F491433
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1189 | 373 | 2378 | 199 |
Family's Representative Sequence
| Representative Sequence | 3300005331|Ga0070670_100026313|Ga0070670_1000263134 |
| Length | 236 |
| Sequence | MNITAVRPYPPSYLATGPEGPRIQTMTLTDDELVARSIGGDAESFNELILRWERPIYALAYRVIGREEDARDVCQETFLRAFRALPGFKGEAKFSSWLYRIALNLCRDWIRRQRRAPVVQMPEGVEPTELAAERGPVESIEELVGRRQLSAVVEEAMALLPEEQRTAIILKEYHGMTFQEIADMQGCPLSTVKTRLYQGLTVLRRHLDKNGIGLNRVEGVAASKVAGQITPRLVKR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 3 | 3300004785 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-1 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 4 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 5 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 6 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 7 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 8 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 10 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 17 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 21 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 48 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 49 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 55 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 58 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 60 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 66 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 68 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 69 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 71 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 72 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 73 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 74 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 75 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 76 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 77 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 78 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 79 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 80 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 81 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 82 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 83 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 84 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 85 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 86 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 87 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 88 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 89 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 90 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 91 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 93 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 94 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 95 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 96 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 97 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 98 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 99 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 100 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 101 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 103 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 129 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 130 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 193 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 195 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 199 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 200 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 201 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 202 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 203 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 204 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 205 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 206 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 207 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 208 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 209 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 210 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 211 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 212 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 213 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 214 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 215 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 216 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 217 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 218 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 219 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 220 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 221 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 222 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 223 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 224 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 225 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 226 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 227 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 228 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 229 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 230 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 231 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 232 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 233 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 234 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 235 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 236 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 237 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 238 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 239 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 240 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 241 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 242 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 243 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 244 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 245 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 246 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 247 | 3300042128 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 | Metagenome | Rhizosphere |
| 248 | 3300042132 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 | Metagenome | Rhizosphere |
| 249 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 250 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 251 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 252 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 253 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 254 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 255 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 256 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 257 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 258 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 259 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 260 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 296 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 297 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 298 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 299 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 300 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 301 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 302 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 303 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 304 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 305 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 306 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 307 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 308 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 309 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 310 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 311 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 312 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 313 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 314 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 315 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 316 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 317 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 318 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 319 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 320 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 321 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 322 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 323 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 324 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 325 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 326 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 327 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 328 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 329 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 330 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 331 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 332 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 333 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 334 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 335 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 336 | 3300049678 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought | Metagenome | Rhizosphere |
| 337 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 338 | 3300049687 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought | Metagenome | Rhizosphere |
| 339 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 340 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 341 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 342 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 343 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 344 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 345 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 346 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 347 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 348 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 349 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 350 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 351 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 352 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 353 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 354 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 355 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 356 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 357 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 358 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 359 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 360 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 361 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 362 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 363 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 366 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 367 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 368 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 369 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 370 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 371 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 372 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 373 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.33 |
| Metatranscriptomes | 0.67 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.44 |
| Nodule | 0 |
| Rhizoplane | 2.19 |
| Rhizosphere | 94.87 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 23.04 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070670_100026313 | 3300005331 | Bacteria | 5008 |
| 2 | JGI25406J46586_10000717 | 3300003203 | Bacteria | 15505 |
| 3 | JGI25406J46586_10002626 | 3300003203 | Bacteria | 8478 |
| 4 | JGI25406J46586_10024043 | 3300003203 | Bacteria | 2396 |
| 5 | Ga0058858_1426466 | 3300004785 | Unclassified | 904 |
| 6 | Ga0058859_11578489 | 3300004798 | Bacteria | 1187 |
| 7 | Ga0058859_11790629 | 3300004798 | Unclassified | 719 |
| 8 | Ga0058861_12044645 | 3300004800 | Unclassified | 934 |
| 9 | Ga0058860_12143216 | 3300004801 | Unclassified | 1151 |
| 10 | Ga0058862_12520517 | 3300004803 | Bacteria | 1132 |
| 11 | Ga0065704_10022086 | 3300005289 | Unclassified | 1430 |
| 12 | Ga0065712_10083022 | 3300005290 | Bacteria | 2868 |
| 13 | Ga0065712_10174957 | 3300005290 | Unclassified | 1223 |
| 14 | Ga0065712_10186090 | 3300005290 | Unclassified | 1169 |
| 15 | Ga0065712_10189294 | 3300005290 | Bacteria | 1155 |
| 16 | Ga0065712_10197171 | 3300005290 | Unclassified | 1123 |
| 17 | Ga0065712_10263114 | 3300005290 | Bacteria | 931 |
| 18 | Ga0065712_10324743 | 3300005290 | Bacteria | 823 |
| 19 | Ga0065715_10110347 | 3300005293 | Bacteria | 2624 |
| 20 | Ga0065715_10144576 | 3300005293 | Unclassified | 1806 |
| 21 | Ga0065715_10174953 | 3300005293 | Bacteria | 1486 |
| 22 | Ga0065715_10364441 | 3300005293 | Unclassified | 930 |
| 23 | Ga0065715_10437544 | 3300005293 | Bacteria | 840 |
| 24 | Ga0065707_10117551 | 3300005295 | Bacteria | 2208 |
| 25 | Ga0065707_10134959 | 3300005295 | Bacteria | 1857 |
| 26 | Ga0065707_10151914 | 3300005295 | Bacteria | 1649 |
| 27 | Ga0065707_10257191 | 3300005295 | Bacteria | 1108 |
| 28 | Ga0070676_10048439 | 3300005328 | Bacteria | 2484 |
| 29 | Ga0070676_10079232 | 3300005328 | Bacteria | 1989 |
| 30 | Ga0070676_10092042 | 3300005328 | Bacteria | 1859 |
| 31 | Ga0070676_10254782 | 3300005328 | Unclassified | 1173 |
| 32 | Ga0070676_10314917 | 3300005328 | Bacteria | 1065 |
| 33 | Ga0070683_100002625 | 3300005329 | Bacteria | 14371 |
| 34 | Ga0070683_100030831 | 3300005329 | Bacteria | 4872 |
| 35 | Ga0070690_100012083 | 3300005330 | Bacteria | 5071 |
| 36 | Ga0070690_100304528 | 3300005330 | Bacteria | 1143 |
| 37 | Ga0070690_100708680 | 3300005330 | Bacteria | 773 |
| 38 | Ga0070670_100010086 | 3300005331 | Bacteria | 8061 |
| 39 | Ga0070670_100012414 | 3300005331 | Bacteria | 7290 |
| 40 | Ga0070670_100018368 | 3300005331 | Bacteria | 6000 |
| 41 | Ga0070670_100023579 | 3300005331 | Bacteria | 5296 |
| 42 | Ga0070670_100055636 | 3300005331 | Bacteria | 3396 |
| 43 | Ga0070670_100424101 | 3300005331 | Bacteria | 1176 |
| 44 | Ga0070670_100777205 | 3300005331 | Bacteria | 864 |
| 45 | Ga0070677_10053910 | 3300005333 | Bacteria | 1636 |
| 46 | Ga0070677_10185057 | 3300005333 | Bacteria | 995 |
| 47 | Ga0068869_100023804 | 3300005334 | Bacteria | 4236 |
| 48 | Ga0068869_100117396 | 3300005334 | Bacteria | 2031 |
| 49 | Ga0068869_100370206 | 3300005334 | Bacteria | 1172 |
| 50 | Ga0070666_10001460 | 3300005335 | Bacteria | 14346 |
| 51 | Ga0070666_10078500 | 3300005335 | Bacteria | 2254 |
| 52 | Ga0070666_10286409 | 3300005335 | Bacteria | 1172 |
| 53 | Ga0070666_10376318 | 3300005335 | Unclassified | 1019 |
| 54 | Ga0070680_100168366 | 3300005336 | Bacteria | 1843 |
| 55 | Ga0070680_100463986 | 3300005336 | Bacteria | 1082 |
| 56 | Ga0070680_100588429 | 3300005336 | Bacteria | 955 |
| 57 | Ga0070680_100701612 | 3300005336 | Unclassified | 871 |
| 58 | Ga0070682_100299639 | 3300005337 | Bacteria | 1179 |
| 59 | Ga0070682_100512078 | 3300005337 | Unclassified | 932 |
| 60 | Ga0068868_100430738 | 3300005338 | Unclassified | 1144 |
| 61 | Ga0068868_100446569 | 3300005338 | Unclassified | 1124 |
| 62 | Ga0068868_100447567 | 3300005338 | Bacteria | 1123 |
| 63 | Ga0070660_100056707 | 3300005339 | Bacteria | 3032 |
| 64 | Ga0070689_100021821 | 3300005340 | Bacteria | 4773 |
| 65 | Ga0070689_100022436 | 3300005340 | Bacteria | 4712 |
| 66 | Ga0070689_100072399 | 3300005340 | Bacteria | 2693 |
| 67 | Ga0070689_100152383 | 3300005340 | Bacteria | 1865 |
| 68 | Ga0070689_100192528 | 3300005340 | Unclassified | 1661 |
| 69 | Ga0070689_100259095 | 3300005340 | Bacteria | 1437 |
| 70 | Ga0070689_100503373 | 3300005340 | Unclassified | 1038 |
| 71 | Ga0070689_100717689 | 3300005340 | Unclassified | 874 |
| 72 | Ga0070689_100750038 | 3300005340 | Unclassified | 855 |
| 73 | Ga0070691_10032075 | 3300005341 | Bacteria | 2467 |
| 74 | Ga0070687_100047492 | 3300005343 | Bacteria | 2202 |
| 75 | Ga0070687_100049562 | 3300005343 | Bacteria | 2165 |
| 76 | Ga0070687_100685063 | 3300005343 | Unclassified | 714 |
| 77 | Ga0070661_100168806 | 3300005344 | Bacteria | 1661 |
| 78 | Ga0070661_100263132 | 3300005344 | Bacteria | 1334 |
| 79 | Ga0070692_10061075 | 3300005345 | Bacteria | 1986 |
| 80 | Ga0070668_100451620 | 3300005347 | Bacteria | 1105 |
| 81 | Ga0070668_100542997 | 3300005347 | Bacteria | 1011 |
| 82 | Ga0070669_100003238 | 3300005353 | Bacteria | 11696 |
| 83 | Ga0070669_100008530 | 3300005353 | Bacteria | 7316 |
| 84 | Ga0070669_100085713 | 3300005353 | Bacteria | 2352 |
| 85 | Ga0070669_100108206 | 3300005353 | Bacteria | 2106 |
| 86 | Ga0070669_100152404 | 3300005353 | Bacteria | 1790 |
| 87 | Ga0070669_100159766 | 3300005353 | Bacteria | 1750 |
| 88 | Ga0070669_100183548 | 3300005353 | Bacteria | 1638 |
| 89 | Ga0070669_100447080 | 3300005353 | Bacteria | 1065 |
| 90 | Ga0070669_100492414 | 3300005353 | Unclassified | 1016 |
| 91 | Ga0070675_100000617 | 3300005354 | Bacteria | 24579 |
| 92 | Ga0070675_100001519 | 3300005354 | Bacteria | 17153 |
| 93 | Ga0070675_100003475 | 3300005354 | Bacteria | 11947 |
| 94 | Ga0070675_100007631 | 3300005354 | Bacteria | 8369 |
| 95 | Ga0070675_100007926 | 3300005354 | Bacteria | 8233 |
| 96 | Ga0070675_100024800 | 3300005354 | Bacteria | 4804 |
| 97 | Ga0070675_100072184 | 3300005354 | Unclassified | 2865 |
| 98 | Ga0070675_100106073 | 3300005354 | Bacteria | 2372 |
| 99 | Ga0070675_100115083 | 3300005354 | Bacteria | 2279 |
| 100 | Ga0070675_100404555 | 3300005354 | Bacteria | 1218 |
| 101 | Ga0070675_100711946 | 3300005354 | Unclassified | 915 |
| 102 | Ga0070671_100004187 | 3300005355 | Bacteria | 11406 |
| 103 | Ga0070671_100046654 | 3300005355 | Bacteria | 3603 |
| 104 | Ga0070671_100063454 | 3300005355 | Unclassified | 3076 |
| 105 | Ga0070671_100127168 | 3300005355 | Bacteria | 2146 |
| 106 | Ga0070671_100691833 | 3300005355 | Unclassified | 884 |
| 107 | Ga0070671_101271637 | 3300005355 | Bacteria | 649 |
| 108 | Ga0070674_100014856 | 3300005356 | Bacteria | 4847 |
| 109 | Ga0070674_100091393 | 3300005356 | Bacteria | 2198 |
| 110 | Ga0070674_100264668 | 3300005356 | Bacteria | 1356 |
| 111 | Ga0070674_100406947 | 3300005356 | Bacteria | 1113 |
| 112 | Ga0070674_100708812 | 3300005356 | Bacteria | 861 |
| 113 | Ga0070673_100003552 | 3300005364 | Bacteria | 9729 |
| 114 | Ga0070673_100010680 | 3300005364 | Bacteria | 6227 |
| 115 | Ga0070673_100014066 | 3300005364 | Bacteria | 5558 |
| 116 | Ga0070673_100017589 | 3300005364 | Bacteria | 5089 |
| 117 | Ga0070673_100056981 | 3300005364 | Bacteria | 3086 |
| 118 | Ga0070673_100070875 | 3300005364 | Bacteria | 2799 |
| 119 | Ga0070673_100180396 | 3300005364 | Bacteria | 1807 |
| 120 | Ga0070673_100553880 | 3300005364 | Bacteria | 1045 |
| 121 | Ga0070673_100632812 | 3300005364 | Bacteria | 978 |
| 122 | Ga0070688_100082983 | 3300005365 | Bacteria | 2079 |
| 123 | Ga0070688_100136071 | 3300005365 | Bacteria | 1663 |
| 124 | Ga0070688_100154171 | 3300005365 | Bacteria | 1573 |
| 125 | Ga0070688_100475626 | 3300005365 | Unclassified | 938 |
| 126 | Ga0070659_100052454 | 3300005366 | Bacteria | 3208 |
| 127 | Ga0070659_100215705 | 3300005366 | Unclassified | 1583 |
| 128 | Ga0070659_100430331 | 3300005366 | Bacteria | 1117 |
| 129 | Ga0070659_100692624 | 3300005366 | Unclassified | 881 |
| 130 | Ga0070667_100242186 | 3300005367 | Unclassified | 1611 |
| 131 | Ga0070667_100390253 | 3300005367 | Bacteria | 1266 |
| 132 | Ga0070667_100524171 | 3300005367 | Unclassified | 1088 |
| 133 | Ga0070667_100573020 | 3300005367 | Bacteria | 1039 |
| 134 | Ga0070703_10053542 | 3300005406 | Bacteria | 1298 |
| 135 | Ga0070714_100041923 | 3300005435 | Bacteria | 3864 |
| 136 | Ga0070713_100041155 | 3300005436 | Bacteria | 3763 |
| 137 | Ga0070713_100097307 | 3300005436 | Unclassified | 2543 |
| 138 | Ga0070713_100351393 | 3300005436 | Bacteria | 1368 |
| 139 | Ga0070701_10002629 | 3300005438 | Bacteria | 6957 |
| 140 | Ga0070701_10022582 | 3300005438 | Unclassified | 3017 |
| 141 | Ga0070701_10043915 | 3300005438 | Bacteria | 2288 |
| 142 | Ga0070701_10335155 | 3300005438 | Unclassified | 940 |
| 143 | Ga0070705_100048215 | 3300005440 | Bacteria | 2466 |
| 144 | Ga0070705_100051202 | 3300005440 | Bacteria | 2406 |
| 145 | Ga0070705_100060914 | 3300005440 | Bacteria | 2241 |
| 146 | Ga0070705_100271070 | 3300005440 | Bacteria | 1202 |
| 147 | Ga0070705_100289556 | 3300005440 | Unclassified | 1168 |
| 148 | Ga0070705_100336934 | 3300005440 | Unclassified | 1095 |
| 149 | Ga0070700_100002087 | 3300005441 | Bacteria | 10147 |
| 150 | Ga0070700_100011496 | 3300005441 | Bacteria | 4905 |
| 151 | Ga0070700_100049403 | 3300005441 | Bacteria | 2612 |
| 152 | Ga0070700_100136775 | 3300005441 | Bacteria | 1660 |
| 153 | Ga0070700_100145215 | 3300005441 | Unclassified | 1616 |
| 154 | Ga0070694_100003530 | 3300005444 | Bacteria | 9350 |
| 155 | Ga0070694_100009709 | 3300005444 | Bacteria | 5909 |
| 156 | Ga0070694_100079788 | 3300005444 | Bacteria | 2273 |
| 157 | Ga0070694_100109687 | 3300005444 | Bacteria | 1965 |
| 158 | Ga0070694_100195470 | 3300005444 | Bacteria | 1505 |
| 159 | Ga0070694_100216907 | 3300005444 | Bacteria | 1433 |
| 160 | Ga0070694_100569194 | 3300005444 | Bacteria | 909 |
| 161 | Ga0070708_100269672 | 3300005445 | Unclassified | 1601 |
| 162 | Ga0070708_100906382 | 3300005445 | Bacteria | 828 |
| 163 | Ga0070663_100023419 | 3300005455 | Bacteria | 4140 |
| 164 | Ga0070663_100025375 | 3300005455 | Bacteria | 4000 |
| 165 | Ga0070663_100083330 | 3300005455 | Bacteria | 2355 |
| 166 | Ga0070678_100218400 | 3300005456 | Bacteria | 1583 |
| 167 | Ga0070678_100253519 | 3300005456 | Bacteria | 1476 |
| 168 | Ga0070678_100486455 | 3300005456 | Unclassified | 1087 |
| 169 | Ga0070678_100761022 | 3300005456 | Bacteria | 877 |
| 170 | Ga0070678_101051791 | 3300005456 | Bacteria | 750 |
| 171 | Ga0070662_100108748 | 3300005457 | Bacteria | 2109 |
| 172 | Ga0070662_100121481 | 3300005457 | Bacteria | 2003 |
| 173 | Ga0070662_100213070 | 3300005457 | Bacteria | 1538 |
| 174 | Ga0070662_100224355 | 3300005457 | Unclassified | 1501 |
| 175 | Ga0070662_100471291 | 3300005457 | Bacteria | 1044 |
| 176 | Ga0070662_100527198 | 3300005457 | Bacteria | 988 |
| 177 | Ga0070662_100632389 | 3300005457 | Unclassified | 902 |
| 178 | Ga0070662_101019977 | 3300005457 | Unclassified | 709 |
| 179 | Ga0070681_10003234 | 3300005458 | Bacteria | 15193 |
| 180 | Ga0070681_10025795 | 3300005458 | Bacteria | 5910 |
| 181 | Ga0070681_10080026 | 3300005458 | Bacteria | 3224 |
| 182 | Ga0070681_10425357 | 3300005458 | Bacteria | 1240 |
| 183 | Ga0070681_10603486 | 3300005458 | Bacteria | 1012 |
| 184 | Ga0070681_10617802 | 3300005458 | Unclassified | 998 |
| 185 | Ga0068867_100003458 | 3300005459 | Bacteria | 11108 |
| 186 | Ga0068867_100006787 | 3300005459 | Bacteria | 8093 |
| 187 | Ga0068867_100015827 | 3300005459 | Bacteria | 5354 |
| 188 | Ga0068867_100226648 | 3300005459 | Bacteria | 1509 |
| 189 | Ga0070685_10055310 | 3300005466 | Bacteria | 2305 |
| 190 | Ga0070685_10443790 | 3300005466 | Bacteria | 907 |
| 191 | Ga0070706_100365177 | 3300005467 | Unclassified | 1345 |
| 192 | Ga0070706_100506555 | 3300005467 | Unclassified | 1123 |
| 193 | Ga0070707_100050521 | 3300005468 | Bacteria | 3986 |
| 194 | Ga0070707_100500183 | 3300005468 | Bacteria | 1177 |
| 195 | Ga0070698_100011373 | 3300005471 | Bacteria | 9446 |
| 196 | Ga0070698_100129061 | 3300005471 | Bacteria | 2484 |
| 197 | Ga0070698_100321503 | 3300005471 | Bacteria | 1478 |
| 198 | Ga0070699_100001754 | 3300005518 | Bacteria | 19774 |
| 199 | Ga0070699_100005910 | 3300005518 | Bacteria | 10693 |
| 200 | Ga0070699_100007030 | 3300005518 | Bacteria | 9778 |
| 201 | Ga0070699_100020778 | 3300005518 | Bacteria | 5662 |
| 202 | Ga0070679_100146193 | 3300005530 | Bacteria | 2342 |
| 203 | Ga0070679_100525927 | 3300005530 | Bacteria | 1127 |
| 204 | Ga0070684_100004802 | 3300005535 | Bacteria | 10327 |
| 205 | Ga0070684_100015024 | 3300005535 | Bacteria | 6289 |
| 206 | Ga0070684_100370480 | 3300005535 | Bacteria | 1319 |
| 207 | Ga0070684_100699684 | 3300005535 | Unclassified | 945 |
| 208 | Ga0070697_100007518 | 3300005536 | Bacteria | 8481 |
| 209 | Ga0068853_100233518 | 3300005539 | Bacteria | 1683 |
| 210 | Ga0070672_100022715 | 3300005543 | Bacteria | 4613 |
| 211 | Ga0070672_100030757 | 3300005543 | Bacteria | 4037 |
| 212 | Ga0070672_100205258 | 3300005543 | Unclassified | 1649 |
| 213 | Ga0070672_100211558 | 3300005543 | Bacteria | 1624 |
| 214 | Ga0070672_100258875 | 3300005543 | Bacteria | 1467 |
| 215 | Ga0070672_100268205 | 3300005543 | Bacteria | 1441 |
| 216 | Ga0070672_100291759 | 3300005543 | Bacteria | 1381 |
| 217 | Ga0070672_100766166 | 3300005543 | Unclassified | 848 |
| 218 | Ga0070686_100001443 | 3300005544 | Bacteria | 13429 |
| 219 | Ga0070686_100017081 | 3300005544 | Bacteria | 4235 |
| 220 | Ga0070686_100121824 | 3300005544 | Unclassified | 1792 |
| 221 | Ga0070686_100196261 | 3300005544 | Bacteria | 1444 |
| 222 | Ga0070686_100298596 | 3300005544 | Bacteria | 1194 |
| 223 | Ga0070686_100439309 | 3300005544 | Bacteria | 1001 |
| 224 | Ga0070686_100639127 | 3300005544 | Bacteria | 842 |
| 225 | Ga0070686_100711104 | 3300005544 | Unclassified | 802 |
| 226 | Ga0070695_100001218 | 3300005545 | Bacteria | 14150 |
| 227 | Ga0070695_100094340 | 3300005545 | Bacteria | 2004 |
| 228 | Ga0070695_100153677 | 3300005545 | Bacteria | 1608 |
| 229 | Ga0070695_100330713 | 3300005545 | Unclassified | 1136 |
| 230 | Ga0070695_100368605 | 3300005545 | Bacteria | 1081 |
| 231 | Ga0070695_100409379 | 3300005545 | Bacteria | 1030 |
| 232 | Ga0070696_100002157 | 3300005546 | Bacteria | 12961 |
| 233 | Ga0070696_100004447 | 3300005546 | Bacteria | 9355 |
| 234 | Ga0070696_100005834 | 3300005546 | Bacteria | 8216 |
| 235 | Ga0070696_100044304 | 3300005546 | Bacteria | 3081 |
| 236 | Ga0070696_100406644 | 3300005546 | Bacteria | 1066 |
| 237 | Ga0070696_100989646 | 3300005546 | Bacteria | 702 |
| 238 | Ga0070693_100031621 | 3300005547 | Bacteria | 2903 |
| 239 | Ga0070693_100102096 | 3300005547 | Bacteria | 1749 |
| 240 | Ga0070693_100259552 | 3300005547 | Bacteria | 1155 |
| 241 | Ga0070693_100458516 | 3300005547 | Bacteria | 896 |
| 242 | Ga0070665_100082746 | 3300005548 | Bacteria | 3215 |
| 243 | Ga0070665_100572659 | 3300005548 | Bacteria | 1142 |
| 244 | Ga0070704_100009084 | 3300005549 | Bacteria | 5997 |
| 245 | Ga0070704_100009193 | 3300005549 | Bacteria | 5960 |
| 246 | Ga0070704_100110374 | 3300005549 | Bacteria | 2092 |
| 247 | Ga0070704_100135635 | 3300005549 | Bacteria | 1914 |
| 248 | Ga0070704_100219851 | 3300005549 | Bacteria | 1544 |
| 249 | Ga0070704_100226268 | 3300005549 | Bacteria | 1523 |
| 250 | Ga0070704_100319375 | 3300005549 | Bacteria | 1301 |
| 251 | Ga0070704_100525312 | 3300005549 | Bacteria | 1031 |
| 252 | Ga0070704_100525981 | 3300005549 | Unclassified | 1030 |
| 253 | Ga0068855_100602131 | 3300005563 | Bacteria | 1185 |
| 254 | Ga0070664_100000832 | 3300005564 | Bacteria | 23806 |
| 255 | Ga0070664_100024195 | 3300005564 | Bacteria | 5022 |
| 256 | Ga0070664_100151298 | 3300005564 | Bacteria | 2049 |
| 257 | Ga0070664_100196586 | 3300005564 | Unclassified | 1798 |
| 258 | Ga0070664_100279561 | 3300005564 | Bacteria | 1505 |
| 259 | Ga0070664_100452751 | 3300005564 | Unclassified | 1179 |
| 260 | Ga0070664_100589394 | 3300005564 | Bacteria | 1030 |
| 261 | Ga0070664_101229701 | 3300005564 | Unclassified | 707 |
| 262 | Ga0068857_100015517 | 3300005577 | Bacteria | 6657 |
| 263 | Ga0068857_100067796 | 3300005577 | Bacteria | 3176 |
| 264 | Ga0068857_100187979 | 3300005577 | Unclassified | 1881 |
| 265 | Ga0068854_100004044 | 3300005578 | Bacteria | 9206 |
| 266 | Ga0068854_100043326 | 3300005578 | Bacteria | 3189 |
| 267 | Ga0068854_100084705 | 3300005578 | Bacteria | 2346 |
| 268 | Ga0070702_100031413 | 3300005615 | Bacteria | 2905 |
| 269 | Ga0070702_100064214 | 3300005615 | Unclassified | 2147 |
| 270 | Ga0070702_100070398 | 3300005615 | Bacteria | 2065 |
| 271 | Ga0070702_100159944 | 3300005615 | Unclassified | 1455 |
| 272 | Ga0070702_100207339 | 3300005615 | Unclassified | 1302 |
| 273 | Ga0068852_100016767 | 3300005616 | Bacteria | 5724 |
| 274 | Ga0068852_100051384 | 3300005616 | Bacteria | 3537 |
| 275 | Ga0068852_100435132 | 3300005616 | Unclassified | 1296 |
| 276 | Ga0068859_100040288 | 3300005617 | Bacteria | 4689 |
| 277 | Ga0068859_100168081 | 3300005617 | Unclassified | 2273 |
| 278 | Ga0068859_100206025 | 3300005617 | Bacteria | 2052 |
| 279 | Ga0068859_100306687 | 3300005617 | Bacteria | 1681 |
| 280 | Ga0068859_100379265 | 3300005617 | Unclassified | 1509 |
| 281 | Ga0068859_100409808 | 3300005617 | Unclassified | 1451 |
| 282 | Ga0068859_100887832 | 3300005617 | Bacteria | 976 |
| 283 | Ga0068859_101409786 | 3300005617 | Unclassified | 768 |
| 284 | Ga0068864_100009165 | 3300005618 | Bacteria | 8159 |
| 285 | Ga0068864_100062567 | 3300005618 | Bacteria | 3224 |
| 286 | Ga0068864_100373005 | 3300005618 | Bacteria | 1351 |
| 287 | Ga0068864_100621421 | 3300005618 | Bacteria | 1050 |
| 288 | Ga0068864_100645027 | 3300005618 | Unclassified | 1031 |
| 289 | Ga0068864_101041391 | 3300005618 | Archaea | 813 |
| 290 | Ga0068866_10011610 | 3300005718 | Bacteria | 3816 |
| 291 | Ga0068866_10043798 | 3300005718 | Bacteria | 2236 |
| 292 | Ga0068861_100003679 | 3300005719 | Bacteria | 10228 |
| 293 | Ga0068861_100029946 | 3300005719 | Bacteria | 3986 |
| 294 | Ga0068861_100075669 | 3300005719 | Bacteria | 2621 |
| 295 | Ga0068861_100320593 | 3300005719 | Bacteria | 1349 |
| 296 | Ga0068861_100438532 | 3300005719 | Unclassified | 1168 |
| 297 | Ga0068861_101164138 | 3300005719 | Unclassified | 744 |
| 298 | Ga0068851_10039668 | 3300005834 | Unclassified | 2365 |
| 299 | Ga0068851_10133148 | 3300005834 | Bacteria | 1346 |
| 300 | Ga0068870_10017038 | 3300005840 | Bacteria | 3487 |
| 301 | Ga0068870_10130593 | 3300005840 | Bacteria | 1459 |
| 302 | Ga0068863_100052159 | 3300005841 | Bacteria | 3877 |
| 303 | Ga0068863_100200070 | 3300005841 | Bacteria | 1921 |
| 304 | Ga0068863_100254548 | 3300005841 | Unclassified | 1697 |
| 305 | Ga0068863_100406631 | 3300005841 | Bacteria | 1332 |
| 306 | Ga0068863_100519313 | 3300005841 | Unclassified | 1174 |
| 307 | Ga0068858_100010889 | 3300005842 | Bacteria | 8596 |
| 308 | Ga0068858_100022318 | 3300005842 | Bacteria | 5910 |
| 309 | Ga0068858_100041710 | 3300005842 | Bacteria | 4254 |
| 310 | Ga0068858_100193443 | 3300005842 | Bacteria | 1922 |
| 311 | Ga0068860_100054620 | 3300005843 | Bacteria | 3796 |
| 312 | Ga0068860_100195153 | 3300005843 | Bacteria | 1960 |
| 313 | Ga0068860_100375059 | 3300005843 | Unclassified | 1404 |
| 314 | Ga0068860_100514969 | 3300005843 | Unclassified | 1196 |
| 315 | Ga0068860_100643863 | 3300005843 | Unclassified | 1067 |
| 316 | Ga0068860_100821131 | 3300005843 | Bacteria | 943 |
| 317 | Ga0068862_100056994 | 3300005844 | Bacteria | 3349 |
| 318 | Ga0068862_100119950 | 3300005844 | Bacteria | 2317 |
| 319 | Ga0068862_100292113 | 3300005844 | Unclassified | 1497 |
| 320 | Ga0081455_10076085 | 3300005937 | Bacteria | 2766 |
| 321 | Ga0081538_10099985 | 3300005981 | Bacteria | 1464 |
| 322 | Ga0081539_10000291 | 3300005985 | Bacteria | 113769 |
| 323 | Ga0081539_10000295 | 3300005985 | Bacteria | 112740 |
| 324 | Ga0081539_10002133 | 3300005985 | Bacteria | 29223 |
| 325 | Ga0075368_10010304 | 3300006042 | Bacteria | 3377 |
| 326 | Ga0075368_10045552 | 3300006042 | Unclassified | 1733 |
| 327 | Ga0075364_10002862 | 3300006051 | Bacteria | 9724 |
| 328 | Ga0075364_10007269 | 3300006051 | Bacteria | 6568 |
| 329 | Ga0075362_10003359 | 3300006177 | Bacteria | 5578 |
| 330 | Ga0075367_10005268 | 3300006178 | Bacteria | 6395 |
| 331 | Ga0075367_10019677 | 3300006178 | Bacteria | 3747 |
| 332 | Ga0075369_10135769 | 3300006186 | Unclassified | 1120 |
| 333 | Ga0075427_10017711 | 3300006194 | Bacteria | 1113 |
| 334 | Ga0075366_10029113 | 3300006195 | Unclassified | 3244 |
| 335 | Ga0097621_100123867 | 3300006237 | Bacteria | 2194 |
| 336 | Ga0097621_100214970 | 3300006237 | Unclassified | 1673 |
| 337 | Ga0097621_100301059 | 3300006237 | Bacteria | 1416 |
| 338 | Ga0097621_100382342 | 3300006237 | Unclassified | 1258 |
| 339 | Ga0097621_100449358 | 3300006237 | Bacteria | 1161 |
| 340 | Ga0075370_10008989 | 3300006353 | Bacteria | 5166 |
| 341 | Ga0068871_100060502 | 3300006358 | Bacteria | 3090 |
| 342 | Ga0068871_100257549 | 3300006358 | Bacteria | 1521 |
| 343 | Ga0068871_100883886 | 3300006358 | Bacteria | 827 |
| 344 | Ga0075428_100000931 | 3300006844 | Bacteria | 30952 |
| 345 | Ga0075428_100008691 | 3300006844 | Bacteria | 11267 |
| 346 | Ga0075428_100015755 | 3300006844 | Bacteria | 8376 |
| 347 | Ga0075428_100024626 | 3300006844 | Bacteria | 6661 |
| 348 | Ga0075428_100033671 | 3300006844 | Bacteria | 5655 |
| 349 | Ga0075428_100041952 | 3300006844 | Bacteria | 5031 |
| 350 | Ga0075428_100163037 | 3300006844 | Bacteria | 2419 |
| 351 | Ga0075428_100823678 | 3300006844 | Bacteria | 986 |
| 352 | Ga0075430_100000398 | 3300006846 | Bacteria | 32154 |
| 353 | Ga0075430_100030658 | 3300006846 | Bacteria | 4568 |
| 354 | Ga0075430_100041996 | 3300006846 | Bacteria | 3867 |
| 355 | Ga0075430_100050744 | 3300006846 | Bacteria | 3497 |
| 356 | Ga0075430_100174789 | 3300006846 | Bacteria | 1787 |
| 357 | Ga0075430_100198918 | 3300006846 | Bacteria | 1664 |
| 358 | Ga0075431_100015570 | 3300006847 | Bacteria | 7707 |
| 359 | Ga0075431_100036470 | 3300006847 | Bacteria | 5064 |
| 360 | Ga0075431_100132041 | 3300006847 | Bacteria | 2575 |
| 361 | Ga0075431_100407815 | 3300006847 | Bacteria | 1359 |
| 362 | Ga0075431_100523119 | 3300006847 | Bacteria | 1175 |
| 363 | Ga0075433_10005915 | 3300006852 | Bacteria | 9635 |
| 364 | Ga0075433_10008576 | 3300006852 | Bacteria | 8157 |
| 365 | Ga0075433_10048647 | 3300006852 | Bacteria | 3688 |
| 366 | Ga0075433_10138299 | 3300006852 | Bacteria | 2165 |
| 367 | Ga0075433_10197196 | 3300006852 | Unclassified | 1790 |
| 368 | Ga0075433_10217667 | 3300006852 | Unclassified | 1697 |
| 369 | Ga0075433_10275626 | 3300006852 | Bacteria | 1491 |
| 370 | Ga0075433_10354684 | 3300006852 | Bacteria | 1296 |
| 371 | Ga0075433_10387427 | 3300006852 | Bacteria | 1234 |
| 372 | Ga0075433_11036696 | 3300006852 | Bacteria | 714 |
| 373 | Ga0075434_100004997 | 3300006871 | Bacteria | 12038 |
| 374 | Ga0075434_100010035 | 3300006871 | Bacteria | 8867 |
| 375 | Ga0075434_100011617 | 3300006871 | Bacteria | 8314 |
| 376 | Ga0075434_100019603 | 3300006871 | Bacteria | 6546 |
| 377 | Ga0075434_100019962 | 3300006871 | Bacteria | 6490 |
| 378 | Ga0075434_100136223 | 3300006871 | Bacteria | 2475 |
| 379 | Ga0075434_100161445 | 3300006871 | Unclassified | 2261 |
| 380 | Ga0075434_100181639 | 3300006871 | Bacteria | 2124 |
| 381 | Ga0075434_100194788 | 3300006871 | Unclassified | 2047 |
| 382 | Ga0075434_100640974 | 3300006871 | Unclassified | 1081 |
| 383 | Ga0075429_100005250 | 3300006880 | Bacteria | 11144 |
| 384 | Ga0075429_100012127 | 3300006880 | Bacteria | 7469 |
| 385 | Ga0075429_100055017 | 3300006880 | Bacteria | 3462 |
| 386 | Ga0075429_100066676 | 3300006880 | Bacteria | 3134 |
| 387 | Ga0075429_100121667 | 3300006880 | Bacteria | 2282 |
| 388 | Ga0075429_100149495 | 3300006880 | Bacteria | 2045 |
| 389 | Ga0075429_100220471 | 3300006880 | Bacteria | 1661 |
| 390 | Ga0075429_100283959 | 3300006880 | Bacteria | 1449 |
| 391 | Ga0075429_100288094 | 3300006880 | Unclassified | 1438 |
| 392 | Ga0075429_100482178 | 3300006880 | Bacteria | 1087 |
| 393 | Ga0068865_100008578 | 3300006881 | Bacteria | 6319 |
| 394 | Ga0068865_100015657 | 3300006881 | Bacteria | 4838 |
| 395 | Ga0068865_100071425 | 3300006881 | Unclassified | 2462 |
| 396 | Ga0068865_100574286 | 3300006881 | Unclassified | 950 |
| 397 | Ga0097620_100040291 | 3300006931 | Bacteria | 4689 |
| 398 | Ga0097620_100168076 | 3300006931 | Unclassified | 2273 |
| 399 | Ga0097620_100206025 | 3300006931 | Bacteria | 2052 |
| 400 | Ga0097620_100306663 | 3300006931 | Bacteria | 1681 |
| 401 | Ga0097620_100379258 | 3300006931 | Unclassified | 1509 |
| 402 | Ga0097620_100409791 | 3300006931 | Unclassified | 1451 |
| 403 | Ga0097620_100887886 | 3300006931 | Bacteria | 976 |
| 404 | Ga0097620_101409751 | 3300006931 | Unclassified | 768 |
| 405 | Ga0075435_100000542 | 3300007076 | Bacteria | 23134 |
| 406 | Ga0075435_100003059 | 3300007076 | Bacteria | 11280 |
| 407 | Ga0075435_100040441 | 3300007076 | Bacteria | 3722 |
| 408 | Ga0075435_100112436 | 3300007076 | Bacteria | 2266 |
| 409 | Ga0075435_100164287 | 3300007076 | Unclassified | 1871 |
| 410 | Ga0075435_100232611 | 3300007076 | Unclassified | 1566 |
| 411 | Ga0075435_100374591 | 3300007076 | Bacteria | 1222 |
| 412 | Ga0105240_10364422 | 3300009093 | Bacteria | 1636 |
| 413 | Ga0111539_10002826 | 3300009094 | Bacteria | 23090 |
| 414 | Ga0111539_10004921 | 3300009094 | Bacteria | 17381 |
| 415 | Ga0111539_10005196 | 3300009094 | Bacteria | 16863 |
| 416 | Ga0111539_10005833 | 3300009094 | Bacteria | 15921 |
| 417 | Ga0111539_10008803 | 3300009094 | Bacteria | 12801 |
| 418 | Ga0111539_10012690 | 3300009094 | Bacteria | 10551 |
| 419 | Ga0111539_10032568 | 3300009094 | Bacteria | 6329 |
| 420 | Ga0111539_10044641 | 3300009094 | Bacteria | 5309 |
| 421 | Ga0111539_10056800 | 3300009094 | Bacteria | 4651 |
| 422 | Ga0111539_10152541 | 3300009094 | Unclassified | 2704 |
| 423 | Ga0111539_10216291 | 3300009094 | Bacteria | 2232 |
| 424 | Ga0111539_10220946 | 3300009094 | Bacteria | 2206 |
| 425 | Ga0111539_10344915 | 3300009094 | Bacteria | 1733 |
| 426 | Ga0111539_10417412 | 3300009094 | Unclassified | 1563 |
| 427 | Ga0111539_10869197 | 3300009094 | Unclassified | 1049 |
| 428 | Ga0111539_10923527 | 3300009094 | Unclassified | 1015 |
| 429 | Ga0105245_10115143 | 3300009098 | Bacteria | 2505 |
| 430 | Ga0105245_10909943 | 3300009098 | Unclassified | 922 |
| 431 | Ga0114129_10000288 | 3300009147 | Bacteria | 58119 |
| 432 | Ga0114129_10003329 | 3300009147 | Bacteria | 22583 |
| 433 | Ga0114129_10006935 | 3300009147 | Bacteria | 16117 |
| 434 | Ga0114129_10014822 | 3300009147 | Bacteria | 11109 |
| 435 | Ga0114129_10018044 | 3300009147 | Bacteria | 10051 |
| 436 | Ga0114129_10038503 | 3300009147 | Bacteria | 6744 |
| 437 | Ga0114129_10056807 | 3300009147 | Bacteria | 5480 |
| 438 | Ga0114129_10082261 | 3300009147 | Unclassified | 4474 |
| 439 | Ga0114129_10104445 | 3300009147 | Bacteria | 3915 |
| 440 | Ga0114129_10175991 | 3300009147 | Bacteria | 2914 |
| 441 | Ga0114129_10287740 | 3300009147 | Bacteria | 2194 |
| 442 | Ga0114129_10570195 | 3300009147 | Unclassified | 1470 |
| 443 | Ga0114129_11009442 | 3300009147 | Unclassified | 1047 |
| 444 | Ga0114129_11074977 | 3300009147 | Bacteria | 1009 |
| 445 | Ga0105243_10167484 | 3300009148 | Bacteria | 1900 |
| 446 | Ga0105243_10508626 | 3300009148 | Bacteria | 1143 |
| 447 | Ga0105243_10527205 | 3300009148 | Unclassified | 1124 |
| 448 | Ga0105243_10682958 | 3300009148 | Bacteria | 999 |
| 449 | Ga0105243_10825424 | 3300009148 | Unclassified | 916 |
| 450 | Ga0105241_10089643 | 3300009174 | Bacteria | 2423 |
| 451 | Ga0105241_10155896 | 3300009174 | Bacteria | 1873 |
| 452 | Ga0105242_10707872 | 3300009176 | Bacteria | 986 |
| 453 | Ga0105242_10842426 | 3300009176 | Bacteria | 912 |
| 454 | Ga0105248_10005969 | 3300009177 | Bacteria | 13374 |
| 455 | Ga0105248_10065657 | 3300009177 | Bacteria | 4074 |
| 456 | Ga0105248_10085016 | 3300009177 | Unclassified | 3560 |
| 457 | Ga0105248_10139228 | 3300009177 | Bacteria | 2737 |
| 458 | Ga0105248_10169117 | 3300009177 | Bacteria | 2464 |
| 459 | Ga0105248_10237407 | 3300009177 | Bacteria | 2052 |
| 460 | Ga0105248_10261164 | 3300009177 | Bacteria | 1949 |
| 461 | Ga0105248_10402174 | 3300009177 | Unclassified | 1542 |
| 462 | Ga0105248_11987740 | 3300009177 | Unclassified | 660 |
| 463 | Ga0105237_10995334 | 3300009545 | Unclassified | 845 |
| 464 | Ga0105237_11064841 | 3300009545 | Unclassified | 815 |
| 465 | Ga0105238_10010201 | 3300009551 | Bacteria | 9418 |
| 466 | Ga0105238_10539884 | 3300009551 | Bacteria | 1170 |
| 467 | Ga0105238_10983504 | 3300009551 | Bacteria | 864 |
| 468 | Ga0105249_10010772 | 3300009553 | Bacteria | 8035 |
| 469 | Ga0105249_10013057 | 3300009553 | Bacteria | 7332 |
| 470 | Ga0105249_10664919 | 3300009553 | Unclassified | 1100 |
| 471 | Ga0105249_10820293 | 3300009553 | Bacteria | 995 |
| 472 | Ga0105239_10341302 | 3300010375 | Bacteria | 1690 |
| 473 | Ga0105246_10129190 | 3300011119 | Unclassified | 1884 |
| 474 | Ga0105246_10283744 | 3300011119 | Bacteria | 1330 |
| 475 | Ga0105246_10315946 | 3300011119 | Bacteria | 1267 |
| 476 | Ga0157371_10497322 | 3300013102 | Bacteria | 900 |
| 477 | Ga0157370_10224044 | 3300013104 | Bacteria | 1741 |
| 478 | Ga0157378_10097042 | 3300013297 | Bacteria | 2686 |
| 479 | Ga0157378_10357244 | 3300013297 | Bacteria | 1429 |
| 480 | Ga0157378_10433250 | 3300013297 | Unclassified | 1302 |
| 481 | Ga0157378_11550882 | 3300013297 | Unclassified | 708 |
| 482 | Ga0163162_10217804 | 3300013306 | Unclassified | 2039 |
| 483 | Ga0163162_10763437 | 3300013306 | Unclassified | 1086 |
| 484 | Ga0163162_11784851 | 3300013306 | Bacteria | 703 |
| 485 | Ga0157372_10318584 | 3300013307 | Bacteria | 1810 |
| 486 | Ga0157375_10004150 | 3300013308 | Bacteria | 12571 |
| 487 | Ga0157375_10078790 | 3300013308 | Bacteria | 3329 |
| 488 | Ga0157375_10199439 | 3300013308 | Unclassified | 2156 |
| 489 | Ga0157375_10224181 | 3300013308 | Unclassified | 2039 |
| 490 | Ga0157375_10230113 | 3300013308 | Bacteria | 2013 |
| 491 | Ga0157375_10367272 | 3300013308 | Bacteria | 1605 |
| 492 | Ga0157375_10447432 | 3300013308 | Bacteria | 1457 |
| 493 | Ga0163163_10179074 | 3300014325 | Unclassified | 2167 |
| 494 | Ga0163163_10459499 | 3300014325 | Bacteria | 1333 |
| 495 | Ga0163163_10667924 | 3300014325 | Unclassified | 1103 |
| 496 | Ga0157380_10013835 | 3300014326 | Bacteria | 5893 |
| 497 | Ga0157380_10065298 | 3300014326 | Bacteria | 2925 |
| 498 | Ga0157380_10071511 | 3300014326 | Unclassified | 2806 |
| 499 | Ga0157380_10081265 | 3300014326 | Bacteria | 2650 |
| 500 | Ga0157380_10098599 | 3300014326 | Bacteria | 2428 |
| 501 | Ga0157380_10102056 | 3300014326 | Bacteria | 2391 |
| 502 | Ga0157380_10131019 | 3300014326 | Bacteria | 2139 |
| 503 | Ga0157380_10252226 | 3300014326 | Unclassified | 1598 |
| 504 | Ga0157380_10765007 | 3300014326 | Bacteria | 979 |
| 505 | Ga0157380_10865457 | 3300014326 | Bacteria | 927 |
| 506 | Ga0157377_10041418 | 3300014745 | Bacteria | 2555 |
| 507 | Ga0157379_10158326 | 3300014968 | Bacteria | 2044 |
| 508 | Ga0157376_10334236 | 3300014969 | Bacteria | 1444 |
| 509 | Ga0157376_10341120 | 3300014969 | Bacteria | 1431 |
| 510 | Ga0163161_10652912 | 3300017792 | Unclassified | 872 |
| 511 | Ga0206355_1013067 | 3300020076 | Bacteria | 704 |
| 512 | Ga0224712_10168246 | 3300022467 | Bacteria | 982 |
| 513 | Ga0207697_10239645 | 3300025315 | Unclassified | 802 |
| 514 | Ga0207656_10021939 | 3300025321 | Bacteria | 2557 |
| 515 | Ga0207682_10016422 | 3300025893 | Bacteria | 2887 |
| 516 | Ga0207682_10176731 | 3300025893 | Bacteria | 974 |
| 517 | Ga0207642_10203027 | 3300025899 | Unclassified | 1096 |
| 518 | Ga0207642_10206903 | 3300025899 | Bacteria | 1088 |
| 519 | Ga0207688_10018923 | 3300025901 | Bacteria | 3746 |
| 520 | Ga0207688_10059098 | 3300025901 | Bacteria | 2158 |
| 521 | Ga0207680_10001435 | 3300025903 | Bacteria | 11296 |
| 522 | Ga0207680_10035519 | 3300025903 | Bacteria | 2863 |
| 523 | Ga0207680_10310195 | 3300025903 | Bacteria | 1101 |
| 524 | Ga0207647_10082067 | 3300025904 | Bacteria | 1931 |
| 525 | Ga0207699_10184663 | 3300025906 | Unclassified | 1404 |
| 526 | Ga0207645_10004594 | 3300025907 | Bacteria | 10180 |
| 527 | Ga0207645_10035378 | 3300025907 | Bacteria | 3207 |
| 528 | Ga0207645_10053447 | 3300025907 | Bacteria | 2581 |
| 529 | Ga0207645_10248825 | 3300025907 | Bacteria | 1176 |
| 530 | Ga0207643_10024553 | 3300025908 | Bacteria | 3326 |
| 531 | Ga0207643_10108802 | 3300025908 | Bacteria | 1631 |
| 532 | Ga0207643_10110034 | 3300025908 | Bacteria | 1623 |
| 533 | Ga0207643_10281611 | 3300025908 | Bacteria | 1031 |
| 534 | Ga0207705_10343111 | 3300025909 | Bacteria | 1150 |
| 535 | Ga0207684_10310836 | 3300025910 | Unclassified | 1359 |
| 536 | Ga0207684_10456304 | 3300025910 | Bacteria | 1097 |
| 537 | Ga0207707_10069378 | 3300025912 | Bacteria | 3072 |
| 538 | Ga0207707_10163778 | 3300025912 | Bacteria | 1943 |
| 539 | Ga0207707_10452630 | 3300025912 | Bacteria | 1098 |
| 540 | Ga0207707_10613297 | 3300025912 | Unclassified | 920 |
| 541 | Ga0207663_10405827 | 3300025916 | Bacteria | 1043 |
| 542 | Ga0207660_10150917 | 3300025917 | Unclassified | 1785 |
| 543 | Ga0207660_10450979 | 3300025917 | Bacteria | 1040 |
| 544 | Ga0207660_10466041 | 3300025917 | Bacteria | 1023 |
| 545 | Ga0207662_10005423 | 3300025918 | Bacteria | 6802 |
| 546 | Ga0207662_10025147 | 3300025918 | Bacteria | 3428 |
| 547 | Ga0207662_10034667 | 3300025918 | Bacteria | 2945 |
| 548 | Ga0207662_10051510 | 3300025918 | Bacteria | 2449 |
| 549 | Ga0207662_10103048 | 3300025918 | Bacteria | 1770 |
| 550 | Ga0207657_10022547 | 3300025919 | Bacteria | 5887 |
| 551 | Ga0207649_10203821 | 3300025920 | Bacteria | 1399 |
| 552 | Ga0207649_10598373 | 3300025920 | Bacteria | 848 |
| 553 | Ga0207649_10802681 | 3300025920 | Unclassified | 735 |
| 554 | Ga0207649_10868122 | 3300025920 | Unclassified | 706 |
| 555 | Ga0207652_10367831 | 3300025921 | Bacteria | 1298 |
| 556 | Ga0207652_10497063 | 3300025921 | Bacteria | 1098 |
| 557 | Ga0207652_10894023 | 3300025921 | Unclassified | 785 |
| 558 | Ga0207646_10115578 | 3300025922 | Bacteria | 2410 |
| 559 | Ga0207646_10561833 | 3300025922 | Bacteria | 1025 |
| 560 | Ga0207646_10603016 | 3300025922 | Bacteria | 986 |
| 561 | Ga0207646_10834707 | 3300025922 | Bacteria | 820 |
| 562 | Ga0207681_10008707 | 3300025923 | Bacteria | 6198 |
| 563 | Ga0207681_10013330 | 3300025923 | Bacteria | 5085 |
| 564 | Ga0207681_10024192 | 3300025923 | Bacteria | 3896 |
| 565 | Ga0207681_10081865 | 3300025923 | Bacteria | 2280 |
| 566 | Ga0207681_10086195 | 3300025923 | Bacteria | 2231 |
| 567 | Ga0207681_10426432 | 3300025923 | Bacteria | 1075 |
| 568 | Ga0207694_10039824 | 3300025924 | Bacteria | 3617 |
| 569 | Ga0207650_10017449 | 3300025925 | Bacteria | 5027 |
| 570 | Ga0207650_10032475 | 3300025925 | Bacteria | 3776 |
| 571 | Ga0207650_10033559 | 3300025925 | Bacteria | 3718 |
| 572 | Ga0207650_10158277 | 3300025925 | Unclassified | 1793 |
| 573 | Ga0207650_10246634 | 3300025925 | Unclassified | 1445 |
| 574 | Ga0207650_10380515 | 3300025925 | Bacteria | 1165 |
| 575 | Ga0207650_10508961 | 3300025925 | Unclassified | 1007 |
| 576 | Ga0207650_10566226 | 3300025925 | Bacteria | 953 |
| 577 | Ga0207659_10007390 | 3300025926 | Bacteria | 6753 |
| 578 | Ga0207659_10008018 | 3300025926 | Bacteria | 6534 |
| 579 | Ga0207659_10010018 | 3300025926 | Bacteria | 5937 |
| 580 | Ga0207659_10021094 | 3300025926 | Bacteria | 4317 |
| 581 | Ga0207659_10027258 | 3300025926 | Bacteria | 3866 |
| 582 | Ga0207659_10030245 | 3300025926 | Bacteria | 3698 |
| 583 | Ga0207659_10032184 | 3300025926 | Bacteria | 3597 |
| 584 | Ga0207659_10043333 | 3300025926 | Bacteria | 3160 |
| 585 | Ga0207659_10160998 | 3300025926 | Unclassified | 1762 |
| 586 | Ga0207659_10220799 | 3300025926 | Bacteria | 1524 |
| 587 | Ga0207659_10221507 | 3300025926 | Unclassified | 1521 |
| 588 | Ga0207659_10690721 | 3300025926 | Unclassified | 874 |
| 589 | Ga0207659_10959977 | 3300025926 | Bacteria | 735 |
| 590 | Ga0207687_10278807 | 3300025927 | Bacteria | 1339 |
| 591 | Ga0207700_10025586 | 3300025928 | Bacteria | 4101 |
| 592 | Ga0207700_10096832 | 3300025928 | Unclassified | 2344 |
| 593 | Ga0207664_10083847 | 3300025929 | Unclassified | 2598 |
| 594 | Ga0207644_10014892 | 3300025931 | Bacteria | 5213 |
| 595 | Ga0207644_10046017 | 3300025931 | Bacteria | 3106 |
| 596 | Ga0207644_10051648 | 3300025931 | Bacteria | 2952 |
| 597 | Ga0207644_10126158 | 3300025931 | Bacteria | 1954 |
| 598 | Ga0207644_10164826 | 3300025931 | Unclassified | 1726 |
| 599 | Ga0207644_10469373 | 3300025931 | Bacteria | 1035 |
| 600 | Ga0207690_10034638 | 3300025932 | Bacteria | 3255 |
| 601 | Ga0207690_10530889 | 3300025932 | Unclassified | 955 |
| 602 | Ga0207690_10592061 | 3300025932 | Unclassified | 905 |
| 603 | Ga0207690_10732140 | 3300025932 | Bacteria | 814 |
| 604 | Ga0207706_10020541 | 3300025933 | Bacteria | 5936 |
| 605 | Ga0207706_10057235 | 3300025933 | Bacteria | 3435 |
| 606 | Ga0207706_10069771 | 3300025933 | Bacteria | 3091 |
| 607 | Ga0207706_10147617 | 3300025933 | Bacteria | 2069 |
| 608 | Ga0207706_10287584 | 3300025933 | Unclassified | 1433 |
| 609 | Ga0207706_10431208 | 3300025933 | Bacteria | 1142 |
| 610 | Ga0207706_10543769 | 3300025933 | Unclassified | 1000 |
| 611 | Ga0207686_10004823 | 3300025934 | Bacteria | 7247 |
| 612 | Ga0207686_10010168 | 3300025934 | Bacteria | 5116 |
| 613 | Ga0207709_10043457 | 3300025935 | Bacteria | 2709 |
| 614 | Ga0207670_10007315 | 3300025936 | Bacteria | 6151 |
| 615 | Ga0207670_10033380 | 3300025936 | Bacteria | 3316 |
| 616 | Ga0207670_10129052 | 3300025936 | Bacteria | 1849 |
| 617 | Ga0207670_10130889 | 3300025936 | Unclassified | 1838 |
| 618 | Ga0207670_10526464 | 3300025936 | Unclassified | 963 |
| 619 | Ga0207669_10003629 | 3300025937 | Bacteria | 6696 |
| 620 | Ga0207669_10353452 | 3300025937 | Bacteria | 1136 |
| 621 | Ga0207704_10004553 | 3300025938 | Bacteria | 6344 |
| 622 | Ga0207704_10244239 | 3300025938 | Unclassified | 1343 |
| 623 | Ga0207704_10306567 | 3300025938 | Bacteria | 1219 |
| 624 | Ga0207704_10554767 | 3300025938 | Bacteria | 934 |
| 625 | Ga0207691_10005081 | 3300025940 | Bacteria | 12699 |
| 626 | Ga0207691_10020402 | 3300025940 | Bacteria | 6264 |
| 627 | Ga0207691_10033960 | 3300025940 | Bacteria | 4748 |
| 628 | Ga0207691_10125117 | 3300025940 | Bacteria | 2275 |
| 629 | Ga0207691_10159481 | 3300025940 | Unclassified | 1980 |
| 630 | Ga0207691_10170934 | 3300025940 | Bacteria | 1903 |
| 631 | Ga0207691_10346129 | 3300025940 | Bacteria | 1272 |
| 632 | Ga0207711_10076375 | 3300025941 | Bacteria | 2917 |
| 633 | Ga0207711_10098006 | 3300025941 | Bacteria | 2590 |
| 634 | Ga0207711_10162148 | 3300025941 | Bacteria | 2025 |
| 635 | Ga0207711_10247638 | 3300025941 | Bacteria | 1635 |
| 636 | Ga0207711_10288454 | 3300025941 | Bacteria | 1512 |
| 637 | Ga0207711_10405477 | 3300025941 | Bacteria | 1267 |
| 638 | Ga0207711_10571281 | 3300025941 | Bacteria | 1055 |
| 639 | Ga0207689_10000703 | 3300025942 | Bacteria | 32051 |
| 640 | Ga0207689_10049219 | 3300025942 | Bacteria | 3477 |
| 641 | Ga0207689_10166670 | 3300025942 | Unclassified | 1815 |
| 642 | Ga0207689_10525250 | 3300025942 | Bacteria | 993 |
| 643 | Ga0207689_10582927 | 3300025942 | Bacteria | 940 |
| 644 | Ga0207661_10021298 | 3300025944 | Bacteria | 4855 |
| 645 | Ga0207661_10088211 | 3300025944 | Bacteria | 2578 |
| 646 | Ga0207679_10019097 | 3300025945 | Bacteria | 4600 |
| 647 | Ga0207679_10027486 | 3300025945 | Unclassified | 3935 |
| 648 | Ga0207679_10038385 | 3300025945 | Bacteria | 3411 |
| 649 | Ga0207679_10065549 | 3300025945 | Bacteria | 2718 |
| 650 | Ga0207679_10330254 | 3300025945 | Bacteria | 1323 |
| 651 | Ga0207679_10372359 | 3300025945 | Bacteria | 1250 |
| 652 | Ga0207679_10697914 | 3300025945 | Bacteria | 921 |
| 653 | Ga0207679_10741519 | 3300025945 | Unclassified | 893 |
| 654 | Ga0207667_10645896 | 3300025949 | Bacteria | 1064 |
| 655 | Ga0207651_10001279 | 3300025960 | Bacteria | 11318 |
| 656 | Ga0207651_10004812 | 3300025960 | Bacteria | 6871 |
| 657 | Ga0207651_10006276 | 3300025960 | Bacteria | 6200 |
| 658 | Ga0207651_10010393 | 3300025960 | Bacteria | 5158 |
| 659 | Ga0207651_10107666 | 3300025960 | Bacteria | 2084 |
| 660 | Ga0207651_10146281 | 3300025960 | Bacteria | 1833 |
| 661 | Ga0207651_10295301 | 3300025960 | Bacteria | 1345 |
| 662 | Ga0207712_10158070 | 3300025961 | Bacteria | 1758 |
| 663 | Ga0207712_10165955 | 3300025961 | Bacteria | 1721 |
| 664 | Ga0207668_10716859 | 3300025972 | Unclassified | 880 |
| 665 | Ga0207640_10068820 | 3300025981 | Bacteria | 2374 |
| 666 | Ga0207658_10986458 | 3300025986 | Unclassified | 768 |
| 667 | Ga0207677_10396486 | 3300026023 | Bacteria | 1169 |
| 668 | Ga0207677_10670379 | 3300026023 | Unclassified | 917 |
| 669 | Ga0207703_10008901 | 3300026035 | Bacteria | 7907 |
| 670 | Ga0207703_10014124 | 3300026035 | Bacteria | 6226 |
| 671 | Ga0207703_10399331 | 3300026035 | Bacteria | 1275 |
| 672 | Ga0207639_10179525 | 3300026041 | Unclassified | 1800 |
| 673 | Ga0207639_10423946 | 3300026041 | Bacteria | 1203 |
| 674 | Ga0207639_10527391 | 3300026041 | Bacteria | 1082 |
| 675 | Ga0207639_10600752 | 3300026041 | Bacteria | 1015 |
| 676 | Ga0207678_10011333 | 3300026067 | Bacteria | 7824 |
| 677 | Ga0207678_10200574 | 3300026067 | Bacteria | 1706 |
| 678 | Ga0207678_10412680 | 3300026067 | Bacteria | 1170 |
| 679 | Ga0207678_10595176 | 3300026067 | Bacteria | 969 |
| 680 | Ga0207708_10010094 | 3300026075 | Bacteria | 7009 |
| 681 | Ga0207708_10022919 | 3300026075 | Bacteria | 4716 |
| 682 | Ga0207708_10041433 | 3300026075 | Bacteria | 3511 |
| 683 | Ga0207708_10086907 | 3300026075 | Bacteria | 2407 |
| 684 | Ga0207708_10122803 | 3300026075 | Bacteria | 2024 |
| 685 | Ga0207708_10437763 | 3300026075 | Bacteria | 1087 |
| 686 | Ga0207641_10040685 | 3300026088 | Bacteria | 3893 |
| 687 | Ga0207641_10104928 | 3300026088 | Bacteria | 2496 |
| 688 | Ga0207641_10121883 | 3300026088 | Bacteria | 2328 |
| 689 | Ga0207641_10192305 | 3300026088 | Bacteria | 1876 |
| 690 | Ga0207641_10771710 | 3300026088 | Unclassified | 950 |
| 691 | Ga0207648_10000673 | 3300026089 | Bacteria | 38331 |
| 692 | Ga0207648_10006552 | 3300026089 | Bacteria | 11562 |
| 693 | Ga0207648_10009477 | 3300026089 | Bacteria | 9322 |
| 694 | Ga0207648_10040716 | 3300026089 | Bacteria | 4082 |
| 695 | Ga0207648_10198396 | 3300026089 | Bacteria | 1780 |
| 696 | Ga0207648_10791783 | 3300026089 | Unclassified | 882 |
| 697 | Ga0207676_10008591 | 3300026095 | Bacteria | 7257 |
| 698 | Ga0207676_10050636 | 3300026095 | Bacteria | 3239 |
| 699 | Ga0207676_10166369 | 3300026095 | Bacteria | 1916 |
| 700 | Ga0207676_10228133 | 3300026095 | Bacteria | 1663 |
| 701 | Ga0207676_10246540 | 3300026095 | Bacteria | 1606 |
| 702 | Ga0207676_10403074 | 3300026095 | Archaea | 1279 |
| 703 | Ga0207676_10456966 | 3300026095 | Unclassified | 1205 |
| 704 | Ga0207674_10048609 | 3300026116 | Bacteria | 4341 |
| 705 | Ga0207674_10052104 | 3300026116 | Bacteria | 4174 |
| 706 | Ga0207674_10068694 | 3300026116 | Unclassified | 3565 |
| 707 | Ga0207674_10190844 | 3300026116 | Unclassified | 1999 |
| 708 | Ga0207674_10371793 | 3300026116 | Bacteria | 1382 |
| 709 | Ga0207675_100002515 | 3300026118 | Bacteria | 18147 |
| 710 | Ga0207675_100029915 | 3300026118 | Bacteria | 5070 |
| 711 | Ga0207675_100148576 | 3300026118 | Bacteria | 2229 |
| 712 | Ga0207675_100254044 | 3300026118 | Bacteria | 1702 |
| 713 | Ga0207675_100297635 | 3300026118 | Bacteria | 1571 |
| 714 | Ga0207675_101047576 | 3300026118 | Unclassified | 835 |
| 715 | Ga0207683_10113736 | 3300026121 | Unclassified | 2424 |
| 716 | Ga0207683_10119695 | 3300026121 | Bacteria | 2363 |
| 717 | Ga0207683_10184931 | 3300026121 | Bacteria | 1890 |
| 718 | Ga0207683_10196526 | 3300026121 | Bacteria | 1833 |
| 719 | Ga0207683_10256887 | 3300026121 | Bacteria | 1595 |
| 720 | Ga0207683_10580280 | 3300026121 | Bacteria | 1037 |
| 721 | Ga0207683_11001144 | 3300026121 | Bacteria | 776 |
| 722 | Ga0207698_10053233 | 3300026142 | Bacteria | 3105 |
| 723 | Ga0207698_10240694 | 3300026142 | Bacteria | 1649 |
| 724 | Ga0207698_10310365 | 3300026142 | Bacteria | 1472 |
| 725 | Ga0207698_10865600 | 3300026142 | Unclassified | 909 |
| 726 | Ga0207698_11177714 | 3300026142 | Bacteria | 780 |
| 727 | Ga0209996_1011026 | 3300027395 | Unclassified | 1204 |
| 728 | Ga0210002_1021058 | 3300027617 | Unclassified | 1052 |
| 729 | Ga0209966_1060347 | 3300027695 | Unclassified | 819 |
| 730 | Ga0209998_10034810 | 3300027717 | Bacteria | 1127 |
| 731 | Ga0209998_10079742 | 3300027717 | Unclassified | 792 |
| 732 | Ga0209813_10023277 | 3300027866 | Unclassified | 1760 |
| 733 | Ga0209813_10074658 | 3300027866 | Unclassified | 1109 |
| 734 | Ga0209974_10018907 | 3300027876 | Bacteria | 2285 |
| 735 | Ga0209974_10057826 | 3300027876 | Unclassified | 1310 |
| 736 | Ga0209974_10075493 | 3300027876 | Bacteria | 1154 |
| 737 | Ga0207428_10000349 | 3300027907 | Bacteria | 59671 |
| 738 | Ga0207428_10003450 | 3300027907 | Bacteria | 15351 |
| 739 | Ga0207428_10005208 | 3300027907 | Bacteria | 12158 |
| 740 | Ga0207428_10005628 | 3300027907 | Bacteria | 11654 |
| 741 | Ga0207428_10012698 | 3300027907 | Bacteria | 7386 |
| 742 | Ga0207428_10035075 | 3300027907 | Unclassified | 4104 |
| 743 | Ga0207428_10036649 | 3300027907 | Bacteria | 3999 |
| 744 | Ga0207428_10041523 | 3300027907 | Bacteria | 3723 |
| 745 | Ga0207428_10152118 | 3300027907 | Bacteria | 1761 |
| 746 | Ga0207428_10525104 | 3300027907 | Unclassified | 858 |
| 747 | Ga0207428_10634701 | 3300027907 | Unclassified | 767 |
| 748 | Ga0268266_10113043 | 3300028379 | Bacteria | 2408 |
| 749 | Ga0268266_10493739 | 3300028379 | Bacteria | 1168 |
| 750 | Ga0268266_10555242 | 3300028379 | Bacteria | 1101 |
| 751 | Ga0268266_10578787 | 3300028379 | Bacteria | 1077 |
| 752 | Ga0268265_10000519 | 3300028380 | Bacteria | 39355 |
| 753 | Ga0268265_10203017 | 3300028380 | Bacteria | 1721 |
| 754 | Ga0268265_10548784 | 3300028380 | Bacteria | 1097 |
| 755 | Ga0268265_10628947 | 3300028380 | Unclassified | 1029 |
| 756 | Ga0268265_10721010 | 3300028380 | Bacteria | 965 |
| 757 | Ga0268265_10975935 | 3300028380 | Bacteria | 836 |
| 758 | Ga0268264_10009523 | 3300028381 | Bacteria | 8046 |
| 759 | Ga0268264_10130632 | 3300028381 | Bacteria | 2226 |
| 760 | Ga0268264_10480493 | 3300028381 | Unclassified | 1208 |
| 761 | Ga0268264_10511647 | 3300028381 | Bacteria | 1172 |
| 762 | Ga0307408_100065455 | 3300031548 | Bacteria | 2666 |
| 763 | Ga0307408_100089360 | 3300031548 | Bacteria | 2322 |
| 764 | Ga0307408_100135496 | 3300031548 | Unclassified | 1926 |
| 765 | Ga0307408_100249158 | 3300031548 | Bacteria | 1464 |
| 766 | Ga0307408_100251643 | 3300031548 | Bacteria | 1457 |
| 767 | Ga0307408_100630042 | 3300031548 | Unclassified | 956 |
| 768 | Ga0307405_10008615 | 3300031731 | Bacteria | 5182 |
| 769 | Ga0307405_10177467 | 3300031731 | Bacteria | 1526 |
| 770 | Ga0307405_10201069 | 3300031731 | Bacteria | 1447 |
| 771 | Ga0307405_10622377 | 3300031731 | Unclassified | 884 |
| 772 | Ga0307413_10016358 | 3300031824 | Bacteria | 3829 |
| 773 | Ga0307413_10036097 | 3300031824 | Unclassified | 2843 |
| 774 | Ga0307410_10000911 | 3300031852 | Bacteria | 12606 |
| 775 | Ga0307410_10308312 | 3300031852 | Bacteria | 1252 |
| 776 | Ga0307406_10012013 | 3300031901 | Bacteria | 4926 |
| 777 | Ga0307406_10083708 | 3300031901 | Unclassified | 2128 |
| 778 | Ga0307406_10647963 | 3300031901 | Unclassified | 876 |
| 779 | Ga0307407_10000944 | 3300031903 | Bacteria | 9869 |
| 780 | Ga0307407_10083882 | 3300031903 | Bacteria | 1934 |
| 781 | Ga0307407_10261282 | 3300031903 | Unclassified | 1191 |
| 782 | Ga0307407_10483966 | 3300031903 | Bacteria | 904 |
| 783 | Ga0307412_10024414 | 3300031911 | Bacteria | 3731 |
| 784 | Ga0307412_10036410 | 3300031911 | Bacteria | 3152 |
| 785 | Ga0307412_10039142 | 3300031911 | Unclassified | 3059 |
| 786 | Ga0307412_10509178 | 3300031911 | Bacteria | 1004 |
| 787 | Ga0307412_11071986 | 3300031911 | Bacteria | 715 |
| 788 | Ga0307409_100050628 | 3300031995 | Bacteria | 3173 |
| 789 | Ga0307409_100082465 | 3300031995 | Bacteria | 2603 |
| 790 | Ga0307409_100108686 | 3300031995 | Bacteria | 2320 |
| 791 | Ga0307409_101286785 | 3300031995 | Unclassified | 756 |
| 792 | Ga0307416_100014150 | 3300032002 | Bacteria | 5453 |
| 793 | Ga0307416_100026266 | 3300032002 | Unclassified | 4288 |
| 794 | Ga0307416_100044303 | 3300032002 | Bacteria | 3492 |
| 795 | Ga0307416_100168429 | 3300032002 | Bacteria | 2036 |
| 796 | Ga0307416_100250736 | 3300032002 | Bacteria | 1723 |
| 797 | Ga0307416_100905517 | 3300032002 | Bacteria | 982 |
| 798 | Ga0307414_10002043 | 3300032004 | Bacteria | 10485 |
| 799 | Ga0307414_10402545 | 3300032004 | Unclassified | 1189 |
| 800 | Ga0307411_10006132 | 3300032005 | Bacteria | 5979 |
| 801 | Ga0307411_10134026 | 3300032005 | Bacteria | 1815 |
| 802 | Ga0307411_10149847 | 3300032005 | Bacteria | 1732 |
| 803 | Ga0307411_10162091 | 3300032005 | Bacteria | 1676 |
| 804 | Ga0307411_10254308 | 3300032005 | Bacteria | 1383 |
| 805 | Ga0307411_11092553 | 3300032005 | Unclassified | 718 |
| 806 | Ga0307415_100002052 | 3300032126 | Bacteria | 9951 |
| 807 | Ga0307415_100027267 | 3300032126 | Bacteria | 3617 |
| 808 | Ga0307415_100630628 | 3300032126 | Unclassified | 958 |
| 809 | Ga0307415_100735539 | 3300032126 | Unclassified | 894 |
| 810 | Ga0373930_0000356 | 3300034816 | Bacteria | 5972 |
| 811 | Ga0373950_0001243 | 3300034818 | Bacteria | 3293 |
| 812 | Ga0373958_0006007 | 3300034819 | Unclassified | 1872 |
| 813 | Ga0373959_0002318 | 3300034820 | Bacteria | 3028 |
| 814 | Ga0373938_0000948 | 3300034957 | Bacteria | 4651 |
| 815 | Ga0373926_0048702 | 3300035083 | Unclassified | 1525 |
| 816 | Ga0373929_0000732 | 3300035085 | Bacteria | 6351 |
| 817 | Ga0373940_0002332 | 3300035088 | Bacteria | 3671 |
| 818 | Ga0373949_0002529 | 3300035090 | Bacteria | 4657 |
| 819 | Ga0373949_0114111 | 3300035090 | Bacteria | 752 |
| 820 | Ga0373951_0004765 | 3300035091 | Unclassified | 3199 |
| 821 | Ga0373951_0037584 | 3300035091 | Bacteria | 1158 |
| 822 | Ga0373952_0002090 | 3300035092 | Unclassified | 3592 |
| 823 | Ga0373932_0000253 | 3300035112 | Bacteria | 16336 |
| 824 | Ga0373939_0000222 | 3300035114 | Bacteria | 15549 |
| 825 | Ga0373939_0024504 | 3300035114 | Bacteria | 1682 |
| 826 | Ga0373941_0002599 | 3300035115 | Bacteria | 4001 |
| 827 | Ga0373954_0295236 | 3300035118 | Unclassified | 799 |
| 828 | Ga0373957_0097233 | 3300035120 | Unclassified | 1176 |
| 829 | Ga0373960_0000140 | 3300035121 | Bacteria | 12051 |
| 830 | Ga0373955_0076672 | 3300035172 | Bacteria | 1881 |
| 831 | Ga0373942_0001204 | 3300035207 | Bacteria | 6823 |
| 832 | Ga0373961_0003469 | 3300035241 | Bacteria | 3903 |
| 833 | Ga0373961_0112391 | 3300035241 | Bacteria | 894 |
| 834 | Ga0373961_0274970 | 3300035241 | Unclassified | 616 |
| 835 | Ga0373962_0004435 | 3300035242 | Bacteria | 3390 |
| 836 | Ga0373924_0068173 | 3300035410 | Unclassified | 1497 |
| 837 | Ga0373931_0000392 | 3300035691 | Bacteria | 17983 |
| 838 | Ga0373931_0084131 | 3300035691 | Bacteria | 1761 |
| 839 | Ga0373935_0089099 | 3300035692 | Bacteria | 2017 |
| 840 | Ga0373935_0091430 | 3300035692 | Unclassified | 1993 |
| 841 | Ga0373947_0088555 | 3300035725 | Bacteria | 1927 |
| 842 | Ga0373937_0008316 | 3300036401 | Bacteria | 9010 |
| 843 | Ga0373937_0382666 | 3300036401 | Bacteria | 1334 |
| 844 | Ga0373937_1332252 | 3300036401 | Bacteria | 666 |
| 845 | Ga0373925_0349694 | 3300037068 | Unclassified | 1200 |
| 846 | Ga0436365_0576031 | 3300039437 | Unclassified | 2283 |
| 847 | Ga0439439_0011548 | 3300041406 | Bacteria | 2127 |
| 848 | Ga0451853_1505645 | 3300041512 | Unclassified | 928 |
| 849 | Ga0439431_0066619 | 3300041997 | Bacteria | 954 |
| 850 | Ga0439433_0081151 | 3300041999 | Unclassified | 789 |
| 851 | Ga0439441_008890 | 3300042001 | Bacteria | 1651 |
| 852 | Ga0439441_035430 | 3300042001 | Unclassified | 984 |
| 853 | Ga0439445_0100429 | 3300042004 | Unclassified | 820 |
| 854 | Ga0439450_101993 | 3300042008 | Bacteria | 728 |
| 855 | Ga0439462_0042177 | 3300042015 | Bacteria | 1219 |
| 856 | Ga0450919_009265 | 3300042121 | Bacteria | 1132 |
| 857 | Ga0450897_011728 | 3300042128 | Bacteria | 858 |
| 858 | Ga0450895_000346 | 3300042132 | Bacteria | 2516 |
| 859 | Ga0450896_000186 | 3300042133 | Bacteria | 5292 |
| 860 | Ga0439446_0019962 | 3300042156 | Bacteria | 1885 |
| 861 | Ga0439446_0060214 | 3300042156 | Bacteria | 1147 |
| 862 | Ga0439446_0094437 | 3300042156 | Bacteria | 939 |
| 863 | Ga0439435_0053751 | 3300042436 | Unclassified | 1159 |
| 864 | Ga0439459_0061707 | 3300042438 | Unclassified | 848 |
| 865 | Ga0439464_0000519 | 3300042439 | Bacteria | 7919 |
| 866 | Ga0439460_0078517 | 3300042461 | Bacteria | 1033 |
| 867 | Ga0451577_0072273 | 3300042876 | Bacteria | 3077 |
| 868 | Ga0453683_0196183 | 3300044673 | Unclassified | 1282 |
| 869 | Ga0453684_0162310 | 3300044712 | Bacteria | 2642 |
| 870 | Ga0453684_1277048 | 3300044712 | Archaea | 767 |
| 871 | Ga0466960_0291055 | 3300044901 | Bacteria | 918 |
| 872 | Ga0451576_0013723 | 3300045051 | Bacteria | 9049 |
| 873 | Ga0451576_0020147 | 3300045051 | Bacteria | 7267 |
| 874 | Ga0451576_0046638 | 3300045051 | Bacteria | 4562 |
| 875 | Ga0451576_0103613 | 3300045051 | Unclassified | 2960 |
| 876 | Ga0451576_0228494 | 3300045051 | Bacteria | 1943 |
| 877 | Ga0451576_0381993 | 3300045051 | Bacteria | 1476 |
| 878 | Ga0451576_0659732 | 3300045051 | Unclassified | 1099 |
| 879 | Ga0451576_0985048 | 3300045051 | Unclassified | 884 |
| 880 | Ga0495603_0265018 | 3300046455 | Unclassified | 989 |
| 881 | Ga0495629_0020693 | 3300046459 | Bacteria | 4698 |
| 882 | Ga0495580_0629010 | 3300046472 | Bacteria | 707 |
| 883 | Ga0495582_0224711 | 3300046473 | Unclassified | 1075 |
| 884 | Ga0495664_0257626 | 3300046477 | Bacteria | 1055 |
| 885 | Ga0495584_0140955 | 3300046491 | Unclassified | 1224 |
| 886 | Ga0495594_0020414 | 3300046499 | Bacteria | 3529 |
| 887 | Ga0495607_0383239 | 3300046501 | Bacteria | 643 |
| 888 | Ga0495618_0280578 | 3300046514 | Unclassified | 1039 |
| 889 | Ga0495630_0343216 | 3300046517 | Bacteria | 1143 |
| 890 | Ga0495663_0058397 | 3300046525 | Bacteria | 1209 |
| 891 | Ga0495642_0002056 | 3300046528 | Bacteria | 8363 |
| 892 | Ga0495642_0173897 | 3300046528 | Bacteria | 936 |
| 893 | Ga0495652_0392397 | 3300046529 | Bacteria | 985 |
| 894 | Ga0495665_0211205 | 3300046531 | Unclassified | 1005 |
| 895 | Ga0495598_0007811 | 3300046537 | Bacteria | 2469 |
| 896 | Ga0495598_0085363 | 3300046537 | Bacteria | 1020 |
| 897 | Ga0495609_0130377 | 3300046538 | Bacteria | 1077 |
| 898 | Ga0495609_0140583 | 3300046538 | Unclassified | 1030 |
| 899 | Ga0495609_0184846 | 3300046538 | Bacteria | 876 |
| 900 | Ga0495621_0003258 | 3300046539 | Bacteria | 4462 |
| 901 | Ga0495621_0004461 | 3300046539 | Bacteria | 3937 |
| 902 | Ga0495621_0014298 | 3300046539 | Bacteria | 2509 |
| 903 | Ga0495621_0028280 | 3300046539 | Unclassified | 1905 |
| 904 | Ga0495621_0139691 | 3300046539 | Bacteria | 947 |
| 905 | Ga0495621_0258141 | 3300046539 | Unclassified | 713 |
| 906 | Ga0495645_0283572 | 3300046543 | Unclassified | 1088 |
| 907 | Ga0495633_0113338 | 3300046558 | Bacteria | 1257 |
| 908 | Ga0495656_0054797 | 3300046615 | Bacteria | 1717 |
| 909 | Ga0495656_0103580 | 3300046615 | Unclassified | 1320 |
| 910 | Ga0495656_0113304 | 3300046615 | Bacteria | 1272 |
| 911 | Ga0495635_0473677 | 3300046663 | Unclassified | 826 |
| 912 | Ga0495659_0002800 | 3300046664 | Bacteria | 5604 |
| 913 | Ga0495659_0026521 | 3300046664 | Bacteria | 1992 |
| 914 | Ga0495659_0070287 | 3300046664 | Bacteria | 1310 |
| 915 | Ga0495659_0235494 | 3300046664 | Bacteria | 759 |
| 916 | Ga0495599_0378343 | 3300046678 | Unclassified | 846 |
| 917 | Ga0495647_0032716 | 3300046681 | Unclassified | 1940 |
| 918 | Ga0495647_0129223 | 3300046681 | Bacteria | 1069 |
| 919 | Ga0495647_0158415 | 3300046681 | Unclassified | 974 |
| 920 | Ga0495647_0336446 | 3300046681 | Bacteria | 685 |
| 921 | Ga0495647_0336621 | 3300046681 | Unclassified | 685 |
| 922 | Ga0495658_0119915 | 3300046683 | Bacteria | 1590 |
| 923 | Ga0495658_0206620 | 3300046683 | Bacteria | 1225 |
| 924 | Ga0495669_0010057 | 3300046684 | Bacteria | 3996 |
| 925 | Ga0495669_0215121 | 3300046684 | Unclassified | 920 |
| 926 | Ga0495613_0166310 | 3300046689 | Bacteria | 1567 |
| 927 | Ga0495670_0085003 | 3300046691 | Bacteria | 1615 |
| 928 | Ga0495670_0270113 | 3300046691 | Unclassified | 908 |
| 929 | Ga0495600_0109254 | 3300046809 | Bacteria | 1801 |
| 930 | Ga0495604_0696754 | 3300047317 | Unclassified | 645 |
| 931 | Ga0495636_0003385 | 3300047318 | Bacteria | 6185 |
| 932 | Ga0495636_0158635 | 3300047318 | Unclassified | 1018 |
| 933 | Ga0495636_0345500 | 3300047318 | Bacteria | 702 |
| 934 | Ga0495676_0047401 | 3300047321 | Bacteria | 3475 |
| 935 | Ga0495676_0378791 | 3300047321 | Bacteria | 942 |
| 936 | Ga0495677_0016077 | 3300047445 | Bacteria | 2716 |
| 937 | Ga0495677_0020482 | 3300047445 | Bacteria | 2398 |
| 938 | Ga0495685_125016 | 3300047447 | Unclassified | 843 |
| 939 | Ga0495684_0594769 | 3300047471 | Bacteria | 747 |
| 940 | Ga0496102_0117233 | 3300048905 | Bacteria | 2485 |
| 941 | Ga0496102_0210944 | 3300048905 | Bacteria | 1831 |
| 942 | Ga0496103_0069099 | 3300048906 | Bacteria | 2208 |
| 943 | Ga0496104_0016124 | 3300048907 | Bacteria | 6782 |
| 944 | Ga0496104_1132748 | 3300048907 | Bacteria | 686 |
| 945 | Ga0496105_0137438 | 3300048908 | Bacteria | 2012 |
| 946 | Ga0496105_0734154 | 3300048908 | Bacteria | 755 |
| 947 | Ga0496106_0046891 | 3300048909 | Bacteria | 3250 |
| 948 | Ga0496106_0182397 | 3300048909 | Bacteria | 1667 |
| 949 | Ga0496106_0359321 | 3300048909 | Bacteria | 1170 |
| 950 | Ga0496106_0722048 | 3300048909 | Bacteria | 793 |
| 951 | Ga0496106_0826734 | 3300048909 | Bacteria | 734 |
| 952 | Ga0496107_0114548 | 3300048910 | Unclassified | 1984 |
| 953 | Ga0496107_0396602 | 3300048910 | Bacteria | 1026 |
| 954 | Ga0496108_0023020 | 3300048911 | Bacteria | 5125 |
| 955 | Ga0496109_0001647 | 3300048912 | Bacteria | 18650 |
| 956 | Ga0496109_0014534 | 3300048912 | Bacteria | 6848 |
| 957 | Ga0496109_0066884 | 3300048912 | Bacteria | 3292 |
| 958 | Ga0496110_0096471 | 3300048913 | Bacteria | 2649 |
| 959 | Ga0496111_0108094 | 3300048914 | Bacteria | 2048 |
| 960 | Ga0496112_0030569 | 3300048915 | Bacteria | 5213 |
| 961 | Ga0496112_0114530 | 3300048915 | Bacteria | 2667 |
| 962 | Ga0496112_0238020 | 3300048915 | Unclassified | 1774 |
| 963 | Ga0496113_0570161 | 3300048916 | Bacteria | 907 |
| 964 | Ga0496113_0602831 | 3300048916 | Bacteria | 879 |
| 965 | Ga0496114_0657165 | 3300048917 | Bacteria | 922 |
| 966 | Ga0501291_053180 | 3300049514 | Unclassified | 743 |
| 967 | Ga0501299_009817 | 3300049522 | Unclassified | 1586 |
| 968 | Ga0501031_0487721 | 3300049568 | Unclassified | 795 |
| 969 | Ga0501032_0549707 | 3300049569 | Bacteria | 736 |
| 970 | Ga0501033_0014390 | 3300049570 | Bacteria | 6010 |
| 971 | Ga0501033_0626422 | 3300049570 | Bacteria | 736 |
| 972 | Ga0501034_0005914 | 3300049571 | Bacteria | 13275 |
| 973 | Ga0501034_0494402 | 3300049571 | Bacteria | 1137 |
| 974 | Ga0501036_0063837 | 3300049572 | Unclassified | 3118 |
| 975 | Ga0501036_0132452 | 3300049572 | Bacteria | 2104 |
| 976 | Ga0501036_0227136 | 3300049572 | Bacteria | 1567 |
| 977 | Ga0501037_0314022 | 3300049573 | Bacteria | 1086 |
| 978 | Ga0501038_0122937 | 3300049574 | Bacteria | 2138 |
| 979 | Ga0501039_0054444 | 3300049575 | Bacteria | 3097 |
| 980 | Ga0501039_0252703 | 3300049575 | Unclassified | 1386 |
| 981 | Ga0501039_0330237 | 3300049575 | Bacteria | 1198 |
| 982 | Ga0501039_0544276 | 3300049575 | Bacteria | 911 |
| 983 | Ga0501040_0006318 | 3300049576 | Bacteria | 7691 |
| 984 | Ga0501041_0006853 | 3300049577 | Bacteria | 6676 |
| 985 | Ga0501041_0013075 | 3300049577 | Bacteria | 4919 |
| 986 | Ga0501041_0018723 | 3300049577 | Unclassified | 4124 |
| 987 | Ga0501041_0051930 | 3300049577 | Bacteria | 2499 |
| 988 | Ga0501042_0006197 | 3300049578 | Bacteria | 7762 |
| 989 | Ga0501042_0015233 | 3300049578 | Bacteria | 5262 |
| 990 | Ga0501042_0020353 | 3300049578 | Bacteria | 4618 |
| 991 | Ga0501042_0020929 | 3300049578 | Bacteria | 4555 |
| 992 | Ga0501042_0098722 | 3300049578 | Bacteria | 2100 |
| 993 | Ga0501043_0006595 | 3300049579 | Bacteria | 9299 |
| 994 | Ga0501046_0004640 | 3300049580 | Bacteria | 12413 |
| 995 | Ga0501046_0038789 | 3300049580 | Bacteria | 3821 |
| 996 | Ga0501046_0053339 | 3300049580 | Bacteria | 3185 |
| 997 | Ga0501047_0001540 | 3300049581 | Bacteria | 22545 |
| 998 | Ga0501047_0110130 | 3300049581 | Bacteria | 2637 |
| 999 | Ga0501048_0012443 | 3300049582 | Bacteria | 6330 |
| 1000 | Ga0501048_0052509 | 3300049582 | Bacteria | 2901 |
| 1001 | Ga0501067_0018986 | 3300049583 | Bacteria | 3804 |
| 1002 | Ga0501067_0023538 | 3300049583 | Unclassified | 3414 |
| 1003 | Ga0501067_0049932 | 3300049583 | Unclassified | 2318 |
| 1004 | Ga0501068_0006551 | 3300049584 | Bacteria | 6421 |
| 1005 | Ga0501069_0234055 | 3300049585 | Bacteria | 1070 |
| 1006 | Ga0501071_0006349 | 3300049587 | Bacteria | 7666 |
| 1007 | Ga0501071_0035628 | 3300049587 | Bacteria | 3545 |
| 1008 | Ga0501071_0073431 | 3300049587 | Bacteria | 2495 |
| 1009 | Ga0501071_0076173 | 3300049587 | Unclassified | 2450 |
| 1010 | Ga0501071_0134716 | 3300049587 | Bacteria | 1837 |
| 1011 | Ga0501071_0389009 | 3300049587 | Bacteria | 1064 |
| 1012 | Ga0501072_0017724 | 3300049588 | Bacteria | 5476 |
| 1013 | Ga0501072_0027623 | 3300049588 | Bacteria | 4426 |
| 1014 | Ga0501072_0032613 | 3300049588 | Bacteria | 4080 |
| 1015 | Ga0501072_0119520 | 3300049588 | Unclassified | 2099 |
| 1016 | Ga0501072_0154007 | 3300049588 | Unclassified | 1833 |
| 1017 | Ga0501073_0005759 | 3300049589 | Bacteria | 9264 |
| 1018 | Ga0501073_0153552 | 3300049589 | Unclassified | 1596 |
| 1019 | Ga0501074_0729861 | 3300049590 | Bacteria | 699 |
| 1020 | Ga0501075_0007940 | 3300049591 | Bacteria | 7373 |
| 1021 | Ga0501075_0067558 | 3300049591 | Bacteria | 2699 |
| 1022 | Ga0501075_0100545 | 3300049591 | Bacteria | 2196 |
| 1023 | Ga0501075_0111471 | 3300049591 | Bacteria | 2080 |
| 1024 | Ga0501076_0015426 | 3300049592 | Bacteria | 5773 |
| 1025 | Ga0501076_0025535 | 3300049592 | Bacteria | 4572 |
| 1026 | Ga0501076_0059433 | 3300049592 | Bacteria | 3041 |
| 1027 | Ga0501076_0075363 | 3300049592 | Bacteria | 2704 |
| 1028 | Ga0501076_0117301 | 3300049592 | Bacteria | 2154 |
| 1029 | Ga0501076_0219768 | 3300049592 | Bacteria | 1553 |
| 1030 | Ga0501076_0381602 | 3300049592 | Bacteria | 1158 |
| 1031 | Ga0501076_0448068 | 3300049592 | Bacteria | 1063 |
| 1032 | Ga0501077_0037308 | 3300049593 | Bacteria | 3096 |
| 1033 | Ga0501077_0068297 | 3300049593 | Bacteria | 2253 |
| 1034 | Ga0501077_0092256 | 3300049593 | Bacteria | 1919 |
| 1035 | Ga0501077_0144334 | 3300049593 | Unclassified | 1510 |
| 1036 | Ga0501217_161327 | 3300049661 | Unclassified | 676 |
| 1037 | Ga0501248_027713 | 3300049678 | Bacteria | 628 |
| 1038 | Ga0501257_108902 | 3300049686 | Bacteria | 733 |
| 1039 | Ga0501258_022680 | 3300049687 | Bacteria | 748 |
| 1040 | Ga0501079_0004350 | 3300049741 | Bacteria | 10512 |
| 1041 | Ga0501080_0019013 | 3300049742 | Bacteria | 6363 |
| 1042 | Ga0501080_0193555 | 3300049742 | Bacteria | 1868 |
| 1043 | Ga0501080_0484347 | 3300049742 | Bacteria | 1107 |
| 1044 | Ga0501081_0001655 | 3300049743 | Bacteria | 13793 |
| 1045 | Ga0501081_0006802 | 3300049743 | Bacteria | 7436 |
| 1046 | Ga0501081_0022215 | 3300049743 | Bacteria | 4243 |
| 1047 | Ga0501081_0094635 | 3300049743 | Unclassified | 2105 |
| 1048 | Ga0501081_0134587 | 3300049743 | Bacteria | 1768 |
| 1049 | Ga0501083_0175041 | 3300049744 | Unclassified | 1402 |
| 1050 | Ga0501272_037663 | 3300049769 | Bacteria | 636 |
| 1051 | Ga0501035_0420125 | 3300049822 | Bacteria | 1110 |
| 1052 | Ga0501044_0010321 | 3300049823 | Bacteria | 10143 |
| 1053 | Ga0501045_0007123 | 3300049824 | Bacteria | 7756 |
| 1054 | Ga0501045_0034948 | 3300049824 | Bacteria | 3649 |
| 1055 | Ga0501045_0045745 | 3300049824 | Bacteria | 3186 |
| 1056 | Ga0501045_0048697 | 3300049824 | Bacteria | 3089 |
| 1057 | nmdc:mga03683_22921_c1 | 3300050489 | Unclassified | 2426 |
| 1058 | nmdc:mga00v17_284497_c1 | 3300050491 | Unclassified | 1074 |
| 1059 | nmdc:mga00v17_417742_c1 | 3300050491 | Bacteria | 871 |
| 1060 | nmdc:mga00v17_4521_c1 | 3300050491 | Bacteria | 7243 |
| 1061 | nmdc:mga0yw44_145505_c1 | 3300050492 | Bacteria | 1543 |
| 1062 | nmdc:mga0yw44_41109_c1 | 3300050492 | Unclassified | 2750 |
| 1063 | nmdc:mga0k408_10386_c1 | 3300050493 | Bacteria | 5036 |
| 1064 | nmdc:mga0k408_12220_c2 | 3300050493 | Bacteria | 2635 |
| 1065 | nmdc:mga06z11_11337_c1 | 3300050494 | Bacteria | 3841 |
| 1066 | nmdc:mga06z11_120415_c1 | 3300050494 | Bacteria | 1464 |
| 1067 | nmdc:mga06z11_348884_c1 | 3300050494 | Bacteria | 886 |
| 1068 | nmdc:mga04h51_38816_c1 | 3300050495 | Unclassified | 1544 |
| 1069 | nmdc:mga04h51_50780_c1 | 3300050495 | Unclassified | 1391 |
| 1070 | nmdc:mga07m45_16034_c1 | 3300050496 | Unclassified | 4010 |
| 1071 | nmdc:mga07m45_408316_c1 | 3300050496 | Unclassified | 788 |
| 1072 | nmdc:mga05p37_10153_c1 | 3300050507 | Bacteria | 11176 |
| 1073 | nmdc:mga05p37_111875_c1 | 3300050507 | Bacteria | 3358 |
| 1074 | nmdc:mga05p37_139386_c1 | 3300050507 | Bacteria | 2972 |
| 1075 | nmdc:mga05p37_185800_c1 | 3300050507 | Bacteria | 2527 |
| 1076 | nmdc:mga05p37_201663_c1 | 3300050507 | Bacteria | 2409 |
| 1077 | nmdc:mga05p37_23032_c1 | 3300050507 | Bacteria | 7556 |
| 1078 | nmdc:mga05p37_261404_c1 | 3300050507 | Bacteria | 2071 |
| 1079 | nmdc:mga05p37_285821_c1 | 3300050507 | Bacteria | 1965 |
| 1080 | nmdc:mga05p37_39815_c1 | 3300050507 | Bacteria | 5771 |
| 1081 | nmdc:mga05p37_77425_c2 | 3300050507 | Unclassified | 1175 |
| 1082 | nmdc:mga05p37_832_c1 | 3300050507 | Bacteria | 34564 |
| 1083 | nmdc:mga05p37_853308_c1 | 3300050507 | Bacteria | 989 |
| 1084 | nmdc:mga09592_1002_c1 | 3300050508 | Bacteria | 22398 |
| 1085 | nmdc:mga09592_141198_c1 | 3300050508 | Bacteria | 2076 |
| 1086 | nmdc:mga09592_151982_c1 | 3300050508 | Bacteria | 1997 |
| 1087 | nmdc:mga09592_195157_c1 | 3300050508 | Bacteria | 1753 |
| 1088 | nmdc:mga09592_199858_c1 | 3300050508 | Bacteria | 1731 |
| 1089 | nmdc:mga09592_249213_c1 | 3300050508 | Bacteria | 1539 |
| 1090 | nmdc:mga09592_274867_c1 | 3300050508 | Unclassified | 1461 |
| 1091 | nmdc:mga09592_35614_c1 | 3300050508 | Bacteria | 4167 |
| 1092 | nmdc:mga09592_545731_c1 | 3300050508 | Bacteria | 996 |
| 1093 | nmdc:mga09592_63536_c1 | 3300050508 | Bacteria | 3125 |
| 1094 | nmdc:mga09592_79977_c1 | 3300050508 | Bacteria | 2783 |
| 1095 | nmdc:mga09592_80349_c1 | 3300050508 | Unclassified | 2777 |
| 1096 | nmdc:mga09592_95370_c1 | 3300050508 | Unclassified | 2545 |
| 1097 | nmdc:mga0qj67_1417_c1 | 3300050509 | Bacteria | 16782 |
| 1098 | nmdc:mga0qj67_18686_c1 | 3300050509 | Bacteria | 5285 |
| 1099 | nmdc:mga0qj67_227797_c1 | 3300050509 | Bacteria | 1512 |
| 1100 | nmdc:mga0qj67_26931_c1 | 3300050509 | Bacteria | 4452 |
| 1101 | nmdc:mga0qj67_292548_c1 | 3300050509 | Bacteria | 1320 |
| 1102 | nmdc:mga0qj67_3358_c1 | 3300050509 | Bacteria | 11543 |
| 1103 | nmdc:mga0qj67_5858_c1 | 3300050509 | Bacteria | 8998 |
| 1104 | nmdc:mga0qj67_61581_c1 | 3300050509 | Bacteria | 2980 |
| 1105 | nmdc:mga06r32_20469_c1 | 3300050510 | Bacteria | 6092 |
| 1106 | nmdc:mga06r32_406025_c1 | 3300050510 | Bacteria | 1344 |
| 1107 | nmdc:mga06r32_495032_c1 | 3300050510 | Bacteria | 1200 |
| 1108 | nmdc:mga06r32_56689_c1 | 3300050510 | Bacteria | 3762 |
| 1109 | nmdc:mga06r32_591860_c1 | 3300050510 | Bacteria | 1081 |
| 1110 | nmdc:mga08y16_1178741_c1 | 3300050511 | Unclassified | 738 |
| 1111 | nmdc:mga08y16_120198_c1 | 3300050511 | Unclassified | 2734 |
| 1112 | nmdc:mga08y16_129071_c1 | 3300050511 | Bacteria | 2630 |
| 1113 | nmdc:mga08y16_148625_c1 | 3300050511 | Unclassified | 2436 |
| 1114 | nmdc:mga08y16_19430_c1 | 3300050511 | Bacteria | 7163 |
| 1115 | nmdc:mga08y16_226_c1 | 3300050511 | Bacteria | 50561 |
| 1116 | nmdc:mga08y16_283677_c1 | 3300050511 | Unclassified | 1708 |
| 1117 | nmdc:mga08y16_31614_c1 | 3300050511 | Bacteria | 5567 |
| 1118 | nmdc:mga08y16_3914_c1 | 3300050511 | Bacteria | 15504 |
| 1119 | nmdc:mga08y16_429568_c1 | 3300050511 | Bacteria | 1349 |
| 1120 | nmdc:mga08y16_438204_c1 | 3300050511 | Bacteria | 1334 |
| 1121 | nmdc:mga08y16_55022_c1 | 3300050511 | Bacteria | 4159 |
| 1122 | nmdc:mga08y16_611_c1 | 3300050511 | Bacteria | 33310 |
| 1123 | nmdc:mga08y16_64596_c1 | 3300050511 | Bacteria | 3822 |
| 1124 | nmdc:mga08y16_65571_c1 | 3300050511 | Unclassified | 3791 |
| 1125 | nmdc:mga08y16_73278_c1 | 3300050511 | Bacteria | 3568 |
| 1126 | nmdc:mga08y16_76939_c1 | 3300050511 | Bacteria | 3478 |
| 1127 | nmdc:mga0n895_100417_c1 | 3300050512 | Bacteria | 2902 |
| 1128 | nmdc:mga0n895_149457_c1 | 3300050512 | Bacteria | 2365 |
| 1129 | nmdc:mga0n895_15190_c1 | 3300050512 | Bacteria | 7016 |
| 1130 | nmdc:mga0n895_211948_c1 | 3300050512 | Unclassified | 1967 |
| 1131 | nmdc:mga0n895_220208_c1 | 3300050512 | Bacteria | 1927 |
| 1132 | nmdc:mga0n895_353939_c1 | 3300050512 | Bacteria | 1487 |
| 1133 | nmdc:mga0n895_37875_c1 | 3300050512 | Bacteria | 4669 |
| 1134 | nmdc:mga0n895_423852_c1 | 3300050512 | Bacteria | 1345 |
| 1135 | nmdc:mga0n895_4706_c1 | 3300050512 | Bacteria | 11265 |
| 1136 | nmdc:mga0n895_48966_c1 | 3300050512 | Unclassified | 4139 |
| 1137 | nmdc:mga0n895_73604_c1 | 3300050512 | Bacteria | 3392 |
| 1138 | nmdc:mga0n895_8390_c1 | 3300050512 | Bacteria | 8945 |
| 1139 | nmdc:mga0rr50_206299_c1 | 3300050513 | Bacteria | 1617 |
| 1140 | nmdc:mga0rr50_209204_c1 | 3300050513 | Unclassified | 1606 |
| 1141 | nmdc:mga0rr50_326_c1 | 3300050513 | Bacteria | 25897 |
| 1142 | nmdc:mga0rr50_587989_c1 | 3300050513 | Archaea | 949 |
| 1143 | nmdc:mga0rr50_72999_c1 | 3300050513 | Bacteria | 2622 |
| 1144 | nmdc:mga0rr50_98008_c1 | 3300050513 | Bacteria | 2297 |
| 1145 | nmdc:mga08x19_104729_c1 | 3300050514 | Bacteria | 1880 |
| 1146 | nmdc:mga08x19_30526_c1 | 3300050514 | Bacteria | 3386 |
| 1147 | nmdc:mga08x19_448312_c1 | 3300050514 | Bacteria | 908 |
| 1148 | nmdc:mga0a205_118408_c1 | 3300050515 | Bacteria | 2547 |
| 1149 | nmdc:mga0a205_129789_c2 | 3300050515 | Bacteria | 1212 |
| 1150 | nmdc:mga0a205_13661_c1 | 3300050515 | Bacteria | 7566 |
| 1151 | nmdc:mga0a205_139895_c1 | 3300050515 | Bacteria | 2321 |
| 1152 | nmdc:mga0a205_22780_c1 | 3300050515 | Bacteria | 5938 |
| 1153 | nmdc:mga0a205_242599_c1 | 3300050515 | Bacteria | 1683 |
| 1154 | nmdc:mga0a205_325980_c1 | 3300050515 | Unclassified | 1406 |
| 1155 | nmdc:mga0a205_375535_c1 | 3300050515 | Bacteria | 1287 |
| 1156 | nmdc:mga0a205_39003_c1 | 3300050515 | Bacteria | 4571 |
| 1157 | nmdc:mga0a205_42456_c1 | 3300050515 | Bacteria | 4382 |
| 1158 | nmdc:mga0a205_492_c1 | 3300050515 | Bacteria | 30923 |
| 1159 | nmdc:mga0a205_852108_c1 | 3300050515 | Bacteria | 758 |
| 1160 | nmdc:mga0a205_87481_c1 | 3300050515 | Unclassified | 3010 |
| 1161 | Ga0495601_0178922 | 3300053077 | Bacteria | 1387 |
| 1162 | Ga0495619_0033905 | 3300053085 | Bacteria | 3317 |
| 1163 | Ga0495619_0298516 | 3300053085 | Bacteria | 1116 |
| 1164 | Ga0495619_0332242 | 3300053085 | Bacteria | 1052 |
| 1165 | Ga0500646_0001828 | 3300053090 | Bacteria | 5590 |
| 1166 | Ga0500593_188451 | 3300053117 | Bacteria | 758 |
| 1167 | Ga0501084_0025967 | 3300054114 | Bacteria | 4885 |
| 1168 | Ga0501084_0025977 | 3300054114 | Bacteria | 4884 |
| 1169 | Ga0501084_0044608 | 3300054114 | Bacteria | 3712 |
| 1170 | Ga0501084_0090716 | 3300054114 | Bacteria | 2566 |
| 1171 | Ga0501084_0504336 | 3300054114 | Bacteria | 1023 |
| 1172 | Ga0501084_0958622 | 3300054114 | Unclassified | 719 |
| 1173 | Ga0590071_000034 | 3300059421 | Bacteria | 36259 |
| 1174 | Ga0590071_032415 | 3300059421 | Unclassified | 1247 |
| 1175 | Ga0590071_060376 | 3300059421 | Bacteria | 926 |
| 1176 | Ga0590074_001837 | 3300059423 | Unclassified | 3468 |
| 1177 | Ga0590074_023055 | 3300059423 | Unclassified | 1078 |
| 1178 | Ga0590075_000217 | 3300059424 | Bacteria | 16065 |
| 1179 | Ga0590075_001190 | 3300059424 | Bacteria | 6595 |
| 1180 | Ga0590077_000401 | 3300059426 | Bacteria | 12179 |
| 1181 | Ga0590077_001039 | 3300059426 | Bacteria | 6909 |
| 1182 | Ga0590077_046680 | 3300059426 | Bacteria | 969 |
| 1183 | Ga0501082_0015906 | 3300060353 | Bacteria | 6470 |
| 1184 | Ga0501082_0165187 | 3300060353 | Unclassified | 1924 |
| 1185 | Ga0530510_0002263 | 3300061734 | Bacteria | 13198 |
| 1186 | Ga0530510_0038412 | 3300061734 | Unclassified | 3456 |
| 1187 | Ga0530510_0327605 | 3300061734 | Bacteria | 1149 |
| 1188 | Ga0530510_0445896 | 3300061734 | Bacteria | 978 |
| 1189 | Ga0530510_0683008 | 3300061734 | Bacteria | 782 |
| 1190 | Ga0070670_100026313 | |||
| 1191 | JGI25406J46586_10000717 | |||
| 1192 | JGI25406J46586_10002626 | |||
| 1193 | JGI25406J46586_10024043 | |||
| 1194 | Ga0058858_1426466 | |||
| 1195 | Ga0058859_11578489 | |||
| 1196 | Ga0058859_11790629 | |||
| 1197 | Ga0058861_12044645 | |||
| 1198 | Ga0058860_12143216 | |||
| 1199 | Ga0058862_12520517 | |||
| 1200 | Ga0065704_10022086 | |||
| 1201 | Ga0065712_10083022 | |||
| 1202 | Ga0065712_10174957 | |||
| 1203 | Ga0065712_10186090 | |||
| 1204 | Ga0065712_10189294 | |||
| 1205 | Ga0065712_10197171 | |||
| 1206 | Ga0065712_10263114 | |||
| 1207 | Ga0065712_10324743 | |||
| 1208 | Ga0065715_10110347 | |||
| 1209 | Ga0065715_10144576 | |||
| 1210 | Ga0065715_10174953 | |||
| 1211 | Ga0065715_10364441 | |||
| 1212 | Ga0065715_10437544 | |||
| 1213 | Ga0065707_10117551 | |||
| 1214 | Ga0065707_10134959 | |||
| 1215 | Ga0065707_10151914 | |||
| 1216 | Ga0065707_10257191 | |||
| 1217 | Ga0070676_10048439 | |||
| 1218 | Ga0070676_10079232 | |||
| 1219 | Ga0070676_10092042 | |||
| 1220 | Ga0070676_10254782 | |||
| 1221 | Ga0070676_10314917 | |||
| 1222 | Ga0070683_100002625 | |||
| 1223 | Ga0070683_100030831 | |||
| 1224 | Ga0070690_100012083 | |||
| 1225 | Ga0070690_100304528 | |||
| 1226 | Ga0070690_100708680 | |||
| 1227 | Ga0070670_100010086 | |||
| 1228 | Ga0070670_100012414 | |||
| 1229 | Ga0070670_100018368 | |||
| 1230 | Ga0070670_100023579 | |||
| 1231 | Ga0070670_100055636 | |||
| 1232 | Ga0070670_100424101 | |||
| 1233 | Ga0070670_100777205 | |||
| 1234 | Ga0070677_10053910 | |||
| 1235 | Ga0070677_10185057 | |||
| 1236 | Ga0068869_100023804 | |||
| 1237 | Ga0068869_100117396 | |||
| 1238 | Ga0068869_100370206 | |||
| 1239 | Ga0070666_10001460 | |||
| 1240 | Ga0070666_10078500 | |||
| 1241 | Ga0070666_10286409 | |||
| 1242 | Ga0070666_10376318 | |||
| 1243 | Ga0070680_100168366 | |||
| 1244 | Ga0070680_100463986 | |||
| 1245 | Ga0070680_100588429 | |||
| 1246 | Ga0070680_100701612 | |||
| 1247 | Ga0070682_100299639 | |||
| 1248 | Ga0070682_100512078 | |||
| 1249 | Ga0068868_100430738 | |||
| 1250 | Ga0068868_100446569 | |||
| 1251 | Ga0068868_100447567 | |||
| 1252 | Ga0070660_100056707 | |||
| 1253 | Ga0070689_100021821 | |||
| 1254 | Ga0070689_100022436 | |||
| 1255 | Ga0070689_100072399 | |||
| 1256 | Ga0070689_100152383 | |||
| 1257 | Ga0070689_100192528 | |||
| 1258 | Ga0070689_100259095 | |||
| 1259 | Ga0070689_100503373 | |||
| 1260 | Ga0070689_100717689 | |||
| 1261 | Ga0070689_100750038 | |||
| 1262 | Ga0070691_10032075 | |||
| 1263 | Ga0070687_100047492 | |||
| 1264 | Ga0070687_100049562 | |||
| 1265 | Ga0070687_100685063 | |||
| 1266 | Ga0070661_100168806 | |||
| 1267 | Ga0070661_100263132 | |||
| 1268 | Ga0070692_10061075 | |||
| 1269 | Ga0070668_100451620 | |||
| 1270 | Ga0070668_100542997 | |||
| 1271 | Ga0070669_100003238 | |||
| 1272 | Ga0070669_100008530 | |||
| 1273 | Ga0070669_100085713 | |||
| 1274 | Ga0070669_100108206 | |||
| 1275 | Ga0070669_100152404 | |||
| 1276 | Ga0070669_100159766 | |||
| 1277 | Ga0070669_100183548 | |||
| 1278 | Ga0070669_100447080 | |||
| 1279 | Ga0070669_100492414 | |||
| 1280 | Ga0070675_100000617 | |||
| 1281 | Ga0070675_100001519 | |||
| 1282 | Ga0070675_100003475 | |||
| 1283 | Ga0070675_100007631 | |||
| 1284 | Ga0070675_100007926 | |||
| 1285 | Ga0070675_100024800 | |||
| 1286 | Ga0070675_100072184 | |||
| 1287 | Ga0070675_100106073 | |||
| 1288 | Ga0070675_100115083 | |||
| 1289 | Ga0070675_100404555 | |||
| 1290 | Ga0070675_100711946 | |||
| 1291 | Ga0070671_100004187 | |||
| 1292 | Ga0070671_100046654 | |||
| 1293 | Ga0070671_100063454 | |||
| 1294 | Ga0070671_100127168 | |||
| 1295 | Ga0070671_100691833 | |||
| 1296 | Ga0070671_101271637 | |||
| 1297 | Ga0070674_100014856 | |||
| 1298 | Ga0070674_100091393 | |||
| 1299 | Ga0070674_100264668 | |||
| 1300 | Ga0070674_100406947 | |||
| 1301 | Ga0070674_100708812 | |||
| 1302 | Ga0070673_100003552 | |||
| 1303 | Ga0070673_100010680 | |||
| 1304 | Ga0070673_100014066 | |||
| 1305 | Ga0070673_100017589 | |||
| 1306 | Ga0070673_100056981 | |||
| 1307 | Ga0070673_100070875 | |||
| 1308 | Ga0070673_100180396 | |||
| 1309 | Ga0070673_100553880 | |||
| 1310 | Ga0070673_100632812 | |||
| 1311 | Ga0070688_100082983 | |||
| 1312 | Ga0070688_100136071 | |||
| 1313 | Ga0070688_100154171 | |||
| 1314 | Ga0070688_100475626 | |||
| 1315 | Ga0070659_100052454 | |||
| 1316 | Ga0070659_100215705 | |||
| 1317 | Ga0070659_100430331 | |||
| 1318 | Ga0070659_100692624 | |||
| 1319 | Ga0070667_100242186 | |||
| 1320 | Ga0070667_100390253 | |||
| 1321 | Ga0070667_100524171 | |||
| 1322 | Ga0070667_100573020 | |||
| 1323 | Ga0070703_10053542 | |||
| 1324 | Ga0070714_100041923 | |||
| 1325 | Ga0070713_100041155 | |||
| 1326 | Ga0070713_100097307 | |||
| 1327 | Ga0070713_100351393 | |||
| 1328 | Ga0070701_10002629 | |||
| 1329 | Ga0070701_10022582 | |||
| 1330 | Ga0070701_10043915 | |||
| 1331 | Ga0070701_10335155 | |||
| 1332 | Ga0070705_100048215 | |||
| 1333 | Ga0070705_100051202 | |||
| 1334 | Ga0070705_100060914 | |||
| 1335 | Ga0070705_100271070 | |||
| 1336 | Ga0070705_100289556 | |||
| 1337 | Ga0070705_100336934 | |||
| 1338 | Ga0070700_100002087 | |||
| 1339 | Ga0070700_100011496 | |||
| 1340 | Ga0070700_100049403 | |||
| 1341 | Ga0070700_100136775 | |||
| 1342 | Ga0070700_100145215 | |||
| 1343 | Ga0070694_100003530 | |||
| 1344 | Ga0070694_100009709 | |||
| 1345 | Ga0070694_100079788 | |||
| 1346 | Ga0070694_100109687 | |||
| 1347 | Ga0070694_100195470 | |||
| 1348 | Ga0070694_100216907 | |||
| 1349 | Ga0070694_100569194 | |||
| 1350 | Ga0070708_100269672 | |||
| 1351 | Ga0070708_100906382 | |||
| 1352 | Ga0070663_100023419 | |||
| 1353 | Ga0070663_100025375 | |||
| 1354 | Ga0070663_100083330 | |||
| 1355 | Ga0070678_100218400 | |||
| 1356 | Ga0070678_100253519 | |||
| 1357 | Ga0070678_100486455 | |||
| 1358 | Ga0070678_100761022 | |||
| 1359 | Ga0070678_101051791 | |||
| 1360 | Ga0070662_100108748 | |||
| 1361 | Ga0070662_100121481 | |||
| 1362 | Ga0070662_100213070 | |||
| 1363 | Ga0070662_100224355 | |||
| 1364 | Ga0070662_100471291 | |||
| 1365 | Ga0070662_100527198 | |||
| 1366 | Ga0070662_100632389 | |||
| 1367 | Ga0070662_101019977 | |||
| 1368 | Ga0070681_10003234 | |||
| 1369 | Ga0070681_10025795 | |||
| 1370 | Ga0070681_10080026 | |||
| 1371 | Ga0070681_10425357 | |||
| 1372 | Ga0070681_10603486 | |||
| 1373 | Ga0070681_10617802 | |||
| 1374 | Ga0068867_100003458 | |||
| 1375 | Ga0068867_100006787 | |||
| 1376 | Ga0068867_100015827 | |||
| 1377 | Ga0068867_100226648 | |||
| 1378 | Ga0070685_10055310 | |||
| 1379 | Ga0070685_10443790 | |||
| 1380 | Ga0070706_100365177 | |||
| 1381 | Ga0070706_100506555 | |||
| 1382 | Ga0070707_100050521 | |||
| 1383 | Ga0070707_100500183 | |||
| 1384 | Ga0070698_100011373 | |||
| 1385 | Ga0070698_100129061 | |||
| 1386 | Ga0070698_100321503 | |||
| 1387 | Ga0070699_100001754 | |||
| 1388 | Ga0070699_100005910 | |||
| 1389 | Ga0070699_100007030 | |||
| 1390 | Ga0070699_100020778 | |||
| 1391 | Ga0070679_100146193 | |||
| 1392 | Ga0070679_100525927 | |||
| 1393 | Ga0070684_100004802 | |||
| 1394 | Ga0070684_100015024 | |||
| 1395 | Ga0070684_100370480 | |||
| 1396 | Ga0070684_100699684 | |||
| 1397 | Ga0070697_100007518 | |||
| 1398 | Ga0068853_100233518 | |||
| 1399 | Ga0070672_100022715 | |||
| 1400 | Ga0070672_100030757 | |||
| 1401 | Ga0070672_100205258 | |||
| 1402 | Ga0070672_100211558 | |||
| 1403 | Ga0070672_100258875 | |||
| 1404 | Ga0070672_100268205 | |||
| 1405 | Ga0070672_100291759 | |||
| 1406 | Ga0070672_100766166 | |||
| 1407 | Ga0070686_100001443 | |||
| 1408 | Ga0070686_100017081 | |||
| 1409 | Ga0070686_100121824 | |||
| 1410 | Ga0070686_100196261 | |||
| 1411 | Ga0070686_100298596 | |||
| 1412 | Ga0070686_100439309 | |||
| 1413 | Ga0070686_100639127 | |||
| 1414 | Ga0070686_100711104 | |||
| 1415 | Ga0070695_100001218 | |||
| 1416 | Ga0070695_100094340 | |||
| 1417 | Ga0070695_100153677 | |||
| 1418 | Ga0070695_100330713 | |||
| 1419 | Ga0070695_100368605 | |||
| 1420 | Ga0070695_100409379 | |||
| 1421 | Ga0070696_100002157 | |||
| 1422 | Ga0070696_100004447 | |||
| 1423 | Ga0070696_100005834 | |||
| 1424 | Ga0070696_100044304 | |||
| 1425 | Ga0070696_100406644 | |||
| 1426 | Ga0070696_100989646 | |||
| 1427 | Ga0070693_100031621 | |||
| 1428 | Ga0070693_100102096 | |||
| 1429 | Ga0070693_100259552 | |||
| 1430 | Ga0070693_100458516 | |||
| 1431 | Ga0070665_100082746 | |||
| 1432 | Ga0070665_100572659 | |||
| 1433 | Ga0070704_100009084 | |||
| 1434 | Ga0070704_100009193 | |||
| 1435 | Ga0070704_100110374 | |||
| 1436 | Ga0070704_100135635 | |||
| 1437 | Ga0070704_100219851 | |||
| 1438 | Ga0070704_100226268 | |||
| 1439 | Ga0070704_100319375 | |||
| 1440 | Ga0070704_100525312 | |||
| 1441 | Ga0070704_100525981 | |||
| 1442 | Ga0068855_100602131 | |||
| 1443 | Ga0070664_100000832 | |||
| 1444 | Ga0070664_100024195 | |||
| 1445 | Ga0070664_100151298 | |||
| 1446 | Ga0070664_100196586 | |||
| 1447 | Ga0070664_100279561 | |||
| 1448 | Ga0070664_100452751 | |||
| 1449 | Ga0070664_100589394 | |||
| 1450 | Ga0070664_101229701 | |||
| 1451 | Ga0068857_100015517 | |||
| 1452 | Ga0068857_100067796 | |||
| 1453 | Ga0068857_100187979 | |||
| 1454 | Ga0068854_100004044 | |||
| 1455 | Ga0068854_100043326 | |||
| 1456 | Ga0068854_100084705 | |||
| 1457 | Ga0070702_100031413 | |||
| 1458 | Ga0070702_100064214 | |||
| 1459 | Ga0070702_100070398 | |||
| 1460 | Ga0070702_100159944 | |||
| 1461 | Ga0070702_100207339 | |||
| 1462 | Ga0068852_100016767 | |||
| 1463 | Ga0068852_100051384 | |||
| 1464 | Ga0068852_100435132 | |||
| 1465 | Ga0068859_100040288 | |||
| 1466 | Ga0068859_100168081 | |||
| 1467 | Ga0068859_100206025 | |||
| 1468 | Ga0068859_100306687 | |||
| 1469 | Ga0068859_100379265 | |||
| 1470 | Ga0068859_100409808 | |||
| 1471 | Ga0068859_100887832 | |||
| 1472 | Ga0068859_101409786 | |||
| 1473 | Ga0068864_100009165 | |||
| 1474 | Ga0068864_100062567 | |||
| 1475 | Ga0068864_100373005 | |||
| 1476 | Ga0068864_100621421 | |||
| 1477 | Ga0068864_100645027 | |||
| 1478 | Ga0068864_101041391 | |||
| 1479 | Ga0068866_10011610 | |||
| 1480 | Ga0068866_10043798 | |||
| 1481 | Ga0068861_100003679 | |||
| 1482 | Ga0068861_100029946 | |||
| 1483 | Ga0068861_100075669 | |||
| 1484 | Ga0068861_100320593 | |||
| 1485 | Ga0068861_100438532 | |||
| 1486 | Ga0068861_101164138 | |||
| 1487 | Ga0068851_10039668 | |||
| 1488 | Ga0068851_10133148 | |||
| 1489 | Ga0068870_10017038 | |||
| 1490 | Ga0068870_10130593 | |||
| 1491 | Ga0068863_100052159 | |||
| 1492 | Ga0068863_100200070 | |||
| 1493 | Ga0068863_100254548 | |||
| 1494 | Ga0068863_100406631 | |||
| 1495 | Ga0068863_100519313 | |||
| 1496 | Ga0068858_100010889 | |||
| 1497 | Ga0068858_100022318 | |||
| 1498 | Ga0068858_100041710 | |||
| 1499 | Ga0068858_100193443 | |||
| 1500 | Ga0068860_100054620 | |||
| 1501 | Ga0068860_100195153 | |||
| 1502 | Ga0068860_100375059 | |||
| 1503 | Ga0068860_100514969 | |||
| 1504 | Ga0068860_100643863 | |||
| 1505 | Ga0068860_100821131 | |||
| 1506 | Ga0068862_100056994 | |||
| 1507 | Ga0068862_100119950 | |||
| 1508 | Ga0068862_100292113 | |||
| 1509 | Ga0081455_10076085 | |||
| 1510 | Ga0081538_10099985 | |||
| 1511 | Ga0081539_10000291 | |||
| 1512 | Ga0081539_10000295 | |||
| 1513 | Ga0081539_10002133 | |||
| 1514 | Ga0075368_10010304 | |||
| 1515 | Ga0075368_10045552 | |||
| 1516 | Ga0075364_10002862 | |||
| 1517 | Ga0075364_10007269 | |||
| 1518 | Ga0075362_10003359 | |||
| 1519 | Ga0075367_10005268 | |||
| 1520 | Ga0075367_10019677 | |||
| 1521 | Ga0075369_10135769 | |||
| 1522 | Ga0075427_10017711 | |||
| 1523 | Ga0075366_10029113 | |||
| 1524 | Ga0097621_100123867 | |||
| 1525 | Ga0097621_100214970 | |||
| 1526 | Ga0097621_100301059 | |||
| 1527 | Ga0097621_100382342 | |||
| 1528 | Ga0097621_100449358 | |||
| 1529 | Ga0075370_10008989 | |||
| 1530 | Ga0068871_100060502 | |||
| 1531 | Ga0068871_100257549 | |||
| 1532 | Ga0068871_100883886 | |||
| 1533 | Ga0075428_100000931 | |||
| 1534 | Ga0075428_100008691 | |||
| 1535 | Ga0075428_100015755 | |||
| 1536 | Ga0075428_100024626 | |||
| 1537 | Ga0075428_100033671 | |||
| 1538 | Ga0075428_100041952 | |||
| 1539 | Ga0075428_100163037 | |||
| 1540 | Ga0075428_100823678 | |||
| 1541 | Ga0075430_100000398 | |||
| 1542 | Ga0075430_100030658 | |||
| 1543 | Ga0075430_100041996 | |||
| 1544 | Ga0075430_100050744 | |||
| 1545 | Ga0075430_100174789 | |||
| 1546 | Ga0075430_100198918 | |||
| 1547 | Ga0075431_100015570 | |||
| 1548 | Ga0075431_100036470 | |||
| 1549 | Ga0075431_100132041 | |||
| 1550 | Ga0075431_100407815 | |||
| 1551 | Ga0075431_100523119 | |||
| 1552 | Ga0075433_10005915 | |||
| 1553 | Ga0075433_10008576 | |||
| 1554 | Ga0075433_10048647 | |||
| 1555 | Ga0075433_10138299 | |||
| 1556 | Ga0075433_10197196 | |||
| 1557 | Ga0075433_10217667 | |||
| 1558 | Ga0075433_10275626 | |||
| 1559 | Ga0075433_10354684 | |||
| 1560 | Ga0075433_10387427 | |||
| 1561 | Ga0075433_11036696 | |||
| 1562 | Ga0075434_100004997 | |||
| 1563 | Ga0075434_100010035 | |||
| 1564 | Ga0075434_100011617 | |||
| 1565 | Ga0075434_100019603 | |||
| 1566 | Ga0075434_100019962 | |||
| 1567 | Ga0075434_100136223 | |||
| 1568 | Ga0075434_100161445 | |||
| 1569 | Ga0075434_100181639 | |||
| 1570 | Ga0075434_100194788 | |||
| 1571 | Ga0075434_100640974 | |||
| 1572 | Ga0075429_100005250 | |||
| 1573 | Ga0075429_100012127 | |||
| 1574 | Ga0075429_100055017 | |||
| 1575 | Ga0075429_100066676 | |||
| 1576 | Ga0075429_100121667 | |||
| 1577 | Ga0075429_100149495 | |||
| 1578 | Ga0075429_100220471 | |||
| 1579 | Ga0075429_100283959 | |||
| 1580 | Ga0075429_100288094 | |||
| 1581 | Ga0075429_100482178 | |||
| 1582 | Ga0068865_100008578 | |||
| 1583 | Ga0068865_100015657 | |||
| 1584 | Ga0068865_100071425 | |||
| 1585 | Ga0068865_100574286 | |||
| 1586 | Ga0097620_100040291 | |||
| 1587 | Ga0097620_100168076 | |||
| 1588 | Ga0097620_100206025 | |||
| 1589 | Ga0097620_100306663 | |||
| 1590 | Ga0097620_100379258 | |||
| 1591 | Ga0097620_100409791 | |||
| 1592 | Ga0097620_100887886 | |||
| 1593 | Ga0097620_101409751 | |||
| 1594 | Ga0075435_100000542 | |||
| 1595 | Ga0075435_100003059 | |||
| 1596 | Ga0075435_100040441 | |||
| 1597 | Ga0075435_100112436 | |||
| 1598 | Ga0075435_100164287 | |||
| 1599 | Ga0075435_100232611 | |||
| 1600 | Ga0075435_100374591 | |||
| 1601 | Ga0105240_10364422 | |||
| 1602 | Ga0111539_10002826 | |||
| 1603 | Ga0111539_10004921 | |||
| 1604 | Ga0111539_10005196 | |||
| 1605 | Ga0111539_10005833 | |||
| 1606 | Ga0111539_10008803 | |||
| 1607 | Ga0111539_10012690 | |||
| 1608 | Ga0111539_10032568 | |||
| 1609 | Ga0111539_10044641 | |||
| 1610 | Ga0111539_10056800 | |||
| 1611 | Ga0111539_10152541 | |||
| 1612 | Ga0111539_10216291 | |||
| 1613 | Ga0111539_10220946 | |||
| 1614 | Ga0111539_10344915 | |||
| 1615 | Ga0111539_10417412 | |||
| 1616 | Ga0111539_10869197 | |||
| 1617 | Ga0111539_10923527 | |||
| 1618 | Ga0105245_10115143 | |||
| 1619 | Ga0105245_10909943 | |||
| 1620 | Ga0114129_10000288 | |||
| 1621 | Ga0114129_10003329 | |||
| 1622 | Ga0114129_10006935 | |||
| 1623 | Ga0114129_10014822 | |||
| 1624 | Ga0114129_10018044 | |||
| 1625 | Ga0114129_10038503 | |||
| 1626 | Ga0114129_10056807 | |||
| 1627 | Ga0114129_10082261 | |||
| 1628 | Ga0114129_10104445 | |||
| 1629 | Ga0114129_10175991 | |||
| 1630 | Ga0114129_10287740 | |||
| 1631 | Ga0114129_10570195 | |||
| 1632 | Ga0114129_11009442 | |||
| 1633 | Ga0114129_11074977 | |||
| 1634 | Ga0105243_10167484 | |||
| 1635 | Ga0105243_10508626 | |||
| 1636 | Ga0105243_10527205 | |||
| 1637 | Ga0105243_10682958 | |||
| 1638 | Ga0105243_10825424 | |||
| 1639 | Ga0105241_10089643 | |||
| 1640 | Ga0105241_10155896 | |||
| 1641 | Ga0105242_10707872 | |||
| 1642 | Ga0105242_10842426 | |||
| 1643 | Ga0105248_10005969 | |||
| 1644 | Ga0105248_10065657 | |||
| 1645 | Ga0105248_10085016 | |||
| 1646 | Ga0105248_10139228 | |||
| 1647 | Ga0105248_10169117 | |||
| 1648 | Ga0105248_10237407 | |||
| 1649 | Ga0105248_10261164 | |||
| 1650 | Ga0105248_10402174 | |||
| 1651 | Ga0105248_11987740 | |||
| 1652 | Ga0105237_10995334 | |||
| 1653 | Ga0105237_11064841 | |||
| 1654 | Ga0105238_10010201 | |||
| 1655 | Ga0105238_10539884 | |||
| 1656 | Ga0105238_10983504 | |||
| 1657 | Ga0105249_10010772 | |||
| 1658 | Ga0105249_10013057 | |||
| 1659 | Ga0105249_10664919 | |||
| 1660 | Ga0105249_10820293 | |||
| 1661 | Ga0105239_10341302 | |||
| 1662 | Ga0105246_10129190 | |||
| 1663 | Ga0105246_10283744 | |||
| 1664 | Ga0105246_10315946 | |||
| 1665 | Ga0157371_10497322 | |||
| 1666 | Ga0157370_10224044 | |||
| 1667 | Ga0157378_10097042 | |||
| 1668 | Ga0157378_10357244 | |||
| 1669 | Ga0157378_10433250 | |||
| 1670 | Ga0157378_11550882 | |||
| 1671 | Ga0163162_10217804 | |||
| 1672 | Ga0163162_10763437 | |||
| 1673 | Ga0163162_11784851 | |||
| 1674 | Ga0157372_10318584 | |||
| 1675 | Ga0157375_10004150 | |||
| 1676 | Ga0157375_10078790 | |||
| 1677 | Ga0157375_10199439 | |||
| 1678 | Ga0157375_10224181 | |||
| 1679 | Ga0157375_10230113 | |||
| 1680 | Ga0157375_10367272 | |||
| 1681 | Ga0157375_10447432 | |||
| 1682 | Ga0163163_10179074 | |||
| 1683 | Ga0163163_10459499 | |||
| 1684 | Ga0163163_10667924 | |||
| 1685 | Ga0157380_10013835 | |||
| 1686 | Ga0157380_10065298 | |||
| 1687 | Ga0157380_10071511 | |||
| 1688 | Ga0157380_10081265 | |||
| 1689 | Ga0157380_10098599 | |||
| 1690 | Ga0157380_10102056 | |||
| 1691 | Ga0157380_10131019 | |||
| 1692 | Ga0157380_10252226 | |||
| 1693 | Ga0157380_10765007 | |||
| 1694 | Ga0157380_10865457 | |||
| 1695 | Ga0157377_10041418 | |||
| 1696 | Ga0157379_10158326 | |||
| 1697 | Ga0157376_10334236 | |||
| 1698 | Ga0157376_10341120 | |||
| 1699 | Ga0163161_10652912 | |||
| 1700 | Ga0206355_1013067 | |||
| 1701 | Ga0224712_10168246 | |||
| 1702 | Ga0207697_10239645 | |||
| 1703 | Ga0207656_10021939 | |||
| 1704 | Ga0207682_10016422 | |||
| 1705 | Ga0207682_10176731 | |||
| 1706 | Ga0207642_10203027 | |||
| 1707 | Ga0207642_10206903 | |||
| 1708 | Ga0207688_10018923 | |||
| 1709 | Ga0207688_10059098 | |||
| 1710 | Ga0207680_10001435 | |||
| 1711 | Ga0207680_10035519 | |||
| 1712 | Ga0207680_10310195 | |||
| 1713 | Ga0207647_10082067 | |||
| 1714 | Ga0207699_10184663 | |||
| 1715 | Ga0207645_10004594 | |||
| 1716 | Ga0207645_10035378 | |||
| 1717 | Ga0207645_10053447 | |||
| 1718 | Ga0207645_10248825 | |||
| 1719 | Ga0207643_10024553 | |||
| 1720 | Ga0207643_10108802 | |||
| 1721 | Ga0207643_10110034 | |||
| 1722 | Ga0207643_10281611 | |||
| 1723 | Ga0207705_10343111 | |||
| 1724 | Ga0207684_10310836 | |||
| 1725 | Ga0207684_10456304 | |||
| 1726 | Ga0207707_10069378 | |||
| 1727 | Ga0207707_10163778 | |||
| 1728 | Ga0207707_10452630 | |||
| 1729 | Ga0207707_10613297 | |||
| 1730 | Ga0207663_10405827 | |||
| 1731 | Ga0207660_10150917 | |||
| 1732 | Ga0207660_10450979 | |||
| 1733 | Ga0207660_10466041 | |||
| 1734 | Ga0207662_10005423 | |||
| 1735 | Ga0207662_10025147 | |||
| 1736 | Ga0207662_10034667 | |||
| 1737 | Ga0207662_10051510 | |||
| 1738 | Ga0207662_10103048 | |||
| 1739 | Ga0207657_10022547 | |||
| 1740 | Ga0207649_10203821 | |||
| 1741 | Ga0207649_10598373 | |||
| 1742 | Ga0207649_10802681 | |||
| 1743 | Ga0207649_10868122 | |||
| 1744 | Ga0207652_10367831 | |||
| 1745 | Ga0207652_10497063 | |||
| 1746 | Ga0207652_10894023 | |||
| 1747 | Ga0207646_10115578 | |||
| 1748 | Ga0207646_10561833 | |||
| 1749 | Ga0207646_10603016 | |||
| 1750 | Ga0207646_10834707 | |||
| 1751 | Ga0207681_10008707 | |||
| 1752 | Ga0207681_10013330 | |||
| 1753 | Ga0207681_10024192 | |||
| 1754 | Ga0207681_10081865 | |||
| 1755 | Ga0207681_10086195 | |||
| 1756 | Ga0207681_10426432 | |||
| 1757 | Ga0207694_10039824 | |||
| 1758 | Ga0207650_10017449 | |||
| 1759 | Ga0207650_10032475 | |||
| 1760 | Ga0207650_10033559 | |||
| 1761 | Ga0207650_10158277 | |||
| 1762 | Ga0207650_10246634 | |||
| 1763 | Ga0207650_10380515 | |||
| 1764 | Ga0207650_10508961 | |||
| 1765 | Ga0207650_10566226 | |||
| 1766 | Ga0207659_10007390 | |||
| 1767 | Ga0207659_10008018 | |||
| 1768 | Ga0207659_10010018 | |||
| 1769 | Ga0207659_10021094 | |||
| 1770 | Ga0207659_10027258 | |||
| 1771 | Ga0207659_10030245 | |||
| 1772 | Ga0207659_10032184 | |||
| 1773 | Ga0207659_10043333 | |||
| 1774 | Ga0207659_10160998 | |||
| 1775 | Ga0207659_10220799 | |||
| 1776 | Ga0207659_10221507 | |||
| 1777 | Ga0207659_10690721 | |||
| 1778 | Ga0207659_10959977 | |||
| 1779 | Ga0207687_10278807 | |||
| 1780 | Ga0207700_10025586 | |||
| 1781 | Ga0207700_10096832 | |||
| 1782 | Ga0207664_10083847 | |||
| 1783 | Ga0207644_10014892 | |||
| 1784 | Ga0207644_10046017 | |||
| 1785 | Ga0207644_10051648 | |||
| 1786 | Ga0207644_10126158 | |||
| 1787 | Ga0207644_10164826 | |||
| 1788 | Ga0207644_10469373 | |||
| 1789 | Ga0207690_10034638 | |||
| 1790 | Ga0207690_10530889 | |||
| 1791 | Ga0207690_10592061 | |||
| 1792 | Ga0207690_10732140 | |||
| 1793 | Ga0207706_10020541 | |||
| 1794 | Ga0207706_10057235 | |||
| 1795 | Ga0207706_10069771 | |||
| 1796 | Ga0207706_10147617 | |||
| 1797 | Ga0207706_10287584 | |||
| 1798 | Ga0207706_10431208 | |||
| 1799 | Ga0207706_10543769 | |||
| 1800 | Ga0207686_10004823 | |||
| 1801 | Ga0207686_10010168 | |||
| 1802 | Ga0207709_10043457 | |||
| 1803 | Ga0207670_10007315 | |||
| 1804 | Ga0207670_10033380 | |||
| 1805 | Ga0207670_10129052 | |||
| 1806 | Ga0207670_10130889 | |||
| 1807 | Ga0207670_10526464 | |||
| 1808 | Ga0207669_10003629 | |||
| 1809 | Ga0207669_10353452 | |||
| 1810 | Ga0207704_10004553 | |||
| 1811 | Ga0207704_10244239 | |||
| 1812 | Ga0207704_10306567 | |||
| 1813 | Ga0207704_10554767 | |||
| 1814 | Ga0207691_10005081 | |||
| 1815 | Ga0207691_10020402 | |||
| 1816 | Ga0207691_10033960 | |||
| 1817 | Ga0207691_10125117 | |||
| 1818 | Ga0207691_10159481 | |||
| 1819 | Ga0207691_10170934 | |||
| 1820 | Ga0207691_10346129 | |||
| 1821 | Ga0207711_10076375 | |||
| 1822 | Ga0207711_10098006 | |||
| 1823 | Ga0207711_10162148 | |||
| 1824 | Ga0207711_10247638 | |||
| 1825 | Ga0207711_10288454 | |||
| 1826 | Ga0207711_10405477 | |||
| 1827 | Ga0207711_10571281 | |||
| 1828 | Ga0207689_10000703 | |||
| 1829 | Ga0207689_10049219 | |||
| 1830 | Ga0207689_10166670 | |||
| 1831 | Ga0207689_10525250 | |||
| 1832 | Ga0207689_10582927 | |||
| 1833 | Ga0207661_10021298 | |||
| 1834 | Ga0207661_10088211 | |||
| 1835 | Ga0207679_10019097 | |||
| 1836 | Ga0207679_10027486 | |||
| 1837 | Ga0207679_10038385 | |||
| 1838 | Ga0207679_10065549 | |||
| 1839 | Ga0207679_10330254 | |||
| 1840 | Ga0207679_10372359 | |||
| 1841 | Ga0207679_10697914 | |||
| 1842 | Ga0207679_10741519 | |||
| 1843 | Ga0207667_10645896 | |||
| 1844 | Ga0207651_10001279 | |||
| 1845 | Ga0207651_10004812 | |||
| 1846 | Ga0207651_10006276 | |||
| 1847 | Ga0207651_10010393 | |||
| 1848 | Ga0207651_10107666 | |||
| 1849 | Ga0207651_10146281 | |||
| 1850 | Ga0207651_10295301 | |||
| 1851 | Ga0207712_10158070 | |||
| 1852 | Ga0207712_10165955 | |||
| 1853 | Ga0207668_10716859 | |||
| 1854 | Ga0207640_10068820 | |||
| 1855 | Ga0207658_10986458 | |||
| 1856 | Ga0207677_10396486 | |||
| 1857 | Ga0207677_10670379 | |||
| 1858 | Ga0207703_10008901 | |||
| 1859 | Ga0207703_10014124 | |||
| 1860 | Ga0207703_10399331 | |||
| 1861 | Ga0207639_10179525 | |||
| 1862 | Ga0207639_10423946 | |||
| 1863 | Ga0207639_10527391 | |||
| 1864 | Ga0207639_10600752 | |||
| 1865 | Ga0207678_10011333 | |||
| 1866 | Ga0207678_10200574 | |||
| 1867 | Ga0207678_10412680 | |||
| 1868 | Ga0207678_10595176 | |||
| 1869 | Ga0207708_10010094 | |||
| 1870 | Ga0207708_10022919 | |||
| 1871 | Ga0207708_10041433 | |||
| 1872 | Ga0207708_10086907 | |||
| 1873 | Ga0207708_10122803 | |||
| 1874 | Ga0207708_10437763 | |||
| 1875 | Ga0207641_10040685 | |||
| 1876 | Ga0207641_10104928 | |||
| 1877 | Ga0207641_10121883 | |||
| 1878 | Ga0207641_10192305 | |||
| 1879 | Ga0207641_10771710 | |||
| 1880 | Ga0207648_10000673 | |||
| 1881 | Ga0207648_10006552 | |||
| 1882 | Ga0207648_10009477 | |||
| 1883 | Ga0207648_10040716 | |||
| 1884 | Ga0207648_10198396 | |||
| 1885 | Ga0207648_10791783 | |||
| 1886 | Ga0207676_10008591 | |||
| 1887 | Ga0207676_10050636 | |||
| 1888 | Ga0207676_10166369 | |||
| 1889 | Ga0207676_10228133 | |||
| 1890 | Ga0207676_10246540 | |||
| 1891 | Ga0207676_10403074 | |||
| 1892 | Ga0207676_10456966 | |||
| 1893 | Ga0207674_10048609 | |||
| 1894 | Ga0207674_10052104 | |||
| 1895 | Ga0207674_10068694 | |||
| 1896 | Ga0207674_10190844 | |||
| 1897 | Ga0207674_10371793 | |||
| 1898 | Ga0207675_100002515 | |||
| 1899 | Ga0207675_100029915 | |||
| 1900 | Ga0207675_100148576 | |||
| 1901 | Ga0207675_100254044 | |||
| 1902 | Ga0207675_100297635 | |||
| 1903 | Ga0207675_101047576 | |||
| 1904 | Ga0207683_10113736 | |||
| 1905 | Ga0207683_10119695 | |||
| 1906 | Ga0207683_10184931 | |||
| 1907 | Ga0207683_10196526 | |||
| 1908 | Ga0207683_10256887 | |||
| 1909 | Ga0207683_10580280 | |||
| 1910 | Ga0207683_11001144 | |||
| 1911 | Ga0207698_10053233 | |||
| 1912 | Ga0207698_10240694 | |||
| 1913 | Ga0207698_10310365 | |||
| 1914 | Ga0207698_10865600 | |||
| 1915 | Ga0207698_11177714 | |||
| 1916 | Ga0209996_1011026 | |||
| 1917 | Ga0210002_1021058 | |||
| 1918 | Ga0209966_1060347 | |||
| 1919 | Ga0209998_10034810 | |||
| 1920 | Ga0209998_10079742 | |||
| 1921 | Ga0209813_10023277 | |||
| 1922 | Ga0209813_10074658 | |||
| 1923 | Ga0209974_10018907 | |||
| 1924 | Ga0209974_10057826 | |||
| 1925 | Ga0209974_10075493 | |||
| 1926 | Ga0207428_10000349 | |||
| 1927 | Ga0207428_10003450 | |||
| 1928 | Ga0207428_10005208 | |||
| 1929 | Ga0207428_10005628 | |||
| 1930 | Ga0207428_10012698 | |||
| 1931 | Ga0207428_10035075 | |||
| 1932 | Ga0207428_10036649 | |||
| 1933 | Ga0207428_10041523 | |||
| 1934 | Ga0207428_10152118 | |||
| 1935 | Ga0207428_10525104 | |||
| 1936 | Ga0207428_10634701 | |||
| 1937 | Ga0268266_10113043 | |||
| 1938 | Ga0268266_10493739 | |||
| 1939 | Ga0268266_10555242 | |||
| 1940 | Ga0268266_10578787 | |||
| 1941 | Ga0268265_10000519 | |||
| 1942 | Ga0268265_10203017 | |||
| 1943 | Ga0268265_10548784 | |||
| 1944 | Ga0268265_10628947 | |||
| 1945 | Ga0268265_10721010 | |||
| 1946 | Ga0268265_10975935 | |||
| 1947 | Ga0268264_10009523 | |||
| 1948 | Ga0268264_10130632 | |||
| 1949 | Ga0268264_10480493 | |||
| 1950 | Ga0268264_10511647 | |||
| 1951 | Ga0307408_100065455 | |||
| 1952 | Ga0307408_100089360 | |||
| 1953 | Ga0307408_100135496 | |||
| 1954 | Ga0307408_100249158 | |||
| 1955 | Ga0307408_100251643 | |||
| 1956 | Ga0307408_100630042 | |||
| 1957 | Ga0307405_10008615 | |||
| 1958 | Ga0307405_10177467 | |||
| 1959 | Ga0307405_10201069 | |||
| 1960 | Ga0307405_10622377 | |||
| 1961 | Ga0307413_10016358 | |||
| 1962 | Ga0307413_10036097 | |||
| 1963 | Ga0307410_10000911 | |||
| 1964 | Ga0307410_10308312 | |||
| 1965 | Ga0307406_10012013 | |||
| 1966 | Ga0307406_10083708 | |||
| 1967 | Ga0307406_10647963 | |||
| 1968 | Ga0307407_10000944 | |||
| 1969 | Ga0307407_10083882 | |||
| 1970 | Ga0307407_10261282 | |||
| 1971 | Ga0307407_10483966 | |||
| 1972 | Ga0307412_10024414 | |||
| 1973 | Ga0307412_10036410 | |||
| 1974 | Ga0307412_10039142 | |||
| 1975 | Ga0307412_10509178 | |||
| 1976 | Ga0307412_11071986 | |||
| 1977 | Ga0307409_100050628 | |||
| 1978 | Ga0307409_100082465 | |||
| 1979 | Ga0307409_100108686 | |||
| 1980 | Ga0307409_101286785 | |||
| 1981 | Ga0307416_100014150 | |||
| 1982 | Ga0307416_100026266 | |||
| 1983 | Ga0307416_100044303 | |||
| 1984 | Ga0307416_100168429 | |||
| 1985 | Ga0307416_100250736 | |||
| 1986 | Ga0307416_100905517 | |||
| 1987 | Ga0307414_10002043 | |||
| 1988 | Ga0307414_10402545 | |||
| 1989 | Ga0307411_10006132 | |||
| 1990 | Ga0307411_10134026 | |||
| 1991 | Ga0307411_10149847 | |||
| 1992 | Ga0307411_10162091 | |||
| 1993 | Ga0307411_10254308 | |||
| 1994 | Ga0307411_11092553 | |||
| 1995 | Ga0307415_100002052 | |||
| 1996 | Ga0307415_100027267 | |||
| 1997 | Ga0307415_100630628 | |||
| 1998 | Ga0307415_100735539 | |||
| 1999 | Ga0373930_0000356 | |||
| 2000 | Ga0373950_0001243 | |||
| 2001 | Ga0373958_0006007 | |||
| 2002 | Ga0373959_0002318 | |||
| 2003 | Ga0373938_0000948 | |||
| 2004 | Ga0373926_0048702 | |||
| 2005 | Ga0373929_0000732 | |||
| 2006 | Ga0373940_0002332 | |||
| 2007 | Ga0373949_0002529 | |||
| 2008 | Ga0373949_0114111 | |||
| 2009 | Ga0373951_0004765 | |||
| 2010 | Ga0373951_0037584 | |||
| 2011 | Ga0373952_0002090 | |||
| 2012 | Ga0373932_0000253 | |||
| 2013 | Ga0373939_0000222 | |||
| 2014 | Ga0373939_0024504 | |||
| 2015 | Ga0373941_0002599 | |||
| 2016 | Ga0373954_0295236 | |||
| 2017 | Ga0373957_0097233 | |||
| 2018 | Ga0373960_0000140 | |||
| 2019 | Ga0373955_0076672 | |||
| 2020 | Ga0373942_0001204 | |||
| 2021 | Ga0373961_0003469 | |||
| 2022 | Ga0373961_0112391 | |||
| 2023 | Ga0373961_0274970 | |||
| 2024 | Ga0373962_0004435 | |||
| 2025 | Ga0373924_0068173 | |||
| 2026 | Ga0373931_0000392 | |||
| 2027 | Ga0373931_0084131 | |||
| 2028 | Ga0373935_0089099 | |||
| 2029 | Ga0373935_0091430 | |||
| 2030 | Ga0373947_0088555 | |||
| 2031 | Ga0373937_0008316 | |||
| 2032 | Ga0373937_0382666 | |||
| 2033 | Ga0373937_1332252 | |||
| 2034 | Ga0373925_0349694 | |||
| 2035 | Ga0436365_0576031 | |||
| 2036 | Ga0439439_0011548 | |||
| 2037 | Ga0451853_1505645 | |||
| 2038 | Ga0439431_0066619 | |||
| 2039 | Ga0439433_0081151 | |||
| 2040 | Ga0439441_008890 | |||
| 2041 | Ga0439441_035430 | |||
| 2042 | Ga0439445_0100429 | |||
| 2043 | Ga0439450_101993 | |||
| 2044 | Ga0439462_0042177 | |||
| 2045 | Ga0450919_009265 | |||
| 2046 | Ga0450897_011728 | |||
| 2047 | Ga0450895_000346 | |||
| 2048 | Ga0450896_000186 | |||
| 2049 | Ga0439446_0019962 | |||
| 2050 | Ga0439446_0060214 | |||
| 2051 | Ga0439446_0094437 | |||
| 2052 | Ga0439435_0053751 | |||
| 2053 | Ga0439459_0061707 | |||
| 2054 | Ga0439464_0000519 | |||
| 2055 | Ga0439460_0078517 | |||
| 2056 | Ga0451577_0072273 | |||
| 2057 | Ga0453683_0196183 | |||
| 2058 | Ga0453684_0162310 | |||
| 2059 | Ga0453684_1277048 | |||
| 2060 | Ga0466960_0291055 | |||
| 2061 | Ga0451576_0013723 | |||
| 2062 | Ga0451576_0020147 | |||
| 2063 | Ga0451576_0046638 | |||
| 2064 | Ga0451576_0103613 | |||
| 2065 | Ga0451576_0228494 | |||
| 2066 | Ga0451576_0381993 | |||
| 2067 | Ga0451576_0659732 | |||
| 2068 | Ga0451576_0985048 | |||
| 2069 | Ga0495603_0265018 | |||
| 2070 | Ga0495629_0020693 | |||
| 2071 | Ga0495580_0629010 | |||
| 2072 | Ga0495582_0224711 | |||
| 2073 | Ga0495664_0257626 | |||
| 2074 | Ga0495584_0140955 | |||
| 2075 | Ga0495594_0020414 | |||
| 2076 | Ga0495607_0383239 | |||
| 2077 | Ga0495618_0280578 | |||
| 2078 | Ga0495630_0343216 | |||
| 2079 | Ga0495663_0058397 | |||
| 2080 | Ga0495642_0002056 | |||
| 2081 | Ga0495642_0173897 | |||
| 2082 | Ga0495652_0392397 | |||
| 2083 | Ga0495665_0211205 | |||
| 2084 | Ga0495598_0007811 | |||
| 2085 | Ga0495598_0085363 | |||
| 2086 | Ga0495609_0130377 | |||
| 2087 | Ga0495609_0140583 | |||
| 2088 | Ga0495609_0184846 | |||
| 2089 | Ga0495621_0003258 | |||
| 2090 | Ga0495621_0004461 | |||
| 2091 | Ga0495621_0014298 | |||
| 2092 | Ga0495621_0028280 | |||
| 2093 | Ga0495621_0139691 | |||
| 2094 | Ga0495621_0258141 | |||
| 2095 | Ga0495645_0283572 | |||
| 2096 | Ga0495633_0113338 | |||
| 2097 | Ga0495656_0054797 | |||
| 2098 | Ga0495656_0103580 | |||
| 2099 | Ga0495656_0113304 | |||
| 2100 | Ga0495635_0473677 | |||
| 2101 | Ga0495659_0002800 | |||
| 2102 | Ga0495659_0026521 | |||
| 2103 | Ga0495659_0070287 | |||
| 2104 | Ga0495659_0235494 | |||
| 2105 | Ga0495599_0378343 | |||
| 2106 | Ga0495647_0032716 | |||
| 2107 | Ga0495647_0129223 | |||
| 2108 | Ga0495647_0158415 | |||
| 2109 | Ga0495647_0336446 | |||
| 2110 | Ga0495647_0336621 | |||
| 2111 | Ga0495658_0119915 | |||
| 2112 | Ga0495658_0206620 | |||
| 2113 | Ga0495669_0010057 | |||
| 2114 | Ga0495669_0215121 | |||
| 2115 | Ga0495613_0166310 | |||
| 2116 | Ga0495670_0085003 | |||
| 2117 | Ga0495670_0270113 | |||
| 2118 | Ga0495600_0109254 | |||
| 2119 | Ga0495604_0696754 | |||
| 2120 | Ga0495636_0003385 | |||
| 2121 | Ga0495636_0158635 | |||
| 2122 | Ga0495636_0345500 | |||
| 2123 | Ga0495676_0047401 | |||
| 2124 | Ga0495676_0378791 | |||
| 2125 | Ga0495677_0016077 | |||
| 2126 | Ga0495677_0020482 | |||
| 2127 | Ga0495685_125016 | |||
| 2128 | Ga0495684_0594769 | |||
| 2129 | Ga0496102_0117233 | |||
| 2130 | Ga0496102_0210944 | |||
| 2131 | Ga0496103_0069099 | |||
| 2132 | Ga0496104_0016124 | |||
| 2133 | Ga0496104_1132748 | |||
| 2134 | Ga0496105_0137438 | |||
| 2135 | Ga0496105_0734154 | |||
| 2136 | Ga0496106_0046891 | |||
| 2137 | Ga0496106_0182397 | |||
| 2138 | Ga0496106_0359321 | |||
| 2139 | Ga0496106_0722048 | |||
| 2140 | Ga0496106_0826734 | |||
| 2141 | Ga0496107_0114548 | |||
| 2142 | Ga0496107_0396602 | |||
| 2143 | Ga0496108_0023020 | |||
| 2144 | Ga0496109_0001647 | |||
| 2145 | Ga0496109_0014534 | |||
| 2146 | Ga0496109_0066884 | |||
| 2147 | Ga0496110_0096471 | |||
| 2148 | Ga0496111_0108094 | |||
| 2149 | Ga0496112_0030569 | |||
| 2150 | Ga0496112_0114530 | |||
| 2151 | Ga0496112_0238020 | |||
| 2152 | Ga0496113_0570161 | |||
| 2153 | Ga0496113_0602831 | |||
| 2154 | Ga0496114_0657165 | |||
| 2155 | Ga0501291_053180 | |||
| 2156 | Ga0501299_009817 | |||
| 2157 | Ga0501031_0487721 | |||
| 2158 | Ga0501032_0549707 | |||
| 2159 | Ga0501033_0014390 | |||
| 2160 | Ga0501033_0626422 | |||
| 2161 | Ga0501034_0005914 | |||
| 2162 | Ga0501034_0494402 | |||
| 2163 | Ga0501036_0063837 | |||
| 2164 | Ga0501036_0132452 | |||
| 2165 | Ga0501036_0227136 | |||
| 2166 | Ga0501037_0314022 | |||
| 2167 | Ga0501038_0122937 | |||
| 2168 | Ga0501039_0054444 | |||
| 2169 | Ga0501039_0252703 | |||
| 2170 | Ga0501039_0330237 | |||
| 2171 | Ga0501039_0544276 | |||
| 2172 | Ga0501040_0006318 | |||
| 2173 | Ga0501041_0006853 | |||
| 2174 | Ga0501041_0013075 | |||
| 2175 | Ga0501041_0018723 | |||
| 2176 | Ga0501041_0051930 | |||
| 2177 | Ga0501042_0006197 | |||
| 2178 | Ga0501042_0015233 | |||
| 2179 | Ga0501042_0020353 | |||
| 2180 | Ga0501042_0020929 | |||
| 2181 | Ga0501042_0098722 | |||
| 2182 | Ga0501043_0006595 | |||
| 2183 | Ga0501046_0004640 | |||
| 2184 | Ga0501046_0038789 | |||
| 2185 | Ga0501046_0053339 | |||
| 2186 | Ga0501047_0001540 | |||
| 2187 | Ga0501047_0110130 | |||
| 2188 | Ga0501048_0012443 | |||
| 2189 | Ga0501048_0052509 | |||
| 2190 | Ga0501067_0018986 | |||
| 2191 | Ga0501067_0023538 | |||
| 2192 | Ga0501067_0049932 | |||
| 2193 | Ga0501068_0006551 | |||
| 2194 | Ga0501069_0234055 | |||
| 2195 | Ga0501071_0006349 | |||
| 2196 | Ga0501071_0035628 | |||
| 2197 | Ga0501071_0073431 | |||
| 2198 | Ga0501071_0076173 | |||
| 2199 | Ga0501071_0134716 | |||
| 2200 | Ga0501071_0389009 | |||
| 2201 | Ga0501072_0017724 | |||
| 2202 | Ga0501072_0027623 | |||
| 2203 | Ga0501072_0032613 | |||
| 2204 | Ga0501072_0119520 | |||
| 2205 | Ga0501072_0154007 | |||
| 2206 | Ga0501073_0005759 | |||
| 2207 | Ga0501073_0153552 | |||
| 2208 | Ga0501074_0729861 | |||
| 2209 | Ga0501075_0007940 | |||
| 2210 | Ga0501075_0067558 | |||
| 2211 | Ga0501075_0100545 | |||
| 2212 | Ga0501075_0111471 | |||
| 2213 | Ga0501076_0015426 | |||
| 2214 | Ga0501076_0025535 | |||
| 2215 | Ga0501076_0059433 | |||
| 2216 | Ga0501076_0075363 | |||
| 2217 | Ga0501076_0117301 | |||
| 2218 | Ga0501076_0219768 | |||
| 2219 | Ga0501076_0381602 | |||
| 2220 | Ga0501076_0448068 | |||
| 2221 | Ga0501077_0037308 | |||
| 2222 | Ga0501077_0068297 | |||
| 2223 | Ga0501077_0092256 | |||
| 2224 | Ga0501077_0144334 | |||
| 2225 | Ga0501217_161327 | |||
| 2226 | Ga0501248_027713 | |||
| 2227 | Ga0501257_108902 | |||
| 2228 | Ga0501258_022680 | |||
| 2229 | Ga0501079_0004350 | |||
| 2230 | Ga0501080_0019013 | |||
| 2231 | Ga0501080_0193555 | |||
| 2232 | Ga0501080_0484347 | |||
| 2233 | Ga0501081_0001655 | |||
| 2234 | Ga0501081_0006802 | |||
| 2235 | Ga0501081_0022215 | |||
| 2236 | Ga0501081_0094635 | |||
| 2237 | Ga0501081_0134587 | |||
| 2238 | Ga0501083_0175041 | |||
| 2239 | Ga0501272_037663 | |||
| 2240 | Ga0501035_0420125 | |||
| 2241 | Ga0501044_0010321 | |||
| 2242 | Ga0501045_0007123 | |||
| 2243 | Ga0501045_0034948 | |||
| 2244 | Ga0501045_0045745 | |||
| 2245 | Ga0501045_0048697 | |||
| 2246 | nmdc:mga03683_22921_c1 | |||
| 2247 | nmdc:mga00v17_284497_c1 | |||
| 2248 | nmdc:mga00v17_417742_c1 | |||
| 2249 | nmdc:mga00v17_4521_c1 | |||
| 2250 | nmdc:mga0yw44_145505_c1 | |||
| 2251 | nmdc:mga0yw44_41109_c1 | |||
| 2252 | nmdc:mga0k408_10386_c1 | |||
| 2253 | nmdc:mga0k408_12220_c2 | |||
| 2254 | nmdc:mga06z11_11337_c1 | |||
| 2255 | nmdc:mga06z11_120415_c1 | |||
| 2256 | nmdc:mga06z11_348884_c1 | |||
| 2257 | nmdc:mga04h51_38816_c1 | |||
| 2258 | nmdc:mga04h51_50780_c1 | |||
| 2259 | nmdc:mga07m45_16034_c1 | |||
| 2260 | nmdc:mga07m45_408316_c1 | |||
| 2261 | nmdc:mga05p37_10153_c1 | |||
| 2262 | nmdc:mga05p37_111875_c1 | |||
| 2263 | nmdc:mga05p37_139386_c1 | |||
| 2264 | nmdc:mga05p37_185800_c1 | |||
| 2265 | nmdc:mga05p37_201663_c1 | |||
| 2266 | nmdc:mga05p37_23032_c1 | |||
| 2267 | nmdc:mga05p37_261404_c1 | |||
| 2268 | nmdc:mga05p37_285821_c1 | |||
| 2269 | nmdc:mga05p37_39815_c1 | |||
| 2270 | nmdc:mga05p37_77425_c2 | |||
| 2271 | nmdc:mga05p37_832_c1 | |||
| 2272 | nmdc:mga05p37_853308_c1 | |||
| 2273 | nmdc:mga09592_1002_c1 | |||
| 2274 | nmdc:mga09592_141198_c1 | |||
| 2275 | nmdc:mga09592_151982_c1 | |||
| 2276 | nmdc:mga09592_195157_c1 | |||
| 2277 | nmdc:mga09592_199858_c1 | |||
| 2278 | nmdc:mga09592_249213_c1 | |||
| 2279 | nmdc:mga09592_274867_c1 | |||
| 2280 | nmdc:mga09592_35614_c1 | |||
| 2281 | nmdc:mga09592_545731_c1 | |||
| 2282 | nmdc:mga09592_63536_c1 | |||
| 2283 | nmdc:mga09592_79977_c1 | |||
| 2284 | nmdc:mga09592_80349_c1 | |||
| 2285 | nmdc:mga09592_95370_c1 | |||
| 2286 | nmdc:mga0qj67_1417_c1 | |||
| 2287 | nmdc:mga0qj67_18686_c1 | |||
| 2288 | nmdc:mga0qj67_227797_c1 | |||
| 2289 | nmdc:mga0qj67_26931_c1 | |||
| 2290 | nmdc:mga0qj67_292548_c1 | |||
| 2291 | nmdc:mga0qj67_3358_c1 | |||
| 2292 | nmdc:mga0qj67_5858_c1 | |||
| 2293 | nmdc:mga0qj67_61581_c1 | |||
| 2294 | nmdc:mga06r32_20469_c1 | |||
| 2295 | nmdc:mga06r32_406025_c1 | |||
| 2296 | nmdc:mga06r32_495032_c1 | |||
| 2297 | nmdc:mga06r32_56689_c1 | |||
| 2298 | nmdc:mga06r32_591860_c1 | |||
| 2299 | nmdc:mga08y16_1178741_c1 | |||
| 2300 | nmdc:mga08y16_120198_c1 | |||
| 2301 | nmdc:mga08y16_129071_c1 | |||
| 2302 | nmdc:mga08y16_148625_c1 | |||
| 2303 | nmdc:mga08y16_19430_c1 | |||
| 2304 | nmdc:mga08y16_226_c1 | |||
| 2305 | nmdc:mga08y16_283677_c1 | |||
| 2306 | nmdc:mga08y16_31614_c1 | |||
| 2307 | nmdc:mga08y16_3914_c1 | |||
| 2308 | nmdc:mga08y16_429568_c1 | |||
| 2309 | nmdc:mga08y16_438204_c1 | |||
| 2310 | nmdc:mga08y16_55022_c1 | |||
| 2311 | nmdc:mga08y16_611_c1 | |||
| 2312 | nmdc:mga08y16_64596_c1 | |||
| 2313 | nmdc:mga08y16_65571_c1 | |||
| 2314 | nmdc:mga08y16_73278_c1 | |||
| 2315 | nmdc:mga08y16_76939_c1 | |||
| 2316 | nmdc:mga0n895_100417_c1 | |||
| 2317 | nmdc:mga0n895_149457_c1 | |||
| 2318 | nmdc:mga0n895_15190_c1 | |||
| 2319 | nmdc:mga0n895_211948_c1 | |||
| 2320 | nmdc:mga0n895_220208_c1 | |||
| 2321 | nmdc:mga0n895_353939_c1 | |||
| 2322 | nmdc:mga0n895_37875_c1 | |||
| 2323 | nmdc:mga0n895_423852_c1 | |||
| 2324 | nmdc:mga0n895_4706_c1 | |||
| 2325 | nmdc:mga0n895_48966_c1 | |||
| 2326 | nmdc:mga0n895_73604_c1 | |||
| 2327 | nmdc:mga0n895_8390_c1 | |||
| 2328 | nmdc:mga0rr50_206299_c1 | |||
| 2329 | nmdc:mga0rr50_209204_c1 | |||
| 2330 | nmdc:mga0rr50_326_c1 | |||
| 2331 | nmdc:mga0rr50_587989_c1 | |||
| 2332 | nmdc:mga0rr50_72999_c1 | |||
| 2333 | nmdc:mga0rr50_98008_c1 | |||
| 2334 | nmdc:mga08x19_104729_c1 | |||
| 2335 | nmdc:mga08x19_30526_c1 | |||
| 2336 | nmdc:mga08x19_448312_c1 | |||
| 2337 | nmdc:mga0a205_118408_c1 | |||
| 2338 | nmdc:mga0a205_129789_c2 | |||
| 2339 | nmdc:mga0a205_13661_c1 | |||
| 2340 | nmdc:mga0a205_139895_c1 | |||
| 2341 | nmdc:mga0a205_22780_c1 | |||
| 2342 | nmdc:mga0a205_242599_c1 | |||
| 2343 | nmdc:mga0a205_325980_c1 | |||
| 2344 | nmdc:mga0a205_375535_c1 | |||
| 2345 | nmdc:mga0a205_39003_c1 | |||
| 2346 | nmdc:mga0a205_42456_c1 | |||
| 2347 | nmdc:mga0a205_492_c1 | |||
| 2348 | nmdc:mga0a205_852108_c1 | |||
| 2349 | nmdc:mga0a205_87481_c1 | |||
| 2350 | Ga0495601_0178922 | |||
| 2351 | Ga0495619_0033905 | |||
| 2352 | Ga0495619_0298516 | |||
| 2353 | Ga0495619_0332242 | |||
| 2354 | Ga0500646_0001828 | |||
| 2355 | Ga0500593_188451 | |||
| 2356 | Ga0501084_0025967 | |||
| 2357 | Ga0501084_0025977 | |||
| 2358 | Ga0501084_0044608 | |||
| 2359 | Ga0501084_0090716 | |||
| 2360 | Ga0501084_0504336 | |||
| 2361 | Ga0501084_0958622 | |||
| 2362 | Ga0590071_000034 | |||
| 2363 | Ga0590071_032415 | |||
| 2364 | Ga0590071_060376 | |||
| 2365 | Ga0590074_001837 | |||
| 2366 | Ga0590074_023055 | |||
| 2367 | Ga0590075_000217 | |||
| 2368 | Ga0590075_001190 | |||
| 2369 | Ga0590077_000401 | |||
| 2370 | Ga0590077_001039 | |||
| 2371 | Ga0590077_046680 | |||
| 2372 | Ga0501082_0015906 | |||
| 2373 | Ga0501082_0165187 | |||
| 2374 | Ga0530510_0002263 | |||
| 2375 | Ga0530510_0038412 | |||
| 2376 | Ga0530510_0327605 | |||
| 2377 | Ga0530510_0445896 | |||
| 2378 | Ga0530510_0683008 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5o8y-assembly1.cif.gz_D | conformational dynamism for dna interaction in salmonella typhimurium rcsb response regulator. | 0.9649 | 135 | 178 |
| 4lup-assembly2.cif.gz_C | crystal structure of the complex formed by region of e. coli sigmae bound to its -10 element non template strand | 0.9544 | 1 | 90 |
| 7vim-assembly1.cif.gz_A | the c-terminal dna binding domain of esrb from edwardsiella piscicida | 0.9525 | 135 | 185 |
| 6jhe-assembly1.cif.gz_A | crystal structure of bacillus subtilis sigw domain 4 in complexed with -35 element dna | 0.9493 | 135 | 182 |
| 3vep-assembly4.cif.gz_H | crystal structure of sigd4 in complex with its negative regulator rsda | 0.943 | 129 | 184 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4lupC00 | Mainly Alpha;Orthogonal Bundle;Rna Polymerase Sigma Factor; Chain: A;RNA polymerase sigma factor, region 2, helix turn helix motif | 0.9544 | 1 | 90 | 1.10.1740.10 |
| 1or7A02 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9525 | 121 | 183 | 1.10.10.10 |
| 4lupA00 | Mainly Alpha;Orthogonal Bundle;Rna Polymerase Sigma Factor; Chain: A;RNA polymerase sigma factor, region 2, helix turn helix motif | 0.9515 | 3 | 90 | 1.10.1740.10 |
| 1or7B01 | Mainly Alpha;Orthogonal Bundle;Rna Polymerase Sigma Factor; Chain: A;RNA polymerase sigma factor, region 2, helix turn helix motif | 0.9497 | 5 | 90 | 1.10.1740.10 |
| 1or7B02 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.947 | 121 | 184 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1F3LVY6-F1-model_v4 | RNA polymerase sigma-70 factor | 0.7581 | 1 | 189 |
GO:0003677
GO:0006352 GO:0016987 |
| AF-A0A1F3LVY6-F1-model_v4 | RNA polymerase sigma-70 factor | 0.7385 | 1 | 189 |
GO:0003677
GO:0006352 GO:0016987 |
| AF-A0A7C1EMC1-F1-model_v4 | RNA polymerase sigma factor | 0.6198 | 1 | 193 |
GO:0003677
GO:0004518 GO:0006352 GO:0016987 |
| AF-A0A7C1EMC1-F1-model_v4 | RNA polymerase sigma factor | 0.6168 | 1 | 193 |
GO:0003677
GO:0004518 GO:0006352 GO:0016987 |
| AF-A0A2E0VT81-F1-model_v4 | RNA polymerase subunit sigma-24 | 0.6127 | 1 | 193 |
GO:0003677
GO:0006352 GO:0016987 |