F491433

General Info

Members Datasets Scaffolds Average Seq Length
1189 373 2378 199

Family's Representative Sequence

Representative Sequence 3300005331|Ga0070670_100026313|Ga0070670_1000263134
Length 236
Sequence MNITAVRPYPPSYLATGPEGPRIQTMTLTDDELVARSIGGDAESFNELILRWERPIYALAYRVIGREEDARDVCQETFLRAFRALPGFKGEAKFSSWLYRIALNLCRDWIRRQRRAPVVQMPEGVEPTELAAERGPVESIEELVGRRQLSAVVEEAMALLPEEQRTAIILKEYHGMTFQEIADMQGCPLSTVKTRLYQGLTVLRRHLDKNGIGLNRVEGVAASKVAGQITPRLVKR

Samples

Sample ID Description Type Environment
1 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300004785 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-1 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
4 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
5 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
7 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
8 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
24 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
37 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
38 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
39 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
40 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
41 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
42 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
43 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
44 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
45 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
46 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
47 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
48 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
49 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
50 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
51 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
52 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
53 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
54 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
55 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
56 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
57 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
58 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
59 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
60 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
61 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
62 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
63 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
64 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
65 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
66 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
67 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
68 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
69 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
70 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
71 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
72 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
73 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
74 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
75 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
76 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
77 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
78 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
79 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
80 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
81 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
82 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
83 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
84 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
85 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
86 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
87 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
88 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
89 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
90 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
91 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
93 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
94 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
95 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
96 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
97 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
98 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
99 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
100 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
101 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
102 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
103 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
104 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
105 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
106 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
107 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
108 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
109 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
110 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
111 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
112 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
113 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
114 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
115 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
116 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
117 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
118 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
119 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
120 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
121 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
122 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
123 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
124 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
125 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
126 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
127 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
128 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
129 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
130 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
189 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
192 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
193 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
194 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
195 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
199 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
200 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
201 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
202 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
203 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
204 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
205 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
206 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
207 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
208 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
209 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
210 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
211 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
212 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
213 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
214 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
215 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
216 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
217 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
218 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
219 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
220 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
221 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
222 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
223 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
224 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
225 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
226 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
227 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
228 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
229 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
230 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
231 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
232 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
233 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
234 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
235 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
236 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
237 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
238 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
239 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
240 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
241 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
242 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
243 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
244 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
245 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
246 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
247 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
248 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
249 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
250 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
251 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
252 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
253 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
254 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
255 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
256 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
257 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
258 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
259 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
260 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
261 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
262 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
263 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
264 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
265 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
266 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
267 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
268 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
269 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
270 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
271 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
272 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
273 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
274 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
275 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
276 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
277 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
278 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
279 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
280 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
281 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
282 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
283 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
284 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
285 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
286 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
287 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
288 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
289 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
290 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
291 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
292 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
293 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
294 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
295 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
296 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
297 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
298 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
299 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
300 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
301 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
302 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
303 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
304 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
305 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
306 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
307 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
308 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
309 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
310 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
311 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
312 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
313 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
314 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
315 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
316 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
317 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
318 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
319 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
320 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
321 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
322 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
323 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
324 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
325 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
326 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
327 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
328 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
329 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
330 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
331 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
332 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
333 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
334 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
335 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
336 3300049678 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought Metagenome Rhizosphere
337 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
338 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
339 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
340 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
341 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
342 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
343 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
344 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
345 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
346 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
347 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
348 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
349 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
350 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
351 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
352 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
353 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
354 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
355 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
356 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
357 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
358 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
359 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
360 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
361 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
362 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
363 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
364 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
365 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
366 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
367 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
368 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
369 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
370 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
371 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
372 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
373 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.33
Metatranscriptomes 0.67
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.44
Nodule 0
Rhizoplane 2.19
Rhizosphere 94.87
Stem 0
Stem Tuber 0
Unclassified 23.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070670_100026313 3300005331 Bacteria 5008
2 JGI25406J46586_10000717 3300003203 Bacteria 15505
3 JGI25406J46586_10002626 3300003203 Bacteria 8478
4 JGI25406J46586_10024043 3300003203 Bacteria 2396
5 Ga0058858_1426466 3300004785 Unclassified 904
6 Ga0058859_11578489 3300004798 Bacteria 1187
7 Ga0058859_11790629 3300004798 Unclassified 719
8 Ga0058861_12044645 3300004800 Unclassified 934
9 Ga0058860_12143216 3300004801 Unclassified 1151
10 Ga0058862_12520517 3300004803 Bacteria 1132
11 Ga0065704_10022086 3300005289 Unclassified 1430
12 Ga0065712_10083022 3300005290 Bacteria 2868
13 Ga0065712_10174957 3300005290 Unclassified 1223
14 Ga0065712_10186090 3300005290 Unclassified 1169
15 Ga0065712_10189294 3300005290 Bacteria 1155
16 Ga0065712_10197171 3300005290 Unclassified 1123
17 Ga0065712_10263114 3300005290 Bacteria 931
18 Ga0065712_10324743 3300005290 Bacteria 823
19 Ga0065715_10110347 3300005293 Bacteria 2624
20 Ga0065715_10144576 3300005293 Unclassified 1806
21 Ga0065715_10174953 3300005293 Bacteria 1486
22 Ga0065715_10364441 3300005293 Unclassified 930
23 Ga0065715_10437544 3300005293 Bacteria 840
24 Ga0065707_10117551 3300005295 Bacteria 2208
25 Ga0065707_10134959 3300005295 Bacteria 1857
26 Ga0065707_10151914 3300005295 Bacteria 1649
27 Ga0065707_10257191 3300005295 Bacteria 1108
28 Ga0070676_10048439 3300005328 Bacteria 2484
29 Ga0070676_10079232 3300005328 Bacteria 1989
30 Ga0070676_10092042 3300005328 Bacteria 1859
31 Ga0070676_10254782 3300005328 Unclassified 1173
32 Ga0070676_10314917 3300005328 Bacteria 1065
33 Ga0070683_100002625 3300005329 Bacteria 14371
34 Ga0070683_100030831 3300005329 Bacteria 4872
35 Ga0070690_100012083 3300005330 Bacteria 5071
36 Ga0070690_100304528 3300005330 Bacteria 1143
37 Ga0070690_100708680 3300005330 Bacteria 773
38 Ga0070670_100010086 3300005331 Bacteria 8061
39 Ga0070670_100012414 3300005331 Bacteria 7290
40 Ga0070670_100018368 3300005331 Bacteria 6000
41 Ga0070670_100023579 3300005331 Bacteria 5296
42 Ga0070670_100055636 3300005331 Bacteria 3396
43 Ga0070670_100424101 3300005331 Bacteria 1176
44 Ga0070670_100777205 3300005331 Bacteria 864
45 Ga0070677_10053910 3300005333 Bacteria 1636
46 Ga0070677_10185057 3300005333 Bacteria 995
47 Ga0068869_100023804 3300005334 Bacteria 4236
48 Ga0068869_100117396 3300005334 Bacteria 2031
49 Ga0068869_100370206 3300005334 Bacteria 1172
50 Ga0070666_10001460 3300005335 Bacteria 14346
51 Ga0070666_10078500 3300005335 Bacteria 2254
52 Ga0070666_10286409 3300005335 Bacteria 1172
53 Ga0070666_10376318 3300005335 Unclassified 1019
54 Ga0070680_100168366 3300005336 Bacteria 1843
55 Ga0070680_100463986 3300005336 Bacteria 1082
56 Ga0070680_100588429 3300005336 Bacteria 955
57 Ga0070680_100701612 3300005336 Unclassified 871
58 Ga0070682_100299639 3300005337 Bacteria 1179
59 Ga0070682_100512078 3300005337 Unclassified 932
60 Ga0068868_100430738 3300005338 Unclassified 1144
61 Ga0068868_100446569 3300005338 Unclassified 1124
62 Ga0068868_100447567 3300005338 Bacteria 1123
63 Ga0070660_100056707 3300005339 Bacteria 3032
64 Ga0070689_100021821 3300005340 Bacteria 4773
65 Ga0070689_100022436 3300005340 Bacteria 4712
66 Ga0070689_100072399 3300005340 Bacteria 2693
67 Ga0070689_100152383 3300005340 Bacteria 1865
68 Ga0070689_100192528 3300005340 Unclassified 1661
69 Ga0070689_100259095 3300005340 Bacteria 1437
70 Ga0070689_100503373 3300005340 Unclassified 1038
71 Ga0070689_100717689 3300005340 Unclassified 874
72 Ga0070689_100750038 3300005340 Unclassified 855
73 Ga0070691_10032075 3300005341 Bacteria 2467
74 Ga0070687_100047492 3300005343 Bacteria 2202
75 Ga0070687_100049562 3300005343 Bacteria 2165
76 Ga0070687_100685063 3300005343 Unclassified 714
77 Ga0070661_100168806 3300005344 Bacteria 1661
78 Ga0070661_100263132 3300005344 Bacteria 1334
79 Ga0070692_10061075 3300005345 Bacteria 1986
80 Ga0070668_100451620 3300005347 Bacteria 1105
81 Ga0070668_100542997 3300005347 Bacteria 1011
82 Ga0070669_100003238 3300005353 Bacteria 11696
83 Ga0070669_100008530 3300005353 Bacteria 7316
84 Ga0070669_100085713 3300005353 Bacteria 2352
85 Ga0070669_100108206 3300005353 Bacteria 2106
86 Ga0070669_100152404 3300005353 Bacteria 1790
87 Ga0070669_100159766 3300005353 Bacteria 1750
88 Ga0070669_100183548 3300005353 Bacteria 1638
89 Ga0070669_100447080 3300005353 Bacteria 1065
90 Ga0070669_100492414 3300005353 Unclassified 1016
91 Ga0070675_100000617 3300005354 Bacteria 24579
92 Ga0070675_100001519 3300005354 Bacteria 17153
93 Ga0070675_100003475 3300005354 Bacteria 11947
94 Ga0070675_100007631 3300005354 Bacteria 8369
95 Ga0070675_100007926 3300005354 Bacteria 8233
96 Ga0070675_100024800 3300005354 Bacteria 4804
97 Ga0070675_100072184 3300005354 Unclassified 2865
98 Ga0070675_100106073 3300005354 Bacteria 2372
99 Ga0070675_100115083 3300005354 Bacteria 2279
100 Ga0070675_100404555 3300005354 Bacteria 1218
101 Ga0070675_100711946 3300005354 Unclassified 915
102 Ga0070671_100004187 3300005355 Bacteria 11406
103 Ga0070671_100046654 3300005355 Bacteria 3603
104 Ga0070671_100063454 3300005355 Unclassified 3076
105 Ga0070671_100127168 3300005355 Bacteria 2146
106 Ga0070671_100691833 3300005355 Unclassified 884
107 Ga0070671_101271637 3300005355 Bacteria 649
108 Ga0070674_100014856 3300005356 Bacteria 4847
109 Ga0070674_100091393 3300005356 Bacteria 2198
110 Ga0070674_100264668 3300005356 Bacteria 1356
111 Ga0070674_100406947 3300005356 Bacteria 1113
112 Ga0070674_100708812 3300005356 Bacteria 861
113 Ga0070673_100003552 3300005364 Bacteria 9729
114 Ga0070673_100010680 3300005364 Bacteria 6227
115 Ga0070673_100014066 3300005364 Bacteria 5558
116 Ga0070673_100017589 3300005364 Bacteria 5089
117 Ga0070673_100056981 3300005364 Bacteria 3086
118 Ga0070673_100070875 3300005364 Bacteria 2799
119 Ga0070673_100180396 3300005364 Bacteria 1807
120 Ga0070673_100553880 3300005364 Bacteria 1045
121 Ga0070673_100632812 3300005364 Bacteria 978
122 Ga0070688_100082983 3300005365 Bacteria 2079
123 Ga0070688_100136071 3300005365 Bacteria 1663
124 Ga0070688_100154171 3300005365 Bacteria 1573
125 Ga0070688_100475626 3300005365 Unclassified 938
126 Ga0070659_100052454 3300005366 Bacteria 3208
127 Ga0070659_100215705 3300005366 Unclassified 1583
128 Ga0070659_100430331 3300005366 Bacteria 1117
129 Ga0070659_100692624 3300005366 Unclassified 881
130 Ga0070667_100242186 3300005367 Unclassified 1611
131 Ga0070667_100390253 3300005367 Bacteria 1266
132 Ga0070667_100524171 3300005367 Unclassified 1088
133 Ga0070667_100573020 3300005367 Bacteria 1039
134 Ga0070703_10053542 3300005406 Bacteria 1298
135 Ga0070714_100041923 3300005435 Bacteria 3864
136 Ga0070713_100041155 3300005436 Bacteria 3763
137 Ga0070713_100097307 3300005436 Unclassified 2543
138 Ga0070713_100351393 3300005436 Bacteria 1368
139 Ga0070701_10002629 3300005438 Bacteria 6957
140 Ga0070701_10022582 3300005438 Unclassified 3017
141 Ga0070701_10043915 3300005438 Bacteria 2288
142 Ga0070701_10335155 3300005438 Unclassified 940
143 Ga0070705_100048215 3300005440 Bacteria 2466
144 Ga0070705_100051202 3300005440 Bacteria 2406
145 Ga0070705_100060914 3300005440 Bacteria 2241
146 Ga0070705_100271070 3300005440 Bacteria 1202
147 Ga0070705_100289556 3300005440 Unclassified 1168
148 Ga0070705_100336934 3300005440 Unclassified 1095
149 Ga0070700_100002087 3300005441 Bacteria 10147
150 Ga0070700_100011496 3300005441 Bacteria 4905
151 Ga0070700_100049403 3300005441 Bacteria 2612
152 Ga0070700_100136775 3300005441 Bacteria 1660
153 Ga0070700_100145215 3300005441 Unclassified 1616
154 Ga0070694_100003530 3300005444 Bacteria 9350
155 Ga0070694_100009709 3300005444 Bacteria 5909
156 Ga0070694_100079788 3300005444 Bacteria 2273
157 Ga0070694_100109687 3300005444 Bacteria 1965
158 Ga0070694_100195470 3300005444 Bacteria 1505
159 Ga0070694_100216907 3300005444 Bacteria 1433
160 Ga0070694_100569194 3300005444 Bacteria 909
161 Ga0070708_100269672 3300005445 Unclassified 1601
162 Ga0070708_100906382 3300005445 Bacteria 828
163 Ga0070663_100023419 3300005455 Bacteria 4140
164 Ga0070663_100025375 3300005455 Bacteria 4000
165 Ga0070663_100083330 3300005455 Bacteria 2355
166 Ga0070678_100218400 3300005456 Bacteria 1583
167 Ga0070678_100253519 3300005456 Bacteria 1476
168 Ga0070678_100486455 3300005456 Unclassified 1087
169 Ga0070678_100761022 3300005456 Bacteria 877
170 Ga0070678_101051791 3300005456 Bacteria 750
171 Ga0070662_100108748 3300005457 Bacteria 2109
172 Ga0070662_100121481 3300005457 Bacteria 2003
173 Ga0070662_100213070 3300005457 Bacteria 1538
174 Ga0070662_100224355 3300005457 Unclassified 1501
175 Ga0070662_100471291 3300005457 Bacteria 1044
176 Ga0070662_100527198 3300005457 Bacteria 988
177 Ga0070662_100632389 3300005457 Unclassified 902
178 Ga0070662_101019977 3300005457 Unclassified 709
179 Ga0070681_10003234 3300005458 Bacteria 15193
180 Ga0070681_10025795 3300005458 Bacteria 5910
181 Ga0070681_10080026 3300005458 Bacteria 3224
182 Ga0070681_10425357 3300005458 Bacteria 1240
183 Ga0070681_10603486 3300005458 Bacteria 1012
184 Ga0070681_10617802 3300005458 Unclassified 998
185 Ga0068867_100003458 3300005459 Bacteria 11108
186 Ga0068867_100006787 3300005459 Bacteria 8093
187 Ga0068867_100015827 3300005459 Bacteria 5354
188 Ga0068867_100226648 3300005459 Bacteria 1509
189 Ga0070685_10055310 3300005466 Bacteria 2305
190 Ga0070685_10443790 3300005466 Bacteria 907
191 Ga0070706_100365177 3300005467 Unclassified 1345
192 Ga0070706_100506555 3300005467 Unclassified 1123
193 Ga0070707_100050521 3300005468 Bacteria 3986
194 Ga0070707_100500183 3300005468 Bacteria 1177
195 Ga0070698_100011373 3300005471 Bacteria 9446
196 Ga0070698_100129061 3300005471 Bacteria 2484
197 Ga0070698_100321503 3300005471 Bacteria 1478
198 Ga0070699_100001754 3300005518 Bacteria 19774
199 Ga0070699_100005910 3300005518 Bacteria 10693
200 Ga0070699_100007030 3300005518 Bacteria 9778
201 Ga0070699_100020778 3300005518 Bacteria 5662
202 Ga0070679_100146193 3300005530 Bacteria 2342
203 Ga0070679_100525927 3300005530 Bacteria 1127
204 Ga0070684_100004802 3300005535 Bacteria 10327
205 Ga0070684_100015024 3300005535 Bacteria 6289
206 Ga0070684_100370480 3300005535 Bacteria 1319
207 Ga0070684_100699684 3300005535 Unclassified 945
208 Ga0070697_100007518 3300005536 Bacteria 8481
209 Ga0068853_100233518 3300005539 Bacteria 1683
210 Ga0070672_100022715 3300005543 Bacteria 4613
211 Ga0070672_100030757 3300005543 Bacteria 4037
212 Ga0070672_100205258 3300005543 Unclassified 1649
213 Ga0070672_100211558 3300005543 Bacteria 1624
214 Ga0070672_100258875 3300005543 Bacteria 1467
215 Ga0070672_100268205 3300005543 Bacteria 1441
216 Ga0070672_100291759 3300005543 Bacteria 1381
217 Ga0070672_100766166 3300005543 Unclassified 848
218 Ga0070686_100001443 3300005544 Bacteria 13429
219 Ga0070686_100017081 3300005544 Bacteria 4235
220 Ga0070686_100121824 3300005544 Unclassified 1792
221 Ga0070686_100196261 3300005544 Bacteria 1444
222 Ga0070686_100298596 3300005544 Bacteria 1194
223 Ga0070686_100439309 3300005544 Bacteria 1001
224 Ga0070686_100639127 3300005544 Bacteria 842
225 Ga0070686_100711104 3300005544 Unclassified 802
226 Ga0070695_100001218 3300005545 Bacteria 14150
227 Ga0070695_100094340 3300005545 Bacteria 2004
228 Ga0070695_100153677 3300005545 Bacteria 1608
229 Ga0070695_100330713 3300005545 Unclassified 1136
230 Ga0070695_100368605 3300005545 Bacteria 1081
231 Ga0070695_100409379 3300005545 Bacteria 1030
232 Ga0070696_100002157 3300005546 Bacteria 12961
233 Ga0070696_100004447 3300005546 Bacteria 9355
234 Ga0070696_100005834 3300005546 Bacteria 8216
235 Ga0070696_100044304 3300005546 Bacteria 3081
236 Ga0070696_100406644 3300005546 Bacteria 1066
237 Ga0070696_100989646 3300005546 Bacteria 702
238 Ga0070693_100031621 3300005547 Bacteria 2903
239 Ga0070693_100102096 3300005547 Bacteria 1749
240 Ga0070693_100259552 3300005547 Bacteria 1155
241 Ga0070693_100458516 3300005547 Bacteria 896
242 Ga0070665_100082746 3300005548 Bacteria 3215
243 Ga0070665_100572659 3300005548 Bacteria 1142
244 Ga0070704_100009084 3300005549 Bacteria 5997
245 Ga0070704_100009193 3300005549 Bacteria 5960
246 Ga0070704_100110374 3300005549 Bacteria 2092
247 Ga0070704_100135635 3300005549 Bacteria 1914
248 Ga0070704_100219851 3300005549 Bacteria 1544
249 Ga0070704_100226268 3300005549 Bacteria 1523
250 Ga0070704_100319375 3300005549 Bacteria 1301
251 Ga0070704_100525312 3300005549 Bacteria 1031
252 Ga0070704_100525981 3300005549 Unclassified 1030
253 Ga0068855_100602131 3300005563 Bacteria 1185
254 Ga0070664_100000832 3300005564 Bacteria 23806
255 Ga0070664_100024195 3300005564 Bacteria 5022
256 Ga0070664_100151298 3300005564 Bacteria 2049
257 Ga0070664_100196586 3300005564 Unclassified 1798
258 Ga0070664_100279561 3300005564 Bacteria 1505
259 Ga0070664_100452751 3300005564 Unclassified 1179
260 Ga0070664_100589394 3300005564 Bacteria 1030
261 Ga0070664_101229701 3300005564 Unclassified 707
262 Ga0068857_100015517 3300005577 Bacteria 6657
263 Ga0068857_100067796 3300005577 Bacteria 3176
264 Ga0068857_100187979 3300005577 Unclassified 1881
265 Ga0068854_100004044 3300005578 Bacteria 9206
266 Ga0068854_100043326 3300005578 Bacteria 3189
267 Ga0068854_100084705 3300005578 Bacteria 2346
268 Ga0070702_100031413 3300005615 Bacteria 2905
269 Ga0070702_100064214 3300005615 Unclassified 2147
270 Ga0070702_100070398 3300005615 Bacteria 2065
271 Ga0070702_100159944 3300005615 Unclassified 1455
272 Ga0070702_100207339 3300005615 Unclassified 1302
273 Ga0068852_100016767 3300005616 Bacteria 5724
274 Ga0068852_100051384 3300005616 Bacteria 3537
275 Ga0068852_100435132 3300005616 Unclassified 1296
276 Ga0068859_100040288 3300005617 Bacteria 4689
277 Ga0068859_100168081 3300005617 Unclassified 2273
278 Ga0068859_100206025 3300005617 Bacteria 2052
279 Ga0068859_100306687 3300005617 Bacteria 1681
280 Ga0068859_100379265 3300005617 Unclassified 1509
281 Ga0068859_100409808 3300005617 Unclassified 1451
282 Ga0068859_100887832 3300005617 Bacteria 976
283 Ga0068859_101409786 3300005617 Unclassified 768
284 Ga0068864_100009165 3300005618 Bacteria 8159
285 Ga0068864_100062567 3300005618 Bacteria 3224
286 Ga0068864_100373005 3300005618 Bacteria 1351
287 Ga0068864_100621421 3300005618 Bacteria 1050
288 Ga0068864_100645027 3300005618 Unclassified 1031
289 Ga0068864_101041391 3300005618 Archaea 813
290 Ga0068866_10011610 3300005718 Bacteria 3816
291 Ga0068866_10043798 3300005718 Bacteria 2236
292 Ga0068861_100003679 3300005719 Bacteria 10228
293 Ga0068861_100029946 3300005719 Bacteria 3986
294 Ga0068861_100075669 3300005719 Bacteria 2621
295 Ga0068861_100320593 3300005719 Bacteria 1349
296 Ga0068861_100438532 3300005719 Unclassified 1168
297 Ga0068861_101164138 3300005719 Unclassified 744
298 Ga0068851_10039668 3300005834 Unclassified 2365
299 Ga0068851_10133148 3300005834 Bacteria 1346
300 Ga0068870_10017038 3300005840 Bacteria 3487
301 Ga0068870_10130593 3300005840 Bacteria 1459
302 Ga0068863_100052159 3300005841 Bacteria 3877
303 Ga0068863_100200070 3300005841 Bacteria 1921
304 Ga0068863_100254548 3300005841 Unclassified 1697
305 Ga0068863_100406631 3300005841 Bacteria 1332
306 Ga0068863_100519313 3300005841 Unclassified 1174
307 Ga0068858_100010889 3300005842 Bacteria 8596
308 Ga0068858_100022318 3300005842 Bacteria 5910
309 Ga0068858_100041710 3300005842 Bacteria 4254
310 Ga0068858_100193443 3300005842 Bacteria 1922
311 Ga0068860_100054620 3300005843 Bacteria 3796
312 Ga0068860_100195153 3300005843 Bacteria 1960
313 Ga0068860_100375059 3300005843 Unclassified 1404
314 Ga0068860_100514969 3300005843 Unclassified 1196
315 Ga0068860_100643863 3300005843 Unclassified 1067
316 Ga0068860_100821131 3300005843 Bacteria 943
317 Ga0068862_100056994 3300005844 Bacteria 3349
318 Ga0068862_100119950 3300005844 Bacteria 2317
319 Ga0068862_100292113 3300005844 Unclassified 1497
320 Ga0081455_10076085 3300005937 Bacteria 2766
321 Ga0081538_10099985 3300005981 Bacteria 1464
322 Ga0081539_10000291 3300005985 Bacteria 113769
323 Ga0081539_10000295 3300005985 Bacteria 112740
324 Ga0081539_10002133 3300005985 Bacteria 29223
325 Ga0075368_10010304 3300006042 Bacteria 3377
326 Ga0075368_10045552 3300006042 Unclassified 1733
327 Ga0075364_10002862 3300006051 Bacteria 9724
328 Ga0075364_10007269 3300006051 Bacteria 6568
329 Ga0075362_10003359 3300006177 Bacteria 5578
330 Ga0075367_10005268 3300006178 Bacteria 6395
331 Ga0075367_10019677 3300006178 Bacteria 3747
332 Ga0075369_10135769 3300006186 Unclassified 1120
333 Ga0075427_10017711 3300006194 Bacteria 1113
334 Ga0075366_10029113 3300006195 Unclassified 3244
335 Ga0097621_100123867 3300006237 Bacteria 2194
336 Ga0097621_100214970 3300006237 Unclassified 1673
337 Ga0097621_100301059 3300006237 Bacteria 1416
338 Ga0097621_100382342 3300006237 Unclassified 1258
339 Ga0097621_100449358 3300006237 Bacteria 1161
340 Ga0075370_10008989 3300006353 Bacteria 5166
341 Ga0068871_100060502 3300006358 Bacteria 3090
342 Ga0068871_100257549 3300006358 Bacteria 1521
343 Ga0068871_100883886 3300006358 Bacteria 827
344 Ga0075428_100000931 3300006844 Bacteria 30952
345 Ga0075428_100008691 3300006844 Bacteria 11267
346 Ga0075428_100015755 3300006844 Bacteria 8376
347 Ga0075428_100024626 3300006844 Bacteria 6661
348 Ga0075428_100033671 3300006844 Bacteria 5655
349 Ga0075428_100041952 3300006844 Bacteria 5031
350 Ga0075428_100163037 3300006844 Bacteria 2419
351 Ga0075428_100823678 3300006844 Bacteria 986
352 Ga0075430_100000398 3300006846 Bacteria 32154
353 Ga0075430_100030658 3300006846 Bacteria 4568
354 Ga0075430_100041996 3300006846 Bacteria 3867
355 Ga0075430_100050744 3300006846 Bacteria 3497
356 Ga0075430_100174789 3300006846 Bacteria 1787
357 Ga0075430_100198918 3300006846 Bacteria 1664
358 Ga0075431_100015570 3300006847 Bacteria 7707
359 Ga0075431_100036470 3300006847 Bacteria 5064
360 Ga0075431_100132041 3300006847 Bacteria 2575
361 Ga0075431_100407815 3300006847 Bacteria 1359
362 Ga0075431_100523119 3300006847 Bacteria 1175
363 Ga0075433_10005915 3300006852 Bacteria 9635
364 Ga0075433_10008576 3300006852 Bacteria 8157
365 Ga0075433_10048647 3300006852 Bacteria 3688
366 Ga0075433_10138299 3300006852 Bacteria 2165
367 Ga0075433_10197196 3300006852 Unclassified 1790
368 Ga0075433_10217667 3300006852 Unclassified 1697
369 Ga0075433_10275626 3300006852 Bacteria 1491
370 Ga0075433_10354684 3300006852 Bacteria 1296
371 Ga0075433_10387427 3300006852 Bacteria 1234
372 Ga0075433_11036696 3300006852 Bacteria 714
373 Ga0075434_100004997 3300006871 Bacteria 12038
374 Ga0075434_100010035 3300006871 Bacteria 8867
375 Ga0075434_100011617 3300006871 Bacteria 8314
376 Ga0075434_100019603 3300006871 Bacteria 6546
377 Ga0075434_100019962 3300006871 Bacteria 6490
378 Ga0075434_100136223 3300006871 Bacteria 2475
379 Ga0075434_100161445 3300006871 Unclassified 2261
380 Ga0075434_100181639 3300006871 Bacteria 2124
381 Ga0075434_100194788 3300006871 Unclassified 2047
382 Ga0075434_100640974 3300006871 Unclassified 1081
383 Ga0075429_100005250 3300006880 Bacteria 11144
384 Ga0075429_100012127 3300006880 Bacteria 7469
385 Ga0075429_100055017 3300006880 Bacteria 3462
386 Ga0075429_100066676 3300006880 Bacteria 3134
387 Ga0075429_100121667 3300006880 Bacteria 2282
388 Ga0075429_100149495 3300006880 Bacteria 2045
389 Ga0075429_100220471 3300006880 Bacteria 1661
390 Ga0075429_100283959 3300006880 Bacteria 1449
391 Ga0075429_100288094 3300006880 Unclassified 1438
392 Ga0075429_100482178 3300006880 Bacteria 1087
393 Ga0068865_100008578 3300006881 Bacteria 6319
394 Ga0068865_100015657 3300006881 Bacteria 4838
395 Ga0068865_100071425 3300006881 Unclassified 2462
396 Ga0068865_100574286 3300006881 Unclassified 950
397 Ga0097620_100040291 3300006931 Bacteria 4689
398 Ga0097620_100168076 3300006931 Unclassified 2273
399 Ga0097620_100206025 3300006931 Bacteria 2052
400 Ga0097620_100306663 3300006931 Bacteria 1681
401 Ga0097620_100379258 3300006931 Unclassified 1509
402 Ga0097620_100409791 3300006931 Unclassified 1451
403 Ga0097620_100887886 3300006931 Bacteria 976
404 Ga0097620_101409751 3300006931 Unclassified 768
405 Ga0075435_100000542 3300007076 Bacteria 23134
406 Ga0075435_100003059 3300007076 Bacteria 11280
407 Ga0075435_100040441 3300007076 Bacteria 3722
408 Ga0075435_100112436 3300007076 Bacteria 2266
409 Ga0075435_100164287 3300007076 Unclassified 1871
410 Ga0075435_100232611 3300007076 Unclassified 1566
411 Ga0075435_100374591 3300007076 Bacteria 1222
412 Ga0105240_10364422 3300009093 Bacteria 1636
413 Ga0111539_10002826 3300009094 Bacteria 23090
414 Ga0111539_10004921 3300009094 Bacteria 17381
415 Ga0111539_10005196 3300009094 Bacteria 16863
416 Ga0111539_10005833 3300009094 Bacteria 15921
417 Ga0111539_10008803 3300009094 Bacteria 12801
418 Ga0111539_10012690 3300009094 Bacteria 10551
419 Ga0111539_10032568 3300009094 Bacteria 6329
420 Ga0111539_10044641 3300009094 Bacteria 5309
421 Ga0111539_10056800 3300009094 Bacteria 4651
422 Ga0111539_10152541 3300009094 Unclassified 2704
423 Ga0111539_10216291 3300009094 Bacteria 2232
424 Ga0111539_10220946 3300009094 Bacteria 2206
425 Ga0111539_10344915 3300009094 Bacteria 1733
426 Ga0111539_10417412 3300009094 Unclassified 1563
427 Ga0111539_10869197 3300009094 Unclassified 1049
428 Ga0111539_10923527 3300009094 Unclassified 1015
429 Ga0105245_10115143 3300009098 Bacteria 2505
430 Ga0105245_10909943 3300009098 Unclassified 922
431 Ga0114129_10000288 3300009147 Bacteria 58119
432 Ga0114129_10003329 3300009147 Bacteria 22583
433 Ga0114129_10006935 3300009147 Bacteria 16117
434 Ga0114129_10014822 3300009147 Bacteria 11109
435 Ga0114129_10018044 3300009147 Bacteria 10051
436 Ga0114129_10038503 3300009147 Bacteria 6744
437 Ga0114129_10056807 3300009147 Bacteria 5480
438 Ga0114129_10082261 3300009147 Unclassified 4474
439 Ga0114129_10104445 3300009147 Bacteria 3915
440 Ga0114129_10175991 3300009147 Bacteria 2914
441 Ga0114129_10287740 3300009147 Bacteria 2194
442 Ga0114129_10570195 3300009147 Unclassified 1470
443 Ga0114129_11009442 3300009147 Unclassified 1047
444 Ga0114129_11074977 3300009147 Bacteria 1009
445 Ga0105243_10167484 3300009148 Bacteria 1900
446 Ga0105243_10508626 3300009148 Bacteria 1143
447 Ga0105243_10527205 3300009148 Unclassified 1124
448 Ga0105243_10682958 3300009148 Bacteria 999
449 Ga0105243_10825424 3300009148 Unclassified 916
450 Ga0105241_10089643 3300009174 Bacteria 2423
451 Ga0105241_10155896 3300009174 Bacteria 1873
452 Ga0105242_10707872 3300009176 Bacteria 986
453 Ga0105242_10842426 3300009176 Bacteria 912
454 Ga0105248_10005969 3300009177 Bacteria 13374
455 Ga0105248_10065657 3300009177 Bacteria 4074
456 Ga0105248_10085016 3300009177 Unclassified 3560
457 Ga0105248_10139228 3300009177 Bacteria 2737
458 Ga0105248_10169117 3300009177 Bacteria 2464
459 Ga0105248_10237407 3300009177 Bacteria 2052
460 Ga0105248_10261164 3300009177 Bacteria 1949
461 Ga0105248_10402174 3300009177 Unclassified 1542
462 Ga0105248_11987740 3300009177 Unclassified 660
463 Ga0105237_10995334 3300009545 Unclassified 845
464 Ga0105237_11064841 3300009545 Unclassified 815
465 Ga0105238_10010201 3300009551 Bacteria 9418
466 Ga0105238_10539884 3300009551 Bacteria 1170
467 Ga0105238_10983504 3300009551 Bacteria 864
468 Ga0105249_10010772 3300009553 Bacteria 8035
469 Ga0105249_10013057 3300009553 Bacteria 7332
470 Ga0105249_10664919 3300009553 Unclassified 1100
471 Ga0105249_10820293 3300009553 Bacteria 995
472 Ga0105239_10341302 3300010375 Bacteria 1690
473 Ga0105246_10129190 3300011119 Unclassified 1884
474 Ga0105246_10283744 3300011119 Bacteria 1330
475 Ga0105246_10315946 3300011119 Bacteria 1267
476 Ga0157371_10497322 3300013102 Bacteria 900
477 Ga0157370_10224044 3300013104 Bacteria 1741
478 Ga0157378_10097042 3300013297 Bacteria 2686
479 Ga0157378_10357244 3300013297 Bacteria 1429
480 Ga0157378_10433250 3300013297 Unclassified 1302
481 Ga0157378_11550882 3300013297 Unclassified 708
482 Ga0163162_10217804 3300013306 Unclassified 2039
483 Ga0163162_10763437 3300013306 Unclassified 1086
484 Ga0163162_11784851 3300013306 Bacteria 703
485 Ga0157372_10318584 3300013307 Bacteria 1810
486 Ga0157375_10004150 3300013308 Bacteria 12571
487 Ga0157375_10078790 3300013308 Bacteria 3329
488 Ga0157375_10199439 3300013308 Unclassified 2156
489 Ga0157375_10224181 3300013308 Unclassified 2039
490 Ga0157375_10230113 3300013308 Bacteria 2013
491 Ga0157375_10367272 3300013308 Bacteria 1605
492 Ga0157375_10447432 3300013308 Bacteria 1457
493 Ga0163163_10179074 3300014325 Unclassified 2167
494 Ga0163163_10459499 3300014325 Bacteria 1333
495 Ga0163163_10667924 3300014325 Unclassified 1103
496 Ga0157380_10013835 3300014326 Bacteria 5893
497 Ga0157380_10065298 3300014326 Bacteria 2925
498 Ga0157380_10071511 3300014326 Unclassified 2806
499 Ga0157380_10081265 3300014326 Bacteria 2650
500 Ga0157380_10098599 3300014326 Bacteria 2428
501 Ga0157380_10102056 3300014326 Bacteria 2391
502 Ga0157380_10131019 3300014326 Bacteria 2139
503 Ga0157380_10252226 3300014326 Unclassified 1598
504 Ga0157380_10765007 3300014326 Bacteria 979
505 Ga0157380_10865457 3300014326 Bacteria 927
506 Ga0157377_10041418 3300014745 Bacteria 2555
507 Ga0157379_10158326 3300014968 Bacteria 2044
508 Ga0157376_10334236 3300014969 Bacteria 1444
509 Ga0157376_10341120 3300014969 Bacteria 1431
510 Ga0163161_10652912 3300017792 Unclassified 872
511 Ga0206355_1013067 3300020076 Bacteria 704
512 Ga0224712_10168246 3300022467 Bacteria 982
513 Ga0207697_10239645 3300025315 Unclassified 802
514 Ga0207656_10021939 3300025321 Bacteria 2557
515 Ga0207682_10016422 3300025893 Bacteria 2887
516 Ga0207682_10176731 3300025893 Bacteria 974
517 Ga0207642_10203027 3300025899 Unclassified 1096
518 Ga0207642_10206903 3300025899 Bacteria 1088
519 Ga0207688_10018923 3300025901 Bacteria 3746
520 Ga0207688_10059098 3300025901 Bacteria 2158
521 Ga0207680_10001435 3300025903 Bacteria 11296
522 Ga0207680_10035519 3300025903 Bacteria 2863
523 Ga0207680_10310195 3300025903 Bacteria 1101
524 Ga0207647_10082067 3300025904 Bacteria 1931
525 Ga0207699_10184663 3300025906 Unclassified 1404
526 Ga0207645_10004594 3300025907 Bacteria 10180
527 Ga0207645_10035378 3300025907 Bacteria 3207
528 Ga0207645_10053447 3300025907 Bacteria 2581
529 Ga0207645_10248825 3300025907 Bacteria 1176
530 Ga0207643_10024553 3300025908 Bacteria 3326
531 Ga0207643_10108802 3300025908 Bacteria 1631
532 Ga0207643_10110034 3300025908 Bacteria 1623
533 Ga0207643_10281611 3300025908 Bacteria 1031
534 Ga0207705_10343111 3300025909 Bacteria 1150
535 Ga0207684_10310836 3300025910 Unclassified 1359
536 Ga0207684_10456304 3300025910 Bacteria 1097
537 Ga0207707_10069378 3300025912 Bacteria 3072
538 Ga0207707_10163778 3300025912 Bacteria 1943
539 Ga0207707_10452630 3300025912 Bacteria 1098
540 Ga0207707_10613297 3300025912 Unclassified 920
541 Ga0207663_10405827 3300025916 Bacteria 1043
542 Ga0207660_10150917 3300025917 Unclassified 1785
543 Ga0207660_10450979 3300025917 Bacteria 1040
544 Ga0207660_10466041 3300025917 Bacteria 1023
545 Ga0207662_10005423 3300025918 Bacteria 6802
546 Ga0207662_10025147 3300025918 Bacteria 3428
547 Ga0207662_10034667 3300025918 Bacteria 2945
548 Ga0207662_10051510 3300025918 Bacteria 2449
549 Ga0207662_10103048 3300025918 Bacteria 1770
550 Ga0207657_10022547 3300025919 Bacteria 5887
551 Ga0207649_10203821 3300025920 Bacteria 1399
552 Ga0207649_10598373 3300025920 Bacteria 848
553 Ga0207649_10802681 3300025920 Unclassified 735
554 Ga0207649_10868122 3300025920 Unclassified 706
555 Ga0207652_10367831 3300025921 Bacteria 1298
556 Ga0207652_10497063 3300025921 Bacteria 1098
557 Ga0207652_10894023 3300025921 Unclassified 785
558 Ga0207646_10115578 3300025922 Bacteria 2410
559 Ga0207646_10561833 3300025922 Bacteria 1025
560 Ga0207646_10603016 3300025922 Bacteria 986
561 Ga0207646_10834707 3300025922 Bacteria 820
562 Ga0207681_10008707 3300025923 Bacteria 6198
563 Ga0207681_10013330 3300025923 Bacteria 5085
564 Ga0207681_10024192 3300025923 Bacteria 3896
565 Ga0207681_10081865 3300025923 Bacteria 2280
566 Ga0207681_10086195 3300025923 Bacteria 2231
567 Ga0207681_10426432 3300025923 Bacteria 1075
568 Ga0207694_10039824 3300025924 Bacteria 3617
569 Ga0207650_10017449 3300025925 Bacteria 5027
570 Ga0207650_10032475 3300025925 Bacteria 3776
571 Ga0207650_10033559 3300025925 Bacteria 3718
572 Ga0207650_10158277 3300025925 Unclassified 1793
573 Ga0207650_10246634 3300025925 Unclassified 1445
574 Ga0207650_10380515 3300025925 Bacteria 1165
575 Ga0207650_10508961 3300025925 Unclassified 1007
576 Ga0207650_10566226 3300025925 Bacteria 953
577 Ga0207659_10007390 3300025926 Bacteria 6753
578 Ga0207659_10008018 3300025926 Bacteria 6534
579 Ga0207659_10010018 3300025926 Bacteria 5937
580 Ga0207659_10021094 3300025926 Bacteria 4317
581 Ga0207659_10027258 3300025926 Bacteria 3866
582 Ga0207659_10030245 3300025926 Bacteria 3698
583 Ga0207659_10032184 3300025926 Bacteria 3597
584 Ga0207659_10043333 3300025926 Bacteria 3160
585 Ga0207659_10160998 3300025926 Unclassified 1762
586 Ga0207659_10220799 3300025926 Bacteria 1524
587 Ga0207659_10221507 3300025926 Unclassified 1521
588 Ga0207659_10690721 3300025926 Unclassified 874
589 Ga0207659_10959977 3300025926 Bacteria 735
590 Ga0207687_10278807 3300025927 Bacteria 1339
591 Ga0207700_10025586 3300025928 Bacteria 4101
592 Ga0207700_10096832 3300025928 Unclassified 2344
593 Ga0207664_10083847 3300025929 Unclassified 2598
594 Ga0207644_10014892 3300025931 Bacteria 5213
595 Ga0207644_10046017 3300025931 Bacteria 3106
596 Ga0207644_10051648 3300025931 Bacteria 2952
597 Ga0207644_10126158 3300025931 Bacteria 1954
598 Ga0207644_10164826 3300025931 Unclassified 1726
599 Ga0207644_10469373 3300025931 Bacteria 1035
600 Ga0207690_10034638 3300025932 Bacteria 3255
601 Ga0207690_10530889 3300025932 Unclassified 955
602 Ga0207690_10592061 3300025932 Unclassified 905
603 Ga0207690_10732140 3300025932 Bacteria 814
604 Ga0207706_10020541 3300025933 Bacteria 5936
605 Ga0207706_10057235 3300025933 Bacteria 3435
606 Ga0207706_10069771 3300025933 Bacteria 3091
607 Ga0207706_10147617 3300025933 Bacteria 2069
608 Ga0207706_10287584 3300025933 Unclassified 1433
609 Ga0207706_10431208 3300025933 Bacteria 1142
610 Ga0207706_10543769 3300025933 Unclassified 1000
611 Ga0207686_10004823 3300025934 Bacteria 7247
612 Ga0207686_10010168 3300025934 Bacteria 5116
613 Ga0207709_10043457 3300025935 Bacteria 2709
614 Ga0207670_10007315 3300025936 Bacteria 6151
615 Ga0207670_10033380 3300025936 Bacteria 3316
616 Ga0207670_10129052 3300025936 Bacteria 1849
617 Ga0207670_10130889 3300025936 Unclassified 1838
618 Ga0207670_10526464 3300025936 Unclassified 963
619 Ga0207669_10003629 3300025937 Bacteria 6696
620 Ga0207669_10353452 3300025937 Bacteria 1136
621 Ga0207704_10004553 3300025938 Bacteria 6344
622 Ga0207704_10244239 3300025938 Unclassified 1343
623 Ga0207704_10306567 3300025938 Bacteria 1219
624 Ga0207704_10554767 3300025938 Bacteria 934
625 Ga0207691_10005081 3300025940 Bacteria 12699
626 Ga0207691_10020402 3300025940 Bacteria 6264
627 Ga0207691_10033960 3300025940 Bacteria 4748
628 Ga0207691_10125117 3300025940 Bacteria 2275
629 Ga0207691_10159481 3300025940 Unclassified 1980
630 Ga0207691_10170934 3300025940 Bacteria 1903
631 Ga0207691_10346129 3300025940 Bacteria 1272
632 Ga0207711_10076375 3300025941 Bacteria 2917
633 Ga0207711_10098006 3300025941 Bacteria 2590
634 Ga0207711_10162148 3300025941 Bacteria 2025
635 Ga0207711_10247638 3300025941 Bacteria 1635
636 Ga0207711_10288454 3300025941 Bacteria 1512
637 Ga0207711_10405477 3300025941 Bacteria 1267
638 Ga0207711_10571281 3300025941 Bacteria 1055
639 Ga0207689_10000703 3300025942 Bacteria 32051
640 Ga0207689_10049219 3300025942 Bacteria 3477
641 Ga0207689_10166670 3300025942 Unclassified 1815
642 Ga0207689_10525250 3300025942 Bacteria 993
643 Ga0207689_10582927 3300025942 Bacteria 940
644 Ga0207661_10021298 3300025944 Bacteria 4855
645 Ga0207661_10088211 3300025944 Bacteria 2578
646 Ga0207679_10019097 3300025945 Bacteria 4600
647 Ga0207679_10027486 3300025945 Unclassified 3935
648 Ga0207679_10038385 3300025945 Bacteria 3411
649 Ga0207679_10065549 3300025945 Bacteria 2718
650 Ga0207679_10330254 3300025945 Bacteria 1323
651 Ga0207679_10372359 3300025945 Bacteria 1250
652 Ga0207679_10697914 3300025945 Bacteria 921
653 Ga0207679_10741519 3300025945 Unclassified 893
654 Ga0207667_10645896 3300025949 Bacteria 1064
655 Ga0207651_10001279 3300025960 Bacteria 11318
656 Ga0207651_10004812 3300025960 Bacteria 6871
657 Ga0207651_10006276 3300025960 Bacteria 6200
658 Ga0207651_10010393 3300025960 Bacteria 5158
659 Ga0207651_10107666 3300025960 Bacteria 2084
660 Ga0207651_10146281 3300025960 Bacteria 1833
661 Ga0207651_10295301 3300025960 Bacteria 1345
662 Ga0207712_10158070 3300025961 Bacteria 1758
663 Ga0207712_10165955 3300025961 Bacteria 1721
664 Ga0207668_10716859 3300025972 Unclassified 880
665 Ga0207640_10068820 3300025981 Bacteria 2374
666 Ga0207658_10986458 3300025986 Unclassified 768
667 Ga0207677_10396486 3300026023 Bacteria 1169
668 Ga0207677_10670379 3300026023 Unclassified 917
669 Ga0207703_10008901 3300026035 Bacteria 7907
670 Ga0207703_10014124 3300026035 Bacteria 6226
671 Ga0207703_10399331 3300026035 Bacteria 1275
672 Ga0207639_10179525 3300026041 Unclassified 1800
673 Ga0207639_10423946 3300026041 Bacteria 1203
674 Ga0207639_10527391 3300026041 Bacteria 1082
675 Ga0207639_10600752 3300026041 Bacteria 1015
676 Ga0207678_10011333 3300026067 Bacteria 7824
677 Ga0207678_10200574 3300026067 Bacteria 1706
678 Ga0207678_10412680 3300026067 Bacteria 1170
679 Ga0207678_10595176 3300026067 Bacteria 969
680 Ga0207708_10010094 3300026075 Bacteria 7009
681 Ga0207708_10022919 3300026075 Bacteria 4716
682 Ga0207708_10041433 3300026075 Bacteria 3511
683 Ga0207708_10086907 3300026075 Bacteria 2407
684 Ga0207708_10122803 3300026075 Bacteria 2024
685 Ga0207708_10437763 3300026075 Bacteria 1087
686 Ga0207641_10040685 3300026088 Bacteria 3893
687 Ga0207641_10104928 3300026088 Bacteria 2496
688 Ga0207641_10121883 3300026088 Bacteria 2328
689 Ga0207641_10192305 3300026088 Bacteria 1876
690 Ga0207641_10771710 3300026088 Unclassified 950
691 Ga0207648_10000673 3300026089 Bacteria 38331
692 Ga0207648_10006552 3300026089 Bacteria 11562
693 Ga0207648_10009477 3300026089 Bacteria 9322
694 Ga0207648_10040716 3300026089 Bacteria 4082
695 Ga0207648_10198396 3300026089 Bacteria 1780
696 Ga0207648_10791783 3300026089 Unclassified 882
697 Ga0207676_10008591 3300026095 Bacteria 7257
698 Ga0207676_10050636 3300026095 Bacteria 3239
699 Ga0207676_10166369 3300026095 Bacteria 1916
700 Ga0207676_10228133 3300026095 Bacteria 1663
701 Ga0207676_10246540 3300026095 Bacteria 1606
702 Ga0207676_10403074 3300026095 Archaea 1279
703 Ga0207676_10456966 3300026095 Unclassified 1205
704 Ga0207674_10048609 3300026116 Bacteria 4341
705 Ga0207674_10052104 3300026116 Bacteria 4174
706 Ga0207674_10068694 3300026116 Unclassified 3565
707 Ga0207674_10190844 3300026116 Unclassified 1999
708 Ga0207674_10371793 3300026116 Bacteria 1382
709 Ga0207675_100002515 3300026118 Bacteria 18147
710 Ga0207675_100029915 3300026118 Bacteria 5070
711 Ga0207675_100148576 3300026118 Bacteria 2229
712 Ga0207675_100254044 3300026118 Bacteria 1702
713 Ga0207675_100297635 3300026118 Bacteria 1571
714 Ga0207675_101047576 3300026118 Unclassified 835
715 Ga0207683_10113736 3300026121 Unclassified 2424
716 Ga0207683_10119695 3300026121 Bacteria 2363
717 Ga0207683_10184931 3300026121 Bacteria 1890
718 Ga0207683_10196526 3300026121 Bacteria 1833
719 Ga0207683_10256887 3300026121 Bacteria 1595
720 Ga0207683_10580280 3300026121 Bacteria 1037
721 Ga0207683_11001144 3300026121 Bacteria 776
722 Ga0207698_10053233 3300026142 Bacteria 3105
723 Ga0207698_10240694 3300026142 Bacteria 1649
724 Ga0207698_10310365 3300026142 Bacteria 1472
725 Ga0207698_10865600 3300026142 Unclassified 909
726 Ga0207698_11177714 3300026142 Bacteria 780
727 Ga0209996_1011026 3300027395 Unclassified 1204
728 Ga0210002_1021058 3300027617 Unclassified 1052
729 Ga0209966_1060347 3300027695 Unclassified 819
730 Ga0209998_10034810 3300027717 Bacteria 1127
731 Ga0209998_10079742 3300027717 Unclassified 792
732 Ga0209813_10023277 3300027866 Unclassified 1760
733 Ga0209813_10074658 3300027866 Unclassified 1109
734 Ga0209974_10018907 3300027876 Bacteria 2285
735 Ga0209974_10057826 3300027876 Unclassified 1310
736 Ga0209974_10075493 3300027876 Bacteria 1154
737 Ga0207428_10000349 3300027907 Bacteria 59671
738 Ga0207428_10003450 3300027907 Bacteria 15351
739 Ga0207428_10005208 3300027907 Bacteria 12158
740 Ga0207428_10005628 3300027907 Bacteria 11654
741 Ga0207428_10012698 3300027907 Bacteria 7386
742 Ga0207428_10035075 3300027907 Unclassified 4104
743 Ga0207428_10036649 3300027907 Bacteria 3999
744 Ga0207428_10041523 3300027907 Bacteria 3723
745 Ga0207428_10152118 3300027907 Bacteria 1761
746 Ga0207428_10525104 3300027907 Unclassified 858
747 Ga0207428_10634701 3300027907 Unclassified 767
748 Ga0268266_10113043 3300028379 Bacteria 2408
749 Ga0268266_10493739 3300028379 Bacteria 1168
750 Ga0268266_10555242 3300028379 Bacteria 1101
751 Ga0268266_10578787 3300028379 Bacteria 1077
752 Ga0268265_10000519 3300028380 Bacteria 39355
753 Ga0268265_10203017 3300028380 Bacteria 1721
754 Ga0268265_10548784 3300028380 Bacteria 1097
755 Ga0268265_10628947 3300028380 Unclassified 1029
756 Ga0268265_10721010 3300028380 Bacteria 965
757 Ga0268265_10975935 3300028380 Bacteria 836
758 Ga0268264_10009523 3300028381 Bacteria 8046
759 Ga0268264_10130632 3300028381 Bacteria 2226
760 Ga0268264_10480493 3300028381 Unclassified 1208
761 Ga0268264_10511647 3300028381 Bacteria 1172
762 Ga0307408_100065455 3300031548 Bacteria 2666
763 Ga0307408_100089360 3300031548 Bacteria 2322
764 Ga0307408_100135496 3300031548 Unclassified 1926
765 Ga0307408_100249158 3300031548 Bacteria 1464
766 Ga0307408_100251643 3300031548 Bacteria 1457
767 Ga0307408_100630042 3300031548 Unclassified 956
768 Ga0307405_10008615 3300031731 Bacteria 5182
769 Ga0307405_10177467 3300031731 Bacteria 1526
770 Ga0307405_10201069 3300031731 Bacteria 1447
771 Ga0307405_10622377 3300031731 Unclassified 884
772 Ga0307413_10016358 3300031824 Bacteria 3829
773 Ga0307413_10036097 3300031824 Unclassified 2843
774 Ga0307410_10000911 3300031852 Bacteria 12606
775 Ga0307410_10308312 3300031852 Bacteria 1252
776 Ga0307406_10012013 3300031901 Bacteria 4926
777 Ga0307406_10083708 3300031901 Unclassified 2128
778 Ga0307406_10647963 3300031901 Unclassified 876
779 Ga0307407_10000944 3300031903 Bacteria 9869
780 Ga0307407_10083882 3300031903 Bacteria 1934
781 Ga0307407_10261282 3300031903 Unclassified 1191
782 Ga0307407_10483966 3300031903 Bacteria 904
783 Ga0307412_10024414 3300031911 Bacteria 3731
784 Ga0307412_10036410 3300031911 Bacteria 3152
785 Ga0307412_10039142 3300031911 Unclassified 3059
786 Ga0307412_10509178 3300031911 Bacteria 1004
787 Ga0307412_11071986 3300031911 Bacteria 715
788 Ga0307409_100050628 3300031995 Bacteria 3173
789 Ga0307409_100082465 3300031995 Bacteria 2603
790 Ga0307409_100108686 3300031995 Bacteria 2320
791 Ga0307409_101286785 3300031995 Unclassified 756
792 Ga0307416_100014150 3300032002 Bacteria 5453
793 Ga0307416_100026266 3300032002 Unclassified 4288
794 Ga0307416_100044303 3300032002 Bacteria 3492
795 Ga0307416_100168429 3300032002 Bacteria 2036
796 Ga0307416_100250736 3300032002 Bacteria 1723
797 Ga0307416_100905517 3300032002 Bacteria 982
798 Ga0307414_10002043 3300032004 Bacteria 10485
799 Ga0307414_10402545 3300032004 Unclassified 1189
800 Ga0307411_10006132 3300032005 Bacteria 5979
801 Ga0307411_10134026 3300032005 Bacteria 1815
802 Ga0307411_10149847 3300032005 Bacteria 1732
803 Ga0307411_10162091 3300032005 Bacteria 1676
804 Ga0307411_10254308 3300032005 Bacteria 1383
805 Ga0307411_11092553 3300032005 Unclassified 718
806 Ga0307415_100002052 3300032126 Bacteria 9951
807 Ga0307415_100027267 3300032126 Bacteria 3617
808 Ga0307415_100630628 3300032126 Unclassified 958
809 Ga0307415_100735539 3300032126 Unclassified 894
810 Ga0373930_0000356 3300034816 Bacteria 5972
811 Ga0373950_0001243 3300034818 Bacteria 3293
812 Ga0373958_0006007 3300034819 Unclassified 1872
813 Ga0373959_0002318 3300034820 Bacteria 3028
814 Ga0373938_0000948 3300034957 Bacteria 4651
815 Ga0373926_0048702 3300035083 Unclassified 1525
816 Ga0373929_0000732 3300035085 Bacteria 6351
817 Ga0373940_0002332 3300035088 Bacteria 3671
818 Ga0373949_0002529 3300035090 Bacteria 4657
819 Ga0373949_0114111 3300035090 Bacteria 752
820 Ga0373951_0004765 3300035091 Unclassified 3199
821 Ga0373951_0037584 3300035091 Bacteria 1158
822 Ga0373952_0002090 3300035092 Unclassified 3592
823 Ga0373932_0000253 3300035112 Bacteria 16336
824 Ga0373939_0000222 3300035114 Bacteria 15549
825 Ga0373939_0024504 3300035114 Bacteria 1682
826 Ga0373941_0002599 3300035115 Bacteria 4001
827 Ga0373954_0295236 3300035118 Unclassified 799
828 Ga0373957_0097233 3300035120 Unclassified 1176
829 Ga0373960_0000140 3300035121 Bacteria 12051
830 Ga0373955_0076672 3300035172 Bacteria 1881
831 Ga0373942_0001204 3300035207 Bacteria 6823
832 Ga0373961_0003469 3300035241 Bacteria 3903
833 Ga0373961_0112391 3300035241 Bacteria 894
834 Ga0373961_0274970 3300035241 Unclassified 616
835 Ga0373962_0004435 3300035242 Bacteria 3390
836 Ga0373924_0068173 3300035410 Unclassified 1497
837 Ga0373931_0000392 3300035691 Bacteria 17983
838 Ga0373931_0084131 3300035691 Bacteria 1761
839 Ga0373935_0089099 3300035692 Bacteria 2017
840 Ga0373935_0091430 3300035692 Unclassified 1993
841 Ga0373947_0088555 3300035725 Bacteria 1927
842 Ga0373937_0008316 3300036401 Bacteria 9010
843 Ga0373937_0382666 3300036401 Bacteria 1334
844 Ga0373937_1332252 3300036401 Bacteria 666
845 Ga0373925_0349694 3300037068 Unclassified 1200
846 Ga0436365_0576031 3300039437 Unclassified 2283
847 Ga0439439_0011548 3300041406 Bacteria 2127
848 Ga0451853_1505645 3300041512 Unclassified 928
849 Ga0439431_0066619 3300041997 Bacteria 954
850 Ga0439433_0081151 3300041999 Unclassified 789
851 Ga0439441_008890 3300042001 Bacteria 1651
852 Ga0439441_035430 3300042001 Unclassified 984
853 Ga0439445_0100429 3300042004 Unclassified 820
854 Ga0439450_101993 3300042008 Bacteria 728
855 Ga0439462_0042177 3300042015 Bacteria 1219
856 Ga0450919_009265 3300042121 Bacteria 1132
857 Ga0450897_011728 3300042128 Bacteria 858
858 Ga0450895_000346 3300042132 Bacteria 2516
859 Ga0450896_000186 3300042133 Bacteria 5292
860 Ga0439446_0019962 3300042156 Bacteria 1885
861 Ga0439446_0060214 3300042156 Bacteria 1147
862 Ga0439446_0094437 3300042156 Bacteria 939
863 Ga0439435_0053751 3300042436 Unclassified 1159
864 Ga0439459_0061707 3300042438 Unclassified 848
865 Ga0439464_0000519 3300042439 Bacteria 7919
866 Ga0439460_0078517 3300042461 Bacteria 1033
867 Ga0451577_0072273 3300042876 Bacteria 3077
868 Ga0453683_0196183 3300044673 Unclassified 1282
869 Ga0453684_0162310 3300044712 Bacteria 2642
870 Ga0453684_1277048 3300044712 Archaea 767
871 Ga0466960_0291055 3300044901 Bacteria 918
872 Ga0451576_0013723 3300045051 Bacteria 9049
873 Ga0451576_0020147 3300045051 Bacteria 7267
874 Ga0451576_0046638 3300045051 Bacteria 4562
875 Ga0451576_0103613 3300045051 Unclassified 2960
876 Ga0451576_0228494 3300045051 Bacteria 1943
877 Ga0451576_0381993 3300045051 Bacteria 1476
878 Ga0451576_0659732 3300045051 Unclassified 1099
879 Ga0451576_0985048 3300045051 Unclassified 884
880 Ga0495603_0265018 3300046455 Unclassified 989
881 Ga0495629_0020693 3300046459 Bacteria 4698
882 Ga0495580_0629010 3300046472 Bacteria 707
883 Ga0495582_0224711 3300046473 Unclassified 1075
884 Ga0495664_0257626 3300046477 Bacteria 1055
885 Ga0495584_0140955 3300046491 Unclassified 1224
886 Ga0495594_0020414 3300046499 Bacteria 3529
887 Ga0495607_0383239 3300046501 Bacteria 643
888 Ga0495618_0280578 3300046514 Unclassified 1039
889 Ga0495630_0343216 3300046517 Bacteria 1143
890 Ga0495663_0058397 3300046525 Bacteria 1209
891 Ga0495642_0002056 3300046528 Bacteria 8363
892 Ga0495642_0173897 3300046528 Bacteria 936
893 Ga0495652_0392397 3300046529 Bacteria 985
894 Ga0495665_0211205 3300046531 Unclassified 1005
895 Ga0495598_0007811 3300046537 Bacteria 2469
896 Ga0495598_0085363 3300046537 Bacteria 1020
897 Ga0495609_0130377 3300046538 Bacteria 1077
898 Ga0495609_0140583 3300046538 Unclassified 1030
899 Ga0495609_0184846 3300046538 Bacteria 876
900 Ga0495621_0003258 3300046539 Bacteria 4462
901 Ga0495621_0004461 3300046539 Bacteria 3937
902 Ga0495621_0014298 3300046539 Bacteria 2509
903 Ga0495621_0028280 3300046539 Unclassified 1905
904 Ga0495621_0139691 3300046539 Bacteria 947
905 Ga0495621_0258141 3300046539 Unclassified 713
906 Ga0495645_0283572 3300046543 Unclassified 1088
907 Ga0495633_0113338 3300046558 Bacteria 1257
908 Ga0495656_0054797 3300046615 Bacteria 1717
909 Ga0495656_0103580 3300046615 Unclassified 1320
910 Ga0495656_0113304 3300046615 Bacteria 1272
911 Ga0495635_0473677 3300046663 Unclassified 826
912 Ga0495659_0002800 3300046664 Bacteria 5604
913 Ga0495659_0026521 3300046664 Bacteria 1992
914 Ga0495659_0070287 3300046664 Bacteria 1310
915 Ga0495659_0235494 3300046664 Bacteria 759
916 Ga0495599_0378343 3300046678 Unclassified 846
917 Ga0495647_0032716 3300046681 Unclassified 1940
918 Ga0495647_0129223 3300046681 Bacteria 1069
919 Ga0495647_0158415 3300046681 Unclassified 974
920 Ga0495647_0336446 3300046681 Bacteria 685
921 Ga0495647_0336621 3300046681 Unclassified 685
922 Ga0495658_0119915 3300046683 Bacteria 1590
923 Ga0495658_0206620 3300046683 Bacteria 1225
924 Ga0495669_0010057 3300046684 Bacteria 3996
925 Ga0495669_0215121 3300046684 Unclassified 920
926 Ga0495613_0166310 3300046689 Bacteria 1567
927 Ga0495670_0085003 3300046691 Bacteria 1615
928 Ga0495670_0270113 3300046691 Unclassified 908
929 Ga0495600_0109254 3300046809 Bacteria 1801
930 Ga0495604_0696754 3300047317 Unclassified 645
931 Ga0495636_0003385 3300047318 Bacteria 6185
932 Ga0495636_0158635 3300047318 Unclassified 1018
933 Ga0495636_0345500 3300047318 Bacteria 702
934 Ga0495676_0047401 3300047321 Bacteria 3475
935 Ga0495676_0378791 3300047321 Bacteria 942
936 Ga0495677_0016077 3300047445 Bacteria 2716
937 Ga0495677_0020482 3300047445 Bacteria 2398
938 Ga0495685_125016 3300047447 Unclassified 843
939 Ga0495684_0594769 3300047471 Bacteria 747
940 Ga0496102_0117233 3300048905 Bacteria 2485
941 Ga0496102_0210944 3300048905 Bacteria 1831
942 Ga0496103_0069099 3300048906 Bacteria 2208
943 Ga0496104_0016124 3300048907 Bacteria 6782
944 Ga0496104_1132748 3300048907 Bacteria 686
945 Ga0496105_0137438 3300048908 Bacteria 2012
946 Ga0496105_0734154 3300048908 Bacteria 755
947 Ga0496106_0046891 3300048909 Bacteria 3250
948 Ga0496106_0182397 3300048909 Bacteria 1667
949 Ga0496106_0359321 3300048909 Bacteria 1170
950 Ga0496106_0722048 3300048909 Bacteria 793
951 Ga0496106_0826734 3300048909 Bacteria 734
952 Ga0496107_0114548 3300048910 Unclassified 1984
953 Ga0496107_0396602 3300048910 Bacteria 1026
954 Ga0496108_0023020 3300048911 Bacteria 5125
955 Ga0496109_0001647 3300048912 Bacteria 18650
956 Ga0496109_0014534 3300048912 Bacteria 6848
957 Ga0496109_0066884 3300048912 Bacteria 3292
958 Ga0496110_0096471 3300048913 Bacteria 2649
959 Ga0496111_0108094 3300048914 Bacteria 2048
960 Ga0496112_0030569 3300048915 Bacteria 5213
961 Ga0496112_0114530 3300048915 Bacteria 2667
962 Ga0496112_0238020 3300048915 Unclassified 1774
963 Ga0496113_0570161 3300048916 Bacteria 907
964 Ga0496113_0602831 3300048916 Bacteria 879
965 Ga0496114_0657165 3300048917 Bacteria 922
966 Ga0501291_053180 3300049514 Unclassified 743
967 Ga0501299_009817 3300049522 Unclassified 1586
968 Ga0501031_0487721 3300049568 Unclassified 795
969 Ga0501032_0549707 3300049569 Bacteria 736
970 Ga0501033_0014390 3300049570 Bacteria 6010
971 Ga0501033_0626422 3300049570 Bacteria 736
972 Ga0501034_0005914 3300049571 Bacteria 13275
973 Ga0501034_0494402 3300049571 Bacteria 1137
974 Ga0501036_0063837 3300049572 Unclassified 3118
975 Ga0501036_0132452 3300049572 Bacteria 2104
976 Ga0501036_0227136 3300049572 Bacteria 1567
977 Ga0501037_0314022 3300049573 Bacteria 1086
978 Ga0501038_0122937 3300049574 Bacteria 2138
979 Ga0501039_0054444 3300049575 Bacteria 3097
980 Ga0501039_0252703 3300049575 Unclassified 1386
981 Ga0501039_0330237 3300049575 Bacteria 1198
982 Ga0501039_0544276 3300049575 Bacteria 911
983 Ga0501040_0006318 3300049576 Bacteria 7691
984 Ga0501041_0006853 3300049577 Bacteria 6676
985 Ga0501041_0013075 3300049577 Bacteria 4919
986 Ga0501041_0018723 3300049577 Unclassified 4124
987 Ga0501041_0051930 3300049577 Bacteria 2499
988 Ga0501042_0006197 3300049578 Bacteria 7762
989 Ga0501042_0015233 3300049578 Bacteria 5262
990 Ga0501042_0020353 3300049578 Bacteria 4618
991 Ga0501042_0020929 3300049578 Bacteria 4555
992 Ga0501042_0098722 3300049578 Bacteria 2100
993 Ga0501043_0006595 3300049579 Bacteria 9299
994 Ga0501046_0004640 3300049580 Bacteria 12413
995 Ga0501046_0038789 3300049580 Bacteria 3821
996 Ga0501046_0053339 3300049580 Bacteria 3185
997 Ga0501047_0001540 3300049581 Bacteria 22545
998 Ga0501047_0110130 3300049581 Bacteria 2637
999 Ga0501048_0012443 3300049582 Bacteria 6330
1000 Ga0501048_0052509 3300049582 Bacteria 2901
1001 Ga0501067_0018986 3300049583 Bacteria 3804
1002 Ga0501067_0023538 3300049583 Unclassified 3414
1003 Ga0501067_0049932 3300049583 Unclassified 2318
1004 Ga0501068_0006551 3300049584 Bacteria 6421
1005 Ga0501069_0234055 3300049585 Bacteria 1070
1006 Ga0501071_0006349 3300049587 Bacteria 7666
1007 Ga0501071_0035628 3300049587 Bacteria 3545
1008 Ga0501071_0073431 3300049587 Bacteria 2495
1009 Ga0501071_0076173 3300049587 Unclassified 2450
1010 Ga0501071_0134716 3300049587 Bacteria 1837
1011 Ga0501071_0389009 3300049587 Bacteria 1064
1012 Ga0501072_0017724 3300049588 Bacteria 5476
1013 Ga0501072_0027623 3300049588 Bacteria 4426
1014 Ga0501072_0032613 3300049588 Bacteria 4080
1015 Ga0501072_0119520 3300049588 Unclassified 2099
1016 Ga0501072_0154007 3300049588 Unclassified 1833
1017 Ga0501073_0005759 3300049589 Bacteria 9264
1018 Ga0501073_0153552 3300049589 Unclassified 1596
1019 Ga0501074_0729861 3300049590 Bacteria 699
1020 Ga0501075_0007940 3300049591 Bacteria 7373
1021 Ga0501075_0067558 3300049591 Bacteria 2699
1022 Ga0501075_0100545 3300049591 Bacteria 2196
1023 Ga0501075_0111471 3300049591 Bacteria 2080
1024 Ga0501076_0015426 3300049592 Bacteria 5773
1025 Ga0501076_0025535 3300049592 Bacteria 4572
1026 Ga0501076_0059433 3300049592 Bacteria 3041
1027 Ga0501076_0075363 3300049592 Bacteria 2704
1028 Ga0501076_0117301 3300049592 Bacteria 2154
1029 Ga0501076_0219768 3300049592 Bacteria 1553
1030 Ga0501076_0381602 3300049592 Bacteria 1158
1031 Ga0501076_0448068 3300049592 Bacteria 1063
1032 Ga0501077_0037308 3300049593 Bacteria 3096
1033 Ga0501077_0068297 3300049593 Bacteria 2253
1034 Ga0501077_0092256 3300049593 Bacteria 1919
1035 Ga0501077_0144334 3300049593 Unclassified 1510
1036 Ga0501217_161327 3300049661 Unclassified 676
1037 Ga0501248_027713 3300049678 Bacteria 628
1038 Ga0501257_108902 3300049686 Bacteria 733
1039 Ga0501258_022680 3300049687 Bacteria 748
1040 Ga0501079_0004350 3300049741 Bacteria 10512
1041 Ga0501080_0019013 3300049742 Bacteria 6363
1042 Ga0501080_0193555 3300049742 Bacteria 1868
1043 Ga0501080_0484347 3300049742 Bacteria 1107
1044 Ga0501081_0001655 3300049743 Bacteria 13793
1045 Ga0501081_0006802 3300049743 Bacteria 7436
1046 Ga0501081_0022215 3300049743 Bacteria 4243
1047 Ga0501081_0094635 3300049743 Unclassified 2105
1048 Ga0501081_0134587 3300049743 Bacteria 1768
1049 Ga0501083_0175041 3300049744 Unclassified 1402
1050 Ga0501272_037663 3300049769 Bacteria 636
1051 Ga0501035_0420125 3300049822 Bacteria 1110
1052 Ga0501044_0010321 3300049823 Bacteria 10143
1053 Ga0501045_0007123 3300049824 Bacteria 7756
1054 Ga0501045_0034948 3300049824 Bacteria 3649
1055 Ga0501045_0045745 3300049824 Bacteria 3186
1056 Ga0501045_0048697 3300049824 Bacteria 3089
1057 nmdc:mga03683_22921_c1 3300050489 Unclassified 2426
1058 nmdc:mga00v17_284497_c1 3300050491 Unclassified 1074
1059 nmdc:mga00v17_417742_c1 3300050491 Bacteria 871
1060 nmdc:mga00v17_4521_c1 3300050491 Bacteria 7243
1061 nmdc:mga0yw44_145505_c1 3300050492 Bacteria 1543
1062 nmdc:mga0yw44_41109_c1 3300050492 Unclassified 2750
1063 nmdc:mga0k408_10386_c1 3300050493 Bacteria 5036
1064 nmdc:mga0k408_12220_c2 3300050493 Bacteria 2635
1065 nmdc:mga06z11_11337_c1 3300050494 Bacteria 3841
1066 nmdc:mga06z11_120415_c1 3300050494 Bacteria 1464
1067 nmdc:mga06z11_348884_c1 3300050494 Bacteria 886
1068 nmdc:mga04h51_38816_c1 3300050495 Unclassified 1544
1069 nmdc:mga04h51_50780_c1 3300050495 Unclassified 1391
1070 nmdc:mga07m45_16034_c1 3300050496 Unclassified 4010
1071 nmdc:mga07m45_408316_c1 3300050496 Unclassified 788
1072 nmdc:mga05p37_10153_c1 3300050507 Bacteria 11176
1073 nmdc:mga05p37_111875_c1 3300050507 Bacteria 3358
1074 nmdc:mga05p37_139386_c1 3300050507 Bacteria 2972
1075 nmdc:mga05p37_185800_c1 3300050507 Bacteria 2527
1076 nmdc:mga05p37_201663_c1 3300050507 Bacteria 2409
1077 nmdc:mga05p37_23032_c1 3300050507 Bacteria 7556
1078 nmdc:mga05p37_261404_c1 3300050507 Bacteria 2071
1079 nmdc:mga05p37_285821_c1 3300050507 Bacteria 1965
1080 nmdc:mga05p37_39815_c1 3300050507 Bacteria 5771
1081 nmdc:mga05p37_77425_c2 3300050507 Unclassified 1175
1082 nmdc:mga05p37_832_c1 3300050507 Bacteria 34564
1083 nmdc:mga05p37_853308_c1 3300050507 Bacteria 989
1084 nmdc:mga09592_1002_c1 3300050508 Bacteria 22398
1085 nmdc:mga09592_141198_c1 3300050508 Bacteria 2076
1086 nmdc:mga09592_151982_c1 3300050508 Bacteria 1997
1087 nmdc:mga09592_195157_c1 3300050508 Bacteria 1753
1088 nmdc:mga09592_199858_c1 3300050508 Bacteria 1731
1089 nmdc:mga09592_249213_c1 3300050508 Bacteria 1539
1090 nmdc:mga09592_274867_c1 3300050508 Unclassified 1461
1091 nmdc:mga09592_35614_c1 3300050508 Bacteria 4167
1092 nmdc:mga09592_545731_c1 3300050508 Bacteria 996
1093 nmdc:mga09592_63536_c1 3300050508 Bacteria 3125
1094 nmdc:mga09592_79977_c1 3300050508 Bacteria 2783
1095 nmdc:mga09592_80349_c1 3300050508 Unclassified 2777
1096 nmdc:mga09592_95370_c1 3300050508 Unclassified 2545
1097 nmdc:mga0qj67_1417_c1 3300050509 Bacteria 16782
1098 nmdc:mga0qj67_18686_c1 3300050509 Bacteria 5285
1099 nmdc:mga0qj67_227797_c1 3300050509 Bacteria 1512
1100 nmdc:mga0qj67_26931_c1 3300050509 Bacteria 4452
1101 nmdc:mga0qj67_292548_c1 3300050509 Bacteria 1320
1102 nmdc:mga0qj67_3358_c1 3300050509 Bacteria 11543
1103 nmdc:mga0qj67_5858_c1 3300050509 Bacteria 8998
1104 nmdc:mga0qj67_61581_c1 3300050509 Bacteria 2980
1105 nmdc:mga06r32_20469_c1 3300050510 Bacteria 6092
1106 nmdc:mga06r32_406025_c1 3300050510 Bacteria 1344
1107 nmdc:mga06r32_495032_c1 3300050510 Bacteria 1200
1108 nmdc:mga06r32_56689_c1 3300050510 Bacteria 3762
1109 nmdc:mga06r32_591860_c1 3300050510 Bacteria 1081
1110 nmdc:mga08y16_1178741_c1 3300050511 Unclassified 738
1111 nmdc:mga08y16_120198_c1 3300050511 Unclassified 2734
1112 nmdc:mga08y16_129071_c1 3300050511 Bacteria 2630
1113 nmdc:mga08y16_148625_c1 3300050511 Unclassified 2436
1114 nmdc:mga08y16_19430_c1 3300050511 Bacteria 7163
1115 nmdc:mga08y16_226_c1 3300050511 Bacteria 50561
1116 nmdc:mga08y16_283677_c1 3300050511 Unclassified 1708
1117 nmdc:mga08y16_31614_c1 3300050511 Bacteria 5567
1118 nmdc:mga08y16_3914_c1 3300050511 Bacteria 15504
1119 nmdc:mga08y16_429568_c1 3300050511 Bacteria 1349
1120 nmdc:mga08y16_438204_c1 3300050511 Bacteria 1334
1121 nmdc:mga08y16_55022_c1 3300050511 Bacteria 4159
1122 nmdc:mga08y16_611_c1 3300050511 Bacteria 33310
1123 nmdc:mga08y16_64596_c1 3300050511 Bacteria 3822
1124 nmdc:mga08y16_65571_c1 3300050511 Unclassified 3791
1125 nmdc:mga08y16_73278_c1 3300050511 Bacteria 3568
1126 nmdc:mga08y16_76939_c1 3300050511 Bacteria 3478
1127 nmdc:mga0n895_100417_c1 3300050512 Bacteria 2902
1128 nmdc:mga0n895_149457_c1 3300050512 Bacteria 2365
1129 nmdc:mga0n895_15190_c1 3300050512 Bacteria 7016
1130 nmdc:mga0n895_211948_c1 3300050512 Unclassified 1967
1131 nmdc:mga0n895_220208_c1 3300050512 Bacteria 1927
1132 nmdc:mga0n895_353939_c1 3300050512 Bacteria 1487
1133 nmdc:mga0n895_37875_c1 3300050512 Bacteria 4669
1134 nmdc:mga0n895_423852_c1 3300050512 Bacteria 1345
1135 nmdc:mga0n895_4706_c1 3300050512 Bacteria 11265
1136 nmdc:mga0n895_48966_c1 3300050512 Unclassified 4139
1137 nmdc:mga0n895_73604_c1 3300050512 Bacteria 3392
1138 nmdc:mga0n895_8390_c1 3300050512 Bacteria 8945
1139 nmdc:mga0rr50_206299_c1 3300050513 Bacteria 1617
1140 nmdc:mga0rr50_209204_c1 3300050513 Unclassified 1606
1141 nmdc:mga0rr50_326_c1 3300050513 Bacteria 25897
1142 nmdc:mga0rr50_587989_c1 3300050513 Archaea 949
1143 nmdc:mga0rr50_72999_c1 3300050513 Bacteria 2622
1144 nmdc:mga0rr50_98008_c1 3300050513 Bacteria 2297
1145 nmdc:mga08x19_104729_c1 3300050514 Bacteria 1880
1146 nmdc:mga08x19_30526_c1 3300050514 Bacteria 3386
1147 nmdc:mga08x19_448312_c1 3300050514 Bacteria 908
1148 nmdc:mga0a205_118408_c1 3300050515 Bacteria 2547
1149 nmdc:mga0a205_129789_c2 3300050515 Bacteria 1212
1150 nmdc:mga0a205_13661_c1 3300050515 Bacteria 7566
1151 nmdc:mga0a205_139895_c1 3300050515 Bacteria 2321
1152 nmdc:mga0a205_22780_c1 3300050515 Bacteria 5938
1153 nmdc:mga0a205_242599_c1 3300050515 Bacteria 1683
1154 nmdc:mga0a205_325980_c1 3300050515 Unclassified 1406
1155 nmdc:mga0a205_375535_c1 3300050515 Bacteria 1287
1156 nmdc:mga0a205_39003_c1 3300050515 Bacteria 4571
1157 nmdc:mga0a205_42456_c1 3300050515 Bacteria 4382
1158 nmdc:mga0a205_492_c1 3300050515 Bacteria 30923
1159 nmdc:mga0a205_852108_c1 3300050515 Bacteria 758
1160 nmdc:mga0a205_87481_c1 3300050515 Unclassified 3010
1161 Ga0495601_0178922 3300053077 Bacteria 1387
1162 Ga0495619_0033905 3300053085 Bacteria 3317
1163 Ga0495619_0298516 3300053085 Bacteria 1116
1164 Ga0495619_0332242 3300053085 Bacteria 1052
1165 Ga0500646_0001828 3300053090 Bacteria 5590
1166 Ga0500593_188451 3300053117 Bacteria 758
1167 Ga0501084_0025967 3300054114 Bacteria 4885
1168 Ga0501084_0025977 3300054114 Bacteria 4884
1169 Ga0501084_0044608 3300054114 Bacteria 3712
1170 Ga0501084_0090716 3300054114 Bacteria 2566
1171 Ga0501084_0504336 3300054114 Bacteria 1023
1172 Ga0501084_0958622 3300054114 Unclassified 719
1173 Ga0590071_000034 3300059421 Bacteria 36259
1174 Ga0590071_032415 3300059421 Unclassified 1247
1175 Ga0590071_060376 3300059421 Bacteria 926
1176 Ga0590074_001837 3300059423 Unclassified 3468
1177 Ga0590074_023055 3300059423 Unclassified 1078
1178 Ga0590075_000217 3300059424 Bacteria 16065
1179 Ga0590075_001190 3300059424 Bacteria 6595
1180 Ga0590077_000401 3300059426 Bacteria 12179
1181 Ga0590077_001039 3300059426 Bacteria 6909
1182 Ga0590077_046680 3300059426 Bacteria 969
1183 Ga0501082_0015906 3300060353 Bacteria 6470
1184 Ga0501082_0165187 3300060353 Unclassified 1924
1185 Ga0530510_0002263 3300061734 Bacteria 13198
1186 Ga0530510_0038412 3300061734 Unclassified 3456
1187 Ga0530510_0327605 3300061734 Bacteria 1149
1188 Ga0530510_0445896 3300061734 Bacteria 978
1189 Ga0530510_0683008 3300061734 Bacteria 782
1190 Ga0070670_100026313
1191 JGI25406J46586_10000717
1192 JGI25406J46586_10002626
1193 JGI25406J46586_10024043
1194 Ga0058858_1426466
1195 Ga0058859_11578489
1196 Ga0058859_11790629
1197 Ga0058861_12044645
1198 Ga0058860_12143216
1199 Ga0058862_12520517
1200 Ga0065704_10022086
1201 Ga0065712_10083022
1202 Ga0065712_10174957
1203 Ga0065712_10186090
1204 Ga0065712_10189294
1205 Ga0065712_10197171
1206 Ga0065712_10263114
1207 Ga0065712_10324743
1208 Ga0065715_10110347
1209 Ga0065715_10144576
1210 Ga0065715_10174953
1211 Ga0065715_10364441
1212 Ga0065715_10437544
1213 Ga0065707_10117551
1214 Ga0065707_10134959
1215 Ga0065707_10151914
1216 Ga0065707_10257191
1217 Ga0070676_10048439
1218 Ga0070676_10079232
1219 Ga0070676_10092042
1220 Ga0070676_10254782
1221 Ga0070676_10314917
1222 Ga0070683_100002625
1223 Ga0070683_100030831
1224 Ga0070690_100012083
1225 Ga0070690_100304528
1226 Ga0070690_100708680
1227 Ga0070670_100010086
1228 Ga0070670_100012414
1229 Ga0070670_100018368
1230 Ga0070670_100023579
1231 Ga0070670_100055636
1232 Ga0070670_100424101
1233 Ga0070670_100777205
1234 Ga0070677_10053910
1235 Ga0070677_10185057
1236 Ga0068869_100023804
1237 Ga0068869_100117396
1238 Ga0068869_100370206
1239 Ga0070666_10001460
1240 Ga0070666_10078500
1241 Ga0070666_10286409
1242 Ga0070666_10376318
1243 Ga0070680_100168366
1244 Ga0070680_100463986
1245 Ga0070680_100588429
1246 Ga0070680_100701612
1247 Ga0070682_100299639
1248 Ga0070682_100512078
1249 Ga0068868_100430738
1250 Ga0068868_100446569
1251 Ga0068868_100447567
1252 Ga0070660_100056707
1253 Ga0070689_100021821
1254 Ga0070689_100022436
1255 Ga0070689_100072399
1256 Ga0070689_100152383
1257 Ga0070689_100192528
1258 Ga0070689_100259095
1259 Ga0070689_100503373
1260 Ga0070689_100717689
1261 Ga0070689_100750038
1262 Ga0070691_10032075
1263 Ga0070687_100047492
1264 Ga0070687_100049562
1265 Ga0070687_100685063
1266 Ga0070661_100168806
1267 Ga0070661_100263132
1268 Ga0070692_10061075
1269 Ga0070668_100451620
1270 Ga0070668_100542997
1271 Ga0070669_100003238
1272 Ga0070669_100008530
1273 Ga0070669_100085713
1274 Ga0070669_100108206
1275 Ga0070669_100152404
1276 Ga0070669_100159766
1277 Ga0070669_100183548
1278 Ga0070669_100447080
1279 Ga0070669_100492414
1280 Ga0070675_100000617
1281 Ga0070675_100001519
1282 Ga0070675_100003475
1283 Ga0070675_100007631
1284 Ga0070675_100007926
1285 Ga0070675_100024800
1286 Ga0070675_100072184
1287 Ga0070675_100106073
1288 Ga0070675_100115083
1289 Ga0070675_100404555
1290 Ga0070675_100711946
1291 Ga0070671_100004187
1292 Ga0070671_100046654
1293 Ga0070671_100063454
1294 Ga0070671_100127168
1295 Ga0070671_100691833
1296 Ga0070671_101271637
1297 Ga0070674_100014856
1298 Ga0070674_100091393
1299 Ga0070674_100264668
1300 Ga0070674_100406947
1301 Ga0070674_100708812
1302 Ga0070673_100003552
1303 Ga0070673_100010680
1304 Ga0070673_100014066
1305 Ga0070673_100017589
1306 Ga0070673_100056981
1307 Ga0070673_100070875
1308 Ga0070673_100180396
1309 Ga0070673_100553880
1310 Ga0070673_100632812
1311 Ga0070688_100082983
1312 Ga0070688_100136071
1313 Ga0070688_100154171
1314 Ga0070688_100475626
1315 Ga0070659_100052454
1316 Ga0070659_100215705
1317 Ga0070659_100430331
1318 Ga0070659_100692624
1319 Ga0070667_100242186
1320 Ga0070667_100390253
1321 Ga0070667_100524171
1322 Ga0070667_100573020
1323 Ga0070703_10053542
1324 Ga0070714_100041923
1325 Ga0070713_100041155
1326 Ga0070713_100097307
1327 Ga0070713_100351393
1328 Ga0070701_10002629
1329 Ga0070701_10022582
1330 Ga0070701_10043915
1331 Ga0070701_10335155
1332 Ga0070705_100048215
1333 Ga0070705_100051202
1334 Ga0070705_100060914
1335 Ga0070705_100271070
1336 Ga0070705_100289556
1337 Ga0070705_100336934
1338 Ga0070700_100002087
1339 Ga0070700_100011496
1340 Ga0070700_100049403
1341 Ga0070700_100136775
1342 Ga0070700_100145215
1343 Ga0070694_100003530
1344 Ga0070694_100009709
1345 Ga0070694_100079788
1346 Ga0070694_100109687
1347 Ga0070694_100195470
1348 Ga0070694_100216907
1349 Ga0070694_100569194
1350 Ga0070708_100269672
1351 Ga0070708_100906382
1352 Ga0070663_100023419
1353 Ga0070663_100025375
1354 Ga0070663_100083330
1355 Ga0070678_100218400
1356 Ga0070678_100253519
1357 Ga0070678_100486455
1358 Ga0070678_100761022
1359 Ga0070678_101051791
1360 Ga0070662_100108748
1361 Ga0070662_100121481
1362 Ga0070662_100213070
1363 Ga0070662_100224355
1364 Ga0070662_100471291
1365 Ga0070662_100527198
1366 Ga0070662_100632389
1367 Ga0070662_101019977
1368 Ga0070681_10003234
1369 Ga0070681_10025795
1370 Ga0070681_10080026
1371 Ga0070681_10425357
1372 Ga0070681_10603486
1373 Ga0070681_10617802
1374 Ga0068867_100003458
1375 Ga0068867_100006787
1376 Ga0068867_100015827
1377 Ga0068867_100226648
1378 Ga0070685_10055310
1379 Ga0070685_10443790
1380 Ga0070706_100365177
1381 Ga0070706_100506555
1382 Ga0070707_100050521
1383 Ga0070707_100500183
1384 Ga0070698_100011373
1385 Ga0070698_100129061
1386 Ga0070698_100321503
1387 Ga0070699_100001754
1388 Ga0070699_100005910
1389 Ga0070699_100007030
1390 Ga0070699_100020778
1391 Ga0070679_100146193
1392 Ga0070679_100525927
1393 Ga0070684_100004802
1394 Ga0070684_100015024
1395 Ga0070684_100370480
1396 Ga0070684_100699684
1397 Ga0070697_100007518
1398 Ga0068853_100233518
1399 Ga0070672_100022715
1400 Ga0070672_100030757
1401 Ga0070672_100205258
1402 Ga0070672_100211558
1403 Ga0070672_100258875
1404 Ga0070672_100268205
1405 Ga0070672_100291759
1406 Ga0070672_100766166
1407 Ga0070686_100001443
1408 Ga0070686_100017081
1409 Ga0070686_100121824
1410 Ga0070686_100196261
1411 Ga0070686_100298596
1412 Ga0070686_100439309
1413 Ga0070686_100639127
1414 Ga0070686_100711104
1415 Ga0070695_100001218
1416 Ga0070695_100094340
1417 Ga0070695_100153677
1418 Ga0070695_100330713
1419 Ga0070695_100368605
1420 Ga0070695_100409379
1421 Ga0070696_100002157
1422 Ga0070696_100004447
1423 Ga0070696_100005834
1424 Ga0070696_100044304
1425 Ga0070696_100406644
1426 Ga0070696_100989646
1427 Ga0070693_100031621
1428 Ga0070693_100102096
1429 Ga0070693_100259552
1430 Ga0070693_100458516
1431 Ga0070665_100082746
1432 Ga0070665_100572659
1433 Ga0070704_100009084
1434 Ga0070704_100009193
1435 Ga0070704_100110374
1436 Ga0070704_100135635
1437 Ga0070704_100219851
1438 Ga0070704_100226268
1439 Ga0070704_100319375
1440 Ga0070704_100525312
1441 Ga0070704_100525981
1442 Ga0068855_100602131
1443 Ga0070664_100000832
1444 Ga0070664_100024195
1445 Ga0070664_100151298
1446 Ga0070664_100196586
1447 Ga0070664_100279561
1448 Ga0070664_100452751
1449 Ga0070664_100589394
1450 Ga0070664_101229701
1451 Ga0068857_100015517
1452 Ga0068857_100067796
1453 Ga0068857_100187979
1454 Ga0068854_100004044
1455 Ga0068854_100043326
1456 Ga0068854_100084705
1457 Ga0070702_100031413
1458 Ga0070702_100064214
1459 Ga0070702_100070398
1460 Ga0070702_100159944
1461 Ga0070702_100207339
1462 Ga0068852_100016767
1463 Ga0068852_100051384
1464 Ga0068852_100435132
1465 Ga0068859_100040288
1466 Ga0068859_100168081
1467 Ga0068859_100206025
1468 Ga0068859_100306687
1469 Ga0068859_100379265
1470 Ga0068859_100409808
1471 Ga0068859_100887832
1472 Ga0068859_101409786
1473 Ga0068864_100009165
1474 Ga0068864_100062567
1475 Ga0068864_100373005
1476 Ga0068864_100621421
1477 Ga0068864_100645027
1478 Ga0068864_101041391
1479 Ga0068866_10011610
1480 Ga0068866_10043798
1481 Ga0068861_100003679
1482 Ga0068861_100029946
1483 Ga0068861_100075669
1484 Ga0068861_100320593
1485 Ga0068861_100438532
1486 Ga0068861_101164138
1487 Ga0068851_10039668
1488 Ga0068851_10133148
1489 Ga0068870_10017038
1490 Ga0068870_10130593
1491 Ga0068863_100052159
1492 Ga0068863_100200070
1493 Ga0068863_100254548
1494 Ga0068863_100406631
1495 Ga0068863_100519313
1496 Ga0068858_100010889
1497 Ga0068858_100022318
1498 Ga0068858_100041710
1499 Ga0068858_100193443
1500 Ga0068860_100054620
1501 Ga0068860_100195153
1502 Ga0068860_100375059
1503 Ga0068860_100514969
1504 Ga0068860_100643863
1505 Ga0068860_100821131
1506 Ga0068862_100056994
1507 Ga0068862_100119950
1508 Ga0068862_100292113
1509 Ga0081455_10076085
1510 Ga0081538_10099985
1511 Ga0081539_10000291
1512 Ga0081539_10000295
1513 Ga0081539_10002133
1514 Ga0075368_10010304
1515 Ga0075368_10045552
1516 Ga0075364_10002862
1517 Ga0075364_10007269
1518 Ga0075362_10003359
1519 Ga0075367_10005268
1520 Ga0075367_10019677
1521 Ga0075369_10135769
1522 Ga0075427_10017711
1523 Ga0075366_10029113
1524 Ga0097621_100123867
1525 Ga0097621_100214970
1526 Ga0097621_100301059
1527 Ga0097621_100382342
1528 Ga0097621_100449358
1529 Ga0075370_10008989
1530 Ga0068871_100060502
1531 Ga0068871_100257549
1532 Ga0068871_100883886
1533 Ga0075428_100000931
1534 Ga0075428_100008691
1535 Ga0075428_100015755
1536 Ga0075428_100024626
1537 Ga0075428_100033671
1538 Ga0075428_100041952
1539 Ga0075428_100163037
1540 Ga0075428_100823678
1541 Ga0075430_100000398
1542 Ga0075430_100030658
1543 Ga0075430_100041996
1544 Ga0075430_100050744
1545 Ga0075430_100174789
1546 Ga0075430_100198918
1547 Ga0075431_100015570
1548 Ga0075431_100036470
1549 Ga0075431_100132041
1550 Ga0075431_100407815
1551 Ga0075431_100523119
1552 Ga0075433_10005915
1553 Ga0075433_10008576
1554 Ga0075433_10048647
1555 Ga0075433_10138299
1556 Ga0075433_10197196
1557 Ga0075433_10217667
1558 Ga0075433_10275626
1559 Ga0075433_10354684
1560 Ga0075433_10387427
1561 Ga0075433_11036696
1562 Ga0075434_100004997
1563 Ga0075434_100010035
1564 Ga0075434_100011617
1565 Ga0075434_100019603
1566 Ga0075434_100019962
1567 Ga0075434_100136223
1568 Ga0075434_100161445
1569 Ga0075434_100181639
1570 Ga0075434_100194788
1571 Ga0075434_100640974
1572 Ga0075429_100005250
1573 Ga0075429_100012127
1574 Ga0075429_100055017
1575 Ga0075429_100066676
1576 Ga0075429_100121667
1577 Ga0075429_100149495
1578 Ga0075429_100220471
1579 Ga0075429_100283959
1580 Ga0075429_100288094
1581 Ga0075429_100482178
1582 Ga0068865_100008578
1583 Ga0068865_100015657
1584 Ga0068865_100071425
1585 Ga0068865_100574286
1586 Ga0097620_100040291
1587 Ga0097620_100168076
1588 Ga0097620_100206025
1589 Ga0097620_100306663
1590 Ga0097620_100379258
1591 Ga0097620_100409791
1592 Ga0097620_100887886
1593 Ga0097620_101409751
1594 Ga0075435_100000542
1595 Ga0075435_100003059
1596 Ga0075435_100040441
1597 Ga0075435_100112436
1598 Ga0075435_100164287
1599 Ga0075435_100232611
1600 Ga0075435_100374591
1601 Ga0105240_10364422
1602 Ga0111539_10002826
1603 Ga0111539_10004921
1604 Ga0111539_10005196
1605 Ga0111539_10005833
1606 Ga0111539_10008803
1607 Ga0111539_10012690
1608 Ga0111539_10032568
1609 Ga0111539_10044641
1610 Ga0111539_10056800
1611 Ga0111539_10152541
1612 Ga0111539_10216291
1613 Ga0111539_10220946
1614 Ga0111539_10344915
1615 Ga0111539_10417412
1616 Ga0111539_10869197
1617 Ga0111539_10923527
1618 Ga0105245_10115143
1619 Ga0105245_10909943
1620 Ga0114129_10000288
1621 Ga0114129_10003329
1622 Ga0114129_10006935
1623 Ga0114129_10014822
1624 Ga0114129_10018044
1625 Ga0114129_10038503
1626 Ga0114129_10056807
1627 Ga0114129_10082261
1628 Ga0114129_10104445
1629 Ga0114129_10175991
1630 Ga0114129_10287740
1631 Ga0114129_10570195
1632 Ga0114129_11009442
1633 Ga0114129_11074977
1634 Ga0105243_10167484
1635 Ga0105243_10508626
1636 Ga0105243_10527205
1637 Ga0105243_10682958
1638 Ga0105243_10825424
1639 Ga0105241_10089643
1640 Ga0105241_10155896
1641 Ga0105242_10707872
1642 Ga0105242_10842426
1643 Ga0105248_10005969
1644 Ga0105248_10065657
1645 Ga0105248_10085016
1646 Ga0105248_10139228
1647 Ga0105248_10169117
1648 Ga0105248_10237407
1649 Ga0105248_10261164
1650 Ga0105248_10402174
1651 Ga0105248_11987740
1652 Ga0105237_10995334
1653 Ga0105237_11064841
1654 Ga0105238_10010201
1655 Ga0105238_10539884
1656 Ga0105238_10983504
1657 Ga0105249_10010772
1658 Ga0105249_10013057
1659 Ga0105249_10664919
1660 Ga0105249_10820293
1661 Ga0105239_10341302
1662 Ga0105246_10129190
1663 Ga0105246_10283744
1664 Ga0105246_10315946
1665 Ga0157371_10497322
1666 Ga0157370_10224044
1667 Ga0157378_10097042
1668 Ga0157378_10357244
1669 Ga0157378_10433250
1670 Ga0157378_11550882
1671 Ga0163162_10217804
1672 Ga0163162_10763437
1673 Ga0163162_11784851
1674 Ga0157372_10318584
1675 Ga0157375_10004150
1676 Ga0157375_10078790
1677 Ga0157375_10199439
1678 Ga0157375_10224181
1679 Ga0157375_10230113
1680 Ga0157375_10367272
1681 Ga0157375_10447432
1682 Ga0163163_10179074
1683 Ga0163163_10459499
1684 Ga0163163_10667924
1685 Ga0157380_10013835
1686 Ga0157380_10065298
1687 Ga0157380_10071511
1688 Ga0157380_10081265
1689 Ga0157380_10098599
1690 Ga0157380_10102056
1691 Ga0157380_10131019
1692 Ga0157380_10252226
1693 Ga0157380_10765007
1694 Ga0157380_10865457
1695 Ga0157377_10041418
1696 Ga0157379_10158326
1697 Ga0157376_10334236
1698 Ga0157376_10341120
1699 Ga0163161_10652912
1700 Ga0206355_1013067
1701 Ga0224712_10168246
1702 Ga0207697_10239645
1703 Ga0207656_10021939
1704 Ga0207682_10016422
1705 Ga0207682_10176731
1706 Ga0207642_10203027
1707 Ga0207642_10206903
1708 Ga0207688_10018923
1709 Ga0207688_10059098
1710 Ga0207680_10001435
1711 Ga0207680_10035519
1712 Ga0207680_10310195
1713 Ga0207647_10082067
1714 Ga0207699_10184663
1715 Ga0207645_10004594
1716 Ga0207645_10035378
1717 Ga0207645_10053447
1718 Ga0207645_10248825
1719 Ga0207643_10024553
1720 Ga0207643_10108802
1721 Ga0207643_10110034
1722 Ga0207643_10281611
1723 Ga0207705_10343111
1724 Ga0207684_10310836
1725 Ga0207684_10456304
1726 Ga0207707_10069378
1727 Ga0207707_10163778
1728 Ga0207707_10452630
1729 Ga0207707_10613297
1730 Ga0207663_10405827
1731 Ga0207660_10150917
1732 Ga0207660_10450979
1733 Ga0207660_10466041
1734 Ga0207662_10005423
1735 Ga0207662_10025147
1736 Ga0207662_10034667
1737 Ga0207662_10051510
1738 Ga0207662_10103048
1739 Ga0207657_10022547
1740 Ga0207649_10203821
1741 Ga0207649_10598373
1742 Ga0207649_10802681
1743 Ga0207649_10868122
1744 Ga0207652_10367831
1745 Ga0207652_10497063
1746 Ga0207652_10894023
1747 Ga0207646_10115578
1748 Ga0207646_10561833
1749 Ga0207646_10603016
1750 Ga0207646_10834707
1751 Ga0207681_10008707
1752 Ga0207681_10013330
1753 Ga0207681_10024192
1754 Ga0207681_10081865
1755 Ga0207681_10086195
1756 Ga0207681_10426432
1757 Ga0207694_10039824
1758 Ga0207650_10017449
1759 Ga0207650_10032475
1760 Ga0207650_10033559
1761 Ga0207650_10158277
1762 Ga0207650_10246634
1763 Ga0207650_10380515
1764 Ga0207650_10508961
1765 Ga0207650_10566226
1766 Ga0207659_10007390
1767 Ga0207659_10008018
1768 Ga0207659_10010018
1769 Ga0207659_10021094
1770 Ga0207659_10027258
1771 Ga0207659_10030245
1772 Ga0207659_10032184
1773 Ga0207659_10043333
1774 Ga0207659_10160998
1775 Ga0207659_10220799
1776 Ga0207659_10221507
1777 Ga0207659_10690721
1778 Ga0207659_10959977
1779 Ga0207687_10278807
1780 Ga0207700_10025586
1781 Ga0207700_10096832
1782 Ga0207664_10083847
1783 Ga0207644_10014892
1784 Ga0207644_10046017
1785 Ga0207644_10051648
1786 Ga0207644_10126158
1787 Ga0207644_10164826
1788 Ga0207644_10469373
1789 Ga0207690_10034638
1790 Ga0207690_10530889
1791 Ga0207690_10592061
1792 Ga0207690_10732140
1793 Ga0207706_10020541
1794 Ga0207706_10057235
1795 Ga0207706_10069771
1796 Ga0207706_10147617
1797 Ga0207706_10287584
1798 Ga0207706_10431208
1799 Ga0207706_10543769
1800 Ga0207686_10004823
1801 Ga0207686_10010168
1802 Ga0207709_10043457
1803 Ga0207670_10007315
1804 Ga0207670_10033380
1805 Ga0207670_10129052
1806 Ga0207670_10130889
1807 Ga0207670_10526464
1808 Ga0207669_10003629
1809 Ga0207669_10353452
1810 Ga0207704_10004553
1811 Ga0207704_10244239
1812 Ga0207704_10306567
1813 Ga0207704_10554767
1814 Ga0207691_10005081
1815 Ga0207691_10020402
1816 Ga0207691_10033960
1817 Ga0207691_10125117
1818 Ga0207691_10159481
1819 Ga0207691_10170934
1820 Ga0207691_10346129
1821 Ga0207711_10076375
1822 Ga0207711_10098006
1823 Ga0207711_10162148
1824 Ga0207711_10247638
1825 Ga0207711_10288454
1826 Ga0207711_10405477
1827 Ga0207711_10571281
1828 Ga0207689_10000703
1829 Ga0207689_10049219
1830 Ga0207689_10166670
1831 Ga0207689_10525250
1832 Ga0207689_10582927
1833 Ga0207661_10021298
1834 Ga0207661_10088211
1835 Ga0207679_10019097
1836 Ga0207679_10027486
1837 Ga0207679_10038385
1838 Ga0207679_10065549
1839 Ga0207679_10330254
1840 Ga0207679_10372359
1841 Ga0207679_10697914
1842 Ga0207679_10741519
1843 Ga0207667_10645896
1844 Ga0207651_10001279
1845 Ga0207651_10004812
1846 Ga0207651_10006276
1847 Ga0207651_10010393
1848 Ga0207651_10107666
1849 Ga0207651_10146281
1850 Ga0207651_10295301
1851 Ga0207712_10158070
1852 Ga0207712_10165955
1853 Ga0207668_10716859
1854 Ga0207640_10068820
1855 Ga0207658_10986458
1856 Ga0207677_10396486
1857 Ga0207677_10670379
1858 Ga0207703_10008901
1859 Ga0207703_10014124
1860 Ga0207703_10399331
1861 Ga0207639_10179525
1862 Ga0207639_10423946
1863 Ga0207639_10527391
1864 Ga0207639_10600752
1865 Ga0207678_10011333
1866 Ga0207678_10200574
1867 Ga0207678_10412680
1868 Ga0207678_10595176
1869 Ga0207708_10010094
1870 Ga0207708_10022919
1871 Ga0207708_10041433
1872 Ga0207708_10086907
1873 Ga0207708_10122803
1874 Ga0207708_10437763
1875 Ga0207641_10040685
1876 Ga0207641_10104928
1877 Ga0207641_10121883
1878 Ga0207641_10192305
1879 Ga0207641_10771710
1880 Ga0207648_10000673
1881 Ga0207648_10006552
1882 Ga0207648_10009477
1883 Ga0207648_10040716
1884 Ga0207648_10198396
1885 Ga0207648_10791783
1886 Ga0207676_10008591
1887 Ga0207676_10050636
1888 Ga0207676_10166369
1889 Ga0207676_10228133
1890 Ga0207676_10246540
1891 Ga0207676_10403074
1892 Ga0207676_10456966
1893 Ga0207674_10048609
1894 Ga0207674_10052104
1895 Ga0207674_10068694
1896 Ga0207674_10190844
1897 Ga0207674_10371793
1898 Ga0207675_100002515
1899 Ga0207675_100029915
1900 Ga0207675_100148576
1901 Ga0207675_100254044
1902 Ga0207675_100297635
1903 Ga0207675_101047576
1904 Ga0207683_10113736
1905 Ga0207683_10119695
1906 Ga0207683_10184931
1907 Ga0207683_10196526
1908 Ga0207683_10256887
1909 Ga0207683_10580280
1910 Ga0207683_11001144
1911 Ga0207698_10053233
1912 Ga0207698_10240694
1913 Ga0207698_10310365
1914 Ga0207698_10865600
1915 Ga0207698_11177714
1916 Ga0209996_1011026
1917 Ga0210002_1021058
1918 Ga0209966_1060347
1919 Ga0209998_10034810
1920 Ga0209998_10079742
1921 Ga0209813_10023277
1922 Ga0209813_10074658
1923 Ga0209974_10018907
1924 Ga0209974_10057826
1925 Ga0209974_10075493
1926 Ga0207428_10000349
1927 Ga0207428_10003450
1928 Ga0207428_10005208
1929 Ga0207428_10005628
1930 Ga0207428_10012698
1931 Ga0207428_10035075
1932 Ga0207428_10036649
1933 Ga0207428_10041523
1934 Ga0207428_10152118
1935 Ga0207428_10525104
1936 Ga0207428_10634701
1937 Ga0268266_10113043
1938 Ga0268266_10493739
1939 Ga0268266_10555242
1940 Ga0268266_10578787
1941 Ga0268265_10000519
1942 Ga0268265_10203017
1943 Ga0268265_10548784
1944 Ga0268265_10628947
1945 Ga0268265_10721010
1946 Ga0268265_10975935
1947 Ga0268264_10009523
1948 Ga0268264_10130632
1949 Ga0268264_10480493
1950 Ga0268264_10511647
1951 Ga0307408_100065455
1952 Ga0307408_100089360
1953 Ga0307408_100135496
1954 Ga0307408_100249158
1955 Ga0307408_100251643
1956 Ga0307408_100630042
1957 Ga0307405_10008615
1958 Ga0307405_10177467
1959 Ga0307405_10201069
1960 Ga0307405_10622377
1961 Ga0307413_10016358
1962 Ga0307413_10036097
1963 Ga0307410_10000911
1964 Ga0307410_10308312
1965 Ga0307406_10012013
1966 Ga0307406_10083708
1967 Ga0307406_10647963
1968 Ga0307407_10000944
1969 Ga0307407_10083882
1970 Ga0307407_10261282
1971 Ga0307407_10483966
1972 Ga0307412_10024414
1973 Ga0307412_10036410
1974 Ga0307412_10039142
1975 Ga0307412_10509178
1976 Ga0307412_11071986
1977 Ga0307409_100050628
1978 Ga0307409_100082465
1979 Ga0307409_100108686
1980 Ga0307409_101286785
1981 Ga0307416_100014150
1982 Ga0307416_100026266
1983 Ga0307416_100044303
1984 Ga0307416_100168429
1985 Ga0307416_100250736
1986 Ga0307416_100905517
1987 Ga0307414_10002043
1988 Ga0307414_10402545
1989 Ga0307411_10006132
1990 Ga0307411_10134026
1991 Ga0307411_10149847
1992 Ga0307411_10162091
1993 Ga0307411_10254308
1994 Ga0307411_11092553
1995 Ga0307415_100002052
1996 Ga0307415_100027267
1997 Ga0307415_100630628
1998 Ga0307415_100735539
1999 Ga0373930_0000356
2000 Ga0373950_0001243
2001 Ga0373958_0006007
2002 Ga0373959_0002318
2003 Ga0373938_0000948
2004 Ga0373926_0048702
2005 Ga0373929_0000732
2006 Ga0373940_0002332
2007 Ga0373949_0002529
2008 Ga0373949_0114111
2009 Ga0373951_0004765
2010 Ga0373951_0037584
2011 Ga0373952_0002090
2012 Ga0373932_0000253
2013 Ga0373939_0000222
2014 Ga0373939_0024504
2015 Ga0373941_0002599
2016 Ga0373954_0295236
2017 Ga0373957_0097233
2018 Ga0373960_0000140
2019 Ga0373955_0076672
2020 Ga0373942_0001204
2021 Ga0373961_0003469
2022 Ga0373961_0112391
2023 Ga0373961_0274970
2024 Ga0373962_0004435
2025 Ga0373924_0068173
2026 Ga0373931_0000392
2027 Ga0373931_0084131
2028 Ga0373935_0089099
2029 Ga0373935_0091430
2030 Ga0373947_0088555
2031 Ga0373937_0008316
2032 Ga0373937_0382666
2033 Ga0373937_1332252
2034 Ga0373925_0349694
2035 Ga0436365_0576031
2036 Ga0439439_0011548
2037 Ga0451853_1505645
2038 Ga0439431_0066619
2039 Ga0439433_0081151
2040 Ga0439441_008890
2041 Ga0439441_035430
2042 Ga0439445_0100429
2043 Ga0439450_101993
2044 Ga0439462_0042177
2045 Ga0450919_009265
2046 Ga0450897_011728
2047 Ga0450895_000346
2048 Ga0450896_000186
2049 Ga0439446_0019962
2050 Ga0439446_0060214
2051 Ga0439446_0094437
2052 Ga0439435_0053751
2053 Ga0439459_0061707
2054 Ga0439464_0000519
2055 Ga0439460_0078517
2056 Ga0451577_0072273
2057 Ga0453683_0196183
2058 Ga0453684_0162310
2059 Ga0453684_1277048
2060 Ga0466960_0291055
2061 Ga0451576_0013723
2062 Ga0451576_0020147
2063 Ga0451576_0046638
2064 Ga0451576_0103613
2065 Ga0451576_0228494
2066 Ga0451576_0381993
2067 Ga0451576_0659732
2068 Ga0451576_0985048
2069 Ga0495603_0265018
2070 Ga0495629_0020693
2071 Ga0495580_0629010
2072 Ga0495582_0224711
2073 Ga0495664_0257626
2074 Ga0495584_0140955
2075 Ga0495594_0020414
2076 Ga0495607_0383239
2077 Ga0495618_0280578
2078 Ga0495630_0343216
2079 Ga0495663_0058397
2080 Ga0495642_0002056
2081 Ga0495642_0173897
2082 Ga0495652_0392397
2083 Ga0495665_0211205
2084 Ga0495598_0007811
2085 Ga0495598_0085363
2086 Ga0495609_0130377
2087 Ga0495609_0140583
2088 Ga0495609_0184846
2089 Ga0495621_0003258
2090 Ga0495621_0004461
2091 Ga0495621_0014298
2092 Ga0495621_0028280
2093 Ga0495621_0139691
2094 Ga0495621_0258141
2095 Ga0495645_0283572
2096 Ga0495633_0113338
2097 Ga0495656_0054797
2098 Ga0495656_0103580
2099 Ga0495656_0113304
2100 Ga0495635_0473677
2101 Ga0495659_0002800
2102 Ga0495659_0026521
2103 Ga0495659_0070287
2104 Ga0495659_0235494
2105 Ga0495599_0378343
2106 Ga0495647_0032716
2107 Ga0495647_0129223
2108 Ga0495647_0158415
2109 Ga0495647_0336446
2110 Ga0495647_0336621
2111 Ga0495658_0119915
2112 Ga0495658_0206620
2113 Ga0495669_0010057
2114 Ga0495669_0215121
2115 Ga0495613_0166310
2116 Ga0495670_0085003
2117 Ga0495670_0270113
2118 Ga0495600_0109254
2119 Ga0495604_0696754
2120 Ga0495636_0003385
2121 Ga0495636_0158635
2122 Ga0495636_0345500
2123 Ga0495676_0047401
2124 Ga0495676_0378791
2125 Ga0495677_0016077
2126 Ga0495677_0020482
2127 Ga0495685_125016
2128 Ga0495684_0594769
2129 Ga0496102_0117233
2130 Ga0496102_0210944
2131 Ga0496103_0069099
2132 Ga0496104_0016124
2133 Ga0496104_1132748
2134 Ga0496105_0137438
2135 Ga0496105_0734154
2136 Ga0496106_0046891
2137 Ga0496106_0182397
2138 Ga0496106_0359321
2139 Ga0496106_0722048
2140 Ga0496106_0826734
2141 Ga0496107_0114548
2142 Ga0496107_0396602
2143 Ga0496108_0023020
2144 Ga0496109_0001647
2145 Ga0496109_0014534
2146 Ga0496109_0066884
2147 Ga0496110_0096471
2148 Ga0496111_0108094
2149 Ga0496112_0030569
2150 Ga0496112_0114530
2151 Ga0496112_0238020
2152 Ga0496113_0570161
2153 Ga0496113_0602831
2154 Ga0496114_0657165
2155 Ga0501291_053180
2156 Ga0501299_009817
2157 Ga0501031_0487721
2158 Ga0501032_0549707
2159 Ga0501033_0014390
2160 Ga0501033_0626422
2161 Ga0501034_0005914
2162 Ga0501034_0494402
2163 Ga0501036_0063837
2164 Ga0501036_0132452
2165 Ga0501036_0227136
2166 Ga0501037_0314022
2167 Ga0501038_0122937
2168 Ga0501039_0054444
2169 Ga0501039_0252703
2170 Ga0501039_0330237
2171 Ga0501039_0544276
2172 Ga0501040_0006318
2173 Ga0501041_0006853
2174 Ga0501041_0013075
2175 Ga0501041_0018723
2176 Ga0501041_0051930
2177 Ga0501042_0006197
2178 Ga0501042_0015233
2179 Ga0501042_0020353
2180 Ga0501042_0020929
2181 Ga0501042_0098722
2182 Ga0501043_0006595
2183 Ga0501046_0004640
2184 Ga0501046_0038789
2185 Ga0501046_0053339
2186 Ga0501047_0001540
2187 Ga0501047_0110130
2188 Ga0501048_0012443
2189 Ga0501048_0052509
2190 Ga0501067_0018986
2191 Ga0501067_0023538
2192 Ga0501067_0049932
2193 Ga0501068_0006551
2194 Ga0501069_0234055
2195 Ga0501071_0006349
2196 Ga0501071_0035628
2197 Ga0501071_0073431
2198 Ga0501071_0076173
2199 Ga0501071_0134716
2200 Ga0501071_0389009
2201 Ga0501072_0017724
2202 Ga0501072_0027623
2203 Ga0501072_0032613
2204 Ga0501072_0119520
2205 Ga0501072_0154007
2206 Ga0501073_0005759
2207 Ga0501073_0153552
2208 Ga0501074_0729861
2209 Ga0501075_0007940
2210 Ga0501075_0067558
2211 Ga0501075_0100545
2212 Ga0501075_0111471
2213 Ga0501076_0015426
2214 Ga0501076_0025535
2215 Ga0501076_0059433
2216 Ga0501076_0075363
2217 Ga0501076_0117301
2218 Ga0501076_0219768
2219 Ga0501076_0381602
2220 Ga0501076_0448068
2221 Ga0501077_0037308
2222 Ga0501077_0068297
2223 Ga0501077_0092256
2224 Ga0501077_0144334
2225 Ga0501217_161327
2226 Ga0501248_027713
2227 Ga0501257_108902
2228 Ga0501258_022680
2229 Ga0501079_0004350
2230 Ga0501080_0019013
2231 Ga0501080_0193555
2232 Ga0501080_0484347
2233 Ga0501081_0001655
2234 Ga0501081_0006802
2235 Ga0501081_0022215
2236 Ga0501081_0094635
2237 Ga0501081_0134587
2238 Ga0501083_0175041
2239 Ga0501272_037663
2240 Ga0501035_0420125
2241 Ga0501044_0010321
2242 Ga0501045_0007123
2243 Ga0501045_0034948
2244 Ga0501045_0045745
2245 Ga0501045_0048697
2246 nmdc:mga03683_22921_c1
2247 nmdc:mga00v17_284497_c1
2248 nmdc:mga00v17_417742_c1
2249 nmdc:mga00v17_4521_c1
2250 nmdc:mga0yw44_145505_c1
2251 nmdc:mga0yw44_41109_c1
2252 nmdc:mga0k408_10386_c1
2253 nmdc:mga0k408_12220_c2
2254 nmdc:mga06z11_11337_c1
2255 nmdc:mga06z11_120415_c1
2256 nmdc:mga06z11_348884_c1
2257 nmdc:mga04h51_38816_c1
2258 nmdc:mga04h51_50780_c1
2259 nmdc:mga07m45_16034_c1
2260 nmdc:mga07m45_408316_c1
2261 nmdc:mga05p37_10153_c1
2262 nmdc:mga05p37_111875_c1
2263 nmdc:mga05p37_139386_c1
2264 nmdc:mga05p37_185800_c1
2265 nmdc:mga05p37_201663_c1
2266 nmdc:mga05p37_23032_c1
2267 nmdc:mga05p37_261404_c1
2268 nmdc:mga05p37_285821_c1
2269 nmdc:mga05p37_39815_c1
2270 nmdc:mga05p37_77425_c2
2271 nmdc:mga05p37_832_c1
2272 nmdc:mga05p37_853308_c1
2273 nmdc:mga09592_1002_c1
2274 nmdc:mga09592_141198_c1
2275 nmdc:mga09592_151982_c1
2276 nmdc:mga09592_195157_c1
2277 nmdc:mga09592_199858_c1
2278 nmdc:mga09592_249213_c1
2279 nmdc:mga09592_274867_c1
2280 nmdc:mga09592_35614_c1
2281 nmdc:mga09592_545731_c1
2282 nmdc:mga09592_63536_c1
2283 nmdc:mga09592_79977_c1
2284 nmdc:mga09592_80349_c1
2285 nmdc:mga09592_95370_c1
2286 nmdc:mga0qj67_1417_c1
2287 nmdc:mga0qj67_18686_c1
2288 nmdc:mga0qj67_227797_c1
2289 nmdc:mga0qj67_26931_c1
2290 nmdc:mga0qj67_292548_c1
2291 nmdc:mga0qj67_3358_c1
2292 nmdc:mga0qj67_5858_c1
2293 nmdc:mga0qj67_61581_c1
2294 nmdc:mga06r32_20469_c1
2295 nmdc:mga06r32_406025_c1
2296 nmdc:mga06r32_495032_c1
2297 nmdc:mga06r32_56689_c1
2298 nmdc:mga06r32_591860_c1
2299 nmdc:mga08y16_1178741_c1
2300 nmdc:mga08y16_120198_c1
2301 nmdc:mga08y16_129071_c1
2302 nmdc:mga08y16_148625_c1
2303 nmdc:mga08y16_19430_c1
2304 nmdc:mga08y16_226_c1
2305 nmdc:mga08y16_283677_c1
2306 nmdc:mga08y16_31614_c1
2307 nmdc:mga08y16_3914_c1
2308 nmdc:mga08y16_429568_c1
2309 nmdc:mga08y16_438204_c1
2310 nmdc:mga08y16_55022_c1
2311 nmdc:mga08y16_611_c1
2312 nmdc:mga08y16_64596_c1
2313 nmdc:mga08y16_65571_c1
2314 nmdc:mga08y16_73278_c1
2315 nmdc:mga08y16_76939_c1
2316 nmdc:mga0n895_100417_c1
2317 nmdc:mga0n895_149457_c1
2318 nmdc:mga0n895_15190_c1
2319 nmdc:mga0n895_211948_c1
2320 nmdc:mga0n895_220208_c1
2321 nmdc:mga0n895_353939_c1
2322 nmdc:mga0n895_37875_c1
2323 nmdc:mga0n895_423852_c1
2324 nmdc:mga0n895_4706_c1
2325 nmdc:mga0n895_48966_c1
2326 nmdc:mga0n895_73604_c1
2327 nmdc:mga0n895_8390_c1
2328 nmdc:mga0rr50_206299_c1
2329 nmdc:mga0rr50_209204_c1
2330 nmdc:mga0rr50_326_c1
2331 nmdc:mga0rr50_587989_c1
2332 nmdc:mga0rr50_72999_c1
2333 nmdc:mga0rr50_98008_c1
2334 nmdc:mga08x19_104729_c1
2335 nmdc:mga08x19_30526_c1
2336 nmdc:mga08x19_448312_c1
2337 nmdc:mga0a205_118408_c1
2338 nmdc:mga0a205_129789_c2
2339 nmdc:mga0a205_13661_c1
2340 nmdc:mga0a205_139895_c1
2341 nmdc:mga0a205_22780_c1
2342 nmdc:mga0a205_242599_c1
2343 nmdc:mga0a205_325980_c1
2344 nmdc:mga0a205_375535_c1
2345 nmdc:mga0a205_39003_c1
2346 nmdc:mga0a205_42456_c1
2347 nmdc:mga0a205_492_c1
2348 nmdc:mga0a205_852108_c1
2349 nmdc:mga0a205_87481_c1
2350 Ga0495601_0178922
2351 Ga0495619_0033905
2352 Ga0495619_0298516
2353 Ga0495619_0332242
2354 Ga0500646_0001828
2355 Ga0500593_188451
2356 Ga0501084_0025967
2357 Ga0501084_0025977
2358 Ga0501084_0044608
2359 Ga0501084_0090716
2360 Ga0501084_0504336
2361 Ga0501084_0958622
2362 Ga0590071_000034
2363 Ga0590071_032415
2364 Ga0590071_060376
2365 Ga0590074_001837
2366 Ga0590074_023055
2367 Ga0590075_000217
2368 Ga0590075_001190
2369 Ga0590077_000401
2370 Ga0590077_001039
2371 Ga0590077_046680
2372 Ga0501082_0015906
2373 Ga0501082_0165187
2374 Ga0530510_0002263
2375 Ga0530510_0038412
2376 Ga0530510_0327605
2377 Ga0530510_0445896
2378 Ga0530510_0683008

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04545

Sigma70_r4

Sigma-70, region 4

156

205

0.97

PF04542

Sigma70_r2

Sigma-70 region 2

48

116

0.96

PF08281

Sigma70_r4_2

Sigma-70, region 4

150

203

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
5o8y-assembly1.cif.gz_D conformational dynamism for dna interaction in salmonella typhimurium rcsb response regulator. 0.9649 135 178
4lup-assembly2.cif.gz_C crystal structure of the complex formed by region of e. coli sigmae bound to its -10 element non template strand 0.9544 1 90
7vim-assembly1.cif.gz_A the c-terminal dna binding domain of esrb from edwardsiella piscicida 0.9525 135 185
6jhe-assembly1.cif.gz_A crystal structure of bacillus subtilis sigw domain 4 in complexed with -35 element dna 0.9493 135 182
3vep-assembly4.cif.gz_H crystal structure of sigd4 in complex with its negative regulator rsda 0.943 129 184
ID Description Score Start End Superfamily
4lupC00 Mainly Alpha;Orthogonal Bundle;Rna Polymerase Sigma Factor; Chain: A;RNA polymerase sigma factor, region 2, helix turn helix motif 0.9544 1 90 1.10.1740.10
1or7A02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9525 121 183 1.10.10.10
4lupA00 Mainly Alpha;Orthogonal Bundle;Rna Polymerase Sigma Factor; Chain: A;RNA polymerase sigma factor, region 2, helix turn helix motif 0.9515 3 90 1.10.1740.10
1or7B01 Mainly Alpha;Orthogonal Bundle;Rna Polymerase Sigma Factor; Chain: A;RNA polymerase sigma factor, region 2, helix turn helix motif 0.9497 5 90 1.10.1740.10
1or7B02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.947 121 184 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A1F3LVY6-F1-model_v4 RNA polymerase sigma-70 factor 0.7581 1 189 GO:0003677
GO:0006352
GO:0016987
AF-A0A1F3LVY6-F1-model_v4 RNA polymerase sigma-70 factor 0.7385 1 189 GO:0003677
GO:0006352
GO:0016987
AF-A0A7C1EMC1-F1-model_v4 RNA polymerase sigma factor 0.6198 1 193 GO:0003677
GO:0004518
GO:0006352
GO:0016987
AF-A0A7C1EMC1-F1-model_v4 RNA polymerase sigma factor 0.6168 1 193 GO:0003677
GO:0004518
GO:0006352
GO:0016987
AF-A0A2E0VT81-F1-model_v4 RNA polymerase subunit sigma-24 0.6127 1 193 GO:0003677
GO:0006352
GO:0016987

Map