacteria	2721
512	Ga0207686_10002278	3300025934	Bacteria	10539
513	Ga0207686_10012067	3300025934	Bacteria	4746
514	Ga0207686_10180112	3300025934	Bacteria	1498
515	Ga0207709_10000264	3300025935	Bacteria	62258
516	Ga0207670_10014947	3300025936	Bacteria	4623
517	Ga0207670_10017940	3300025936	Bacteria	4288
518	Ga0207670_10198791	3300025936	Bacteria	1522
519	Ga0207670_10363203	3300025936	Bacteria	1149
520	Ga0207669_10001389	3300025937	Bacteria	10299
521	Ga0207669_10044242	3300025937	Bacteria	2614
522	Ga0207669_10154536	3300025937	Bacteria	1612
523	Ga0207669_10202255	3300025937	Bacteria	1443
524	Ga0207704_10001138	3300025938	Bacteria	11824
525	Ga0207665_10001576	3300025939	Bacteria	15389
526	Ga0207665_10077764	3300025939	Bacteria	2278
527	Ga0207665_10387603	3300025939	Bacteria	1062
528	Ga0207691_10009001	3300025940	Bacteria	9573
529	Ga0207691_10184977	3300025940	Bacteria	1819
530	Ga0207711_10011627	3300025941	Bacteria	7313
531	Ga0207711_10055850	3300025941	Bacteria	3391
532	Ga0207689_10000008	3300025942	Bacteria	127942
533	Ga0207689_10000281	3300025942	Bacteria	46204
534	Ga0207689_10163794	3300025942	Bacteria	1832
535	Ga0207661_10002577	3300025944	Bacteria	12474
536	Ga0207661_10213011	3300025944	Bacteria	1704
537	Ga0207661_10261995	3300025944	Bacteria	1540
538	Ga0207679_10004919	3300025945	Bacteria	8331
539	Ga0207679_10026429	3300025945	Bacteria	4002
540	Ga0207679_10215340	3300025945	Bacteria	1613
541	Ga0207667_10000381	3300025949	Bacteria	59990
542	Ga0207667_10008690	3300025949	Bacteria	12035
543	Ga0207667_10113850	3300025949	Bacteria	2789
544	Ga0207651_10000292	3300025960	Bacteria	21406
545	Ga0207651_10007705	3300025960	Bacteria	5754
546	Ga0207651_10028919	3300025960	Bacteria	3504
547	Ga0207651_10083594	3300025960	Bacteria	2309
548	Ga0207651_10505551	3300025960	Bacteria	1045
549	Ga0207712_10007532	3300025961	Bacteria	6875
550	Ga0207712_10093870	3300025961	Bacteria	2215
551	Ga0207712_10220024	3300025961	Bacteria	1517
552	Ga0207668_10001329	3300025972	Bacteria	14678
553	Ga0207668_10066414	3300025972	Bacteria	2557
554	Ga0207668_10158014	3300025972	Bacteria	1763
555	Ga0207668_10234820	3300025972	Bacteria	1480
556	Ga0207640_10001339	3300025981	Bacteria	13347
557	Ga0207640_10001740	3300025981	Bacteria	11681
558	Ga0207658_10014450	3300025986	Bacteria	5406
559	Ga0207658_10057511	3300025986	Bacteria	2890
560	Ga0207677_10011475	3300026023	Bacteria	5057
561	Ga0207677_10137766	3300026023	Bacteria	1864
562	Ga0207703_10006686	3300026035	Bacteria	9198
563	Ga0207703_10032021	3300026035	Bacteria	4160
564	Ga0207703_10046719	3300026035	Bacteria	3488
565	Ga0207703_10085108	3300026035	Bacteria	2645
566	Ga0207703_10316526	3300026035	Bacteria	1428
567	Ga0207639_10004638	3300026041	Bacteria	9252
568	Ga0207639_10011886	3300026041	Bacteria	6056
569	Ga0207639_10085826	3300026041	Bacteria	2505
570	Ga0207678_10007809	3300026067	Bacteria	9445
571	Ga0207678_10009486	3300026067	Bacteria	8558
572	Ga0207678_10045570	3300026067	Bacteria	3792
573	Ga0207678_10059491	3300026067	Bacteria	3287
574	Ga0207678_10090327	3300026067	Bacteria	2618
575	Ga0207708_10006642	3300026075	Bacteria	8558
576	Ga0207702_10025513	3300026078	Bacteria	4906
577	Ga0207702_10035118	3300026078	Bacteria	4192
578	Ga0207702_10066149	3300026078	Bacteria	3097
579	Ga0207702_10362689	3300026078	Bacteria	1389
580	Ga0207641_10013154	3300026088	Bacteria	6784
581	Ga0207641_10231776	3300026088	Bacteria	1716
582	Ga0207641_10456592	3300026088	Bacteria	1235
583	Ga0207641_10567943	3300026088	Bacteria	1108
584	Ga0207648_10009518	3300026089	Bacteria	9297
585	Ga0207648_10066684	3300026089	Bacteria	3139
586	Ga0207648_10264871	3300026089	Bacteria	1534
587	Ga0207648_10580120	3300026089	Bacteria	1032
588	Ga0207648_10594853	3300026089	Bacteria	1019
589	Ga0207676_10000182	3300026095	Bacteria	55544
590	Ga0207676_10046222	3300026095	Bacteria	3367
591	Ga0207676_10102038	3300026095	Bacteria	2380
592	Ga0207674_10001793	3300026116	Bacteria	27390
593	Ga0207674_10012281	3300026116	Bacteria	9578
594	Ga0207675_100009057	3300026118	Bacteria	9341
595	Ga0207675_100009202	3300026118	Bacteria	9264
596	Ga0207675_100015613	3300026118	Bacteria	7083
597	Ga0207675_100060950	3300026118	Bacteria	3522
598	Ga0207675_100142481	3300026118	Bacteria	2277
599	Ga0207675_100394954	3300026118	Bacteria	1362
600	Ga0207675_100737378	3300026118	Bacteria	996
601	Ga0207683_10008899	3300026121	Bacteria	8558
602	Ga0207683_10074809	3300026121	Bacteria	2997
603	Ga0209969_1001687	3300027360	Bacteria	3051
604	Ga0209967_1000969	3300027364	Bacteria	3654
605	Ga0209981_1000658	3300027378	Bacteria	4366
606	Ga0209996_1000275	3300027395	Bacteria	6450
607	Ga0209984_1007643	3300027424	Bacteria	1345
608	Ga0209968_1001134	3300027526	Bacteria	4060
609	Ga0209968_1021574	3300027526	Bacteria	1046
610	Ga0209999_1000305	3300027543	Bacteria	7289
611	Ga0209982_1004119	3300027552	Bacteria	2076
612	Ga0209970_1000685	3300027614	Bacteria	5879
613	Ga0209970_1020355	3300027614	Bacteria	1121
614	Ga0210002_1002183	3300027617	Bacteria	2826
615	Ga0209983_1001147	3300027665	Bacteria	5856
616	Ga0209588_1002131	3300027671	Bacteria	5337
617	Ga0209588_1033390	3300027671	Bacteria	1650
618	Ga0209971_1000054	3300027682	Bacteria	37135
619	Ga0209971_1009792	3300027682	Bacteria	2269
620	Ga0209966_1000059	3300027695	Bacteria	48677
621	Ga0209966_1001377	3300027695	Bacteria	4251
622	Ga0209998_10000066	3300027717	Bacteria	41640
623	Ga0209998_10001521	3300027717	Bacteria	5575
624	Ga0209998_10005041	3300027717	Bacteria	2775
625	Ga0209998_10005227	3300027717	Bacteria	2721
626	Ga0209974_10001584	3300027876	Bacteria	8235
627	Ga0209974_10004634	3300027876	Bacteria	4889
628	Ga0207428_10000115	3300027907	Bacteria	109072
629	Ga0207428_10000994	3300027907	Bacteria	31445
630	Ga0207428_10001793	3300027907	Bacteria	21978
631	Ga0207428_10004461	3300027907	Bacteria	13282
632	Ga0207428_10027449	3300027907	Bacteria	4739
633	Ga0207428_10028254	3300027907	Bacteria	4662
634	Ga0268266_10173366	3300028379	Bacteria	1959
635	Ga0268266_10485678	3300028379	Bacteria	1178
636	Ga0268265_10004000	3300028380	Bacteria	10377
637	Ga0268265_10006061	3300028380	Bacteria	8213
638	Ga0268265_10204454	3300028380	Bacteria	1716
639	Ga0268264_10015470	3300028381	Bacteria	6255
640	Ga0268264_10090834	3300028381	Bacteria	2633
641	Ga0268264_10635474	3300028381	Bacteria	1055
642	Ga0268264_10809588	3300028381	Bacteria	936
643	Ga0265337_1000403	3300028556	Bacteria	23321
644	Ga0265763_1000087	3300030763	Bacteria	4099
645	Ga0265760_10011007	3300031090	Bacteria	2584
646	Ga0265325_10000026	3300031241	Bacteria	109937
647	Ga0265325_10001871	3300031241	Bacteria	14513
648	Ga0265325_10005066	3300031241	Bacteria	8199
649	Ga0265339_10000128	3300031249	Bacteria	62891
650	Ga0265339_10016754	3300031249	Bacteria	4360
651	Ga0265316_10069637	3300031344	Bacteria	2715
652	Ga0265316_10183591	3300031344	Bacteria	1556
653	Ga0265313_10000223	3300031595	Bacteria	61143
654	Ga0265313_10000246	3300031595	Bacteria	58903
655	Ga0265313_10007514	3300031595	Bacteria	7417
656	Ga0265313_10016334	3300031595	Bacteria	4271
657	Ga0265313_10016824	3300031595	Bacteria	4191
658	Ga0265313_10091700	3300031595	Bacteria	1363
659	Ga0316579_10005606	3300031691	Bacteria	5079
660	Ga0265342_10022655	3300031712	Bacteria	3990
661	Ga0373930_0000310	3300034816	Bacteria	6326
662	Ga0373930_0033852	3300034816	Bacteria	1062
663	Ga0373948_0000329	3300034817	Bacteria	5778
664	Ga0373948_0017203	3300034817	Bacteria	1345
665	Ga0373958_0000094	3300034819	Bacteria	9294
666	Ga0373959_0000480	3300034820	Bacteria	7330
667	Ga0373938_0000194	3300034957	Bacteria	9090
668	Ga0373938_0002338	3300034957	Bacteria	3050
669	Ga0373938_0014157	3300034957	Bacteria	1526
670	Ga0373926_0104241	3300035083	Bacteria	1062
671	Ga0373928_0000247	3300035084	Bacteria	10651
672	Ga0373928_0000963	3300035084	Bacteria	5644
673	Ga0373929_0000208	3300035085	Bacteria	10586
674	Ga0373929_0008126	3300035085	Bacteria	1931
675	Ga0373929_0032036	3300035085	Bacteria	1129
676	Ga0373929_0051070	3300035085	Bacteria	945
677	Ga0373940_0000026	3300035088	Bacteria	16296
678	Ga0373940_0042253	3300035088	Bacteria	1256
679	Ga0373944_0000671	3300035089	Bacteria	8184
680	Ga0373949_0001813	3300035090	Bacteria	5835
681	Ga0373949_0042541	3300035090	Bacteria	1121
682	Ga0373952_0002937	3300035092	Bacteria	3078
683	Ga0373952_0046629	3300035092	Bacteria	1020
684	Ga0373923_0022613	3300035111	Bacteria	2467
685	Ga0373923_0028252	3300035111	Bacteria	2243
686	Ga0373932_0000407	3300035112	Bacteria	13181
687	Ga0373932_0001744	3300035112	Bacteria	5904
688	Ga0373932_0003491	3300035112	Bacteria	3775
689	Ga0373936_0003453	3300035113	Bacteria	5928
690	Ga0373936_0164713	3300035113	Bacteria	967
691	Ga0373939_0000587	3300035114	Bacteria	9064
692	Ga0373939_0005462	3300035114	Bacteria	3028
693	Ga0373941_0015027	3300035115	Bacteria	2080
694	Ga0373941_0072345	3300035115	Bacteria	1147
695	Ga0373945_0004819	3300035116	Bacteria	4298
696	Ga0373945_0012078	3300035116	Bacteria	2863
697	Ga0373953_0023257	3300035117	Bacteria	2345
698	Ga0373953_0035150	3300035117	Bacteria	1968
699	Ga0373953_0121149	3300035117	Bacteria	1111
700	Ga0373954_0001647	3300035118	Bacteria	9138
701	Ga0373954_0104182	3300035118	Bacteria	1370
702	Ga0373956_0007852	3300035119	Bacteria	4306
703	Ga0373956_0017547	3300035119	Bacteria	3019
704	Ga0373956_0078737	3300035119	Bacteria	1510
705	Ga0373956_0143887	3300035119	Bacteria	1120
706	Ga0373957_0038078	3300035120	Bacteria	1799
707	Ga0373960_0000582	3300035121	Bacteria	7460
708	Ga0373960_0004777	3300035121	Bacteria	3119
709	Ga0373960_0074207	3300035121	Bacteria	1058
710	Ga0373943_0004095	3300035170	Bacteria	6619
711	Ga0373943_0010807	3300035170	Bacteria	4097
712	Ga0373943_0132134	3300035170	Bacteria	1337
713	Ga0373943_0182379	3300035170	Bacteria	1154
714	Ga0373946_0003226	3300035171	Bacteria	5789
715	Ga0373946_0012694	3300035171	Bacteria	3156
716	Ga0373946_0118923	3300035171	Bacteria	1204
717	Ga0373955_0001161	3300035172	Bacteria	11178
718	Ga0373955_0006219	3300035172	Bacteria	5431
719	Ga0373955_0030028	3300035172	Bacteria	2833
720	Ga0373955_0161000	3300035172	Bacteria	1325
721	Ga0373942_0000429	3300035207	Bacteria	11745
722	Ga0373942_0001181	3300035207	Bacteria	6902
723	Ga0373942_0066423	3300035207	Bacteria	1044
724	Ga0373961_0001623	3300035241	Bacteria	6349
725	Ga0373961_0007423	3300035241	Bacteria	2651
726	Ga0373961_0018962	3300035241	Bacteria	1802
727	Ga0373961_0050767	3300035241	Bacteria	1229
728	Ga0373962_0000098	3300035242	Bacteria	19016
729	Ga0373962_0006178	3300035242	Bacteria	2896
730	Ga0373962_0009516	3300035242	Bacteria	2410
731	Ga0373962_0020385	3300035242	Bacteria	1741
732	Ga0373962_0020497	3300035242	Bacteria	1737
733	Ga0373924_0004747	3300035410	Bacteria	4771
734	Ga0373924_0125516	3300035410	Bacteria	1115
735	Ga0373931_0000378	3300035691	Bacteria	18340
736	Ga0373931_0002381	3300035691	Bacteria	8319
737	Ga0373931_0002834	3300035691	Bacteria	7732
738	Ga0373931_0045072	3300035691	Bacteria	2327
739	Ga0373931_0065188	3300035691	Bacteria	1973
740	Ga0373931_0067852	3300035691	Bacteria	1939
741	Ga0373935_0081762	3300035692	Bacteria	2101
742	Ga0373927_0003203	3300035695	Bacteria	11789
743	Ga0373927_0028014	3300035695	Bacteria	3676
744	Ga0373927_0035441	3300035695	Bacteria	3244
745	Ga0373927_0102437	3300035695	Bacteria	1862
746	Ga0373927_0485491	3300035695	Bacteria	816
747	Ga0373933_0000862	3300035724	Bacteria	18590
748	Ga0373933_0001149	3300035724	Bacteria	15714
749	Ga0373933_0370166	3300035724	Bacteria	932
750	Ga0373947_0000063	3300035725	Bacteria	53746
751	Ga0373947_0021712	3300035725	Bacteria	3717
752	Ga0373947_0028401	3300035725	Bacteria	3280
753	Ga0373947_0134592	3300035725	Bacteria	1580
754	Ga0373947_0204022	3300035725	Bacteria	1295
755	Ga0373937_0004708	3300036401	Bacteria	11605
756	Ga0373937_0006909	3300036401	Bacteria	9797
757	Ga0373937_0009801	3300036401	Bacteria	8352
758	Ga0373937_0018534	3300036401	Bacteria	6217
759	Ga0373937_0090900	3300036401	Bacteria	2828
760	Ga0373937_0340467	3300036401	Bacteria	1420
761	Ga0373925_0000456	3300037068	Bacteria	41315
762	Ga0373925_0004703	3300037068	Bacteria	10301
763	Ga0373925_0010765	3300037068	Bacteria	6632
764	Ga0373925_0046676	3300037068	Bacteria	3222
765	Ga0373925_0054744	3300037068	Bacteria	2984
766	Ga0395900_0381257	3300037418	Bacteria	1378
767	Ga0436364_0140098	3300037853	Bacteria	1071
768	Ga0395901_0195490	3300038443	Bacteria	2121
769	Ga0242419_001370	3300038698	Bacteria	1489
770	Ga0436365_0948719	3300039437	Bacteria	1716
771	Ga0436365_1860506	3300039437	Bacteria	3258
772	Ga0436360_0052627	3300039438	Bacteria	926
773	Ga0436360_0061316	3300039438	Bacteria	1869
774	Ga0436361_0692275	3300039447	Bacteria	908
775	Ga0436362_0553110	3300039453	Bacteria	1081
776	Ga0439463_047620	3300042016	Bacteria	1092
777	Ga0450923_011985	3300042125	Bacteria	1571
778	Ga0450889_006057	3300042144	Bacteria	1211
779	Ga0439458_0002369	3300042157	Bacteria	4618
780	Ga0439435_0021457	3300042436	Bacteria	1677
781	Ga0439459_0008653	3300042438	Bacteria	1745
782	Ga0439464_0021337	3300042439	Bacteria	1778
783	Ga0439460_0006679	3300042461	Bacteria	2867
784	Ga0451577_0010773	3300042876	Bacteria	8699
785	Ga0451577_0030891	3300042876	Bacteria	4837
786	Ga0451577_0220996	3300042876	Bacteria	1712
787	Ga0453683_0180860	3300044673	Bacteria	1338
788	Ga0453684_0119142	3300044712	Bacteria	3191
789	Ga0453684_0553866	3300044712	Bacteria	1266
790	Ga0451576_0005108	3300045051	Bacteria	16632
791	Ga0451576_0005407	3300045051	Bacteria	16032
792	Ga0451576_0588353	3300045051	Bacteria	1169
793	Ga0466958_0002114	3300045836	Bacteria	9857
794	Ga0495617_116240	3300046452	Bacteria	863
795	Ga0495592_0006119	3300046454	Bacteria	8947
796	Ga0495592_0009003	3300046454	Bacteria	7501
797	Ga0495592_0289919	3300046454	Bacteria	1067
798	Ga0495603_0089296	3300046455	Bacteria	1803
799	Ga0495591_013259	3300046458	Bacteria	3027
800	Ga0495629_0000183	3300046459	Bacteria	56534
801	Ga0495641_0049237	3300046461	Bacteria	1930
802	Ga0495651_0006676	3300046462	Bacteria	8825
803	Ga0495651_0012657	3300046462	Bacteria	6511
804	Ga0495651_0018701	3300046462	Bacteria	5368
805	Ga0495651_0072677	3300046462	Bacteria	2612
806	Ga0495653_0008179	3300046463	Bacteria	8565
807	Ga0495653_0017231	3300046463	Bacteria	5875
808	Ga0495653_0104483	3300046463	Bacteria	2047
809	Ga0495653_0228175	3300046463	Bacteria	1248
810	Ga0495580_0015636	3300046472	Bacteria	5718
811	Ga0495580_0016429	3300046472	Bacteria	5553
812	Ga0495582_0005330	3300046473	Bacteria	7180
813	Ga0495639_0004781	3300046475	Bacteria	5822
814	Ga0495639_0005312	3300046475	Bacteria	5548
815	Ga0495662_0003069	3300046476	Bacteria	8421
816	Ga0495664_0000985	3300046477	Bacteria	14643
817	Ga0495664_0011771	3300046477	Bacteria	4938
818	Ga0495584_0005357	3300046491	Bacteria	6798
819	Ga0495585_0003428	3300046492	Bacteria	10719
820	Ga0495607_0004302	3300046501	Bacteria	10510
821	Ga0495608_0087053	3300046511	Bacteria	2024
822	Ga0495608_0166183	3300046511	Bacteria	1401
823	Ga0495618_0030133	3300046514	Bacteria	3387
824	Ga0495618_0108618	3300046514	Bacteria	1776
825	Ga0495628_0000950	3300046516	Bacteria	26607
826	Ga0495630_0022663	3300046517	Bacteria	4638
827	Ga0495630_0030670	3300046517	Bacteria	4001
828	Ga0495630_0167129	3300046517	Bacteria	1675
829	Ga0495630_0225080	3300046517	Bacteria	1432
830	Ga0495630_0292613	3300046517	Bacteria	1244
831	Ga0495637_0100555	3300046520	Bacteria	1130
832	Ga0495644_0002500	3300046523	Bacteria	7335
833	Ga0495663_0006714	3300046525	Bacteria	3172
834	Ga0495666_0055294	3300046526	Bacteria	1902
835	Ga0495652_0002257	3300046529	Bacteria	20113
836	Ga0495652_0011919	3300046529	Bacteria	7861
837	Ga0495652_0156617	3300046529	Bacteria	1773
838	Ga0495652_0380920	3300046529	Bacteria	1003
839	Ga0495665_0004860	3300046531	Bacteria	7248
840	Ga0495665_0012011	3300046531	Bacteria	4687
841	Ga0495665_0014988	3300046531	Bacteria	4176
842	Ga0495665_0039931	3300046531	Bacteria	2499
843	Ga0495640_0003512	3300046533	Bacteria	12603
844	Ga0495640_0015931	3300046533	Bacteria	5639
845	Ga0495640_0045939	3300046533	Bacteria	3028
846	Ga0495640_0165900	3300046533	Bacteria	1413
847	Ga0495586_0009397	3300046535	Bacteria	5204
848	Ga0495587_0018856	3300046536	Bacteria	4276
849	Ga0495587_0035272	3300046536	Bacteria	3013
850	Ga0495587_0064445	3300046536	Bacteria	2141
851	Ga0495598_0000533	3300046537	Bacteria	7095
852	Ga0495609_0121486	3300046538	Bacteria	1122
853	Ga0495645_0001487	3300046543	Bacteria	15879
854	Ga0495645_0032933	3300046543	Bacteria	3780
855	Ga0495645_0192651	3300046543	Bacteria	1388
856	Ga0495622_0017959	3300046557	Bacteria	3294
857	Ga0495633_0005806	3300046558	Bacteria	7447
858	Ga0495667_0029180	3300046559	Bacteria	3712
859	Ga0495667_0031784	3300046559	Bacteria	3540
860	Ga0495667_0044709	3300046559	Bacteria	2932
861	Ga0495656_0000174	3300046615	Bacteria	22784
862	Ga0495656_0004785	3300046615	Bacteria	4657
863	Ga0495634_0023394	3300046642	Bacteria	4343
864	Ga0495634_0054595	3300046642	Bacteria	2673
865	Ga0495625_0107935	3300046660	Bacteria	1905
866	Ga0495635_0027480	3300046663	Bacteria	3957
867	Ga0495635_0039670	3300046663	Bacteria	3256
868	Ga0495635_0106042	3300046663	Bacteria	1920
869	Ga0495659_0005884	3300046664	Bacteria	3874
870	Ga0495659_0022783	3300046664	Bacteria	2123
871	Ga0495661_0147209	3300046665	Bacteria	1275
872	Ga0495657_0013257	3300046675	Bacteria	6088
873	Ga0495657_0060146	3300046675	Bacteria	2518
874	Ga0495657_0105676	3300046675	Bacteria	1789
875	Ga0495657_0140295	3300046675	Bacteria	1507
876	Ga0495599_0004908	3300046678	Bacteria	7950
877	Ga0495599_0134612	3300046678	Bacteria	1534
878	Ga0495623_0049470	3300046679	Bacteria	2664
879	Ga0495623_0071488	3300046679	Bacteria	2159
880	Ga0495646_0021538	3300046680	Bacteria	4071
881	Ga0495647_0059166	3300046681	Bacteria	1508
882	Ga0495658_0000357	3300046683	Bacteria	25736
883	Ga0495658_0009249	3300046683	Bacteria	4901
884	Ga0495613_0008662	3300046689	Bacteria	7545
885	Ga0495613_0009388	3300046689	Bacteria	7258
886	Ga0495613_0022688	3300046689	Bacteria	4676
887	Ga0495624_0009217	3300046690	Bacteria	6839
888	Ga0495624_0034623	3300046690	Bacteria	3265
889	Ga0495670_0000414	3300046691	Bacteria	20494
890	Ga0495589_0090915	3300046794	Bacteria	1482
891	Ga0495600_0025547	3300046809	Bacteria	3807
892	Ga0495581_0007093	3300047315	Bacteria	6488
893	Ga0495581_0113265	3300047315	Bacteria	1577
894	Ga0495604_0007509	3300047317	Bacteria	8627
895	Ga0495604_0046098	3300047317	Bacteria	3399
896	Ga0495604_0111005	3300047317	Bacteria	1999
897	Ga0495604_0146948	3300047317	Bacteria	1679
898	Ga0495674_0012673	3300047319	Bacteria	7945
899	Ga0495674_0206119	3300047319	Bacteria	1630
900	Ga0495674_0350356	3300047319	Bacteria	1199
901	Ga0495672_0159380	3300047320	Bacteria	1162
902	Ga0495676_0026061	3300047321	Bacteria	5037
903	Ga0495676_0026597	3300047321	Bacteria	4978
904	Ga0495676_0274646	3300047321	Bacteria	1142
905	Ga0495680_0005045	3300047322	Bacteria	12473
906	Ga0495680_0005049	3300047322	Bacteria	12462
907	Ga0495680_0042665	3300047322	Bacteria	3597
908	Ga0495680_0074406	3300047322	Bacteria	2580
909	Ga0495680_0183103	3300047322	Bacteria	1511
910	Ga0495675_0079883	3300047444	Bacteria	2060
911	Ga0495675_0105858	3300047444	Bacteria	1758
912	Ga0495675_0112979	3300047444	Bacteria	1695
913	Ga0495684_0007856	3300047471	Bacteria	8255
914	Ga0495684_0039176	3300047471	Bacteria	3633
915	Ga0495684_0052631	3300047471	Bacteria	3107
916	Ga0495684_0423673	3300047471	Bacteria	930
917	Ga0495593_0008350	3300047673	Bacteria	6026
918	Ga0495593_0033995	3300047673	Bacteria	2774
919	Ga0495593_0152214	3300047673	Bacteria	1170
920	Ga0495602_0004084	3300048088	Bacteria	15203
921	Ga0495602_0103399	3300048088	Bacteria	2332
922	Ga0495602_0123471	3300048088	Bacteria	2079
923	Ga0495602_0123999	3300048088	Bacteria	2073
924	Ga0495602_0193895	3300048088	Bacteria	1555
925	Ga0495614_0004206	3300048089	Bacteria	6487
926	Ga0496100_0002624	3300048903	Bacteria	9166
927	Ga0496100_0031631	3300048903	Bacteria	3291
928	Ga0496100_0088525	3300048903	Bacteria	2107
929	Ga0496101_0003320	3300048904	Bacteria	10009
930	Ga0496101_0021084	3300048904	Bacteria	4472
931	Ga0496102_0021916	3300048905	Bacteria	5657
932	Ga0496102_0024560	3300048905	Bacteria	5357
933	Ga0496102_0024748	3300048905	Bacteria	5340
934	Ga0496102_0053297	3300048905	Bacteria	3687
935	Ga0496102_0057801	3300048905	Bacteria	3543
936	Ga0496102_0371005	3300048905	Bacteria	1347
937	Ga0496102_0620396	3300048905	Bacteria	1004
938	Ga0496102_0623851	3300048905	Bacteria	1001
939	Ga0496103_0060328	3300048906	Bacteria	2358
940	Ga0496103_0112319	3300048906	Bacteria	1731
941	Ga0496103_0257430	3300048906	Bacteria	1123
942	Ga0496104_0001363	3300048907	Bacteria	21131
943	Ga0496104_0003990	3300048907	Bacteria	12779
944	Ga0496104_0004283	3300048907	Bacteria	12406
945	Ga0496104_0041939	3300048907	Bacteria	4292
946	Ga0496104_0475821	3300048907	Bacteria	1160
947	Ga0496104_0530754	3300048907	Bacteria	1088
948	Ga0496105_0002131	3300048908	Bacteria	14342
949	Ga0496105_0054552	3300048908	Bacteria	3300
950	Ga0496105_0057880	3300048908	Bacteria	3199
951	Ga0496105_0062655	3300048908	Bacteria	3069
952	Ga0496105_0081996	3300048908	Bacteria	2664
953	Ga0496105_0135803	3300048908	Bacteria	2026
954	Ga0496105_0503566	3300048908	Bacteria	950
955	Ga0496106_0004015	3300048909	Bacteria	10998
956	Ga0496106_0030341	3300048909	Bacteria	4032
957	Ga0496106_0076169	3300048909	Bacteria	2571
958	Ga0496106_0107410	3300048909	Bacteria	2171
959	Ga0496106_0133050	3300048909	Bacteria	1951
960	Ga0496106_0245991	3300048909	Bacteria	1429
961	Ga0496106_0284820	3300048909	Bacteria	1324
962	Ga0496107_0005878	3300048910	Bacteria	8404
963	Ga0496107_0018210	3300048910	Bacteria	4943
964	Ga0496107_0073579	3300048910	Bacteria	2486
965	Ga0496107_0114944	3300048910	Bacteria	1980
966	Ga0496108_0002494	3300048911	Bacteria	14730
967	Ga0496108_0012544	3300048911	Bacteria	6902
968	Ga0496108_0032485	3300048911	Bacteria	4335
969	Ga0496108_0149744	3300048911	Bacteria	2013
970	Ga0496108_0822454	3300048911	Bacteria	801
971	Ga0496109_0000567	3300048912	Bacteria	30903
972	Ga0496109_0030748	3300048912	Bacteria	4812
973	Ga0496109_0060988	3300048912	Bacteria	3447
974	Ga0496109_0133057	3300048912	Bacteria	2322
975	Ga0496109_0243967	3300048912	Bacteria	1691
976	Ga0496109_0306602	3300048912	Bacteria	1498
977	Ga0496109_0468385	3300048912	Bacteria	1190
978	Ga0496110_0008186	3300048913	Bacteria	8403
979	Ga0496110_0085886	3300048913	Bacteria	2809
980	Ga0496110_0109883	3300048913	Bacteria	2476
981	Ga0496110_0214421	3300048913	Bacteria	1750
982	Ga0496110_0236507	3300048913	Bacteria	1662
983	Ga0496110_0264578	3300048913	Bacteria	1565
984	Ga0496110_0408057	3300048913	Bacteria	1238
985	Ga0496111_0030038	3300048914	Bacteria	3863
986	Ga0496111_0038074	3300048914	Bacteria	3444
987	Ga0496111_0050153	3300048914	Bacteria	3009
988	Ga0496111_0156139	3300048914	Bacteria	1693
989	Ga0496112_0050002	3300048915	Bacteria	4098
990	Ga0496112_0059918	3300048915	Bacteria	3751
991	Ga0496112_0106098	3300048915	Bacteria	2779
992	Ga0496112_0109044	3300048915	Bacteria	2739
993	Ga0496112_0109071	3300048915	Bacteria	2739
994	Ga0496112_0137191	3300048915	Bacteria	2416
995	Ga0496112_0260068	3300048915	Bacteria	1685
996	Ga0496112_0455086	3300048915	Bacteria	1217
997	Ga0496113_0026105	3300048916	Bacteria	4173
998	Ga0496113_0044851	3300048916	Bacteria	3276
999	Ga0496113_0115796	3300048916	Bacteria	2091
1000	Ga0496113_0162966	3300048916	Bacteria	1763
1001	Ga0496113_0240206	3300048916	Bacteria	1445
1002	Ga0496114_0003201	3300048917	Bacteria	12556
1003	Ga0496114_0011484	3300048917	Bacteria	7078
1004	Ga0496114_0020132	3300048917	Bacteria	5414
1005	Ga0496115_0001922	3300048918	Bacteria	14830
1006	Ga0496115_0068549	3300048918	Bacteria	2872
1007	Ga0496115_0228085	3300048918	Bacteria	1536
1008	Ga0496115_0368576	3300048918	Bacteria	1169
1009	Ga0501033_0241696	3300049570	Bacteria	1281
1010	Ga0501034_0470155	3300049571	Bacteria	1173
1011	Ga0501036_0556121	3300049572	Bacteria	953
1012	Ga0501038_0049333	3300049574	Bacteria	3640
1013	Ga0501039_0085660	3300049575	Bacteria	2454
1014	Ga0501039_0154916	3300049575	Bacteria	1800
1015	Ga0501040_0123417	3300049576	Bacteria	1818
1016	Ga0501040_0127540	3300049576	Bacteria	1788
1017	Ga0501041_0007435	3300049577	Bacteria	6433
1018	Ga0501041_0088818	3300049577	Bacteria	1908
1019	Ga0501042_0008901	3300049578	Bacteria	6658
1020	Ga0501042_0193688	3300049578	Bacteria	1466
1021	Ga0501042_0429464	3300049578	Bacteria	958
1022	Ga0501043_0302614	3300049579	Bacteria	1222
1023	Ga0501046_0000202	3300049580	Bacteria	61588
1024	Ga0501046_0227668	3300049580	Bacteria	1379
1025	Ga0501046_0447307	3300049580	Bacteria	929
1026	Ga0501047_0011524	3300049581	Bacteria	8370
1027	Ga0501047_0071767	3300049581	Bacteria	3333
1028	Ga0501047_0371669	3300049581	Bacteria	1265
1029	Ga0501048_0010069	3300049582	Bacteria	7071
1030	Ga0501069_0022684	3300049585	Bacteria	3418
1031	Ga0501069_0048647	3300049585	Bacteria	2355
1032	Ga0501070_0004890	3300049586	Bacteria	11446
1033	Ga0501070_0011260	3300049586	Bacteria	7554
1034	Ga0501070_0462923	3300049586	Bacteria	1021
1035	Ga0501071_0145686	3300049587	Bacteria	1765
1036	Ga0501071_0206854	3300049587	Bacteria	1475
1037	Ga0501072_0050236	3300049588	Bacteria	3284
1038	Ga0501072_0121247	3300049588	Bacteria	2083
1039	Ga0501072_0187127	3300049588	Bacteria	1651
1040	Ga0501073_0113511	3300049589	Bacteria	1879
1041	Ga0501074_0003506	3300049590	Bacteria	11135
1042	Ga0501074_0019004	3300049590	Bacteria	4991
1043	Ga0501074_0234274	3300049590	Bacteria	1307
1044	Ga0501075_0169008	3300049591	Bacteria	1668
1045	Ga0501075_0281148	3300049591	Bacteria	1268
1046	Ga0501076_0013356	3300049592	Bacteria	6159
1047	Ga0501076_0043209	3300049592	Bacteria	3550
1048	Ga0501076_0088236	3300049592	Bacteria	2493
1049	Ga0501076_0107872	3300049592	Bacteria	2249
1050	Ga0501076_0779320	3300049592	Bacteria	789
1051	Ga0501077_0017209	3300049593	Bacteria	4559
1052	Ga0501077_0292143	3300049593	Bacteria	1038
1053	Ga0501079_0003432	3300049741	Bacteria	11636
1054	Ga0501079_0040193	3300049741	Bacteria	3607
1055	Ga0501079_0121104	3300049741	Bacteria	2035
1056	Ga0501079_0164146	3300049741	Bacteria	1732
1057	Ga0501080_0049950	3300049742	Bacteria	3893
1058	Ga0501080_0066436	3300049742	Bacteria	3354
1059	Ga0501080_0193622	3300049742	Bacteria	1868
1060	Ga0501081_0003211	3300049743	Bacteria	10388
1061	Ga0501081_0016150	3300049743	Bacteria	4931
1062	Ga0501081_0136454	3300049743	Bacteria	1756
1063	Ga0501081_0404559	3300049743	Bacteria	1011
1064	Ga0501083_0003824	3300049744	Bacteria	10573
1065	Ga0501083_0167900	3300049744	Bacteria	1435
1066	Ga0501044_0385582	3300049823	Bacteria	1316
1067	Ga0501045_0002814	3300049824	Bacteria	11882
1068	Ga0501045_0187591	3300049824	Bacteria	1541
1069	Ga0501045_0243592	3300049824	Bacteria	1338
1070	nmdc:mga03683_26975_c1	3300050489	Bacteria	2271
1071	nmdc:mga03n38_111336_c1	3300050490	Bacteria	1333
1072	nmdc:mga03n38_8170_c1	3300050490	Bacteria	3741
1073	nmdc:mga00v17_31547_c1	3300050491	Bacteria	3126
1074	nmdc:mga00v17_38630_c1	3300050491	Bacteria	2855
1075	nmdc:mga0yw44_21453_c1	3300050492	Bacteria	3603
1076	nmdc:mga0yw44_239914_c1	3300050492	Bacteria	1204
1077	nmdc:mga0yw44_391004_c1	3300050492	Bacteria	939
1078	nmdc:mga0k408_259896_c1	3300050493	Bacteria	1037
1079	nmdc:mga0k408_38643_c1	3300050493	Bacteria	2740
1080	nmdc:mga0k408_401319_c1	3300050493	Bacteria	816
1081	nmdc:mga06z11_1418_c1	3300050494	Bacteria	8905
1082	nmdc:mga06z11_57486_c1	3300050494	Bacteria	2015
1083	nmdc:mga07m45_32220_c1	3300050496	Bacteria	1856
1084	nmdc:mga05p37_219157_c1	3300050507	Bacteria	2297
1085	nmdc:mga05p37_243725_c1	3300050507	Bacteria	2159
1086	nmdc:mga05p37_270252_c1	3300050507	Bacteria	2032
1087	nmdc:mga05p37_29250_c1	3300050507	Bacteria	6725
1088	nmdc:mga05p37_37199_c1	3300050507	Bacteria	5969
1089	nmdc:mga05p37_455153_c1	3300050507	Bacteria	1480
1090	nmdc:mga05p37_496473_c1	3300050507	Bacteria	1402
1091	nmdc:mga05p37_5774_c1	3300050507	Bacteria	14558
1092	nmdc:mga05p37_74_c1	3300050507	Bacteria	87063
1093	nmdc:mga05p37_828_c1	3300050507	Bacteria	34679
1094	nmdc:mga05p37_96329_c1	3300050507	Bacteria	3645
1095	nmdc:mga05p37_981539_c1	3300050507	Bacteria	900
1096	nmdc:mga09592_12180_c1	3300050508	Bacteria	7001
1097	nmdc:mga09592_182666_c1	3300050508	Bacteria	1815
1098	nmdc:mga09592_25067_c1	3300050508	Bacteria	4934
1099	nmdc:mga09592_257895_c1	3300050508	Bacteria	1512
1100	nmdc:mga09592_5121_c1	3300050508	Bacteria	10647
1101	nmdc:mga09592_8944_c1	3300050508	Bacteria	8142
1102	nmdc:mga0qj67_165_c1	3300050509	Bacteria	44307
1103	nmdc:mga0qj67_209086_c1	3300050509	Bacteria	1585
1104	nmdc:mga0qj67_239973_c1	3300050509	Bacteria	1470
1105	nmdc:mga0qj67_31467_c1	3300050509	Bacteria	4133
1106	nmdc:mga0qj67_87421_c1	3300050509	Bacteria	2502
1107	nmdc:mga06r32_146_c1	3300050510	Bacteria	53243
1108	nmdc:mga06r32_2051_c1	3300050510	Bacteria	18023
1109	nmdc:mga06r32_385024_c1	3300050510	Bacteria	1385
1110	nmdc:mga06r32_391649_c1	3300050510	Bacteria	1372
1111	nmdc:mga06r32_513_c1	3300050510	Bacteria	33328
1112	nmdc:mga06r32_533739_c1	3300050510	Bacteria	1148
1113	nmdc:mga06r32_655570_c1	3300050510	Bacteria	1018
1114	nmdc:mga06r32_90750_c1	3300050510	Bacteria	2985
1115	nmdc:mga08y16_166400_c1	3300050511	Bacteria	2291
1116	nmdc:mga08y16_19387_c1	3300050511	Bacteria	7172
1117	nmdc:mga08y16_373_c1	3300050511	Bacteria	40656
1118	nmdc:mga08y16_37893_c1	3300050511	Bacteria	5062
1119	nmdc:mga08y16_431721_c1	3300050511	Bacteria	1345
1120	nmdc:mga08y16_523503_c1	3300050511	Bacteria	1202
1121	nmdc:mga08y16_54262_c1	3300050511	Bacteria	4188
1122	nmdc:mga08y16_574911_c1	3300050511	Bacteria	1138
1123	nmdc:mga08y16_5774_c1	3300050511	Bacteria	12961
1124	nmdc:mga0n895_10747_c1	3300050512	Bacteria	8115
1125	nmdc:mga0n895_1284_c1	3300050512	Bacteria	18562
1126	nmdc:mga0n895_1396_c1	3300050512	Bacteria	17996
1127	nmdc:mga0n895_165518_c1	3300050512	Bacteria	2243
1128	nmdc:mga0n895_22138_c1	3300050512	Bacteria	5957
1129	nmdc:mga0n895_3297_c1	3300050512	Bacteria	12959
1130	nmdc:mga0n895_37636_c1	3300050512	Bacteria	4682
1131	nmdc:mga0n895_5328_c1	3300050512	Bacteria	10715
1132	nmdc:mga0rr50_133436_c1	3300050513	Bacteria	1991
1133	nmdc:mga0rr50_14131_c1	3300050513	Bacteria	5226
1134	nmdc:mga0rr50_180303_c1	3300050513	Bacteria	1726
1135	nmdc:mga0rr50_25756_c1	3300050513	Bacteria	4094
1136	nmdc:mga0rr50_48454_c1	3300050513	Bacteria	3141
1137	nmdc:mga0rr50_58552_c1	3300050513	Bacteria	2888
1138	nmdc:mga0rr50_798_c1	3300050513	Bacteria	17004
1139	nmdc:mga0rr50_95181_c1	3300050513	Bacteria	2327
1140	nmdc:mga08x19_111729_c1	3300050514	Bacteria	1823
1141	nmdc:mga08x19_26393_c1	3300050514	Bacteria	3624
1142	nmdc:mga08x19_43704_c1	3300050514	Bacteria	2858
1143	nmdc:mga08x19_76896_c1	3300050514	Bacteria	2185
1144	nmdc:mga0a205_1140_c1	3300050515	Bacteria	22064
1145	nmdc:mga0a205_18335_c1	3300050515	Bacteria	6578
1146	nmdc:mga0a205_19531_c1	3300050515	Bacteria	6391
1147	nmdc:mga0a205_203741_c1	3300050515	Bacteria	1868
1148	nmdc:mga0a205_2320_c1	3300050515	Bacteria	16782
1149	nmdc:mga0a205_2547_c1	3300050515	Bacteria	16064
1150	nmdc:mga0a205_331314_c1	3300050515	Bacteria	1392
1151	nmdc:mga0a205_65103_c1	3300050515	Bacteria	3521
1152	Ga0495601_0000075	3300053077	Bacteria	54434
1153	Ga0495601_0001285	3300053077	Bacteria	13775
1154	Ga0495601_0005306	3300053077	Bacteria	7501
1155	Ga0495601_0008795	3300053077	Bacteria	5959
1156	Ga0495601_0045061	3300053077	Bacteria	2772
1157	Ga0495601_0054316	3300053077	Bacteria	2534
1158	Ga0495612_0000270	3300053078	Bacteria	21369
1159	Ga0495612_0001581	3300053078	Bacteria	9398
1160	Ga0495612_0075214	3300053078	Bacteria	1413
1161	Ga0495595_0000311	3300053084	Bacteria	18978
1162	Ga0495595_0000650	3300053084	Bacteria	13209
1163	Ga0495595_0027381	3300053084	Bacteria	2540
1164	Ga0495595_0157249	3300053084	Bacteria	1120
1165	Ga0495619_0000301	3300053085	Bacteria	34829
1166	Ga0495619_0000645	3300053085	Bacteria	22971
1167	Ga0495619_0016264	3300053085	Bacteria	4708
1168	Ga0495619_0024178	3300053085	Bacteria	3896
1169	Ga0495619_0056324	3300053085	Bacteria	2606
1170	Ga0495619_0062178	3300053085	Bacteria	2485
1171	Ga0495619_0112369	3300053085	Bacteria	1862
1172	Ga0501084_0019705	3300054114	Bacteria	5621
1173	Ga0501084_0080714	3300054114	Bacteria	2728
1174	Ga0501084_0162177	3300054114	Bacteria	1886
1175	Ga0501084_0241039	3300054114	Bacteria	1526
1176	Ga0501084_0294806	3300054114	Bacteria	1370
1177	Ga0501084_0558417	3300054114	Bacteria	967
1178	Ga0501082_0001816	3300060353	Bacteria	18794
1179	Ga0501082_0008032	3300060353	Bacteria	9109
1180	Ga0501082_0051132	3300060353	Bacteria	3562
1181	Ga0501082_0124899	3300060353	Bacteria	2232
1182	Ga0501082_0132723	3300060353	Bacteria	2160
1183	Ga0501082_0304814	3300060353	Bacteria	1387
1184	Ga0501082_0310702	3300060353	Bacteria	1373
1185	Ga0501082_0326616	3300060353	Bacteria	1337
1186	Ga0530510_0050731	3300061734	Bacteria	2997
1187	Ga0530510_0177547	3300061734	Bacteria	1579
1188	Ga0530510_0194886	3300061734	Bacteria	1504
1189	Ga0530510_0335152	3300061734	Bacteria	1135
1190	Ga0530510_0361420	3300061734	Bacteria	1091
1191	Ga0070698_100295511
1192	2214600498
1193	ARSoilYngRDRAFT_c00160
1194	ARcpr5yngRDRAFT_c000030
1195	ARSoilOldRDRAFT_c000033
1196	ARCol0yngRDRAFT_1000078
1197	JGI24746J21847_1010903
1198	JGI24747J21853_1007940
1199	JGI24739J22299_10002387
1200	JGI24737J22298_10002611
1201	JGI24750J21931_1000579
1202	JGI24745J21846_1000593
1203	JGI24748J21848_1004750
1204	JGI24738J21930_10000453
1205	JGI24749J21850_1004751
1206	JGI24744J21845_10008958
1207	JGI24035J26624_1000356
1208	JGI24033J26618_1002015
1209	JGI24742J22300_10000426
1210	JGI25153J46596_10001355
1211	JGI26145J50221_1004715
1212	JGI25405J52794_10000335
1213	Ga0065717_1002042
1214	Ga0065712_10002685
1215	Ga0065715_10005190
1216	Ga0065715_10092065
1217	Ga0065715_10095212
1218	Ga0065707_10101569
1219	Ga0070676_10002407
1220	Ga0070676_10007057
1221	Ga0070676_10125464
1222	Ga0070683_100004780
1223	Ga0070690_100000577
1224	Ga0070690_100140473
1225	Ga0070670_100012134
1226	Ga0070670_100026119
1227	Ga0070677_10000943
1228	Ga0068869_100000679
1229	Ga0068869_100000973
1230	Ga0070680_100017320
1231	Ga0070680_100055396
1232	Ga0070680_100062248
1233	Ga0070680_100185423
1234	Ga0070682_100000467
1235	Ga0070682_100002906
1236	Ga0068868_100000892
1237	Ga0068868_100062551
1238	Ga0070660_100000369
1239	Ga0070660_100003390
1240	Ga0070689_100002855
1241	Ga0070689_100033685
1242	Ga0070689_100117634
1243	Ga0070689_100334453
1244	Ga0070691_10001992
1245	Ga0070691_10014721
1246	Ga0070687_100000895
1247	Ga0070687_100008379
1248	Ga0070661_100000449
1249	Ga0070661_100000804
1250	Ga0070692_10000830
1251	Ga0070692_10009315
1252	Ga0070668_100005596
1253	Ga0070668_100127963
1254	Ga0070668_100142910
1255	Ga0070669_100010788
1256	Ga0070675_100007817
1257	Ga0070675_100007876
1258	Ga0070675_100679722
1259	Ga0070671_100000144
1260	Ga0070671_100028902
1261	Ga0070674_100003771
1262	Ga0070674_100070743
1263	Ga0070674_100104546
1264	Ga0070673_100007016
1265	Ga0070673_100029612
1266	Ga0070673_100054584
1267	Ga0070673_100174210
1268	Ga0070673_100485165
1269	Ga0070688_100011365
1270	Ga0070688_100031244
1271	Ga0070688_100243715
1272	Ga0070659_100004686
1273	Ga0070659_100005098
1274	Ga0070667_100003448
1275	Ga0070667_100100919
1276	Ga0070703_10046906
1277	Ga0070709_10292929
1278	Ga0070714_100024062
1279	Ga0070714_100154613
1280	Ga0070714_100175469
1281	Ga0070714_100251988
1282	Ga0070713_100014908
1283	Ga0070713_100029068
1284	Ga0070713_100125280
1285	Ga0070713_100139308
1286	Ga0070713_100291677
1287	Ga0070713_100678771
1288	Ga0070710_10019293
1289	Ga0070710_10071882
1290	Ga0070710_10117706
1291	Ga0070710_10306704
1292	Ga0070701_10000951
1293	Ga0070701_10258902
1294	Ga0070711_100463897
1295	Ga0070705_100000292
1296	Ga0070705_100003034
1297	Ga0070705_100343491
1298	Ga0070700_100001925
1299	Ga0070694_100001870
1300	Ga0070694_100003035
1301	Ga0070694_100004146
1302	Ga0070694_100006591
1303	Ga0070694_100036734
1304	Ga0070708_100108366
1305	Ga0070708_100161751
1306	Ga0070708_100252916
1307	Ga0070708_100281624
1308	Ga0070708_100451638
1309	Ga0070708_100458932
1310	Ga0070663_100003836
1311	Ga0070663_100008331
1312	Ga0070663_100092786
1313	Ga0070678_100010321
1314	Ga0070678_100014729
1315	Ga0070678_100082297
1316	Ga0070662_100009476
1317	Ga0070662_100010201
1318	Ga0070662_100011706
1319	Ga0070662_100079907
1320	Ga0070681_10012385
1321	Ga0070681_10049870
1322	Ga0070681_10069132
1323	Ga0070681_10292449
1324	Ga0068867_100011042
1325	Ga0068867_100070341
1326	Ga0068867_100597464
1327	Ga0070685_10025949
1328	Ga0070685_10099271
1329	Ga0070706_100029875
1330	Ga0070706_100041402
1331	Ga0070706_100126534
1332	Ga0070706_100315025
1333	Ga0070706_100325006
1334	Ga0070707_100034910
1335	Ga0070707_100261558
1336	Ga0070698_100010422
1337	Ga0070698_100049507
1338	Ga0070698_100068558
1339	Ga0070698_100262767
1340	Ga0070698_100300648
1341	Ga0070699_100005647
1342	Ga0070699_100007440
1343	Ga0070699_100073025
1344	Ga0070679_100019238
1345	Ga0070679_100039784
1346	Ga0070684_100001753
1347	Ga0070684_100042779
1348	Ga0070684_100074944
1349	Ga0070684_100527461
1350	Ga0070697_100012191
1351	Ga0070697_100024096
1352	Ga0070697_100165450
1353	Ga0070697_100229202
1354	Ga0070697_100285542
1355	Ga0070697_100296413
1356	Ga0068853_100005560
1357	Ga0068853_100005853
1358	Ga0068853_100016265
1359	Ga0070672_100012405
1360	Ga0070686_100000086
1361	Ga0070686_100005092
1362	Ga0070686_100056253
1363	Ga0070695_100002332
1364	Ga0070695_100003402
1365	Ga0070695_100007717
1366	Ga0070695_100011294
1367	Ga0070696_100004489
1368	Ga0070696_100011694
1369	Ga0070693_100000164
1370	Ga0070693_100002732
1371	Ga0070693_100104282
1372	Ga0070665_100065324
1373	Ga0070704_100000280
1374	Ga0070704_100005441
1375	Ga0068855_100004461
1376	Ga0068855_100027435
1377	Ga0068855_100063461
1378	Ga0070664_100008530
1379	Ga0070664_100044537
1380	Ga0070664_100188364
1381	Ga0068857_100019723
1382	Ga0068857_100037351
1383	Ga0068857_100068077
1384	Ga0068857_100357896
1385	Ga0068854_100000497
1386	Ga0068854_100003207
1387	Ga0068856_100010687
1388	Ga0068856_100015657
1389	Ga0068856_100104855
1390	Ga0070702_100102886
1391	Ga0070702_100103222
1392	Ga0068859_100009076
1393	Ga0068859_100018036
1394	Ga0068859_100054157
1395	Ga0068859_100149718
1396	Ga0068864_100001754
1397	Ga0068864_100002526
1398	Ga0068864_100258653
1399	Ga0068864_100594321
1400	Ga0068866_10001865
1401	Ga0068866_10096029
1402	Ga0068866_10233314
1403	Ga0068866_10422942
1404	Ga0068861_100007774
1405	Ga0068861_100012371
1406	Ga0068861_100034303
1407	Ga0068861_100050762
1408	Ga0068870_10000419
1409	Ga0068870_10018600
1410	Ga0068863_100000340
1411	Ga0068863_100068996
1412	Ga0068863_100794089
1413	Ga0068858_100009413
1414	Ga0068860_100033304
1415	Ga0068860_100121656
1416	Ga0068860_100408896
1417	Ga0068860_100723324
1418	Ga0068862_100006116
1419	Ga0068862_100056602
1420	Ga0068862_100061701
1421	Ga0068862_100066392
1422	Ga0081455_10000007
1423	Ga0081455_10000371
1424	Ga0081455_10000788
1425	Ga0081455_10004553
1426	Ga0081455_10053071
1427	Ga0081455_10179750
1428	Ga0081538_10014227
1429	Ga0081538_10024923
1430	Ga0081540_1000604
1431	Ga0081540_1006112
1432	Ga0081540_1038399
1433	Ga0081540_1048502
1434	Ga0081539_10103808
1435	Ga0070717_10006270
1436	Ga0070717_10050726
1437	Ga0070717_10131111
1438	Ga0070717_10147315
1439	Ga0075365_10004953
1440	Ga0075368_10030244
1441	Ga0075363_100005500
1442	Ga0075364_10014387
1443	Ga0075432_10008949
1444	Ga0075432_10017928
1445	Ga0070715_10020204
1446	Ga0070715_10025480
1447	Ga0070716_100007236
1448	Ga0070712_100000165
1449	Ga0070712_100023832
1450	Ga0070712_100229762
1451	Ga0075367_10004355
1452	Ga0075367_10025883
1453	Ga0075367_10299599
1454	Ga0075427_10000264
1455	Ga0075366_10000798
1456	Ga0075366_10176076
1457	Ga0097621_100000880
1458	Ga0068871_100006040
1459	Ga0075428_100001723
1460	Ga0075428_100001793
1461	Ga0075428_100207998
1462	Ga0075428_100847627
1463	Ga0075430_100000201
1464	Ga0075430_100541015
1465	Ga0075431_100000136
1466	Ga0075431_100000260
1467	Ga0075431_100003907
1468	Ga0075431_100080417
1469	Ga0075431_100240301
1470	Ga0075431_100558217
1471	Ga0075431_100686189
1472	Ga0075433_10000007
1473	Ga0075433_10003530
1474	Ga0075433_10060197
1475	Ga0075433_10174811
1476	Ga0075433_10208705
1477	Ga0075433_10309771
1478	Ga0075434_100000091
1479	Ga0075434_100000906
1480	Ga0075434_100005057
1481	Ga0075434_100009491
1482	Ga0075434_100011355
1483	Ga0075434_100018407
1484	Ga0075434_100049464
1485	Ga0075434_100057453
1486	Ga0075434_100367589
1487	Ga0075429_100001265
1488	Ga0075429_100016285
1489	Ga0075429_100086888
1490	Ga0075429_100149213
1491	Ga0075429_100525994
1492	Ga0075429_100562336
1493	Ga0068865_100000615
1494	Ga0068865_100028289
1495	Ga0068865_100189338
1496	Ga0075436_100056293
1497	Ga0075436_100069732
1498	Ga0075436_100071440
1499	Ga0075436_100127816
1500	Ga0097620_100009075
1501	Ga0097620_100018036
1502	Ga0097620_100054155
1503	Ga0097620_100149712
1504	Ga0075435_100019064
1505	Ga0075435_100021393
1506	Ga0075435_100055471
1507	Ga0075435_100064394
1508	Ga0075435_100114925
1509	Ga0099794_10015829
1510	Ga0099794_10016829
1511	Ga0099795_10001258
1512	Ga0099795_10022044
1513	Ga0099795_10039387
1514	Ga0105251_10033916
1515	Ga0105244_10030527
1516	Ga0105240_10412816
1517	Ga0105240_10737020
1518	Ga0111539_10000405
1519	Ga0111539_10001412
1520	Ga0111539_10006123
1521	Ga0111539_10017112
1522	Ga0111539_10021963
1523	Ga0111539_10024531
1524	Ga0111539_10046377
1525	Ga0111539_10139297
1526	Ga0111539_10196446
1527	Ga0111539_10564188
1528	Ga0111539_11000407
1529	Ga0105245_10480528
1530	Ga0105245_10556393
1531	Ga0105247_10059134
1532	Ga0114129_10002465
1533	Ga0114129_10005016
1534	Ga0114129_10017987
1535	Ga0114129_10042614
1536	Ga0114129_10056719
1537	Ga0114129_10076569
1538	Ga0114129_10095950
1539	Ga0114129_10116521
1540	Ga0114129_10640753
1541	Ga0114129_11066263
1542	Ga0105243_10006356
1543	Ga0105243_10007677
1544	Ga0105241_10000966
1545	Ga0105241_10013233
1546	Ga0105241_10021798
1547	Ga0105242_10007702
1548	Ga0105242_10060261
1549	Ga0105242_10360610
1550	Ga0105248_10004655
1551	Ga0105248_10033947
1552	Ga0105237_10109379
1553	Ga0105238_10087827
1554	Ga0105238_10205378
1555	Ga0105249_10010100
1556	Ga0105249_10556502
1557	Ga0099796_10001221
1558	Ga0105239_10233362
1559	Ga0105239_10287367
1560	Ga0105246_10001908
1561	Ga0105246_10269447
1562	Ga0157320_1001105
1563	Ga0157342_1008840
1564	Ga0157373_10000304
1565	Ga0157373_10094883
1566	Ga0157373_10104592
1567	Ga0157371_10011884
1568	Ga0157371_10014045
1569	Ga0157369_10052048
1570	Ga0157369_10241243
1571	Ga0157374_10010364
1572	Ga0157374_10139586
1573	Ga0157378_10009964
1574	Ga0163162_10301764
1575	Ga0163162_10417278
1576	Ga0163162_10553230
1577	Ga0163162_10672629
1578	Ga0157372_10005468
1579	Ga0157372_10027038
1580	Ga0157372_10029929
1581	Ga0157372_10422015
1582	Ga0157375_10007981
1583	Ga0157375_10207089
1584	Ga0157375_10655146
1585	Ga0163163_10420666
1586	Ga0157380_10004902
1587	Ga0157380_10012253
1588	Ga0182008_10086320
1589	Ga0157377_10002529
1590	Ga0157379_10000036
1591	Ga0157379_10148517
1592	Ga0157376_10027787
1593	Ga0157376_10327419
1594	Ga0182007_10046967
1595	Ga0163161_10006198
1596	Ga0163161_10181149
1597	Ga0213873_10011019
1598	Ga0213871_10023420
1599	Ga0224572_1031445
1600	Ga0228598_1023872
1601	Ga0207666_1000147
1602	Ga0207673_1001066
1603	Ga0209758_1000158
1604	Ga0207697_10004223
1605	Ga0207697_10026228
1606	Ga0207653_10003233
1607	Ga0207653_10024585
1608	Ga0207682_10001723
1609	Ga0207692_10010637
1610	Ga0207692_10015380
1611	Ga0207692_10083257
1612	Ga0207642_10001921
1613	Ga0207642_10036165
1614	Ga0207642_10253154
1615	Ga0207710_10004857
1616	Ga0207710_10010654
1617	Ga0207688_10000167
1618	Ga0207688_10115311
1619	Ga0207688_10204115
1620	Ga0207680_10032909
1621	Ga0207647_10000681
1622	Ga0207685_10011851
1623	Ga0207685_10028109
1624	Ga0207685_10182106
1625	Ga0207699_10001769
1626	Ga0207699_10042955
1627	Ga0207699_10250920
1628	Ga0207645_10000076
1629	Ga0207645_10005140
1630	Ga0207645_10109303
1631	Ga0207643_10000227
1632	Ga0207643_10004063
1633	Ga0207684_10011632
1634	Ga0207684_10013663
1635	Ga0207684_10125212
1636	Ga0207684_10158900
1637	Ga0207684_10246191
1638	Ga0207654_10003427
1639	Ga0207654_10011317
1640	Ga0207707_10000357
1641	Ga0207707_10016807
1642	Ga0207707_10072185
1643	Ga0207671_10035659
1644	Ga0207693_10001566
1645	Ga0207693_10031005
1646	Ga0207693_10031776
1647	Ga0207693_10051273
1648	Ga0207693_10097296
1649	Ga0207693_10287449
1650	Ga0207663_10025337
1651	Ga0207663_10031129
1652	Ga0207663_10403707
1653	Ga0207663_10430563
1654	Ga0207663_10552353
1655	Ga0207660_10001252
1656	Ga0207660_10001661
1657	Ga0207662_10000195
1658	Ga0207662_10004491
1659	Ga0207662_10114795
1660	Ga0207657_10000417
1661	Ga0207657_10012031
1662	Ga0207657_10085483
1663	Ga0207649_10000944
1664	Ga0207649_10036871
1665	Ga0207649_10234865
1666	Ga0207652_10003410
1667	Ga0207646_10017807
1668	Ga0207646_10042685
1669	Ga0207646_10190243
1670	Ga0207681_10004024
1671	Ga0207681_10054101
1672	Ga0207681_10401905
1673	Ga0207694_10291247
1674	Ga0207650_10011209
1675	Ga0207650_10024424
1676	Ga0207650_10026959
1677	Ga0207659_10001128
1678	Ga0207659_10341397
1679	Ga0207659_10373382
1680	Ga0207687_10006293
1681	Ga0207687_10129621
1682	Ga0207700_10000389
1683	Ga0207700_10003921
1684	Ga0207700_10038715
1685	Ga0207700_10046114
1686	Ga0207700_10121906
1687	Ga0207700_10233453
1688	Ga0207700_10302709
1689	Ga0207700_10627162
1690	Ga0207664_10035366
1691	Ga0207664_10307940
1692	Ga0207664_10324595
1693	Ga0207664_10452393
1694	Ga0207664_10524968
1695	Ga0207644_10017054
1696	Ga0207644_10043334
1697	Ga0207690_10003172
1698	Ga0207690_10097585
1699	Ga0207706_10010273
1700	Ga0207706_10019755
1701	Ga0207706_10088588
1702	Ga0207686_10002278
1703	Ga0207686_10012067
1704	Ga0207686_10180112
1705	Ga0207709_10000264
1706	Ga0207670_10014947
1707	Ga0207670_10017940
1708	Ga0207670_10198791
1709	Ga0207670_10363203
1710	Ga0207669_10001389
1711	Ga0207669_10044242
1712	Ga0207669_10154536
1713	Ga0207669_10202255
1714	Ga0207704_10001138
1715	Ga0207665_10001576
1716	Ga0207665_10077764
1717	Ga0207665_10387603
1718	Ga0207691_10009001
1719	Ga0207691_10184977
1720	Ga0207711_10011627
1721	Ga0207711_10055850
1722	Ga0207689_10000008
1723	Ga0207689_10000281
1724	Ga0207689_10163794
1725	Ga0207661_10002577
1726	Ga0207661_10213011
1727	Ga0207661_10261995
1728	Ga0207679_10004919
1729	Ga0207679_10026429
1730	Ga0207679_10215340
1731	Ga0207667_10000381
1732	Ga0207667_10008690
1733	Ga0207667_10113850
1734	Ga0207651_10000292
1735	Ga0207651_10007705
1736	Ga0207651_10028919
1737	Ga0207651_10083594
1738	Ga0207651_10505551
1739	Ga0207712_10007532
1740	Ga0207712_10093870
1741	Ga0207712_10220024
1742	Ga0207668_10001329
1743	Ga0207668_10066414
1744	Ga0207668_10158014
1745	Ga0207668_10234820
1746	Ga0207640_10001339
1747	Ga0207640_10001740
1748	Ga0207658_10014450
1749	Ga0207658_10057511
1750	Ga0207677_10011475
1751	Ga0207677_10137766
1752	Ga0207703_10006686
1753	Ga0207703_10032021
1754	Ga0207703_10046719
1755	Ga0207703_10085108
1756	Ga0207703_10316526
1757	Ga0207639_10004638
1758	Ga0207639_10011886
1759	Ga0207639_10085826
1760	Ga0207678_10007809
1761	Ga0207678_10009486
1762	Ga0207678_10045570
1763	Ga0207678_10059491
1764	Ga0207678_10090327
1765	Ga0207708_10006642
1766	Ga0207702_10025513
1767	Ga0207702_10035118
1768	Ga0207702_10066149
1769	Ga0207702_10362689
1770	Ga0207641_10013154
1771	Ga0207641_10231776
1772	Ga0207641_10456592
1773	Ga0207641_10567943
1774	Ga0207648_10009518
1775	Ga0207648_10066684
1776	Ga0207648_10264871
1777	Ga0207648_10580120
1778	Ga0207648_10594853
1779	Ga0207676_10000182
1780	Ga0207676_10046222
1781	Ga0207676_10102038
1782	Ga0207674_10001793
1783	Ga0207674_10012281
1784	Ga0207675_100009057
1785	Ga0207675_100009202
1786	Ga0207675_100015613
1787	Ga0207675_100060950
1788	Ga0207675_100142481
1789	Ga0207675_100394954
1790	Ga0207675_100737378
1791	Ga0207683_10008899
1792	Ga0207683_10074809
1793	Ga0209969_1001687
1794	Ga0209967_1000969
1795	Ga0209981_1000658
1796	Ga0209996_1000275
1797	Ga0209984_1007643
1798	Ga0209968_1001134
1799	Ga0209968_1021574
1800	Ga0209999_1000305
1801	Ga0209982_1004119
1802	Ga0209970_1000685
1803	Ga0209970_1020355
1804	Ga0210002_1002183
1805	Ga0209983_1001147
1806	Ga0209588_1002131
1807	Ga0209588_1033390
1808	Ga0209971_1000054
1809	Ga0209971_1009792
1810	Ga0209966_1000059
1811	Ga0209966_1001377
1812	Ga0209998_10000066
1813	Ga0209998_10001521
1814	Ga0209998_10005041
1815	Ga0209998_10005227
1816	Ga0209974_10001584
1817	Ga0209974_10004634
1818	Ga0207428_10000115
1819	Ga0207428_10000994
1820	Ga0207428_10001793
1821	Ga0207428_10004461
1822	Ga0207428_10027449
1823	Ga0207428_10028254
1824	Ga0268266_10173366
1825	Ga0268266_10485678
1826	Ga0268265_10004000
1827	Ga0268265_10006061
1828	Ga0268265_10204454
1829	Ga0268264_10015470
1830	Ga0268264_10090834
1831	Ga0268264_10635474
1832	Ga0268264_10809588
1833	Ga0265337_1000403
1834	Ga0265763_1000087
1835	Ga0265760_10011007
1836	Ga0265325_10000026
1837	Ga0265325_10001871
1838	Ga0265325_10005066
1839	Ga0265339_10000128
1840	Ga0265339_10016754
1841	Ga0265316_10069637
1842	Ga0265316_10183591
1843	Ga0265313_10000223
1844	Ga0265313_10000246
1845	Ga0265313_10007514
1846	Ga0265313_10016334
1847	Ga0265313_10016824
1848	Ga0265313_10091700
1849	Ga0316579_10005606
1850	Ga0265342_10022655
1851	Ga0373930_0000310
1852	Ga0373930_0033852
1853	Ga0373948_0000329
1854	Ga0373948_0017203
1855	Ga0373958_0000094
1856	Ga0373959_0000480
1857	Ga0373938_0000194
1858	Ga0373938_0002338
1859	Ga0373938_0014157
1860	Ga0373926_0104241
1861	Ga0373928_0000247
1862	Ga0373928_0000963
1863	Ga0373929_0000208
1864	Ga0373929_0008126
1865	Ga0373929_0032036
1866	Ga0373929_0051070
1867	Ga0373940_0000026
1868	Ga0373940_0042253
1869	Ga0373944_0000671
1870	Ga0373949_0001813
1871	Ga0373949_0042541
1872	Ga0373952_0002937
1873	Ga0373952_0046629
1874	Ga0373923_0022613
1875	Ga0373923_0028252
1876	Ga0373932_0000407
1877	Ga0373932_0001744
1878	Ga0373932_0003491
1879	Ga0373936_0003453
1880	Ga0373936_0164713
1881	Ga0373939_0000587
1882	Ga0373939_0005462
1883	Ga0373941_0015027
1884	Ga0373941_0072345
1885	Ga0373945_0004819
1886	Ga0373945_0012078
1887	Ga0373953_0023257
1888	Ga0373953_0035150
1889	Ga0373953_0121149
1890	Ga0373954_0001647
1891	Ga0373954_0104182
1892	Ga0373956_0007852
1893	Ga0373956_0017547
1894	Ga0373956_0078737
1895	Ga0373956_0143887
1896	Ga0373957_0038078
1897	Ga0373960_0000582
1898	Ga0373960_0004777
1899	Ga0373960_0074207
1900	Ga0373943_0004095
1901	Ga0373943_0010807
1902	Ga0373943_0132134
1903	Ga0373943_0182379
1904	Ga0373946_0003226
1905	Ga0373946_0012694
1906	Ga0373946_0118923
1907	Ga0373955_0001161
1908	Ga0373955_0006219
1909	Ga0373955_0030028
1910	Ga0373955_0161000
1911	Ga0373942_0000429
1912	Ga0373942_0001181
1913	Ga0373942_0066423
1914	Ga0373961_0001623
1915	Ga0373961_0007423
1916	Ga0373961_0018962
1917	Ga0373961_0050767
1918	Ga0373962_0000098
1919	Ga0373962_0006178
1920	Ga0373962_0009516
1921	Ga0373962_0020385
1922	Ga0373962_0020497
1923	Ga0373924_0004747
1924	Ga0373924_0125516
1925	Ga0373931_0000378
1926	Ga0373931_0002381
1927	Ga0373931_0002834
1928	Ga0373931_0045072
1929	Ga0373931_0065188
1930	Ga0373931_0067852
1931	Ga0373935_0081762
1932	Ga0373927_0003203
1933	Ga0373927_0028014
1934	Ga0373927_0035441
1935	Ga0373927_0102437
1936	Ga0373927_0485491
1937	Ga0373933_0000862
1938	Ga0373933_0001149
1939	Ga0373933_0370166
1940	Ga0373947_0000063
1941	Ga0373947_0021712
1942	Ga0373947_0028401
1943	Ga0373947_0134592
1944	Ga0373947_0204022
1945	Ga0373937_0004708
1946	Ga0373937_0006909
1947	Ga0373937_0009801
1948	Ga0373937_0018534
1949	Ga0373937_0090900
1950	Ga0373937_0340467
1951	Ga0373925_0000456
1952	Ga0373925_0004703
1953	Ga0373925_0010765
1954	Ga0373925_0046676
1955	Ga0373925_0054744
1956	Ga0395900_0381257
1957	Ga0436364_0140098
1958	Ga0395901_0195490
1959	Ga0242419_001370
1960	Ga0436365_0948719
1961	Ga0436365_1860506
1962	Ga0436360_0052627
1963	Ga0436360_0061316
1964	Ga0436361_0692275
1965	Ga0436362_0553110
1966	Ga0439463_047620
1967	Ga0450923_011985
1968	Ga0450889_006057
1969	Ga0439458_0002369
1970	Ga0439435_0021457
1971	Ga0439459_0008653
1972	Ga0439464_0021337
1973	Ga0439460_0006679
1974	Ga0451577_0010773
1975	Ga0451577_0030891
1976	Ga0451577_0220996
1977	Ga0453683_0180860
1978	Ga0453684_0119142
1979	Ga0453684_0553866
1980	Ga0451576_0005108
1981	Ga0451576_0005407
1982	Ga0451576_0588353
1983	Ga0466958_0002114
1984	Ga0495617_116240
1985	Ga0495592_0006119
1986	Ga0495592_0009003
1987	Ga0495592_0289919
1988	Ga0495603_0089296
1989	Ga0495591_013259
1990	Ga0495629_0000183
1991	Ga0495641_0049237
1992	Ga0495651_0006676
1993	Ga0495651_0012657
1994	Ga0495651_0018701
1995	Ga0495651_0072677
1996	Ga0495653_0008179
1997	Ga0495653_0017231
1998	Ga0495653_0104483
1999	Ga0495653_0228175
2000	Ga0495580_0015636
2001	Ga0495580_0016429
2002	Ga0495582_0005330
2003	Ga0495639_0004781
2004	Ga0495639_0005312
2005	Ga0495662_0003069
2006	Ga0495664_0000985
2007	Ga0495664_0011771
2008	Ga0495584_0005357
2009	Ga0495585_0003428
2010	Ga0495607_0004302
2011	Ga0495608_0087053
2012	Ga0495608_0166183
2013	Ga0495618_0030133
2014	Ga0495618_0108618
2015	Ga0495628_0000950
2016	Ga0495630_0022663
2017	Ga0495630_0030670
2018	Ga0495630_0167129
2019	Ga0495630_0225080
2020	Ga0495630_0292613
2021	Ga0495637_0100555
2022	Ga0495644_0002500
2023	Ga0495663_0006714
2024	Ga0495666_0055294
2025	Ga0495652_0002257
2026	Ga0495652_0011919
2027	Ga0495652_0156617
2028	Ga0495652_0380920
2029	Ga0495665_0004860
2030	Ga0495665_0012011
2031	Ga0495665_0014988
2032	Ga0495665_0039931
2033	Ga0495640_0003512
2034	Ga0495640_0015931
2035	Ga0495640_0045939
2036	Ga0495640_0165900
2037	Ga0495586_0009397
2038	Ga0495587_0018856
2039	Ga0495587_0035272
2040	Ga0495587_0064445
2041	Ga0495598_0000533
2042	Ga0495609_0121486
2043	Ga0495645_0001487
2044	Ga0495645_0032933
2045	Ga0495645_0192651
2046	Ga0495622_0017959
2047	Ga0495633_0005806
2048	Ga0495667_0029180
2049	Ga0495667_0031784
2050	Ga0495667_0044709
2051	Ga0495656_0000174
2052	Ga0495656_0004785
2053	Ga0495634_0023394
2054	Ga0495634_0054595
2055	Ga0495625_0107935
2056	Ga0495635_0027480
2057	Ga0495635_0039670
2058	Ga0495635_0106042
2059	Ga0495659_0005884
2060	Ga0495659_0022783
2061	Ga0495661_0147209
2062	Ga0495657_0013257
2063	Ga0495657_0060146
2064	Ga0495657_0105676
2065	Ga0495657_0140295
2066	Ga0495599_0004908
2067	Ga0495599_0134612
2068	Ga0495623_0049470
2069	Ga0495623_0071488
2070	Ga0495646_0021538
2071	Ga0495647_0059166
2072	Ga0495658_0000357
2073	Ga0495658_0009249
2074	Ga0495613_0008662
2075	Ga0495613_0009388
2076	Ga0495613_0022688
2077	Ga0495624_0009217
2078	Ga0495624_0034623
2079	Ga0495670_0000414
2080	Ga0495589_0090915
2081	Ga0495600_0025547
2082	Ga0495581_0007093
2083	Ga0495581_0113265
2084	Ga0495604_0007509
2085	Ga0495604_0046098
2086	Ga0495604_0111005
2087	Ga0495604_0146948
2088	Ga0495674_0012673
2089	Ga0495674_0206119
2090	Ga0495674_0350356
2091	Ga0495672_0159380
2092	Ga0495676_0026061
2093	Ga0495676_0026597
2094	Ga0495676_0274646
2095	Ga0495680_0005045
2096	Ga0495680_0005049
2097	Ga0495680_0042665
2098	Ga0495680_0074406
2099	Ga0495680_0183103
2100	Ga0495675_0079883
2101	Ga0495675_0105858
2102	Ga0495675_0112979
2103	Ga0495684_0007856
2104	Ga0495684_0039176
2105	Ga0495684_0052631
2106	Ga0495684_0423673
2107	Ga0495593_0008350
2108	Ga0495593_0033995
2109	Ga0495593_0152214
2110	Ga0495602_0004084
2111	Ga0495602_0103399
2112	Ga0495602_0123471
2113	Ga0495602_0123999
2114	Ga0495602_0193895
2115	Ga0495614_0004206
2116	Ga0496100_0002624
2117	Ga0496100_0031631
2118	Ga0496100_0088525
2119	Ga0496101_0003320
2120	Ga0496101_0021084
2121	Ga0496102_0021916
2122	Ga0496102_0024560
2123	Ga0496102_0024748
2124	Ga0496102_0053297
2125	Ga0496102_0057801
2126	Ga0496102_0371005
2127	Ga0496102_0620396
2128	Ga0496102_0623851
2129	Ga0496103_0060328
2130	Ga0496103_0112319
2131	Ga0496103_0257430
2132	Ga0496104_0001363
2133	Ga0496104_0003990
2134	Ga0496104_0004283
2135	Ga0496104_0041939
2136	Ga0496104_0475821
2137	Ga0496104_0530754
2138	Ga0496105_0002131
2139	Ga0496105_0054552
2140	Ga0496105_0057880
2141	Ga0496105_0062655
2142	Ga0496105_0081996
2143	Ga0496105_0135803
2144	Ga0496105_0503566
2145	Ga0496106_0004015
2146	Ga0496106_0030341
2147	Ga0496106_0076169
2148	Ga0496106_0107410
2149	Ga0496106_0133050
2150	Ga0496106_0245991
2151	Ga0496106_0284820
2152	Ga0496107_0005878
2153	Ga0496107_0018210
2154	Ga0496107_0073579
2155	Ga0496107_0114944
2156	Ga0496108_0002494
2157	Ga0496108_0012544
2158	Ga0496108_0032485
2159	Ga0496108_0149744
2160	Ga0496108_0822454
2161	Ga0496109_0000567
2162	Ga0496109_0030748
2163	Ga0496109_0060988
2164	Ga0496109_0133057
2165	Ga0496109_0243967
2166	Ga0496109_0306602
2167	Ga0496109_0468385
2168	Ga0496110_0008186
2169	Ga0496110_0085886
2170	Ga0496110_0109883
2171	Ga0496110_0214421
2172	Ga0496110_0236507
2173	Ga0496110_0264578
2174	Ga0496110_0408057
2175	Ga0496111_0030038
2176	Ga0496111_0038074
2177	Ga0496111_0050153
2178	Ga0496111_0156139
2179	Ga0496112_0050002
2180	Ga0496112_0059918
2181	Ga0496112_0106098
2182	Ga0496112_0109044
2183	Ga0496112_0109071
2184	Ga0496112_0137191
2185	Ga0496112_0260068
2186	Ga0496112_0455086
2187	Ga0496113_0026105
2188	Ga0496113_0044851
2189	Ga0496113_0115796
2190	Ga0496113_0162966
2191	Ga0496113_0240206
2192	Ga0496114_0003201
2193	Ga0496114_0011484
2194	Ga0496114_0020132
2195	Ga0496115_0001922
2196	Ga0496115_0068549
2197	Ga0496115_0228085
2198	Ga0496115_0368576
2199	Ga0501033_0241696
2200	Ga0501034_0470155
2201	Ga0501036_0556121
2202	Ga0501038_0049333
2203	Ga0501039_0085660
2204	Ga0501039_0154916
2205	Ga0501040_0123417
2206	Ga0501040_0127540
2207	Ga0501041_0007435
2208	Ga0501041_0088818
2209	Ga0501042_0008901
2210	Ga0501042_0193688
2211	Ga0501042_0429464
2212	Ga0501043_0302614
2213	Ga0501046_0000202
2214	Ga0501046_0227668
2215	Ga0501046_0447307
2216	Ga0501047_0011524
2217	Ga0501047_0071767
2218	Ga0501047_0371669
2219	Ga0501048_0010069
2220	Ga0501069_0022684
2221	Ga0501069_0048647
2222	Ga0501070_0004890
2223	Ga0501070_0011260
2224	Ga0501070_0462923
2225	Ga0501071_0145686
2226	Ga0501071_0206854
2227	Ga0501072_0050236
2228	Ga0501072_0121247
2229	Ga0501072_0187127
2230	Ga0501073_0113511
2231	Ga0501074_0003506
2232	Ga0501074_0019004
2233	Ga0501074_0234274
2234	Ga0501075_0169008
2235	Ga0501075_0281148
2236	Ga0501076_0013356
2237	Ga0501076_0043209
2238	Ga0501076_0088236
2239	Ga0501076_0107872
2240	Ga0501076_0779320
2241	Ga0501077_0017209
2242	Ga0501077_0292143
2243	Ga0501079_0003432
2244	Ga0501079_0040193
2245	Ga0501079_0121104
2246	Ga0501079_0164146
2247	Ga0501080_0049950
2248	Ga0501080_0066436
2249	Ga0501080_0193622
2250	Ga0501081_0003211
2251	Ga0501081_0016150
2252	Ga0501081_0136454
2253	Ga0501081_0404559
2254	Ga0501083_0003824
2255	Ga0501083_0167900
2256	Ga0501044_0385582
2257	Ga0501045_0002814
2258	Ga0501045_0187591
2259	Ga0501045_0243592
2260	nmdc:mga03683_26975_c1
2261	nmdc:mga03n38_111336_c1
2262	nmdc:mga03n38_8170_c1
2263	nmdc:mga00v17_31547_c1
2264	nmdc:mga00v17_38630_c1
2265	nmdc:mga0yw44_21453_c1
2266	nmdc:mga0yw44_239914_c1
2267	nmdc:mga0yw44_391004_c1
2268	nmdc:mga0k408_259896_c1
2269	nmdc:mga0k408_38643_c1
2270	nmdc:mga0k408_401319_c1
2271	nmdc:mga06z11_1418_c1
2272	nmdc:mga06z11_57486_c1
2273	nmdc:mga07m45_32220_c1
2274	nmdc:mga05p37_219157_c1
2275	nmdc:mga05p37_243725_c1
2276	nmdc:mga05p37_270252_c1
2277	nmdc:mga05p37_29250_c1
2278	nmdc:mga05p37_37199_c1
2279	nmdc:mga05p37_455153_c1
2280	nmdc:mga05p37_496473_c1
2281	nmdc:mga05p37_5774_c1
2282	nmdc:mga05p37_74_c1
2283	nmdc:mga05p37_828_c1
2284	nmdc:mga05p37_96329_c1
2285	nmdc:mga05p37_981539_c1
2286	nmdc:mga09592_12180_c1
2287	nmdc:mga09592_182666_c1
2288	nmdc:mga09592_25067_c1
2289	nmdc:mga09592_257895_c1
2290	nmdc:mga09592_5121_c1
2291	nmdc:mga09592_8944_c1
2292	nmdc:mga0qj67_165_c1
2293	nmdc:mga0qj67_209086_c1
2294	nmdc:mga0qj67_239973_c1
2295	nmdc:mga0qj67_31467_c1
2296	nmdc:mga0qj67_87421_c1
2297	nmdc:mga06r32_146_c1
2298	nmdc:mga06r32_2051_c1
2299	nmdc:mga06r32_385024_c1
2300	nmdc:mga06r32_391649_c1
2301	nmdc:mga06r32_513_c1
2302	nmdc:mga06r32_533739_c1
2303	nmdc:mga06r32_655570_c1
2304	nmdc:mga06r32_90750_c1
2305	nmdc:mga08y16_166400_c1
2306	nmdc:mga08y16_19387_c1
2307	nmdc:mga08y16_373_c1
2308	nmdc:mga08y16_37893_c1
2309	nmdc:mga08y16_431721_c1
2310	nmdc:mga08y16_523503_c1
2311	nmdc:mga08y16_54262_c1
2312	nmdc:mga08y16_574911_c1
2313	nmdc:mga08y16_5774_c1
2314	nmdc:mga0n895_10747_c1
2315	nmdc:mga0n895_1284_c1
2316	nmdc:mga0n895_1396_c1
2317	nmdc:mga0n895_165518_c1
2318	nmdc:mga0n895_22138_c1
2319	nmdc:mga0n895_3297_c1
2320	nmdc:mga0n895_37636_c1
2321	nmdc:mga0n895_5328_c1
2322	nmdc:mga0rr50_133436_c1
2323	nmdc:mga0rr50_14131_c1
2324	nmdc:mga0rr50_180303_c1
2325	nmdc:mga0rr50_25756_c1
2326	nmdc:mga0rr50_48454_c1
2327	nmdc:mga0rr50_58552_c1
2328	nmdc:mga0rr50_798_c1
2329	nmdc:mga0rr50_95181_c1
2330	nmdc:mga08x19_111729_c1
2331	nmdc:mga08x19_26393_c1
2332	nmdc:mga08x19_43704_c1
2333	nmdc:mga08x19_76896_c1
2334	nmdc:mga0a205_1140_c1
2335	nmdc:mga0a205_18335_c1
2336	nmdc:mga0a205_19531_c1
2337	nmdc:mga0a205_203741_c1
2338	nmdc:mga0a205_2320_c1
2339	nmdc:mga0a205_2547_c1
2340	nmdc:mga0a205_331314_c1
2341	nmdc:mga0a205_65103_c1
2342	Ga0495601_0000075
2343	Ga0495601_0001285
2344	Ga0495601_0005306
2345	Ga0495601_0008795
2346	Ga0495601_0045061
2347	Ga0495601_0054316
2348	Ga0495612_0000270
2349	Ga0495612_0001581
2350	Ga0495612_0075214
2351	Ga0495595_0000311
2352	Ga0495595_0000650
2353	Ga0495595_0027381
2354	Ga0495595_0157249
2355	Ga0495619_0000301
2356	Ga0495619_0000645
2357	Ga0495619_0016264
2358	Ga0495619_0024178
2359	Ga0495619_0056324
2360	Ga0495619_0062178
2361	Ga0495619_0112369
2362	Ga0501084_0019705
2363	Ga0501084_0080714
2364	Ga0501084_0162177
2365	Ga0501084_0241039
2366	Ga0501084_0294806
2367	Ga0501084_0558417
2368	Ga0501082_0001816
2369	Ga0501082_0008032
2370	Ga0501082_0051132
2371	Ga0501082_0124899
2372	Ga0501082_0132723
2373	Ga0501082_0304814
2374	Ga0501082_0310702
2375	Ga0501082_0326616
2376	Ga0530510_0050731
2377	Ga0530510_0177547
2378	Ga0530510_0194886
2379	Ga0530510_0335152
2380	Ga0530510_0361420

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

84

231

0.88 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
7caf-assembly1.cif.gz_C	mycobacterium smegmatis lpqy-sugabc complex in the pre-translocation state	0.9375	12	231
1ji0-assembly1.cif.gz_A	crystal structure analysis of the abc transporter from thermotoga maritima	0.9355	8	245
7x0q-assembly1.cif.gz_A	crystal structure of atpase clo1313_2554 from clostridium thermocellum	0.9343	12	231
7cad-assembly1.cif.gz_D	mycobacterium smegmatis sugabc complex	0.9336	12	231
7efo-assembly1.cif.gz_A	lptb2fg-lps from klebsiella pneumoniae in nanodiscs	0.9329	12	241

ID	Description	Score	Start	End	Superfamily
af_P22731_1_237_3.40.50.300	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases	0.954	9	245	3.40.50.300
af_P22731_1_237_3.40.50.300	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases	0.9423	9	245	3.40.50.300
af_Q58664_1_235_3.40.50.300	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases	0.9403	12	241	3.40.50.300
af_P77795_1_218_3.40.50.300	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases	0.9354	10	228	3.40.50.300
af_P31548_12_228_3.40.50.300	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases	0.9323	32	231	3.40.50.300

ID	Description	Score	Start	End	GO Terms
AF-A0A2V6RKS6-F1-model_v4	ABC transporter ATP-binding protein	0.9751	12	245	GO:0005524 GO:0015658 GO:0015807 GO:0016887
AF-A0A1F7NTE8-F1-model_v4	ABC transporter ATP-binding protein	0.9743	12	245	GO:0005524 GO:0015658 GO:0015807 GO:0016887
AF-A0A535HMN3-F1-model_v4	ABC transporter ATP-binding protein	0.97	32	244	GO:0005524 GO:0015658 GO:0015807 GO:0016887
AF-A0A2V6RKS6-F1-model_v4	ABC transporter ATP-binding protein	0.967	12	245	GO:0005524 GO:0015658 GO:0015807 GO:0016887
AF-A0A1F7NTE8-F1-model_v4	ABC transporter ATP-binding protein	0.9662	12	245	GO:0005524 GO:0015658 GO:0015807 GO:0016887

F491443

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF00005

ABC_tran

ABC transporter

84

231

0.88

Structural Annotation

Top 5 Hits

Map