F491399
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1187 | 472 | 1185 | 329 |
Family's Representative Sequence
| Representative Sequence | 3300005937|Ga0081455_10007107|Ga0081455_100071078 |
| Length | 360 |
| Sequence | VGIQSPHFSFGELLPWIPAFAGMSEKVPAMSVASRSAAMTPQGYLQAQSRWHPLEIAFWLATLLPFVLFPNYLSLASQIAITALFALSLDIILGYAGVVSLGHAAFFGIGAYSAGLLAKHGWGEPLTGLVAATAIAGLVGFAVSFMIARFRHFTLIMITLGLGLLAFEAANRAHWLTGGSDGLQGVSMWPVLGLFKFDLYGYTAYTYSLVVLFLVFLGARRLINSPFGLALRGIRENWVRMPAIGADSLAHIRKAYTIAAAMAGLAGALLTQTTESVSLESISFQRSADVLVMLVLGGAGRLYGGLIGAIIFMVARDQFSGIAPQYWYFWIGVLLVAVVMVLPNGILGGLSHFYARWRGK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 2 | 2643221547 | Pseudolabrys sp. Root1462 | Isolate | Unclassified |
| 3 | 2808606418 | Herbaspirillum sp. SJZ107 | Isolate | Rhizosphere |
| 4 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 5 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 6 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 7 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 8 | 3300000045 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere | Metagenome | Rhizosphere |
| 9 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 10 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 11 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 12 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 13 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 14 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 15 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 16 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 17 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 18 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 19 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 20 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 21 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 22 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 23 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 29 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 33 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 35 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 46 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 63 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 64 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 65 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 68 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 69 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 70 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 71 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 73 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 74 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 78 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 79 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 81 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 82 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 83 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 85 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 86 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 87 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 88 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 89 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 90 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 91 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 92 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 93 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 94 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 95 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 96 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 97 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 98 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 100 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 101 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 102 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 103 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 104 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 105 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 106 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 107 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 109 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 110 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 111 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 112 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 113 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 114 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 115 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 116 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 117 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 119 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 137 | 3300012505 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 | Metagenome | Rhizosphere |
| 138 | 3300012510 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 | Metagenome | Rhizosphere |
| 139 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 155 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 156 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 230 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 234 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 235 | 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 236 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 237 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 238 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 239 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 240 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 241 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 242 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 243 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 244 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 245 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 246 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 247 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 248 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 249 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 250 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 251 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 252 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 253 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 254 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 255 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 256 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 257 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 258 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 259 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 260 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 261 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 262 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 263 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 264 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 265 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 266 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 267 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 268 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 269 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 270 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 271 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 272 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 273 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 274 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 275 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 276 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 277 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 278 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 279 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 280 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 281 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 282 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 283 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 284 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 285 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 286 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 287 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 288 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 289 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 290 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 291 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 292 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 293 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 294 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 295 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 296 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 297 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 298 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 299 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 300 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 301 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 302 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 303 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 304 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 305 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 306 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 393 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 394 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 395 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 396 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 397 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 398 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 399 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 400 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 401 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 402 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 403 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 404 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 405 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 406 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 407 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 408 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 409 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 410 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 411 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 414 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 415 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 416 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 417 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 418 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 419 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 420 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 421 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 422 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 423 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 424 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 425 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 426 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 427 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 428 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 429 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 430 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 431 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 432 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 433 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 434 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 435 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 436 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 437 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 438 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 439 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 440 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 441 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 442 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 443 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 444 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 445 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 446 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 447 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 448 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 449 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 450 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 451 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 452 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 453 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 454 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 455 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 456 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 457 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 458 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 459 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 460 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 461 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 462 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 463 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 464 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 465 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 466 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 467 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 468 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 469 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 470 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 471 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 472 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.66 |
| Metatranscriptomes | 0.17 |
| Isolates | 0.17 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.11 |
| Nodule | 0 |
| Rhizoplane | 7.25 |
| Rhizosphere | 89.55 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.1 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | 2214544943 | 2209111006 | Bacteria | 6169 |
| 2 | ARcpr5oldR_c000022 | 3300000041 | Bacteria | 31880 |
| 3 | ARSoilYngRDRAFT_c00124 | 3300000042 | Bacteria | 13179 |
| 4 | ARcpr5yngRDRAFT_c000127 | 3300000043 | Bacteria | 11898 |
| 5 | ARSoilOldRDRAFT_c000182 | 3300000044 | Bacteria | 10255 |
| 6 | ARCol0oldRDRAFT_c00133 | 3300000045 | Bacteria | 6647 |
| 7 | ARCol0yngRDRAFT_1000244 | 3300000652 | Bacteria | 8794 |
| 8 | JGI24752J21851_1003015 | 3300001976 | Bacteria | 2233 |
| 9 | JGI24739J22299_10001439 | 3300001989 | Bacteria | 8974 |
| 10 | JGI24737J22298_10003452 | 3300001990 | Bacteria | 5585 |
| 11 | JGI24737J22298_10006660 | 3300001990 | Bacteria | 3933 |
| 12 | JGI24750J21931_1000236 | 3300002070 | Bacteria | 9434 |
| 13 | JGI24745J21846_1000672 | 3300002073 | Bacteria | 3087 |
| 14 | JGI24748J21848_1000246 | 3300002074 | Bacteria | 6419 |
| 15 | JGI24738J21930_10000321 | 3300002075 | Bacteria | 13225 |
| 16 | JGI24749J21850_1001668 | 3300002076 | Bacteria | 3149 |
| 17 | JGI24742J22300_10003211 | 3300002244 | Bacteria | 2646 |
| 18 | JGI25153J46596_10003330 | 3300003215 | Bacteria | 9029 |
| 19 | Ga0065712_10014721 | 3300005290 | Bacteria | 1944 |
| 20 | Ga0065712_10073486 | 3300005290 | Bacteria | 4375 |
| 21 | Ga0065715_10110340 | 3300005293 | Bacteria | 2617 |
| 22 | Ga0065707_10115366 | 3300005295 | Bacteria | 2269 |
| 23 | Ga0070676_10014872 | 3300005328 | Bacteria | 4282 |
| 24 | Ga0070676_10017202 | 3300005328 | Bacteria | 4001 |
| 25 | Ga0070683_100015103 | 3300005329 | Bacteria | 6777 |
| 26 | Ga0070690_100009004 | 3300005330 | Bacteria | 5771 |
| 27 | Ga0070690_100015717 | 3300005330 | Bacteria | 4521 |
| 28 | Ga0070690_100083018 | 3300005330 | Bacteria | 2099 |
| 29 | Ga0070690_100289108 | 3300005330 | Bacteria | 1172 |
| 30 | Ga0070670_100002552 | 3300005331 | Bacteria | 15030 |
| 31 | Ga0070670_100392200 | 3300005331 | Bacteria | 1224 |
| 32 | Ga0070677_10000229 | 3300005333 | Bacteria | 19338 |
| 33 | Ga0070677_10010167 | 3300005333 | Bacteria | 3211 |
| 34 | Ga0068869_100000813 | 3300005334 | Bacteria | 17841 |
| 35 | Ga0068869_100046245 | 3300005334 | Bacteria | 3137 |
| 36 | Ga0068869_100084615 | 3300005334 | Bacteria | 2374 |
| 37 | Ga0068869_100287558 | 3300005334 | Bacteria | 1324 |
| 38 | Ga0070666_10006602 | 3300005335 | Bacteria | 7132 |
| 39 | Ga0070666_10016756 | 3300005335 | Bacteria | 4691 |
| 40 | Ga0070666_10017385 | 3300005335 | Bacteria | 4611 |
| 41 | Ga0070666_10062024 | 3300005335 | Bacteria | 2532 |
| 42 | Ga0070680_100016299 | 3300005336 | Bacteria | 5846 |
| 43 | Ga0070680_100031606 | 3300005336 | Bacteria | 4257 |
| 44 | Ga0070680_100033258 | 3300005336 | Bacteria | 4154 |
| 45 | Ga0070680_100146404 | 3300005336 | Bacteria | 1982 |
| 46 | Ga0070682_100001697 | 3300005337 | Bacteria | 12242 |
| 47 | Ga0070682_100006283 | 3300005337 | Bacteria | 6663 |
| 48 | Ga0070682_100128359 | 3300005337 | Bacteria | 1712 |
| 49 | Ga0068868_100097555 | 3300005338 | Bacteria | 2375 |
| 50 | Ga0068868_100119733 | 3300005338 | Bacteria | 2146 |
| 51 | Ga0070660_100003220 | 3300005339 | Bacteria | 11218 |
| 52 | Ga0070660_100092905 | 3300005339 | Bacteria | 2382 |
| 53 | Ga0070660_100321427 | 3300005339 | Bacteria | 1271 |
| 54 | Ga0070660_100334729 | 3300005339 | Bacteria | 1245 |
| 55 | Ga0070689_100001674 | 3300005340 | Bacteria | 14154 |
| 56 | Ga0070689_100132728 | 3300005340 | Bacteria | 1997 |
| 57 | Ga0070691_10012615 | 3300005341 | Bacteria | 3870 |
| 58 | Ga0070687_100000287 | 3300005343 | Bacteria | 17083 |
| 59 | Ga0070661_100001342 | 3300005344 | Bacteria | 17213 |
| 60 | Ga0070661_100057287 | 3300005344 | Bacteria | 2856 |
| 61 | Ga0070661_100059600 | 3300005344 | Bacteria | 2800 |
| 62 | Ga0070692_10031678 | 3300005345 | Bacteria | 2652 |
| 63 | Ga0070668_100002613 | 3300005347 | Bacteria | 13234 |
| 64 | Ga0070668_100148599 | 3300005347 | Bacteria | 1893 |
| 65 | Ga0070669_100009501 | 3300005353 | Bacteria | 6927 |
| 66 | Ga0070669_100038922 | 3300005353 | Bacteria | 3453 |
| 67 | Ga0070669_100088541 | 3300005353 | Bacteria | 2317 |
| 68 | Ga0070669_100103055 | 3300005353 | Bacteria | 2155 |
| 69 | Ga0070675_100011412 | 3300005354 | Bacteria | 6953 |
| 70 | Ga0070675_100030373 | 3300005354 | Bacteria | 4363 |
| 71 | Ga0070675_100049682 | 3300005354 | Bacteria | 3443 |
| 72 | Ga0070671_100001574 | 3300005355 | Bacteria | 17176 |
| 73 | Ga0070671_100009073 | 3300005355 | Bacteria | 7981 |
| 74 | Ga0070671_100070337 | 3300005355 | Bacteria | 2919 |
| 75 | Ga0070674_100006844 | 3300005356 | Bacteria | 6684 |
| 76 | Ga0070674_100016960 | 3300005356 | Bacteria | 4571 |
| 77 | Ga0070674_100210849 | 3300005356 | Bacteria | 1505 |
| 78 | Ga0070673_100002949 | 3300005364 | Bacteria | 10488 |
| 79 | Ga0070673_100327494 | 3300005364 | Bacteria | 1354 |
| 80 | Ga0070688_100038858 | 3300005365 | Bacteria | 2909 |
| 81 | Ga0070688_100097177 | 3300005365 | Bacteria | 1935 |
| 82 | Ga0070659_100001372 | 3300005366 | Bacteria | 17532 |
| 83 | Ga0070659_100172661 | 3300005366 | Bacteria | 1771 |
| 84 | Ga0070667_100004661 | 3300005367 | Bacteria | 11506 |
| 85 | Ga0070667_100009580 | 3300005367 | Bacteria | 8031 |
| 86 | Ga0070667_100557304 | 3300005367 | Bacteria | 1054 |
| 87 | Ga0070703_10006082 | 3300005406 | Bacteria | 3379 |
| 88 | Ga0070703_10028431 | 3300005406 | Bacteria | 1671 |
| 89 | Ga0070709_10001382 | 3300005434 | Bacteria | 13210 |
| 90 | Ga0070709_10029146 | 3300005434 | Bacteria | 3298 |
| 91 | Ga0070709_10082042 | 3300005434 | Bacteria | 2106 |
| 92 | Ga0070714_100003309 | 3300005435 | Bacteria | 12019 |
| 93 | Ga0070714_100013144 | 3300005435 | Bacteria | 6628 |
| 94 | Ga0070714_100091829 | 3300005435 | Bacteria | 2660 |
| 95 | Ga0070714_100150094 | 3300005435 | Bacteria | 2099 |
| 96 | Ga0070713_100003127 | 3300005436 | Bacteria | 10895 |
| 97 | Ga0070713_100006430 | 3300005436 | Bacteria | 8146 |
| 98 | Ga0070710_10010291 | 3300005437 | Bacteria | 4593 |
| 99 | Ga0070710_10023419 | 3300005437 | Bacteria | 3246 |
| 100 | Ga0070710_10041225 | 3300005437 | Bacteria | 2548 |
| 101 | Ga0070710_10060527 | 3300005437 | Bacteria | 2154 |
| 102 | Ga0070701_10012182 | 3300005438 | Bacteria | 3870 |
| 103 | Ga0070701_10020616 | 3300005438 | Bacteria | 3133 |
| 104 | Ga0070711_100038864 | 3300005439 | Bacteria | 3202 |
| 105 | Ga0070711_100093216 | 3300005439 | Bacteria | 2174 |
| 106 | Ga0070711_100102484 | 3300005439 | Bacteria | 2085 |
| 107 | Ga0070711_100206981 | 3300005439 | Bacteria | 1517 |
| 108 | Ga0070705_100004113 | 3300005440 | Bacteria | 7107 |
| 109 | Ga0070700_100008630 | 3300005441 | Bacteria | 5554 |
| 110 | Ga0070700_100237365 | 3300005441 | Bacteria | 1301 |
| 111 | Ga0070694_100055279 | 3300005444 | Bacteria | 2692 |
| 112 | Ga0070694_100148370 | 3300005444 | Bacteria | 1710 |
| 113 | Ga0070708_100140660 | 3300005445 | Bacteria | 2238 |
| 114 | Ga0070663_100012485 | 3300005455 | Bacteria | 5375 |
| 115 | Ga0070663_100027620 | 3300005455 | Bacteria | 3855 |
| 116 | Ga0070663_100028209 | 3300005455 | Bacteria | 3819 |
| 117 | Ga0070663_100049988 | 3300005455 | Bacteria | 2972 |
| 118 | Ga0070663_100162645 | 3300005455 | Bacteria | 1719 |
| 119 | Ga0070678_100005790 | 3300005456 | Bacteria | 7193 |
| 120 | Ga0070678_100052827 | 3300005456 | Bacteria | 2952 |
| 121 | Ga0070662_100007259 | 3300005457 | Bacteria | 7182 |
| 122 | Ga0070662_100008362 | 3300005457 | Bacteria | 6745 |
| 123 | Ga0070662_100040719 | 3300005457 | Bacteria | 3310 |
| 124 | Ga0070662_100057910 | 3300005457 | Bacteria | 2817 |
| 125 | Ga0070662_100164305 | 3300005457 | Bacteria | 1738 |
| 126 | Ga0070662_100243235 | 3300005457 | Bacteria | 1444 |
| 127 | Ga0070681_10008531 | 3300005458 | Bacteria | 10034 |
| 128 | Ga0070681_10034265 | 3300005458 | Bacteria | 5099 |
| 129 | Ga0070681_10039942 | 3300005458 | Bacteria | 4704 |
| 130 | Ga0070681_10106963 | 3300005458 | Bacteria | 2738 |
| 131 | Ga0068867_100000628 | 3300005459 | Bacteria | 23309 |
| 132 | Ga0068867_100044629 | 3300005459 | Bacteria | 3248 |
| 133 | Ga0070685_10029919 | 3300005466 | Bacteria | 3029 |
| 134 | Ga0070685_10042444 | 3300005466 | Bacteria | 2596 |
| 135 | Ga0070707_100204783 | 3300005468 | Bacteria | 1923 |
| 136 | Ga0070699_100003093 | 3300005518 | Bacteria | 14735 |
| 137 | Ga0070679_100014494 | 3300005530 | Bacteria | 7573 |
| 138 | Ga0070679_100017445 | 3300005530 | Bacteria | 6948 |
| 139 | Ga0070679_100037757 | 3300005530 | Bacteria | 4799 |
| 140 | Ga0070679_100232897 | 3300005530 | Bacteria | 1801 |
| 141 | Ga0070679_100330528 | 3300005530 | Bacteria | 1473 |
| 142 | Ga0070684_100004311 | 3300005535 | Bacteria | 10805 |
| 143 | Ga0070697_100060873 | 3300005536 | Bacteria | 3078 |
| 144 | Ga0070697_100312320 | 3300005536 | Bacteria | 1353 |
| 145 | Ga0070697_100350061 | 3300005536 | Bacteria | 1276 |
| 146 | Ga0068853_100087460 | 3300005539 | Bacteria | 2735 |
| 147 | Ga0070672_100000991 | 3300005543 | Bacteria | 17181 |
| 148 | Ga0070672_100066373 | 3300005543 | Bacteria | 2857 |
| 149 | Ga0070672_100079454 | 3300005543 | Bacteria | 2626 |
| 150 | Ga0070686_100001041 | 3300005544 | Bacteria | 15960 |
| 151 | Ga0070686_100184039 | 3300005544 | Bacteria | 1486 |
| 152 | Ga0070695_100003393 | 3300005545 | Bacteria | 9316 |
| 153 | Ga0070695_100177787 | 3300005545 | Bacteria | 1506 |
| 154 | Ga0070695_100185533 | 3300005545 | Bacteria | 1477 |
| 155 | Ga0070696_100225652 | 3300005546 | Bacteria | 1407 |
| 156 | Ga0070696_100262306 | 3300005546 | Bacteria | 1310 |
| 157 | Ga0070693_100006238 | 3300005547 | Bacteria | 5775 |
| 158 | Ga0070665_100065244 | 3300005548 | Bacteria | 3652 |
| 159 | Ga0070665_100089591 | 3300005548 | Bacteria | 3082 |
| 160 | Ga0070665_100220572 | 3300005548 | Bacteria | 1897 |
| 161 | Ga0070704_100001471 | 3300005549 | Bacteria | 12643 |
| 162 | Ga0068855_100040118 | 3300005563 | Bacteria | 5557 |
| 163 | Ga0068855_100052442 | 3300005563 | Bacteria | 4802 |
| 164 | Ga0070664_100049659 | 3300005564 | Bacteria | 3548 |
| 165 | Ga0070664_100088982 | 3300005564 | Bacteria | 2670 |
| 166 | Ga0070664_100090632 | 3300005564 | Bacteria | 2646 |
| 167 | Ga0070664_100232450 | 3300005564 | Bacteria | 1653 |
| 168 | Ga0070664_100349043 | 3300005564 | Bacteria | 1345 |
| 169 | Ga0068857_100003798 | 3300005577 | Bacteria | 12713 |
| 170 | Ga0068854_100003622 | 3300005578 | Bacteria | 9664 |
| 171 | Ga0068856_100004576 | 3300005614 | Bacteria | 13748 |
| 172 | Ga0068856_100021694 | 3300005614 | Bacteria | 6241 |
| 173 | Ga0068856_100397280 | 3300005614 | Bacteria | 1398 |
| 174 | Ga0070702_100014828 | 3300005615 | Bacteria | 3964 |
| 175 | Ga0070702_100025792 | 3300005615 | Bacteria | 3153 |
| 176 | Ga0070702_100058381 | 3300005615 | Bacteria | 2235 |
| 177 | Ga0068852_100004573 | 3300005616 | Bacteria | 9795 |
| 178 | Ga0068852_100087545 | 3300005616 | Bacteria | 2779 |
| 179 | Ga0068859_100006571 | 3300005617 | Bacteria | 11800 |
| 180 | Ga0068859_100026815 | 3300005617 | Bacteria | 5780 |
| 181 | Ga0068859_100073377 | 3300005617 | Bacteria | 3460 |
| 182 | Ga0068859_100263538 | 3300005617 | Bacteria | 1815 |
| 183 | Ga0068864_100005577 | 3300005618 | Bacteria | 10320 |
| 184 | Ga0068864_100036637 | 3300005618 | Bacteria | 4182 |
| 185 | Ga0068864_100117170 | 3300005618 | Bacteria | 2377 |
| 186 | Ga0068866_10037168 | 3300005718 | Bacteria | 2390 |
| 187 | Ga0068866_10041065 | 3300005718 | Bacteria | 2293 |
| 188 | Ga0068861_100062966 | 3300005719 | Bacteria | 2850 |
| 189 | Ga0068861_100270621 | 3300005719 | Bacteria | 1459 |
| 190 | Ga0068870_10001295 | 3300005840 | Bacteria | 10067 |
| 191 | Ga0068863_100006108 | 3300005841 | Bacteria | 11814 |
| 192 | Ga0068863_100071965 | 3300005841 | Bacteria | 3271 |
| 193 | Ga0068858_100006462 | 3300005842 | Bacteria | 11411 |
| 194 | Ga0068858_100055331 | 3300005842 | Bacteria | 3667 |
| 195 | Ga0068858_100223543 | 3300005842 | Bacteria | 1784 |
| 196 | Ga0068860_100009949 | 3300005843 | Bacteria | 9424 |
| 197 | Ga0068860_100010732 | 3300005843 | Bacteria | 9045 |
| 198 | Ga0068862_100002184 | 3300005844 | Bacteria | 17550 |
| 199 | Ga0068862_100107984 | 3300005844 | Bacteria | 2440 |
| 200 | Ga0068862_100185952 | 3300005844 | Bacteria | 1867 |
| 201 | Ga0081455_10000209 | 3300005937 | Bacteria | 74597 |
| 202 | Ga0081455_10001640 | 3300005937 | Bacteria | 27256 |
| 203 | Ga0081455_10003885 | 3300005937 | Bacteria | 17016 |
| 204 | Ga0081455_10007107 | 3300005937 | Bacteria | 11855 |
| 205 | Ga0081455_10052830 | 3300005937 | Bacteria | 3476 |
| 206 | Ga0081455_10149165 | 3300005937 | Bacteria | 1805 |
| 207 | Ga0081455_10160779 | 3300005937 | Bacteria | 1722 |
| 208 | Ga0081538_10061674 | 3300005981 | Bacteria | 2145 |
| 209 | Ga0081540_1019759 | 3300005983 | Bacteria | 4080 |
| 210 | Ga0081539_10029790 | 3300005985 | Bacteria | 3402 |
| 211 | Ga0081539_10039242 | 3300005985 | Bacteria | 2797 |
| 212 | Ga0081539_10049773 | 3300005985 | Bacteria | 2375 |
| 213 | Ga0070717_10040382 | 3300006028 | Bacteria | 3800 |
| 214 | Ga0070717_10095309 | 3300006028 | Bacteria | 2519 |
| 215 | Ga0070717_10290733 | 3300006028 | Bacteria | 1451 |
| 216 | Ga0075368_10066955 | 3300006042 | Bacteria | 1445 |
| 217 | Ga0075363_100002037 | 3300006048 | Bacteria | 8062 |
| 218 | Ga0075364_10006763 | 3300006051 | Bacteria | 6762 |
| 219 | Ga0075364_10024740 | 3300006051 | Bacteria | 3815 |
| 220 | Ga0070715_10017578 | 3300006163 | Bacteria | 2709 |
| 221 | Ga0070715_10046818 | 3300006163 | Bacteria | 1840 |
| 222 | Ga0070716_100157913 | 3300006173 | Bacteria | 1466 |
| 223 | Ga0070712_100026284 | 3300006175 | Bacteria | 3876 |
| 224 | Ga0070712_100063268 | 3300006175 | Bacteria | 2619 |
| 225 | Ga0070712_100075359 | 3300006175 | Bacteria | 2426 |
| 226 | Ga0075362_10036152 | 3300006177 | Bacteria | 2159 |
| 227 | Ga0075369_10044119 | 3300006186 | Bacteria | 1915 |
| 228 | Ga0097621_100002538 | 3300006237 | Bacteria | 12508 |
| 229 | Ga0097621_100012683 | 3300006237 | Bacteria | 6259 |
| 230 | Ga0075370_10160632 | 3300006353 | Bacteria | 1319 |
| 231 | Ga0075370_10231347 | 3300006353 | Bacteria | 1094 |
| 232 | Ga0068871_100003984 | 3300006358 | Bacteria | 10210 |
| 233 | Ga0068871_100014697 | 3300006358 | Bacteria | 5841 |
| 234 | Ga0075428_100008075 | 3300006844 | Bacteria | 11688 |
| 235 | Ga0075428_100040633 | 3300006844 | Bacteria | 5116 |
| 236 | Ga0075428_100158465 | 3300006844 | Bacteria | 2458 |
| 237 | Ga0075428_100174930 | 3300006844 | Bacteria | 2325 |
| 238 | Ga0075428_100189560 | 3300006844 | Bacteria | 2224 |
| 239 | Ga0075430_100000304 | 3300006846 | Bacteria | 34813 |
| 240 | Ga0075430_100228067 | 3300006846 | Bacteria | 1545 |
| 241 | Ga0075431_100006534 | 3300006847 | Bacteria | 11581 |
| 242 | Ga0075431_100070583 | 3300006847 | Bacteria | 3604 |
| 243 | Ga0075431_100080913 | 3300006847 | Bacteria | 3354 |
| 244 | Ga0075431_100206396 | 3300006847 | Bacteria | 2009 |
| 245 | Ga0075431_100336755 | 3300006847 | Bacteria | 1519 |
| 246 | Ga0075433_10000958 | 3300006852 | Bacteria | 20392 |
| 247 | Ga0075434_100001677 | 3300006871 | Bacteria | 18913 |
| 248 | Ga0075434_100026434 | 3300006871 | Bacteria | 5685 |
| 249 | Ga0075434_100052639 | 3300006871 | Bacteria | 4045 |
| 250 | Ga0075434_100094886 | 3300006871 | Bacteria | 2988 |
| 251 | Ga0075434_100142354 | 3300006871 | Bacteria | 2418 |
| 252 | Ga0075429_100013390 | 3300006880 | Bacteria | 7111 |
| 253 | Ga0068865_100006167 | 3300006881 | Bacteria | 7308 |
| 254 | Ga0097620_100006571 | 3300006931 | Bacteria | 11800 |
| 255 | Ga0097620_100026813 | 3300006931 | Bacteria | 5780 |
| 256 | Ga0097620_100073377 | 3300006931 | Bacteria | 3460 |
| 257 | Ga0097620_100263548 | 3300006931 | Bacteria | 1815 |
| 258 | Ga0075435_100098556 | 3300007076 | Bacteria | 2420 |
| 259 | Ga0105251_10025235 | 3300009011 | Bacteria | 3043 |
| 260 | Ga0105244_10078598 | 3300009036 | Bacteria | 1636 |
| 261 | Ga0105250_10048962 | 3300009092 | Bacteria | 1694 |
| 262 | Ga0105240_10059489 | 3300009093 | Bacteria | 4768 |
| 263 | Ga0105240_10197688 | 3300009093 | Bacteria | 2359 |
| 264 | Ga0111539_10000138 | 3300009094 | Bacteria | 82968 |
| 265 | Ga0111539_10013242 | 3300009094 | Bacteria | 10308 |
| 266 | Ga0111539_10028897 | 3300009094 | Bacteria | 6760 |
| 267 | Ga0111539_10041591 | 3300009094 | Bacteria | 5524 |
| 268 | Ga0111539_10045686 | 3300009094 | Bacteria | 5242 |
| 269 | Ga0111539_10097609 | 3300009094 | Bacteria | 3451 |
| 270 | Ga0111539_10159158 | 3300009094 | Bacteria | 2641 |
| 271 | Ga0111539_10196236 | 3300009094 | Bacteria | 2354 |
| 272 | Ga0105245_10013826 | 3300009098 | Bacteria | 7031 |
| 273 | Ga0105245_10178764 | 3300009098 | Bacteria | 2026 |
| 274 | Ga0105245_10205176 | 3300009098 | Bacteria | 1894 |
| 275 | Ga0105245_10374113 | 3300009098 | Bacteria | 1417 |
| 276 | Ga0105247_10008270 | 3300009101 | Bacteria | 6350 |
| 277 | Ga0105247_10016996 | 3300009101 | Bacteria | 4364 |
| 278 | Ga0105247_10058153 | 3300009101 | Bacteria | 2392 |
| 279 | Ga0105247_10171123 | 3300009101 | Bacteria | 1444 |
| 280 | Ga0114129_10095344 | 3300009147 | Bacteria | 4121 |
| 281 | Ga0114129_10100655 | 3300009147 | Bacteria | 3999 |
| 282 | Ga0114129_10116952 | 3300009147 | Bacteria | 3674 |
| 283 | Ga0114129_10213207 | 3300009147 | Bacteria | 2609 |
| 284 | Ga0114129_10347780 | 3300009147 | Bacteria | 1965 |
| 285 | Ga0105243_10020347 | 3300009148 | Bacteria | 5033 |
| 286 | Ga0105241_10030482 | 3300009174 | Bacteria | 4031 |
| 287 | Ga0105241_10252399 | 3300009174 | Bacteria | 1496 |
| 288 | Ga0105242_10008746 | 3300009176 | Bacteria | 7771 |
| 289 | Ga0105242_10042237 | 3300009176 | Bacteria | 3681 |
| 290 | Ga0105242_10308819 | 3300009176 | Bacteria | 1446 |
| 291 | Ga0105248_10003287 | 3300009177 | Bacteria | 17938 |
| 292 | Ga0105248_10006183 | 3300009177 | Bacteria | 13124 |
| 293 | Ga0105248_10020983 | 3300009177 | Bacteria | 7239 |
| 294 | Ga0105248_10452980 | 3300009177 | Bacteria | 1446 |
| 295 | Ga0105237_10093716 | 3300009545 | Bacteria | 2992 |
| 296 | Ga0105237_10205699 | 3300009545 | Bacteria | 1969 |
| 297 | Ga0105238_10087006 | 3300009551 | Bacteria | 3112 |
| 298 | Ga0105238_10154016 | 3300009551 | Bacteria | 2273 |
| 299 | Ga0105249_10032452 | 3300009553 | Bacteria | 4724 |
| 300 | Ga0105249_10057226 | 3300009553 | Bacteria | 3571 |
| 301 | Ga0105249_10164553 | 3300009553 | Bacteria | 2146 |
| 302 | Ga0105249_10195887 | 3300009553 | Bacteria | 1975 |
| 303 | Ga0105239_10020880 | 3300010375 | Bacteria | 7226 |
| 304 | Ga0105246_10001801 | 3300011119 | Bacteria | 12821 |
| 305 | Ga0105246_10046723 | 3300011119 | Bacteria | 2954 |
| 306 | Ga0157345_1001131 | 3300012498 | Bacteria | 1921 |
| 307 | Ga0157339_1002850 | 3300012505 | Bacteria | 1202 |
| 308 | Ga0157316_1001901 | 3300012510 | Bacteria | 1360 |
| 309 | Ga0157373_10033846 | 3300013100 | Bacteria | 3672 |
| 310 | Ga0157373_10040198 | 3300013100 | Bacteria | 3347 |
| 311 | Ga0157371_10015753 | 3300013102 | Bacteria | 5658 |
| 312 | Ga0157371_10229260 | 3300013102 | Bacteria | 1335 |
| 313 | Ga0157370_10042057 | 3300013104 | Bacteria | 4405 |
| 314 | Ga0157369_10088552 | 3300013105 | Bacteria | 3304 |
| 315 | Ga0157374_10070918 | 3300013296 | Bacteria | 3284 |
| 316 | Ga0157374_10100128 | 3300013296 | Bacteria | 2777 |
| 317 | Ga0157374_10160667 | 3300013296 | Bacteria | 2188 |
| 318 | Ga0157374_10285228 | 3300013296 | Bacteria | 1631 |
| 319 | Ga0157378_10046130 | 3300013297 | Bacteria | 3874 |
| 320 | Ga0157378_10121402 | 3300013297 | Bacteria | 2409 |
| 321 | Ga0157378_10139422 | 3300013297 | Bacteria | 2251 |
| 322 | Ga0157378_10222958 | 3300013297 | Bacteria | 1793 |
| 323 | Ga0163162_10003576 | 3300013306 | Bacteria | 14865 |
| 324 | Ga0163162_10065114 | 3300013306 | Bacteria | 3691 |
| 325 | Ga0163162_10100584 | 3300013306 | Bacteria | 2982 |
| 326 | Ga0163162_10404595 | 3300013306 | Bacteria | 1498 |
| 327 | Ga0157372_10006003 | 3300013307 | Bacteria | 12905 |
| 328 | Ga0157372_10156057 | 3300013307 | Bacteria | 2636 |
| 329 | Ga0157372_10178558 | 3300013307 | Bacteria | 2458 |
| 330 | Ga0157372_10232613 | 3300013307 | Bacteria | 2137 |
| 331 | Ga0157372_10398222 | 3300013307 | Bacteria | 1604 |
| 332 | Ga0157375_10002114 | 3300013308 | Bacteria | 17161 |
| 333 | Ga0157375_10002488 | 3300013308 | Bacteria | 15965 |
| 334 | Ga0157375_10117399 | 3300013308 | Bacteria | 2766 |
| 335 | Ga0157375_10246725 | 3300013308 | Bacteria | 1946 |
| 336 | Ga0157375_10311881 | 3300013308 | Bacteria | 1737 |
| 337 | Ga0163163_10024233 | 3300014325 | Bacteria | 5773 |
| 338 | Ga0163163_10058909 | 3300014325 | Bacteria | 3797 |
| 339 | Ga0157380_10001040 | 3300014326 | Bacteria | 17720 |
| 340 | Ga0157380_10008840 | 3300014326 | Bacteria | 7198 |
| 341 | Ga0157380_10157758 | 3300014326 | Bacteria | 1968 |
| 342 | Ga0157377_10000448 | 3300014745 | Bacteria | 17743 |
| 343 | Ga0157377_10002924 | 3300014745 | Bacteria | 7634 |
| 344 | Ga0157379_10017754 | 3300014968 | Bacteria | 6269 |
| 345 | Ga0157379_10024836 | 3300014968 | Bacteria | 5319 |
| 346 | Ga0157379_10070713 | 3300014968 | Bacteria | 3122 |
| 347 | Ga0157379_10126245 | 3300014968 | Bacteria | 2302 |
| 348 | Ga0157376_10008924 | 3300014969 | Bacteria | 7260 |
| 349 | Ga0157376_10009420 | 3300014969 | Bacteria | 7090 |
| 350 | Ga0157376_10062958 | 3300014969 | Bacteria | 3123 |
| 351 | Ga0157376_10204644 | 3300014969 | Bacteria | 1819 |
| 352 | Ga0163161_10006692 | 3300017792 | Bacteria | 7976 |
| 353 | Ga0163161_10107885 | 3300017792 | Bacteria | 2078 |
| 354 | Ga0163161_10148822 | 3300017792 | Bacteria | 1778 |
| 355 | Ga0163161_10326392 | 3300017792 | Bacteria | 1214 |
| 356 | Ga0206354_11320193 | 3300020081 | Bacteria | 2257 |
| 357 | Ga0213876_10008996 | 3300021384 | Bacteria | 5381 |
| 358 | Ga0213876_10029221 | 3300021384 | Bacteria | 2906 |
| 359 | Ga0213876_10090496 | 3300021384 | Bacteria | 1620 |
| 360 | Ga0209233_1016691 | 3300025261 | Bacteria | 2017 |
| 361 | Ga0207666_1000094 | 3300025271 | Bacteria | 13927 |
| 362 | Ga0207673_1000042 | 3300025290 | Bacteria | 10040 |
| 363 | Ga0209758_1000158 | 3300025297 | Bacteria | 156129 |
| 364 | Ga0207426_1020337 | 3300025302 | Bacteria | 2308 |
| 365 | Ga0207697_10011526 | 3300025315 | Bacteria | 3737 |
| 366 | Ga0207697_10106732 | 3300025315 | Bacteria | 1197 |
| 367 | Ga0207682_10000360 | 3300025893 | Bacteria | 20873 |
| 368 | Ga0207682_10006222 | 3300025893 | Bacteria | 4822 |
| 369 | Ga0207692_10015830 | 3300025898 | Bacteria | 3327 |
| 370 | Ga0207692_10016295 | 3300025898 | Bacteria | 3287 |
| 371 | Ga0207692_10060212 | 3300025898 | Bacteria | 1963 |
| 372 | Ga0207692_10098876 | 3300025898 | Bacteria | 1598 |
| 373 | Ga0207642_10002194 | 3300025899 | Bacteria | 6051 |
| 374 | Ga0207642_10013792 | 3300025899 | Bacteria | 2960 |
| 375 | Ga0207710_10007821 | 3300025900 | Bacteria | 4525 |
| 376 | Ga0207710_10008348 | 3300025900 | Bacteria | 4367 |
| 377 | Ga0207710_10031004 | 3300025900 | Bacteria | 2335 |
| 378 | Ga0207710_10036632 | 3300025900 | Bacteria | 2164 |
| 379 | Ga0207688_10000024 | 3300025901 | Bacteria | 48792 |
| 380 | Ga0207688_10000262 | 3300025901 | Bacteria | 23919 |
| 381 | Ga0207688_10075463 | 3300025901 | Unclassified | 1919 |
| 382 | Ga0207688_10081666 | 3300025901 | Bacteria | 1846 |
| 383 | Ga0207688_10087598 | 3300025901 | Bacteria | 1785 |
| 384 | Ga0207680_10003320 | 3300025903 | Bacteria | 7577 |
| 385 | Ga0207680_10053610 | 3300025903 | Bacteria | 2422 |
| 386 | Ga0207647_10020019 | 3300025904 | Bacteria | 4493 |
| 387 | Ga0207647_10068896 | 3300025904 | Bacteria | 2140 |
| 388 | Ga0207685_10003863 | 3300025905 | Bacteria | 3713 |
| 389 | Ga0207685_10020245 | 3300025905 | Bacteria | 2208 |
| 390 | Ga0207685_10042113 | 3300025905 | Bacteria | 1713 |
| 391 | Ga0207645_10001827 | 3300025907 | Bacteria | 17160 |
| 392 | Ga0207645_10013182 | 3300025907 | Bacteria | 5579 |
| 393 | Ga0207645_10027609 | 3300025907 | Bacteria | 3663 |
| 394 | Ga0207645_10137723 | 3300025907 | Bacteria | 1590 |
| 395 | Ga0207643_10000035 | 3300025908 | Bacteria | 90905 |
| 396 | Ga0207643_10002713 | 3300025908 | Bacteria | 9574 |
| 397 | Ga0207705_10079496 | 3300025909 | Bacteria | 2388 |
| 398 | Ga0207654_10074341 | 3300025911 | Bacteria | 2028 |
| 399 | Ga0207707_10007090 | 3300025912 | Bacteria | 9768 |
| 400 | Ga0207707_10025302 | 3300025912 | Bacteria | 5193 |
| 401 | Ga0207707_10031302 | 3300025912 | Bacteria | 4655 |
| 402 | Ga0207707_10039822 | 3300025912 | Bacteria | 4106 |
| 403 | Ga0207707_10058970 | 3300025912 | Bacteria | 3339 |
| 404 | Ga0207707_10072826 | 3300025912 | Bacteria | 2995 |
| 405 | Ga0207695_10089660 | 3300025913 | Bacteria | 3092 |
| 406 | Ga0207695_10121584 | 3300025913 | Bacteria | 2578 |
| 407 | Ga0207671_10149440 | 3300025914 | Bacteria | 1804 |
| 408 | Ga0207693_10003819 | 3300025915 | Bacteria | 12829 |
| 409 | Ga0207693_10004725 | 3300025915 | Bacteria | 11455 |
| 410 | Ga0207693_10203121 | 3300025915 | Bacteria | 1558 |
| 411 | Ga0207693_10266677 | 3300025915 | Unclassified | 1342 |
| 412 | Ga0207663_10062209 | 3300025916 | Bacteria | 2372 |
| 413 | Ga0207663_10157689 | 3300025916 | Bacteria | 1598 |
| 414 | Ga0207663_10313092 | 3300025916 | Bacteria | 1177 |
| 415 | Ga0207660_10000104 | 3300025917 | Bacteria | 47254 |
| 416 | Ga0207660_10064971 | 3300025917 | Bacteria | 2635 |
| 417 | Ga0207660_10256357 | 3300025917 | Bacteria | 1382 |
| 418 | Ga0207662_10022714 | 3300025918 | Bacteria | 3599 |
| 419 | Ga0207662_10044859 | 3300025918 | Bacteria | 2612 |
| 420 | Ga0207662_10188611 | 3300025918 | Bacteria | 1330 |
| 421 | Ga0207657_10008208 | 3300025919 | Bacteria | 10637 |
| 422 | Ga0207657_10034331 | 3300025919 | Bacteria | 4563 |
| 423 | Ga0207657_10064983 | 3300025919 | Bacteria | 3112 |
| 424 | Ga0207657_10080606 | 3300025919 | Bacteria | 2736 |
| 425 | Ga0207657_10100631 | 3300025919 | Bacteria | 2399 |
| 426 | Ga0207649_10002932 | 3300025920 | Bacteria | 9389 |
| 427 | Ga0207649_10031396 | 3300025920 | Bacteria | 3157 |
| 428 | Ga0207649_10252061 | 3300025920 | Bacteria | 1272 |
| 429 | Ga0207652_10001464 | 3300025921 | Bacteria | 20891 |
| 430 | Ga0207652_10049899 | 3300025921 | Bacteria | 3584 |
| 431 | Ga0207652_10061488 | 3300025921 | Bacteria | 3243 |
| 432 | Ga0207652_10158295 | 3300025921 | Bacteria | 2029 |
| 433 | Ga0207652_10164786 | 3300025921 | Bacteria | 1987 |
| 434 | Ga0207681_10001121 | 3300025923 | Bacteria | 17344 |
| 435 | Ga0207694_10036921 | 3300025924 | Bacteria | 3750 |
| 436 | Ga0207694_10096619 | 3300025924 | Bacteria | 2337 |
| 437 | Ga0207650_10000743 | 3300025925 | Bacteria | 25164 |
| 438 | Ga0207650_10006629 | 3300025925 | Bacteria | 7896 |
| 439 | Ga0207659_10000899 | 3300025926 | Bacteria | 17704 |
| 440 | Ga0207659_10022466 | 3300025926 | Bacteria | 4200 |
| 441 | Ga0207687_10002095 | 3300025927 | Bacteria | 13631 |
| 442 | Ga0207687_10059806 | 3300025927 | Bacteria | 2686 |
| 443 | Ga0207687_10073745 | 3300025927 | Bacteria | 2444 |
| 444 | Ga0207700_10001350 | 3300025928 | Bacteria | 13908 |
| 445 | Ga0207700_10004335 | 3300025928 | Bacteria | 8345 |
| 446 | Ga0207700_10214051 | 3300025928 | Bacteria | 1631 |
| 447 | Ga0207664_10004320 | 3300025929 | Bacteria | 9625 |
| 448 | Ga0207664_10049839 | 3300025929 | Bacteria | 3299 |
| 449 | Ga0207644_10001933 | 3300025931 | Bacteria | 13440 |
| 450 | Ga0207690_10001009 | 3300025932 | Bacteria | 17974 |
| 451 | Ga0207690_10145160 | 3300025932 | Bacteria | 1753 |
| 452 | Ga0207690_10249889 | 3300025932 | Bacteria | 1369 |
| 453 | Ga0207706_10005187 | 3300025933 | Bacteria | 12161 |
| 454 | Ga0207706_10012802 | 3300025933 | Bacteria | 7633 |
| 455 | Ga0207706_10077468 | 3300025933 | Bacteria | 2924 |
| 456 | Ga0207706_10203277 | 3300025933 | Bacteria | 1737 |
| 457 | Ga0207706_10276072 | 3300025933 | Bacteria | 1466 |
| 458 | Ga0207686_10006384 | 3300025934 | Bacteria | 6345 |
| 459 | Ga0207686_10039418 | 3300025934 | Bacteria | 2866 |
| 460 | Ga0207709_10000575 | 3300025935 | Bacteria | 30869 |
| 461 | Ga0207709_10117034 | 3300025935 | Bacteria | 1793 |
| 462 | Ga0207670_10000182 | 3300025936 | Bacteria | 41877 |
| 463 | Ga0207670_10005380 | 3300025936 | Bacteria | 7023 |
| 464 | Ga0207670_10013702 | 3300025936 | Bacteria | 4790 |
| 465 | Ga0207670_10240532 | 3300025936 | Bacteria | 1394 |
| 466 | Ga0207670_10371119 | 3300025936 | Bacteria | 1137 |
| 467 | Ga0207669_10004684 | 3300025937 | Bacteria | 6050 |
| 468 | Ga0207669_10011106 | 3300025937 | Bacteria | 4368 |
| 469 | Ga0207669_10077664 | 3300025937 | Bacteria | 2112 |
| 470 | Ga0207704_10000642 | 3300025938 | Bacteria | 15460 |
| 471 | Ga0207665_10001219 | 3300025939 | Bacteria | 17354 |
| 472 | Ga0207665_10020078 | 3300025939 | Bacteria | 4388 |
| 473 | Ga0207691_10001015 | 3300025940 | Bacteria | 27838 |
| 474 | Ga0207691_10002681 | 3300025940 | Bacteria | 17406 |
| 475 | Ga0207691_10079326 | 3300025940 | Bacteria | 2955 |
| 476 | Ga0207711_10002482 | 3300025941 | Bacteria | 16454 |
| 477 | Ga0207711_10057458 | 3300025941 | Bacteria | 3345 |
| 478 | Ga0207711_10074015 | 3300025941 | Bacteria | 2962 |
| 479 | Ga0207711_10153970 | 3300025941 | Bacteria | 2076 |
| 480 | Ga0207711_10165963 | 3300025941 | Bacteria | 2001 |
| 481 | Ga0207711_10401790 | 3300025941 | Bacteria | 1273 |
| 482 | Ga0207689_10002374 | 3300025942 | Bacteria | 17572 |
| 483 | Ga0207689_10013837 | 3300025942 | Bacteria | 6874 |
| 484 | Ga0207689_10036395 | 3300025942 | Bacteria | 4087 |
| 485 | Ga0207661_10001332 | 3300025944 | Bacteria | 16556 |
| 486 | Ga0207679_10000035 | 3300025945 | Bacteria | 144173 |
| 487 | Ga0207667_10058946 | 3300025949 | Bacteria | 4024 |
| 488 | Ga0207667_10177458 | 3300025949 | Bacteria | 2188 |
| 489 | Ga0207651_10000180 | 3300025960 | Bacteria | 27549 |
| 490 | Ga0207651_10085264 | 3300025960 | Bacteria | 2291 |
| 491 | Ga0207651_10135299 | 3300025960 | Bacteria | 1894 |
| 492 | Ga0207712_10008108 | 3300025961 | Bacteria | 6646 |
| 493 | Ga0207712_10310602 | 3300025961 | Bacteria | 1297 |
| 494 | Ga0207668_10000149 | 3300025972 | Bacteria | 48188 |
| 495 | Ga0207668_10089867 | 3300025972 | Bacteria | 2253 |
| 496 | Ga0207640_10014682 | 3300025981 | Bacteria | 4513 |
| 497 | Ga0207640_10039474 | 3300025981 | Bacteria | 2988 |
| 498 | Ga0207640_10146369 | 3300025981 | Bacteria | 1729 |
| 499 | Ga0207658_10003553 | 3300025986 | Bacteria | 11007 |
| 500 | Ga0207658_10043386 | 3300025986 | Bacteria | 3269 |
| 501 | Ga0207677_10004580 | 3300026023 | Bacteria | 7434 |
| 502 | Ga0207677_10120803 | 3300026023 | Bacteria | 1970 |
| 503 | Ga0207703_10002471 | 3300026035 | Bacteria | 16028 |
| 504 | Ga0207703_10079135 | 3300026035 | Bacteria | 2734 |
| 505 | Ga0207703_10128856 | 3300026035 | Bacteria | 2182 |
| 506 | Ga0207703_10140304 | 3300026035 | Bacteria | 2096 |
| 507 | Ga0207639_10002906 | 3300026041 | Bacteria | 11517 |
| 508 | Ga0207639_10063477 | 3300026041 | Bacteria | 2860 |
| 509 | Ga0207678_10009048 | 3300026067 | Bacteria | 8768 |
| 510 | Ga0207678_10015567 | 3300026067 | Bacteria | 6688 |
| 511 | Ga0207678_10020228 | 3300026067 | Bacteria | 5844 |
| 512 | Ga0207678_10034290 | 3300026067 | Bacteria | 4421 |
| 513 | Ga0207678_10079722 | 3300026067 | Bacteria | 2803 |
| 514 | Ga0207678_10091621 | 3300026067 | Bacteria | 2598 |
| 515 | Ga0207708_10000358 | 3300026075 | Bacteria | 35755 |
| 516 | Ga0207708_10039584 | 3300026075 | Bacteria | 3592 |
| 517 | Ga0207708_10295341 | 3300026075 | Bacteria | 1316 |
| 518 | Ga0207702_10006764 | 3300026078 | Bacteria | 9835 |
| 519 | Ga0207702_10168387 | 3300026078 | Bacteria | 2007 |
| 520 | Ga0207641_10002628 | 3300026088 | Bacteria | 16468 |
| 521 | Ga0207641_10080365 | 3300026088 | Bacteria | 2828 |
| 522 | Ga0207648_10001075 | 3300026089 | Bacteria | 30605 |
| 523 | Ga0207648_10035823 | 3300026089 | Bacteria | 4372 |
| 524 | Ga0207648_10098034 | 3300026089 | Bacteria | 2566 |
| 525 | Ga0207648_10136005 | 3300026089 | Bacteria | 2165 |
| 526 | Ga0207676_10001216 | 3300026095 | Bacteria | 19200 |
| 527 | Ga0207676_10052251 | 3300026095 | Bacteria | 3193 |
| 528 | Ga0207676_10068056 | 3300026095 | Bacteria | 2846 |
| 529 | Ga0207674_10002767 | 3300026116 | Bacteria | 21863 |
| 530 | Ga0207674_10162393 | 3300026116 | Bacteria | 2188 |
| 531 | Ga0207675_100026983 | 3300026118 | Bacteria | 5347 |
| 532 | Ga0207675_100034640 | 3300026118 | Bacteria | 4709 |
| 533 | Ga0207675_100077875 | 3300026118 | Bacteria | 3106 |
| 534 | Ga0207675_100366112 | 3300026118 | Bacteria | 1415 |
| 535 | Ga0207683_10002564 | 3300026121 | Bacteria | 15846 |
| 536 | Ga0207683_10005615 | 3300026121 | Bacteria | 10761 |
| 537 | Ga0207683_10006130 | 3300026121 | Bacteria | 10299 |
| 538 | Ga0207683_10009850 | 3300026121 | Bacteria | 8151 |
| 539 | Ga0207683_10051838 | 3300026121 | Bacteria | 3595 |
| 540 | Ga0207683_10235638 | 3300026121 | Bacteria | 1669 |
| 541 | Ga0207698_10007529 | 3300026142 | Bacteria | 6823 |
| 542 | Ga0207698_10170021 | 3300026142 | Bacteria | 1918 |
| 543 | Ga0210002_1001374 | 3300027617 | Bacteria | 3409 |
| 544 | Ga0209971_1004676 | 3300027682 | Bacteria | 3247 |
| 545 | Ga0209971_1006118 | 3300027682 | Bacteria | 2849 |
| 546 | Ga0209971_1013547 | 3300027682 | Bacteria | 1931 |
| 547 | Ga0209966_1003962 | 3300027695 | Bacteria | 2499 |
| 548 | Ga0209998_10002490 | 3300027717 | Bacteria | 4201 |
| 549 | Ga0209998_10007384 | 3300027717 | Bacteria | 2282 |
| 550 | Ga0209974_10000880 | 3300027876 | Bacteria | 10422 |
| 551 | Ga0209974_10010975 | 3300027876 | Bacteria | 3049 |
| 552 | Ga0209974_10024633 | 3300027876 | Bacteria | 1991 |
| 553 | Ga0207428_10000075 | 3300027907 | Bacteria | 137887 |
| 554 | Ga0207428_10002495 | 3300027907 | Bacteria | 18379 |
| 555 | Ga0207428_10004858 | 3300027907 | Bacteria | 12675 |
| 556 | Ga0268266_10065473 | 3300028379 | Bacteria | 3142 |
| 557 | Ga0268266_10152012 | 3300028379 | Bacteria | 2087 |
| 558 | Ga0268265_10001891 | 3300028380 | Bacteria | 16658 |
| 559 | Ga0268265_10008056 | 3300028380 | Bacteria | 7118 |
| 560 | Ga0268265_10120219 | 3300028380 | Bacteria | 2163 |
| 561 | Ga0268264_10050126 | 3300028381 | Bacteria | 3475 |
| 562 | Ga0268264_10096411 | 3300028381 | Bacteria | 2562 |
| 563 | Ga0268264_10346131 | 3300028381 | Bacteria | 1413 |
| 564 | Ga0265334_10054621 | 3300028573 | Bacteria | 1523 |
| 565 | Ga0265338_10132968 | 3300028800 | Bacteria | 1961 |
| 566 | Ga0265763_1004377 | 3300030763 | Bacteria | 1155 |
| 567 | Ga0265320_10032363 | 3300031240 | Bacteria | 2678 |
| 568 | Ga0265325_10008594 | 3300031241 | Bacteria | 6016 |
| 569 | Ga0265325_10011730 | 3300031241 | Bacteria | 5027 |
| 570 | Ga0265325_10094433 | 3300031241 | Bacteria | 1471 |
| 571 | Ga0265340_10027878 | 3300031247 | Bacteria | 2844 |
| 572 | Ga0265339_10002967 | 3300031249 | Bacteria | 11987 |
| 573 | Ga0265339_10014744 | 3300031249 | Bacteria | 4704 |
| 574 | Ga0265339_10031835 | 3300031249 | Bacteria | 2978 |
| 575 | Ga0265339_10087310 | 3300031249 | Bacteria | 1640 |
| 576 | Ga0265316_10027004 | 3300031344 | Bacteria | 4764 |
| 577 | Ga0265313_10015070 | 3300031595 | Bacteria | 4530 |
| 578 | Ga0265313_10024495 | 3300031595 | Bacteria | 3222 |
| 579 | Ga0316575_10006778 | 3300031665 | Bacteria | 4137 |
| 580 | Ga0265314_10099824 | 3300031711 | Bacteria | 1869 |
| 581 | Ga0265342_10000510 | 3300031712 | Bacteria | 41579 |
| 582 | Ga0265342_10017708 | 3300031712 | Bacteria | 4627 |
| 583 | Ga0265342_10069525 | 3300031712 | Bacteria | 2055 |
| 584 | Ga0307413_10379883 | 3300031824 | Bacteria | 1100 |
| 585 | Ga0307406_10113666 | 3300031901 | Bacteria | 1869 |
| 586 | Ga0307409_100416364 | 3300031995 | Bacteria | 1288 |
| 587 | Ga0316583_10000603 | 3300032133 | Bacteria | 10926 |
| 588 | Ga0373930_0000182 | 3300034816 | Bacteria | 7519 |
| 589 | Ga0373948_0000591 | 3300034817 | Bacteria | 4645 |
| 590 | Ga0373959_0001645 | 3300034820 | Bacteria | 3554 |
| 591 | Ga0373938_0000151 | 3300034957 | Bacteria | 10052 |
| 592 | Ga0373926_0092652 | 3300035083 | Unclassified | 1124 |
| 593 | Ga0373928_0007047 | 3300035084 | Bacteria | 2167 |
| 594 | Ga0373929_0001158 | 3300035085 | Bacteria | 5102 |
| 595 | Ga0373940_0000142 | 3300035088 | Bacteria | 9220 |
| 596 | Ga0373940_0030186 | 3300035088 | Bacteria | 1441 |
| 597 | Ga0373944_0016090 | 3300035089 | Bacteria | 2104 |
| 598 | Ga0373949_0001994 | 3300035090 | Bacteria | 5457 |
| 599 | Ga0373949_0003060 | 3300035090 | Bacteria | 4091 |
| 600 | Ga0373949_0003729 | 3300035090 | Bacteria | 3560 |
| 601 | Ga0373949_0014713 | 3300035090 | Bacteria | 1744 |
| 602 | Ga0373951_0001484 | 3300035091 | Bacteria | 6116 |
| 603 | Ga0373952_0010722 | 3300035092 | Bacteria | 1776 |
| 604 | Ga0373952_0016091 | 3300035092 | Bacteria | 1516 |
| 605 | Ga0373923_0013137 | 3300035111 | Bacteria | 3079 |
| 606 | Ga0373932_0000611 | 3300035112 | Bacteria | 10816 |
| 607 | Ga0373932_0003639 | 3300035112 | Bacteria | 3684 |
| 608 | Ga0373939_0001079 | 3300035114 | Bacteria | 6712 |
| 609 | Ga0373939_0002011 | 3300035114 | Bacteria | 4855 |
| 610 | Ga0373941_0001642 | 3300035115 | Bacteria | 4770 |
| 611 | Ga0373941_0002631 | 3300035115 | Bacteria | 3978 |
| 612 | Ga0373945_0007601 | 3300035116 | Bacteria | 3514 |
| 613 | Ga0373953_0040545 | 3300035117 | Bacteria | 1850 |
| 614 | Ga0373954_0009184 | 3300035118 | Bacteria | 4349 |
| 615 | Ga0373956_0005298 | 3300035119 | Bacteria | 5164 |
| 616 | Ga0373956_0014565 | 3300035119 | Bacteria | 3288 |
| 617 | Ga0373956_0014993 | 3300035119 | Bacteria | 3242 |
| 618 | Ga0373957_0036910 | 3300035120 | Bacteria | 1823 |
| 619 | Ga0373957_0062008 | 3300035120 | Bacteria | 1450 |
| 620 | Ga0373960_0004279 | 3300035121 | Bacteria | 3261 |
| 621 | Ga0373960_0020112 | 3300035121 | Bacteria | 1762 |
| 622 | Ga0373960_0030235 | 3300035121 | Bacteria | 1507 |
| 623 | Ga0373943_0003515 | 3300035170 | Bacteria | 7140 |
| 624 | Ga0373943_0037169 | 3300035170 | Bacteria | 2336 |
| 625 | Ga0373943_0201897 | 3300035170 | Bacteria | 1101 |
| 626 | Ga0373946_0133444 | 3300035171 | Bacteria | 1144 |
| 627 | Ga0373955_0012410 | 3300035172 | Bacteria | 4095 |
| 628 | Ga0373955_0017584 | 3300035172 | Bacteria | 3541 |
| 629 | Ga0373942_0001627 | 3300035207 | Bacteria | 5728 |
| 630 | Ga0373961_0008943 | 3300035241 | Bacteria | 2443 |
| 631 | Ga0373961_0018987 | 3300035241 | Bacteria | 1801 |
| 632 | Ga0373961_0035394 | 3300035241 | Bacteria | 1417 |
| 633 | Ga0373931_0004505 | 3300035691 | Bacteria | 6370 |
| 634 | Ga0373931_0009578 | 3300035691 | Bacteria | 4634 |
| 635 | Ga0373935_0004817 | 3300035692 | Bacteria | 7935 |
| 636 | Ga0373935_0197096 | 3300035692 | Bacteria | 1390 |
| 637 | Ga0373927_0105788 | 3300035695 | Bacteria | 1832 |
| 638 | Ga0373933_0008478 | 3300035724 | Bacteria | 5608 |
| 639 | Ga0373933_0098430 | 3300035724 | Bacteria | 1812 |
| 640 | Ga0373933_0201583 | 3300035724 | Bacteria | 1273 |
| 641 | Ga0373947_0005443 | 3300035725 | Bacteria | 7428 |
| 642 | Ga0373947_0029566 | 3300035725 | Bacteria | 3215 |
| 643 | Ga0373937_0023033 | 3300036401 | Bacteria | 5602 |
| 644 | Ga0373937_0053125 | 3300036401 | Bacteria | 3716 |
| 645 | Ga0373937_0357967 | 3300036401 | Bacteria | 1383 |
| 646 | Ga0373937_0528808 | 3300036401 | Bacteria | 1120 |
| 647 | Ga0373925_0005226 | 3300037068 | Bacteria | 9706 |
| 648 | Ga0373925_0070249 | 3300037068 | Bacteria | 2646 |
| 649 | Ga0373925_0111196 | 3300037068 | Bacteria | 2116 |
| 650 | Ga0395899_0003128 | 3300037312 | Bacteria | 13176 |
| 651 | Ga0395899_0031176 | 3300037312 | Bacteria | 4007 |
| 652 | Ga0395900_0015232 | 3300037418 | Bacteria | 7841 |
| 653 | Ga0395900_0120177 | 3300037418 | Bacteria | 2696 |
| 654 | Ga0395900_0187776 | 3300037418 | Bacteria | 2097 |
| 655 | Ga0395898_0052801 | 3300037466 | Bacteria | 3971 |
| 656 | Ga0395898_0080033 | 3300037466 | Bacteria | 3151 |
| 657 | Ga0395898_0105504 | 3300037466 | Bacteria | 2702 |
| 658 | Ga0395905_0011373 | 3300037471 | Bacteria | 8604 |
| 659 | Ga0395905_0161254 | 3300037471 | Bacteria | 2107 |
| 660 | Ga0395905_0437463 | 3300037471 | Bacteria | 1205 |
| 661 | Ga0436364_0609713 | 3300037853 | Bacteria | 1494 |
| 662 | Ga0395901_0081984 | 3300038443 | Bacteria | 3369 |
| 663 | Ga0395901_0112885 | 3300038443 | Bacteria | 2854 |
| 664 | Ga0436365_0534746 | 3300039437 | Bacteria | 6587 |
| 665 | Ga0436365_0932459 | 3300039437 | Bacteria | 27077 |
| 666 | Ga0436365_1516841 | 3300039437 | Bacteria | 1832 |
| 667 | Ga0436360_0635187 | 3300039438 | Bacteria | 1104 |
| 668 | Ga0436360_0728136 | 3300039438 | Bacteria | 1779 |
| 669 | Ga0436360_1357448 | 3300039438 | Bacteria | 1596 |
| 670 | Ga0436361_0726405 | 3300039447 | Bacteria | 14368 |
| 671 | Ga0436363_0810999 | 3300039450 | Bacteria | 2117 |
| 672 | Ga0451853_0997884 | 3300041512 | Bacteria | 2031 |
| 673 | Ga0439455_0008055 | 3300042012 | Bacteria | 2249 |
| 674 | Ga0453683_0162827 | 3300044673 | Bacteria | 1412 |
| 675 | Ga0466965_0008580 | 3300044683 | Bacteria | 4729 |
| 676 | Ga0466966_0015172 | 3300044684 | Bacteria | 5097 |
| 677 | Ga0466966_0028792 | 3300044684 | Bacteria | 3616 |
| 678 | Ga0466966_0059790 | 3300044684 | Bacteria | 2406 |
| 679 | Ga0466961_0020886 | 3300044693 | Bacteria | 4213 |
| 680 | Ga0466963_0000255 | 3300044694 | Bacteria | 23380 |
| 681 | Ga0466963_0017165 | 3300044694 | Bacteria | 4508 |
| 682 | Ga0466963_0114234 | 3300044694 | Bacteria | 1855 |
| 683 | Ga0466963_0190919 | 3300044694 | Bacteria | 1431 |
| 684 | Ga0466963_0206837 | 3300044694 | Bacteria | 1373 |
| 685 | Ga0466963_0241059 | 3300044694 | Bacteria | 1268 |
| 686 | Ga0466971_0021322 | 3300044719 | Bacteria | 2884 |
| 687 | Ga0466957_0003978 | 3300044842 | Bacteria | 8171 |
| 688 | Ga0466957_0021505 | 3300044842 | Bacteria | 3802 |
| 689 | Ga0466960_0161758 | 3300044901 | Bacteria | 1202 |
| 690 | Ga0466959_0064395 | 3300045049 | Bacteria | 2661 |
| 691 | Ga0466958_0026431 | 3300045836 | Bacteria | 3430 |
| 692 | Ga0466958_0124893 | 3300045836 | Bacteria | 1613 |
| 693 | Ga0466958_0133022 | 3300045836 | Bacteria | 1563 |
| 694 | Ga0466967_0002672 | 3300045976 | Bacteria | 11251 |
| 695 | Ga0466967_0060796 | 3300045976 | Bacteria | 3350 |
| 696 | Ga0466967_0212576 | 3300045976 | Bacteria | 1835 |
| 697 | Ga0495592_0053098 | 3300046454 | Bacteria | 3006 |
| 698 | Ga0495603_0000816 | 3300046455 | Bacteria | 17875 |
| 699 | Ga0495603_0052530 | 3300046455 | Bacteria | 2419 |
| 700 | Ga0495590_0000013 | 3300046457 | Bacteria | 271977 |
| 701 | Ga0495591_000109 | 3300046458 | Bacteria | 94877 |
| 702 | Ga0495629_0000140 | 3300046459 | Bacteria | 63496 |
| 703 | Ga0495638_0004233 | 3300046460 | Bacteria | 10916 |
| 704 | Ga0495651_0056264 | 3300046462 | Bacteria | 3022 |
| 705 | Ga0495651_0242165 | 3300046462 | Bacteria | 1236 |
| 706 | Ga0495653_0009696 | 3300046463 | Bacteria | 7874 |
| 707 | Ga0495653_0047492 | 3300046463 | Bacteria | 3320 |
| 708 | Ga0495650_0000322 | 3300046471 | Bacteria | 85802 |
| 709 | Ga0495580_0058773 | 3300046472 | Bacteria | 2703 |
| 710 | Ga0495580_0078199 | 3300046472 | Bacteria | 2307 |
| 711 | Ga0495582_0005878 | 3300046473 | Bacteria | 6837 |
| 712 | Ga0495605_0011394 | 3300046474 | Bacteria | 4957 |
| 713 | Ga0495605_0091546 | 3300046474 | Bacteria | 1408 |
| 714 | Ga0495639_0001632 | 3300046475 | Bacteria | 10003 |
| 715 | Ga0495639_0012290 | 3300046475 | Bacteria | 3692 |
| 716 | Ga0495662_0015537 | 3300046476 | Bacteria | 3695 |
| 717 | Ga0495662_0075454 | 3300046476 | Bacteria | 1636 |
| 718 | Ga0495664_0005918 | 3300046477 | Bacteria | 6732 |
| 719 | Ga0495664_0038354 | 3300046477 | Bacteria | 2828 |
| 720 | Ga0495584_0000029 | 3300046491 | Bacteria | 105850 |
| 721 | Ga0495584_0004385 | 3300046491 | Bacteria | 7599 |
| 722 | Ga0495584_0019984 | 3300046491 | Bacteria | 3402 |
| 723 | Ga0495585_0002257 | 3300046492 | Bacteria | 13934 |
| 724 | Ga0495585_0077342 | 3300046492 | Bacteria | 1806 |
| 725 | Ga0495585_0131863 | 3300046492 | Bacteria | 1315 |
| 726 | Ga0495594_0019830 | 3300046499 | Bacteria | 3576 |
| 727 | Ga0495594_0042704 | 3300046499 | Bacteria | 2483 |
| 728 | Ga0495594_0200662 | 3300046499 | Bacteria | 1137 |
| 729 | Ga0495596_0004688 | 3300046500 | Bacteria | 6615 |
| 730 | Ga0495596_0009396 | 3300046500 | Bacteria | 4302 |
| 731 | Ga0495607_0002596 | 3300046501 | Bacteria | 14539 |
| 732 | Ga0495607_0011649 | 3300046501 | Bacteria | 5844 |
| 733 | Ga0495607_0023691 | 3300046501 | Bacteria | 3839 |
| 734 | Ga0495607_0037500 | 3300046501 | Bacteria | 2911 |
| 735 | Ga0495583_0001070 | 3300046506 | Bacteria | 30573 |
| 736 | Ga0495583_0009969 | 3300046506 | Bacteria | 5603 |
| 737 | Ga0495583_0011275 | 3300046506 | Bacteria | 5143 |
| 738 | Ga0495583_0046864 | 3300046506 | Bacteria | 1991 |
| 739 | Ga0495583_0077909 | 3300046506 | Bacteria | 1445 |
| 740 | Ga0495606_0030335 | 3300046507 | Bacteria | 3779 |
| 741 | Ga0495606_0237736 | 3300046507 | Bacteria | 1017 |
| 742 | Ga0495608_0023230 | 3300046511 | Bacteria | 4250 |
| 743 | Ga0495608_0068600 | 3300046511 | Bacteria | 2318 |
| 744 | Ga0495608_0133031 | 3300046511 | Bacteria | 1590 |
| 745 | Ga0495610_0048174 | 3300046512 | Bacteria | 2093 |
| 746 | Ga0495616_0003207 | 3300046513 | Bacteria | 10544 |
| 747 | Ga0495616_0010739 | 3300046513 | Bacteria | 5282 |
| 748 | Ga0495616_0056302 | 3300046513 | Bacteria | 1942 |
| 749 | Ga0495616_0074748 | 3300046513 | Bacteria | 1632 |
| 750 | Ga0495618_0051343 | 3300046514 | Bacteria | 2605 |
| 751 | Ga0495618_0082799 | 3300046514 | Bacteria | 2049 |
| 752 | Ga0495618_0088817 | 3300046514 | Bacteria | 1976 |
| 753 | Ga0495618_0153880 | 3300046514 | Bacteria | 1468 |
| 754 | Ga0495628_0006258 | 3300046516 | Bacteria | 10403 |
| 755 | Ga0495628_0152301 | 3300046516 | Bacteria | 1760 |
| 756 | Ga0495628_0153375 | 3300046516 | Bacteria | 1754 |
| 757 | Ga0495630_0012741 | 3300046517 | Bacteria | 6107 |
| 758 | Ga0495630_0083972 | 3300046517 | Bacteria | 2405 |
| 759 | Ga0495631_0009316 | 3300046518 | Bacteria | 4908 |
| 760 | Ga0495631_0011171 | 3300046518 | Bacteria | 4423 |
| 761 | Ga0495631_0015481 | 3300046518 | Bacteria | 3652 |
| 762 | Ga0495632_0000530 | 3300046519 | Bacteria | 36061 |
| 763 | Ga0495632_0096819 | 3300046519 | Bacteria | 1393 |
| 764 | Ga0495637_0000008 | 3300046520 | Bacteria | 404658 |
| 765 | Ga0495643_0010264 | 3300046522 | Bacteria | 5768 |
| 766 | Ga0495643_0014879 | 3300046522 | Bacteria | 4616 |
| 767 | Ga0495644_0001244 | 3300046523 | Bacteria | 10440 |
| 768 | Ga0495644_0028261 | 3300046523 | Bacteria | 2122 |
| 769 | Ga0495648_0012819 | 3300046524 | Bacteria | 6224 |
| 770 | Ga0495648_0016800 | 3300046524 | Bacteria | 5260 |
| 771 | Ga0495642_0031569 | 3300046528 | Bacteria | 2124 |
| 772 | Ga0495642_0093966 | 3300046528 | Bacteria | 1271 |
| 773 | Ga0495652_0032347 | 3300046529 | Bacteria | 4575 |
| 774 | Ga0495652_0058188 | 3300046529 | Bacteria | 3274 |
| 775 | Ga0495652_0090548 | 3300046529 | Bacteria | 2502 |
| 776 | Ga0495652_0131223 | 3300046529 | Bacteria | 1983 |
| 777 | Ga0495665_0004725 | 3300046531 | Bacteria | 7354 |
| 778 | Ga0495665_0016123 | 3300046531 | Bacteria | 4025 |
| 779 | Ga0495665_0063110 | 3300046531 | Bacteria | 1956 |
| 780 | Ga0495640_0016839 | 3300046533 | Bacteria | 5463 |
| 781 | Ga0495640_0044715 | 3300046533 | Bacteria | 3078 |
| 782 | Ga0495640_0051481 | 3300046533 | Bacteria | 2831 |
| 783 | Ga0495586_0013278 | 3300046535 | Bacteria | 4366 |
| 784 | Ga0495587_0027310 | 3300046536 | Bacteria | 3476 |
| 785 | Ga0495609_0004835 | 3300046538 | Bacteria | 7264 |
| 786 | Ga0495609_0101618 | 3300046538 | Bacteria | 1245 |
| 787 | Ga0495621_0019441 | 3300046539 | Bacteria | 2218 |
| 788 | Ga0495645_0009517 | 3300046543 | Bacteria | 6793 |
| 789 | Ga0495622_0053196 | 3300046557 | Bacteria | 1878 |
| 790 | Ga0495633_0000874 | 3300046558 | Bacteria | 26052 |
| 791 | Ga0495633_0006563 | 3300046558 | Bacteria | 6877 |
| 792 | Ga0495667_0005276 | 3300046559 | Bacteria | 8739 |
| 793 | Ga0495667_0005868 | 3300046559 | Bacteria | 8317 |
| 794 | Ga0495667_0050977 | 3300046559 | Bacteria | 2731 |
| 795 | Ga0495667_0119655 | 3300046559 | Bacteria | 1701 |
| 796 | Ga0495667_0131876 | 3300046559 | Bacteria | 1612 |
| 797 | Ga0495656_0003395 | 3300046615 | Bacteria | 5386 |
| 798 | Ga0495656_0067904 | 3300046615 | Bacteria | 1575 |
| 799 | Ga0495634_0015355 | 3300046642 | Bacteria | 5505 |
| 800 | Ga0495634_0038064 | 3300046642 | Bacteria | 3280 |
| 801 | Ga0495634_0076834 | 3300046642 | Bacteria | 2191 |
| 802 | Ga0495611_0000410 | 3300046648 | Bacteria | 26643 |
| 803 | Ga0495611_0005586 | 3300046648 | Bacteria | 5365 |
| 804 | Ga0495635_0009872 | 3300046663 | Bacteria | 6672 |
| 805 | Ga0495635_0052879 | 3300046663 | Bacteria | 2797 |
| 806 | Ga0495635_0085362 | 3300046663 | Bacteria | 2160 |
| 807 | Ga0495659_0002292 | 3300046664 | Bacteria | 6207 |
| 808 | Ga0495661_0000049 | 3300046665 | Bacteria | 144060 |
| 809 | Ga0495661_0015113 | 3300046665 | Bacteria | 5158 |
| 810 | Ga0495661_0039401 | 3300046665 | Bacteria | 2937 |
| 811 | Ga0495588_0065461 | 3300046674 | Bacteria | 1885 |
| 812 | Ga0495657_0020435 | 3300046675 | Bacteria | 4759 |
| 813 | Ga0495657_0032788 | 3300046675 | Bacteria | 3622 |
| 814 | Ga0495657_0035218 | 3300046675 | Bacteria | 3471 |
| 815 | Ga0495599_0005271 | 3300046678 | Bacteria | 7714 |
| 816 | Ga0495599_0039395 | 3300046678 | Bacteria | 2969 |
| 817 | Ga0495623_0054138 | 3300046679 | Bacteria | 2532 |
| 818 | Ga0495647_0003703 | 3300046681 | Bacteria | 4909 |
| 819 | Ga0495658_0009443 | 3300046683 | Bacteria | 4863 |
| 820 | Ga0495658_0021021 | 3300046683 | Bacteria | 3435 |
| 821 | Ga0495658_0099415 | 3300046683 | Bacteria | 1734 |
| 822 | Ga0495669_0097053 | 3300046684 | Bacteria | 1366 |
| 823 | Ga0495613_0013393 | 3300046689 | Bacteria | 6093 |
| 824 | Ga0495613_0040585 | 3300046689 | Bacteria | 3448 |
| 825 | Ga0495624_0010799 | 3300046690 | Bacteria | 6295 |
| 826 | Ga0495670_0006450 | 3300046691 | Bacteria | 5762 |
| 827 | Ga0495670_0030691 | 3300046691 | Bacteria | 2670 |
| 828 | Ga0495671_0107130 | 3300046692 | Bacteria | 1365 |
| 829 | Ga0495649_0000071 | 3300046694 | Bacteria | 89386 |
| 830 | Ga0495649_0010074 | 3300046694 | Bacteria | 5587 |
| 831 | Ga0495589_0036872 | 3300046794 | Bacteria | 2450 |
| 832 | Ga0495589_0090005 | 3300046794 | Bacteria | 1490 |
| 833 | Ga0495600_0001615 | 3300046809 | Bacteria | 12569 |
| 834 | Ga0495600_0055706 | 3300046809 | Bacteria | 2582 |
| 835 | Ga0495600_0128497 | 3300046809 | Bacteria | 1647 |
| 836 | Ga0495660_0007687 | 3300046810 | Bacteria | 6332 |
| 837 | Ga0495660_0018224 | 3300046810 | Bacteria | 4035 |
| 838 | Ga0495581_0020190 | 3300047315 | Bacteria | 3868 |
| 839 | Ga0495581_0085284 | 3300047315 | Bacteria | 1830 |
| 840 | Ga0495604_0004634 | 3300047317 | Bacteria | 10899 |
| 841 | Ga0495604_0015973 | 3300047317 | Bacteria | 5994 |
| 842 | Ga0495604_0023059 | 3300047317 | Bacteria | 4967 |
| 843 | Ga0495604_0049732 | 3300047317 | Bacteria | 3255 |
| 844 | Ga0495604_0270936 | 3300047317 | Bacteria | 1150 |
| 845 | Ga0495674_0009246 | 3300047319 | Bacteria | 9366 |
| 846 | Ga0495674_0123965 | 3300047319 | Bacteria | 2181 |
| 847 | Ga0495674_0208245 | 3300047319 | Bacteria | 1620 |
| 848 | Ga0495672_0000033 | 3300047320 | Bacteria | 291992 |
| 849 | Ga0495672_0001752 | 3300047320 | Bacteria | 20938 |
| 850 | Ga0495676_0012611 | 3300047321 | Bacteria | 7610 |
| 851 | Ga0495676_0065576 | 3300047321 | Bacteria | 2818 |
| 852 | Ga0495676_0142816 | 3300047321 | Bacteria | 1713 |
| 853 | Ga0495676_0258450 | 3300047321 | Bacteria | 1185 |
| 854 | Ga0495680_0005304 | 3300047322 | Bacteria | 12168 |
| 855 | Ga0495680_0005608 | 3300047322 | Bacteria | 11762 |
| 856 | Ga0495680_0073679 | 3300047322 | Bacteria | 2594 |
| 857 | Ga0495680_0098692 | 3300047322 | Bacteria | 2179 |
| 858 | Ga0495680_0183861 | 3300047322 | Bacteria | 1507 |
| 859 | Ga0495680_0215297 | 3300047322 | Bacteria | 1373 |
| 860 | Ga0495683_0000168 | 3300047323 | Bacteria | 63828 |
| 861 | Ga0495683_0041154 | 3300047323 | Bacteria | 2332 |
| 862 | Ga0495683_0063091 | 3300047323 | Bacteria | 1831 |
| 863 | Ga0495687_002679 | 3300047443 | Bacteria | 13854 |
| 864 | Ga0495687_004011 | 3300047443 | Bacteria | 10234 |
| 865 | Ga0495675_0003024 | 3300047444 | Bacteria | 10101 |
| 866 | Ga0495675_0187204 | 3300047444 | Bacteria | 1265 |
| 867 | Ga0495677_0000910 | 3300047445 | Bacteria | 11901 |
| 868 | Ga0495677_0003825 | 3300047445 | Bacteria | 5823 |
| 869 | Ga0495679_016361 | 3300047446 | Bacteria | 2685 |
| 870 | Ga0495679_031274 | 3300047446 | Bacteria | 1718 |
| 871 | Ga0495679_033131 | 3300047446 | Bacteria | 1652 |
| 872 | Ga0495685_033408 | 3300047447 | Bacteria | 1767 |
| 873 | Ga0495685_050020 | 3300047447 | Bacteria | 1419 |
| 874 | Ga0495681_0006172 | 3300047470 | Bacteria | 7913 |
| 875 | Ga0495681_0083340 | 3300047470 | Bacteria | 1423 |
| 876 | Ga0495684_0026140 | 3300047471 | Bacteria | 4485 |
| 877 | Ga0495684_0140287 | 3300047471 | Bacteria | 1812 |
| 878 | Ga0495684_0166451 | 3300047471 | Bacteria | 1642 |
| 879 | Ga0495686_0025648 | 3300047472 | Bacteria | 3863 |
| 880 | Ga0495593_0020219 | 3300047673 | Bacteria | 3729 |
| 881 | Ga0495602_0006383 | 3300048088 | Bacteria | 12370 |
| 882 | Ga0495602_0043428 | 3300048088 | Bacteria | 4087 |
| 883 | Ga0495602_0072323 | 3300048088 | Bacteria | 2941 |
| 884 | Ga0495602_0082044 | 3300048088 | Bacteria | 2707 |
| 885 | Ga0495614_0003972 | 3300048089 | Bacteria | 6640 |
| 886 | Ga0495626_0022127 | 3300048091 | Bacteria | 3142 |
| 887 | Ga0495626_0033656 | 3300048091 | Bacteria | 2454 |
| 888 | Ga0495626_0037034 | 3300048091 | Bacteria | 2320 |
| 889 | Ga0495626_0060530 | 3300048091 | Bacteria | 1725 |
| 890 | Ga0495626_0095564 | 3300048091 | Bacteria | 1301 |
| 891 | Ga0496100_0000806 | 3300048903 | Bacteria | 15000 |
| 892 | Ga0496100_0013729 | 3300048903 | Bacteria | 4683 |
| 893 | Ga0496100_0030965 | 3300048903 | Bacteria | 3323 |
| 894 | Ga0496100_0031708 | 3300048903 | Bacteria | 3288 |
| 895 | Ga0496101_0008655 | 3300048904 | Bacteria | 6653 |
| 896 | Ga0496101_0026703 | 3300048904 | Bacteria | 4015 |
| 897 | Ga0496101_0027887 | 3300048904 | Bacteria | 3938 |
| 898 | Ga0496101_0061494 | 3300048904 | Bacteria | 2728 |
| 899 | Ga0496101_0062004 | 3300048904 | Bacteria | 2717 |
| 900 | Ga0496102_0005850 | 3300048905 | Bacteria | 10465 |
| 901 | Ga0496102_0014158 | 3300048905 | Bacteria | 6929 |
| 902 | Ga0496102_0038976 | 3300048905 | Bacteria | 4291 |
| 903 | Ga0496102_0044345 | 3300048905 | Bacteria | 4036 |
| 904 | Ga0496102_0075742 | 3300048905 | Bacteria | 3093 |
| 905 | Ga0496102_0179152 | 3300048905 | Bacteria | 1996 |
| 906 | Ga0496103_0012301 | 3300048906 | Bacteria | 5079 |
| 907 | Ga0496103_0053490 | 3300048906 | Bacteria | 2502 |
| 908 | Ga0496104_0000079 | 3300048907 | Bacteria | 98874 |
| 909 | Ga0496104_0000905 | 3300048907 | Bacteria | 25438 |
| 910 | Ga0496104_0023005 | 3300048907 | Bacteria | 5727 |
| 911 | Ga0496104_0025752 | 3300048907 | Bacteria | 5425 |
| 912 | Ga0496104_0077766 | 3300048907 | Bacteria | 3161 |
| 913 | Ga0496104_0086386 | 3300048907 | Bacteria | 2994 |
| 914 | Ga0496104_0148862 | 3300048907 | Bacteria | 2247 |
| 915 | Ga0496104_0242297 | 3300048907 | Bacteria | 1715 |
| 916 | Ga0496105_0000225 | 3300048908 | Bacteria | 38002 |
| 917 | Ga0496105_0001448 | 3300048908 | Bacteria | 16699 |
| 918 | Ga0496105_0002273 | 3300048908 | Bacteria | 13939 |
| 919 | Ga0496105_0025717 | 3300048908 | Bacteria | 4794 |
| 920 | Ga0496105_0042175 | 3300048908 | Bacteria | 3760 |
| 921 | Ga0496105_0067130 | 3300048908 | Bacteria | 2961 |
| 922 | Ga0496105_0159666 | 3300048908 | Bacteria | 1851 |
| 923 | Ga0496106_0000782 | 3300048909 | Bacteria | 22988 |
| 924 | Ga0496106_0013575 | 3300048909 | Bacteria | 6012 |
| 925 | Ga0496106_0029782 | 3300048909 | Bacteria | 4069 |
| 926 | Ga0496106_0067750 | 3300048909 | Bacteria | 2721 |
| 927 | Ga0496106_0122005 | 3300048909 | Bacteria | 2038 |
| 928 | Ga0496106_0386495 | 3300048909 | Bacteria | 1125 |
| 929 | Ga0496107_0001064 | 3300048910 | Bacteria | 16457 |
| 930 | Ga0496107_0002049 | 3300048910 | Bacteria | 12883 |
| 931 | Ga0496107_0015114 | 3300048910 | Bacteria | 5407 |
| 932 | Ga0496107_0020789 | 3300048910 | Bacteria | 4638 |
| 933 | Ga0496107_0029290 | 3300048910 | Bacteria | 3916 |
| 934 | Ga0496107_0043893 | 3300048910 | Bacteria | 3213 |
| 935 | Ga0496108_0001587 | 3300048911 | Bacteria | 18010 |
| 936 | Ga0496108_0008984 | 3300048911 | Bacteria | 8098 |
| 937 | Ga0496108_0040406 | 3300048911 | Bacteria | 3888 |
| 938 | Ga0496108_0047868 | 3300048911 | Bacteria | 3574 |
| 939 | Ga0496108_0088726 | 3300048911 | Bacteria | 2628 |
| 940 | Ga0496109_0001253 | 3300048912 | Bacteria | 21077 |
| 941 | Ga0496109_0010418 | 3300048912 | Bacteria | 7940 |
| 942 | Ga0496109_0042508 | 3300048912 | Bacteria | 4117 |
| 943 | Ga0496109_0151178 | 3300048912 | Bacteria | 2173 |
| 944 | Ga0496109_0161799 | 3300048912 | Bacteria | 2097 |
| 945 | Ga0496110_0028356 | 3300048913 | Bacteria | 4808 |
| 946 | Ga0496110_0100491 | 3300048913 | Bacteria | 2593 |
| 947 | Ga0496110_0111674 | 3300048913 | Bacteria | 2457 |
| 948 | Ga0496110_0199355 | 3300048913 | Bacteria | 1818 |
| 949 | Ga0496110_0375520 | 3300048913 | Bacteria | 1295 |
| 950 | Ga0496111_0000416 | 3300048914 | Bacteria | 21461 |
| 951 | Ga0496111_0007782 | 3300048914 | Bacteria | 7056 |
| 952 | Ga0496111_0046274 | 3300048914 | Bacteria | 3132 |
| 953 | Ga0496111_0073417 | 3300048914 | Bacteria | 2491 |
| 954 | Ga0496112_0002998 | 3300048915 | Bacteria | 13796 |
| 955 | Ga0496112_0003843 | 3300048915 | Bacteria | 12540 |
| 956 | Ga0496112_0015232 | 3300048915 | Bacteria | 7168 |
| 957 | Ga0496112_0102249 | 3300048915 | Bacteria | 2835 |
| 958 | Ga0496112_0149775 | 3300048915 | Bacteria | 2300 |
| 959 | Ga0496113_0000215 | 3300048916 | Bacteria | 27020 |
| 960 | Ga0496113_0049503 | 3300048916 | Bacteria | 3129 |
| 961 | Ga0496113_0108825 | 3300048916 | Bacteria | 2154 |
| 962 | Ga0496113_0174989 | 3300048916 | Bacteria | 1700 |
| 963 | Ga0496113_0192885 | 3300048916 | Bacteria | 1617 |
| 964 | Ga0496113_0249270 | 3300048916 | Bacteria | 1417 |
| 965 | Ga0496113_0264016 | 3300048916 | Bacteria | 1375 |
| 966 | Ga0496114_0002900 | 3300048917 | Bacteria | 13140 |
| 967 | Ga0496114_0018697 | 3300048917 | Bacteria | 5607 |
| 968 | Ga0496114_0026644 | 3300048917 | Bacteria | 4735 |
| 969 | Ga0496114_0040057 | 3300048917 | Bacteria | 3877 |
| 970 | Ga0496115_0001718 | 3300048918 | Bacteria | 15712 |
| 971 | Ga0496115_0008715 | 3300048918 | Bacteria | 7517 |
| 972 | Ga0496115_0021185 | 3300048918 | Bacteria | 5018 |
| 973 | Ga0496115_0024187 | 3300048918 | Bacteria | 4718 |
| 974 | Ga0496115_0048443 | 3300048918 | Bacteria | 3399 |
| 975 | Ga0496115_0077466 | 3300048918 | Bacteria | 2703 |
| 976 | Ga0496115_0184135 | 3300048918 | Bacteria | 1726 |
| 977 | Ga0496122_0001753 | 3300048925 | Bacteria | 33345 |
| 978 | Ga0496123_0003783 | 3300048926 | Bacteria | 16574 |
| 979 | Ga0496125_0006247 | 3300048928 | Bacteria | 12950 |
| 980 | Ga0495678_000024 | 3300049459 | Bacteria | 229034 |
| 981 | Ga0495678_000061 | 3300049459 | Bacteria | 142649 |
| 982 | Ga0495682_0001519 | 3300049460 | Bacteria | 12302 |
| 983 | Ga0495682_0023599 | 3300049460 | Bacteria | 2295 |
| 984 | Ga0501031_0000643 | 3300049568 | Bacteria | 20718 |
| 985 | Ga0501031_0007697 | 3300049568 | Bacteria | 7013 |
| 986 | Ga0501031_0076562 | 3300049568 | Bacteria | 2179 |
| 987 | Ga0501032_0012676 | 3300049569 | Bacteria | 6011 |
| 988 | Ga0501032_0047591 | 3300049569 | Bacteria | 2895 |
| 989 | Ga0501033_0010744 | 3300049570 | Bacteria | 7018 |
| 990 | Ga0501033_0014803 | 3300049570 | Bacteria | 5922 |
| 991 | Ga0501033_0023102 | 3300049570 | Bacteria | 4689 |
| 992 | Ga0501033_0041519 | 3300049570 | Bacteria | 3432 |
| 993 | Ga0501033_0077981 | 3300049570 | Bacteria | 2431 |
| 994 | Ga0501034_0069583 | 3300049571 | Bacteria | 3530 |
| 995 | Ga0501034_0072331 | 3300049571 | Bacteria | 3457 |
| 996 | Ga0501034_0079371 | 3300049571 | Bacteria | 3285 |
| 997 | Ga0501034_0149849 | 3300049571 | Bacteria | 2309 |
| 998 | Ga0501036_0001896 | 3300049572 | Bacteria | 16262 |
| 999 | Ga0501036_0012065 | 3300049572 | Bacteria | 7159 |
| 1000 | Ga0501036_0073557 | 3300049572 | Bacteria | 2889 |
| 1001 | Ga0501036_0163731 | 3300049572 | Bacteria | 1875 |
| 1002 | Ga0501037_0013364 | 3300049573 | Bacteria | 6048 |
| 1003 | Ga0501037_0034705 | 3300049573 | Bacteria | 3721 |
| 1004 | Ga0501037_0082587 | 3300049573 | Bacteria | 2328 |
| 1005 | Ga0501037_0122063 | 3300049573 | Bacteria | 1873 |
| 1006 | Ga0501038_0004733 | 3300049574 | Bacteria | 12659 |
| 1007 | Ga0501038_0011296 | 3300049574 | Bacteria | 8152 |
| 1008 | Ga0501038_0015310 | 3300049574 | Bacteria | 6973 |
| 1009 | Ga0501038_0032332 | 3300049574 | Bacteria | 4617 |
| 1010 | Ga0501038_0139520 | 3300049574 | Bacteria | 1984 |
| 1011 | Ga0501038_0163315 | 3300049574 | Bacteria | 1808 |
| 1012 | Ga0501039_0004579 | 3300049575 | Bacteria | 10449 |
| 1013 | Ga0501039_0026855 | 3300049575 | Bacteria | 4425 |
| 1014 | Ga0501039_0066121 | 3300049575 | Bacteria | 2806 |
| 1015 | Ga0501039_0066303 | 3300049575 | Bacteria | 2802 |
| 1016 | Ga0501040_0000761 | 3300049576 | Bacteria | 19995 |
| 1017 | Ga0501040_0005348 | 3300049576 | Bacteria | 8302 |
| 1018 | Ga0501040_0075445 | 3300049576 | Bacteria | 2330 |
| 1019 | Ga0501041_0005396 | 3300049577 | Bacteria | 7491 |
| 1020 | Ga0501041_0008980 | 3300049577 | Bacteria | 5881 |
| 1021 | Ga0501041_0111693 | 3300049577 | Bacteria | 1695 |
| 1022 | Ga0501042_0003840 | 3300049578 | Bacteria | 9501 |
| 1023 | Ga0501042_0008836 | 3300049578 | Bacteria | 6679 |
| 1024 | Ga0501042_0112913 | 3300049578 | Bacteria | 1956 |
| 1025 | Ga0501046_0002981 | 3300049580 | Bacteria | 15644 |
| 1026 | Ga0501047_0046651 | 3300049581 | Bacteria | 4187 |
| 1027 | Ga0501047_0085291 | 3300049581 | Bacteria | 3034 |
| 1028 | Ga0501047_0157589 | 3300049581 | Bacteria | 2143 |
| 1029 | Ga0501047_0206302 | 3300049581 | Bacteria | 1824 |
| 1030 | Ga0501048_0003011 | 3300049582 | Bacteria | 12860 |
| 1031 | Ga0501048_0011184 | 3300049582 | Bacteria | 6690 |
| 1032 | Ga0501048_0025358 | 3300049582 | Bacteria | 4321 |
| 1033 | Ga0501067_0039738 | 3300049583 | Bacteria | 2612 |
| 1034 | Ga0501068_0033037 | 3300049584 | Bacteria | 3080 |
| 1035 | Ga0501068_0057648 | 3300049584 | Bacteria | 2355 |
| 1036 | Ga0501068_0058676 | 3300049584 | Bacteria | 2336 |
| 1037 | Ga0501069_0006910 | 3300049585 | Bacteria | 5932 |
| 1038 | Ga0501070_0020457 | 3300049586 | Bacteria | 5551 |
| 1039 | Ga0501071_0000078 | 3300049587 | Bacteria | 34978 |
| 1040 | Ga0501071_0054905 | 3300049587 | Bacteria | 2875 |
| 1041 | Ga0501072_0001618 | 3300049588 | Bacteria | 16843 |
| 1042 | Ga0501072_0013652 | 3300049588 | Bacteria | 6219 |
| 1043 | Ga0501072_0050631 | 3300049588 | Bacteria | 3270 |
| 1044 | Ga0501072_0055797 | 3300049588 | Bacteria | 3113 |
| 1045 | Ga0501072_0132378 | 3300049588 | Bacteria | 1988 |
| 1046 | Ga0501072_0134688 | 3300049588 | Bacteria | 1970 |
| 1047 | Ga0501072_0403812 | 3300049588 | Bacteria | 1084 |
| 1048 | Ga0501073_0024329 | 3300049589 | Bacteria | 4348 |
| 1049 | Ga0501073_0072835 | 3300049589 | Bacteria | 2393 |
| 1050 | Ga0501073_0271441 | 3300049589 | Bacteria | 1170 |
| 1051 | Ga0501074_0032389 | 3300049590 | Bacteria | 3787 |
| 1052 | Ga0501074_0244576 | 3300049590 | Bacteria | 1276 |
| 1053 | Ga0501074_0336853 | 3300049590 | Bacteria | 1071 |
| 1054 | Ga0501075_0000784 | 3300049591 | Bacteria | 19847 |
| 1055 | Ga0501075_0002758 | 3300049591 | Bacteria | 11765 |
| 1056 | Ga0501075_0021286 | 3300049591 | Bacteria | 4726 |
| 1057 | Ga0501075_0072073 | 3300049591 | Bacteria | 2611 |
| 1058 | Ga0501075_0122141 | 3300049591 | Bacteria | 1982 |
| 1059 | Ga0501076_0001426 | 3300049592 | Bacteria | 16037 |
| 1060 | Ga0501076_0002404 | 3300049592 | Bacteria | 12827 |
| 1061 | Ga0501076_0037727 | 3300049592 | Bacteria | 3791 |
| 1062 | Ga0501076_0059533 | 3300049592 | Bacteria | 3038 |
| 1063 | Ga0501076_0166375 | 3300049592 | Bacteria | 1797 |
| 1064 | Ga0501077_0002379 | 3300049593 | Bacteria | 11287 |
| 1065 | Ga0501077_0006663 | 3300049593 | Bacteria | 7097 |
| 1066 | Ga0501077_0013226 | 3300049593 | Bacteria | 5172 |
| 1067 | Ga0501077_0108584 | 3300049593 | Bacteria | 1758 |
| 1068 | Ga0501079_0000213 | 3300049741 | Bacteria | 34053 |
| 1069 | Ga0501079_0002094 | 3300049741 | Bacteria | 14313 |
| 1070 | Ga0501079_0005043 | 3300049741 | Bacteria | 9802 |
| 1071 | Ga0501079_0034239 | 3300049741 | Bacteria | 3908 |
| 1072 | Ga0501079_0058357 | 3300049741 | Bacteria | 2978 |
| 1073 | Ga0501079_0209956 | 3300049741 | Bacteria | 1521 |
| 1074 | Ga0501080_0001183 | 3300049742 | Bacteria | 21629 |
| 1075 | Ga0501080_0013912 | 3300049742 | Bacteria | 7407 |
| 1076 | Ga0501080_0042100 | 3300049742 | Bacteria | 4255 |
| 1077 | Ga0501080_0106635 | 3300049742 | Bacteria | 2597 |
| 1078 | Ga0501080_0150193 | 3300049742 | Bacteria | 2154 |
| 1079 | Ga0501081_0006277 | 3300049743 | Bacteria | 7705 |
| 1080 | Ga0501081_0011772 | 3300049743 | Bacteria | 5728 |
| 1081 | Ga0501081_0024126 | 3300049743 | Bacteria | 4083 |
| 1082 | Ga0501081_0055263 | 3300049743 | Bacteria | 2743 |
| 1083 | Ga0501083_0005838 | 3300049744 | Bacteria | 8717 |
| 1084 | Ga0501083_0005926 | 3300049744 | Bacteria | 8653 |
| 1085 | Ga0501083_0026484 | 3300049744 | Bacteria | 4008 |
| 1086 | Ga0501083_0107285 | 3300049744 | Bacteria | 1838 |
| 1087 | Ga0501035_0108543 | 3300049822 | Bacteria | 2433 |
| 1088 | Ga0501035_0209166 | 3300049822 | Bacteria | 1670 |
| 1089 | Ga0501044_0000084 | 3300049823 | Bacteria | 114544 |
| 1090 | Ga0501044_0064866 | 3300049823 | Bacteria | 3726 |
| 1091 | Ga0501044_0101084 | 3300049823 | Bacteria | 2901 |
| 1092 | Ga0501044_0111899 | 3300049823 | Bacteria | 2737 |
| 1093 | Ga0501044_0278065 | 3300049823 | Bacteria | 1608 |
| 1094 | Ga0501045_0001082 | 3300049824 | Bacteria | 18002 |
| 1095 | Ga0501045_0018252 | 3300049824 | Bacteria | 4989 |
| 1096 | Ga0501045_0148243 | 3300049824 | Bacteria | 1745 |
| 1097 | Ga0501045_0232864 | 3300049824 | Bacteria | 1371 |
| 1098 | nmdc:mga03683_21567_c1 | 3300050489 | Bacteria | 2485 |
| 1099 | nmdc:mga03n38_47518_c1 | 3300050490 | Bacteria | 1900 |
| 1100 | nmdc:mga00v17_99901_c1 | 3300050491 | Bacteria | 1831 |
| 1101 | nmdc:mga0yw44_167638_c1 | 3300050492 | Bacteria | 1441 |
| 1102 | nmdc:mga0yw44_211992_c1 | 3300050492 | Bacteria | 1281 |
| 1103 | nmdc:mga0k408_7449_c1 | 3300050493 | Bacteria | 5844 |
| 1104 | nmdc:mga07m45_42260_c1 | 3300050496 | Bacteria | 2555 |
| 1105 | nmdc:mga05p37_120335_c1 | 3300050507 | Bacteria | 3226 |
| 1106 | nmdc:mga05p37_122041_c1 | 3300050507 | Bacteria | 3200 |
| 1107 | nmdc:mga05p37_20486_c1 | 3300050507 | Bacteria | 8000 |
| 1108 | nmdc:mga05p37_224789_c1 | 3300050507 | Bacteria | 2264 |
| 1109 | nmdc:mga05p37_32_c1 | 3300050507 | Bacteria | 112982 |
| 1110 | nmdc:mga05p37_35373_c1 | 3300050507 | Bacteria | 6124 |
| 1111 | nmdc:mga09592_74927_c1 | 3300050508 | Bacteria | 2877 |
| 1112 | nmdc:mga09592_7970_c1 | 3300050508 | Bacteria | 8608 |
| 1113 | nmdc:mga0qj67_1240_c1 | 3300050509 | Bacteria | 17825 |
| 1114 | nmdc:mga0qj67_214126_c1 | 3300050509 | Bacteria | 1564 |
| 1115 | nmdc:mga0qj67_67130_c1 | 3300050509 | Bacteria | 2857 |
| 1116 | nmdc:mga06r32_135821_c1 | 3300050510 | Bacteria | 2434 |
| 1117 | nmdc:mga06r32_1670_c1 | 3300050510 | Bacteria | 20024 |
| 1118 | nmdc:mga06r32_96585_c1 | 3300050510 | Bacteria | 2894 |
| 1119 | nmdc:mga08y16_116492_c1 | 3300050511 | Bacteria | 2781 |
| 1120 | nmdc:mga08y16_129212_c1 | 3300050511 | Bacteria | 2628 |
| 1121 | nmdc:mga08y16_66352_c1 | 3300050511 | Bacteria | 3766 |
| 1122 | nmdc:mga08y16_6877_c1 | 3300050511 | Bacteria | 11928 |
| 1123 | nmdc:mga08y16_73993_c1 | 3300050511 | Bacteria | 3550 |
| 1124 | nmdc:mga08y16_997_c1 | 3300050511 | Bacteria | 27611 |
| 1125 | nmdc:mga0n895_184916_c1 | 3300050512 | Bacteria | 2115 |
| 1126 | nmdc:mga0n895_389536_c1 | 3300050512 | Bacteria | 1410 |
| 1127 | nmdc:mga0n895_4071_c1 | 3300050512 | Bacteria | 11900 |
| 1128 | nmdc:mga0n895_60104_c1 | 3300050512 | Bacteria | 3750 |
| 1129 | nmdc:mga0rr50_152109_c1 | 3300050513 | Bacteria | 1871 |
| 1130 | nmdc:mga0rr50_159095_c1 | 3300050513 | Bacteria | 1832 |
| 1131 | nmdc:mga0rr50_216119_c1 | 3300050513 | Bacteria | 1581 |
| 1132 | nmdc:mga08x19_107498_c1 | 3300050514 | Bacteria | 1857 |
| 1133 | nmdc:mga08x19_137288_c1 | 3300050514 | Bacteria | 1649 |
| 1134 | nmdc:mga08x19_91457_c1 | 3300050514 | Bacteria | 2009 |
| 1135 | nmdc:mga0a205_111119_c1 | 3300050515 | Bacteria | 2639 |
| 1136 | nmdc:mga0a205_1694_c1 | 3300050515 | Bacteria | 19038 |
| 1137 | nmdc:mga0a205_374115_c1 | 3300050515 | Bacteria | 1290 |
| 1138 | nmdc:mga0a205_43990_c1 | 3300050515 | Bacteria | 4304 |
| 1139 | nmdc:mga0a205_63882_c1 | 3300050515 | Bacteria | 3556 |
| 1140 | nmdc:mga0sz30_48518_c1 | 3300050516 | Bacteria | 1796 |
| 1141 | Ga0495601_0000334 | 3300053077 | Bacteria | 24822 |
| 1142 | Ga0495601_0001025 | 3300053077 | Bacteria | 15278 |
| 1143 | Ga0495601_0002590 | 3300053077 | Bacteria | 10252 |
| 1144 | Ga0495601_0019507 | 3300053077 | Bacteria | 4135 |
| 1145 | Ga0495601_0026030 | 3300053077 | Bacteria | 3610 |
| 1146 | Ga0495601_0092352 | 3300053077 | Bacteria | 1949 |
| 1147 | Ga0495601_0116912 | 3300053077 | Bacteria | 1730 |
| 1148 | Ga0495601_0161301 | 3300053077 | Bacteria | 1465 |
| 1149 | Ga0495601_0210986 | 3300053077 | Unclassified | 1268 |
| 1150 | Ga0495612_0045604 | 3300053078 | Bacteria | 1794 |
| 1151 | Ga0495595_0001239 | 3300053084 | Bacteria | 9939 |
| 1152 | Ga0495595_0001716 | 3300053084 | Bacteria | 8577 |
| 1153 | Ga0495595_0006503 | 3300053084 | Bacteria | 4767 |
| 1154 | Ga0495595_0008339 | 3300053084 | Bacteria | 4253 |
| 1155 | Ga0495595_0021468 | 3300053084 | Bacteria | 2822 |
| 1156 | Ga0495595_0100010 | 3300053084 | Bacteria | 1399 |
| 1157 | Ga0495619_0000016 | 3300053085 | Bacteria | 231442 |
| 1158 | Ga0495619_0000384 | 3300053085 | Bacteria | 30338 |
| 1159 | Ga0495619_0001774 | 3300053085 | Bacteria | 14345 |
| 1160 | Ga0495619_0012701 | 3300053085 | Bacteria | 5301 |
| 1161 | Ga0495619_0018412 | 3300053085 | Bacteria | 4431 |
| 1162 | Ga0495619_0038680 | 3300053085 | Bacteria | 3112 |
| 1163 | Ga0495619_0047152 | 3300053085 | Bacteria | 2836 |
| 1164 | Ga0495619_0273583 | 3300053085 | Bacteria | 1170 |
| 1165 | Ga0500650_0091834 | 3300053098 | Bacteria | 1421 |
| 1166 | Ga0500595_006007 | 3300053119 | Bacteria | 5219 |
| 1167 | Ga0500652_058240 | 3300053131 | Bacteria | 1586 |
| 1168 | Ga0500616_0020313 | 3300053153 | Bacteria | 3732 |
| 1169 | Ga0500616_0073191 | 3300053153 | Bacteria | 1740 |
| 1170 | Ga0501084_0000457 | 3300054114 | Bacteria | 31427 |
| 1171 | Ga0501084_0002873 | 3300054114 | Bacteria | 13931 |
| 1172 | Ga0501084_0090621 | 3300054114 | Bacteria | 2567 |
| 1173 | Ga0501084_0091849 | 3300054114 | Bacteria | 2549 |
| 1174 | Ga0501084_0240306 | 3300054114 | Bacteria | 1529 |
| 1175 | Ga0501082_0012045 | 3300060353 | Bacteria | 7431 |
| 1176 | Ga0501082_0013927 | 3300060353 | Bacteria | 6915 |
| 1177 | Ga0501082_0076653 | 3300060353 | Bacteria | 2882 |
| 1178 | Ga0501082_0080565 | 3300060353 | Bacteria | 2810 |
| 1179 | Ga0466962_0047914 | 3300061719 | Bacteria | 2042 |
| 1180 | Ga0466962_0058785 | 3300061719 | Bacteria | 1835 |
| 1181 | Ga0530510_0000158 | 3300061734 | Bacteria | 40587 |
| 1182 | Ga0530510_0011122 | 3300061734 | Bacteria | 6312 |
| 1183 | Ga0530510_0051650 | 3300061734 | Bacteria | 2971 |
| 1184 | Ga0530510_0052308 | 3300061734 | Bacteria | 2952 |
| 1185 | Ga0530510_0128852 | 3300061734 | Bacteria | 1861 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049588 | Ga0501072_0403812 | Ga0501072_0403812_319_1053 | 240 |
| 2 | 3300039438 | Ga0436360_0635187 | Ga0436360_0635187_17_841 | 271 |
| 3 | 3300005458 | Ga0070681_10039942 | Ga0070681_100399422 | 274 |
| 4 | 3300025912 | Ga0207707_10072826 | Ga0207707_100728262 | 274 |
| 5 | 3300049576 | Ga0501040_0075445 | Ga0501040_0075445_892_1887 | 285 |
| 6 | 3300049741 | Ga0501079_0034239 | Ga0501079_0034239_149_1144 | 285 |
| 7 | 3300049743 | Ga0501081_0024126 | Ga0501081_0024126_1306_2301 | 285 |
| 8 | 3300047443 | Ga0495687_004011 | Ga0495687_004011_2301_3299 | 288 |
| 9 | 3300049572 | Ga0501036_0163731 | Ga0501036_0163731_103_1098 | 288 |
| 10 | 3300049588 | Ga0501072_0050631 | Ga0501072_0050631_399_1394 | 288 |
| 11 | 3300049591 | Ga0501075_0072073 | Ga0501075_0072073_723_1718 | 288 |
| 12 | 3300049742 | Ga0501080_0106635 | Ga0501080_0106635_944_1939 | 288 |
| 13 | 3300046528 | Ga0495642_0031569 | Ga0495642_0031569_274_1272 | 289 |
| 14 | 3300005295 | Ga0065707_10115366 | Ga0065707_101153661 | 292 |
| 15 | 3300025932 | Ga0207690_10145160 | Ga0207690_101451602 | 292 |
| 16 | 3300046679 | Ga0495623_0054138 | Ga0495623_0054138_1637_2521 | 292 |
| 17 | 3300035116 | Ga0373945_0007601 | Ga0373945_0007601_806_1735 | 296 |
| 18 | 3300046531 | Ga0495665_0016123 | Ga0495665_0016123_300_1274 | 296 |
| 19 | 3300053077 | Ga0495601_0116912 | Ga0495601_0116912_626_1612 | 301 |
| 20 | 3300036401 | Ga0373937_0357967 | Ga0373937_0357967_198_1115 | 302 |
| 21 | 3300005530 | Ga0070679_100330528 | Ga0070679_1003305282 | 303 |
| 22 | 3300030763 | Ga0265763_1004377 | Ga0265763_10043771 | 303 |
| 23 | 3300035119 | Ga0373956_0014565 | Ga0373956_0014565_2234_3223 | 303 |
| 24 | 3300035172 | Ga0373955_0017584 | Ga0373955_0017584_528_1517 | 303 |
| 25 | 3300036401 | Ga0373937_0023033 | Ga0373937_0023033_3669_4658 | 303 |
| 26 | 3300046559 | Ga0495667_0119655 | Ga0495667_0119655_165_1154 | 303 |
| 27 | 3300046675 | Ga0495657_0032788 | Ga0495657_0032788_1600_2589 | 303 |
| 28 | 3300047317 | Ga0495604_0270936 | Ga0495604_0270936_120_1109 | 303 |
| 29 | 3300047322 | Ga0495680_0183861 | Ga0495680_0183861_106_1095 | 303 |
| 30 | 3300048088 | Ga0495602_0043428 | Ga0495602_0043428_423_1412 | 303 |
| 31 | 3300049589 | Ga0501073_0271441 | Ga0501073_0271441_30_950 | 303 |
| 32 | 3300053077 | Ga0495601_0019507 | Ga0495601_0019507_1126_2115 | 303 |
| 33 | 3300053084 | Ga0495595_0008339 | Ga0495595_0008339_2696_3685 | 303 |
| 34 | 3300053085 | Ga0495619_0038680 | Ga0495619_0038680_1606_2595 | 303 |
| 35 | 3300009147 | Ga0114129_10116952 | Ga0114129_101169522 | 305 |
| 36 | 3300036401 | Ga0373937_0528808 | Ga0373937_0528808_104_1090 | 305 |
| 37 | 3300049590 | Ga0501074_0244576 | Ga0501074_0244576_16_942 | 305 |
| 38 | 3300028800 | Ga0265338_10132968 | Ga0265338_101329681 | 306 |
| 39 | 3300038443 | Ga0395901_0112885 | Ga0395901_0112885_1787_2794 | 306 |
| 40 | 3300054114 | Ga0501084_0091849 | Ga0501084_0091849_1160_2152 | 306 |
| 41 | 3300005335 | Ga0070666_10017385 | Ga0070666_100173856 | 307 |
| 42 | 3300005355 | Ga0070671_100009073 | Ga0070671_1000090736 | 307 |
| 43 | 3300005457 | Ga0070662_100164305 | Ga0070662_1001643052 | 307 |
| 44 | 3300005543 | Ga0070672_100066373 | Ga0070672_1000663732 | 307 |
| 45 | 3300009177 | Ga0105248_10003287 | Ga0105248_100032878 | 307 |
| 46 | 3300025903 | Ga0207680_10003320 | Ga0207680_100033206 | 307 |
| 47 | 3300025907 | Ga0207645_10137723 | Ga0207645_101377232 | 307 |
| 48 | 3300025933 | Ga0207706_10077468 | Ga0207706_100774682 | 307 |
| 49 | 3300025940 | Ga0207691_10079326 | Ga0207691_100793262 | 307 |
| 50 | 3300025941 | Ga0207711_10002482 | Ga0207711_100024827 | 307 |
| 51 | 3300026118 | Ga0207675_100366112 | Ga0207675_1003661122 | 307 |
| 52 | 3300026121 | Ga0207683_10235638 | Ga0207683_102356382 | 307 |
| 53 | 3300026142 | Ga0207698_10170021 | Ga0207698_101700212 | 307 |
| 54 | 3300027682 | Ga0209971_1004676 | Ga0209971_10046762 | 307 |
| 55 | 3300027876 | Ga0209974_10000880 | Ga0209974_100008807 | 307 |
| 56 | 3300048911 | Ga0496108_0088726 | Ga0496108_0088726_1052_2065 | 307 |
| 57 | 3300031901 | Ga0307406_10113666 | Ga0307406_101136662 | 308 |
| 58 | 3300031995 | Ga0307409_100416364 | Ga0307409_1004163642 | 308 |
| 59 | 3300037471 | Ga0395905_0011373 | Ga0395905_0011373_2930_3937 | 308 |
| 60 | 3300006175 | Ga0070712_100075359 | Ga0070712_1000753593 | 309 |
| 61 | 3300044684 | Ga0466966_0028792 | Ga0466966_0028792_672_1658 | 309 |
| 62 | 3300044693 | Ga0466961_0020886 | Ga0466961_0020886_1602_2588 | 309 |
| 63 | 3300044694 | Ga0466963_0017165 | Ga0466963_0017165_2980_3966 | 309 |
| 64 | 3300044719 | Ga0466971_0021322 | Ga0466971_0021322_40_1026 | 309 |
| 65 | 3300044842 | Ga0466957_0003978 | Ga0466957_0003978_2714_3700 | 309 |
| 66 | 3300045049 | Ga0466959_0064395 | Ga0466959_0064395_1218_2204 | 309 |
| 67 | 3300045836 | Ga0466958_0026431 | Ga0466958_0026431_1686_2672 | 309 |
| 68 | 3300045976 | Ga0466967_0212576 | Ga0466967_0212576_489_1475 | 309 |
| 69 | 3300044694 | Ga0466963_0206837 | Ga0466963_0206837_246_1235 | 310 |
| 70 | 3300049574 | Ga0501038_0163315 | Ga0501038_0163315_604_1548 | 310 |
| 71 | 3300050492 | nmdc:mga0yw44_211992_c1 | nmdc:mga0yw44_211992_c1_183_1169 | 310 |
| 72 | 3300025918 | Ga0207662_10188611 | Ga0207662_101886112 | 311 |
| 73 | 3300031249 | Ga0265339_10014744 | Ga0265339_100147443 | 311 |
| 74 | 3300031665 | Ga0316575_10006778 | Ga0316575_100067783 | 311 |
| 75 | 3300044694 | Ga0466963_0114234 | Ga0466963_0114234_195_1181 | 311 |
| 76 | 3300044901 | Ga0466960_0161758 | Ga0466960_0161758_173_1159 | 311 |
| 77 | 3300045836 | Ga0466958_0124893 | Ga0466958_0124893_348_1334 | 311 |
| 78 | 3300061719 | Ga0466962_0047914 | Ga0466962_0047914_354_1340 | 311 |
| 79 | 3300031712 | Ga0265342_10069525 | Ga0265342_100695252 | 312 |
| 80 | 3300031824 | Ga0307413_10379883 | Ga0307413_103798831 | 312 |
| 81 | 3300048910 | Ga0496107_0020789 | Ga0496107_0020789_1594_2532 | 312 |
| 82 | 3300049741 | Ga0501079_0209956 | Ga0501079_0209956_15_1013 | 312 |
| 83 | 3300005563 | Ga0068855_100052442 | Ga0068855_1000524422 | 313 |
| 84 | 3300006048 | Ga0075363_100002037 | Ga0075363_1000020373 | 313 |
| 85 | 3300006051 | Ga0075364_10006763 | Ga0075364_100067636 | 313 |
| 86 | 3300013102 | Ga0157371_10229260 | Ga0157371_102292602 | 313 |
| 87 | 3300025917 | Ga0207660_10064971 | Ga0207660_100649712 | 313 |
| 88 | 3300025919 | Ga0207657_10080606 | Ga0207657_100806062 | 313 |
| 89 | 3300025921 | Ga0207652_10164786 | Ga0207652_101647862 | 313 |
| 90 | 3300025936 | Ga0207670_10013702 | Ga0207670_100137023 | 313 |
| 91 | 3300025949 | Ga0207667_10058946 | Ga0207667_100589462 | 313 |
| 92 | 3300028573 | Ga0265334_10054621 | Ga0265334_100546212 | 313 |
| 93 | 3300031249 | Ga0265339_10087310 | Ga0265339_100873102 | 313 |
| 94 | 3300031711 | Ga0265314_10099824 | Ga0265314_100998242 | 313 |
| 95 | 3300031712 | Ga0265342_10000510 | Ga0265342_1000051027 | 313 |
| 96 | 3300048904 | Ga0496101_0061494 | Ga0496101_0061494_108_1106 | 313 |
| 97 | 3300048905 | Ga0496102_0038976 | Ga0496102_0038976_2887_3885 | 313 |
| 98 | 3300048908 | Ga0496105_0067130 | Ga0496105_0067130_1892_2890 | 313 |
| 99 | 3300048913 | Ga0496110_0199355 | Ga0496110_0199355_587_1585 | 313 |
| 100 | 3300049581 | Ga0501047_0157589 | Ga0501047_0157589_951_1943 | 313 |
| 101 | 3300049742 | Ga0501080_0150193 | Ga0501080_0150193_149_1120 | 313 |
| 102 | 3300005439 | Ga0070711_100206981 | Ga0070711_1002069811 | 314 |
| 103 | 3300006177 | Ga0075362_10036152 | Ga0075362_100361522 | 314 |
| 104 | 3300006186 | Ga0075369_10044119 | Ga0075369_100441192 | 314 |
| 105 | 3300025904 | Ga0207647_10068896 | Ga0207647_100688962 | 314 |
| 106 | 3300046507 | Ga0495606_0237736 | Ga0495606_0237736_20_1000 | 314 |
| 107 | 3300046519 | Ga0495632_0096819 | Ga0495632_0096819_15_986 | 314 |
| 108 | 3300046522 | Ga0495643_0014879 | Ga0495643_0014879_3026_4099 | 314 |
| 109 | 3300046665 | Ga0495661_0015113 | Ga0495661_0015113_4165_5136 | 314 |
| 110 | 3300046794 | Ga0495589_0090005 | Ga0495589_0090005_12_995 | 314 |
| 111 | 3300047447 | Ga0495685_033408 | Ga0495685_033408_73_1044 | 314 |
| 112 | 3300048091 | Ga0495626_0033656 | Ga0495626_0033656_1316_2284 | 314 |
| 113 | 3300049570 | Ga0501033_0023102 | Ga0501033_0023102_1961_2959 | 314 |
| 114 | 3300049574 | Ga0501038_0032332 | Ga0501038_0032332_3398_4396 | 314 |
| 115 | 3300050493 | nmdc:mga0k408_7449_c1 | nmdc:mga0k408_7449_c1_657_1652 | 314 |
| 116 | 3300050516 | nmdc:mga0sz30_48518_c1 | nmdc:mga0sz30_48518_c1_297_1292 | 314 |
| 117 | 3300005290 | Ga0065712_10014721 | Ga0065712_100147212 | 315 |
| 118 | 3300005334 | Ga0068869_100287558 | Ga0068869_1002875582 | 315 |
| 119 | 3300005340 | Ga0070689_100132728 | Ga0070689_1001327282 | 315 |
| 120 | 3300005353 | Ga0070669_100103055 | Ga0070669_1001030552 | 315 |
| 121 | 3300005365 | Ga0070688_100097177 | Ga0070688_1000971772 | 315 |
| 122 | 3300005459 | Ga0068867_100044629 | Ga0068867_1000446293 | 315 |
| 123 | 3300005617 | Ga0068859_100026815 | Ga0068859_1000268155 | 315 |
| 124 | 3300005618 | Ga0068864_100117170 | Ga0068864_1001171702 | 315 |
| 125 | 3300006931 | Ga0097620_100026813 | Ga0097620_1000268135 | 315 |
| 126 | 3300013297 | Ga0157378_10222958 | Ga0157378_102229582 | 315 |
| 127 | 3300026023 | Ga0207677_10120803 | Ga0207677_101208032 | 315 |
| 128 | 3300026089 | Ga0207648_10098034 | Ga0207648_100980343 | 315 |
| 129 | 3300026116 | Ga0207674_10162393 | Ga0207674_101623932 | 315 |
| 130 | 3300046539 | Ga0495621_0019441 | Ga0495621_0019441_1071_2075 | 315 |
| 131 | 3300047447 | Ga0495685_050020 | Ga0495685_050020_105_1109 | 315 |
| 132 | 3300044673 | Ga0453683_0162827 | Ga0453683_0162827_318_1316 | 316 |
| 133 | 3300049575 | Ga0501039_0066121 | Ga0501039_0066121_1093_2052 | 316 |
| 134 | 3300049578 | Ga0501042_0112913 | Ga0501042_0112913_149_1108 | 316 |
| 135 | 3300049582 | Ga0501048_0011184 | Ga0501048_0011184_3914_4873 | 316 |
| 136 | 3300049741 | Ga0501079_0058357 | Ga0501079_0058357_1189_2148 | 316 |
| 137 | 3300049824 | Ga0501045_0018252 | Ga0501045_0018252_3487_4446 | 316 |
| 138 | 3300054114 | Ga0501084_0090621 | Ga0501084_0090621_1250_2209 | 316 |
| 139 | 3300061734 | Ga0530510_0051650 | Ga0530510_0051650_1539_2549 | 316 |
| 140 | 3300037312 | Ga0395899_0003128 | Ga0395899_0003128_11448_12455 | 317 |
| 141 | 3300045836 | Ga0466958_0133022 | Ga0466958_0133022_407_1396 | 317 |
| 142 | 3300046474 | Ga0495605_0011394 | Ga0495605_0011394_1411_2400 | 317 |
| 143 | 3300046665 | Ga0495661_0039401 | Ga0495661_0039401_1013_1972 | 317 |
| 144 | 3300047445 | Ga0495677_0003825 | Ga0495677_0003825_3961_4950 | 317 |
| 145 | 3300048091 | Ga0495626_0060530 | Ga0495626_0060530_123_1112 | 317 |
| 146 | 3300053077 | Ga0495601_0161301 | Ga0495601_0161301_207_1265 | 317 |
| 147 | 3300061719 | Ga0466962_0058785 | Ga0466962_0058785_25_1014 | 317 |
| 148 | 3300045976 | Ga0466967_0060796 | Ga0466967_0060796_2268_3260 | 318 |
| 149 | 3300049593 | Ga0501077_0108584 | Ga0501077_0108584_404_1405 | 318 |
| 150 | 3300005353 | Ga0070669_100088541 | Ga0070669_1000885412 | 319 |
| 151 | 3300005434 | Ga0070709_10029146 | Ga0070709_100291464 | 319 |
| 152 | 3300005985 | Ga0081539_10049773 | Ga0081539_100497732 | 319 |
| 153 | 3300006163 | Ga0070715_10017578 | Ga0070715_100175784 | 319 |
| 154 | 3300006237 | Ga0097621_100002538 | Ga0097621_1000025386 | 319 |
| 155 | 3300017792 | Ga0163161_10326392 | Ga0163161_103263921 | 319 |
| 156 | 3300025916 | Ga0207663_10062209 | Ga0207663_100622094 | 319 |
| 157 | 3300025928 | Ga0207700_10004335 | Ga0207700_100043355 | 319 |
| 158 | 3300037068 | Ga0373925_0070249 | Ga0373925_0070249_1106_2095 | 319 |
| 159 | 3300046475 | Ga0495639_0001632 | Ga0495639_0001632_5183_6172 | 319 |
| 160 | 3300046476 | Ga0495662_0015537 | Ga0495662_0015537_65_1054 | 319 |
| 161 | 3300046499 | Ga0495594_0019830 | Ga0495594_0019830_2527_3516 | 319 |
| 162 | 3300046517 | Ga0495630_0012741 | Ga0495630_0012741_2142_3131 | 319 |
| 163 | 3300046522 | Ga0495643_0010264 | Ga0495643_0010264_183_1205 | 319 |
| 164 | 3300046529 | Ga0495652_0032347 | Ga0495652_0032347_3137_4126 | 319 |
| 165 | 3300046533 | Ga0495640_0051481 | Ga0495640_0051481_80_1069 | 319 |
| 166 | 3300046559 | Ga0495667_0005868 | Ga0495667_0005868_5566_6555 | 319 |
| 167 | 3300046663 | Ga0495635_0052879 | Ga0495635_0052879_773_1762 | 319 |
| 168 | 3300046674 | Ga0495588_0065461 | Ga0495588_0065461_417_1406 | 319 |
| 169 | 3300046681 | Ga0495647_0003703 | Ga0495647_0003703_91_1080 | 319 |
| 170 | 3300046694 | Ga0495649_0010074 | Ga0495649_0010074_1033_2055 | 319 |
| 171 | 3300046809 | Ga0495600_0001615 | Ga0495600_0001615_10126_11115 | 319 |
| 172 | 3300047317 | Ga0495604_0023059 | Ga0495604_0023059_1036_2025 | 319 |
| 173 | 3300047322 | Ga0495680_0005608 | Ga0495680_0005608_3101_4090 | 319 |
| 174 | 3300047471 | Ga0495684_0026140 | Ga0495684_0026140_2723_3712 | 319 |
| 175 | 3300048089 | Ga0495614_0003972 | Ga0495614_0003972_4822_5811 | 319 |
| 176 | 3300053077 | Ga0495601_0026030 | Ga0495601_0026030_472_1461 | 319 |
| 177 | 3300053077 | Ga0495601_0092352 | Ga0495601_0092352_399_1388 | 319 |
| 178 | 3300053078 | Ga0495612_0045604 | Ga0495612_0045604_432_1421 | 319 |
| 179 | 3300053085 | Ga0495619_0012701 | Ga0495619_0012701_2093_3082 | 319 |
| 180 | 3300001976 | JGI24752J21851_1003015 | JGI24752J21851_10030152 | 320 |
| 181 | 3300001989 | JGI24739J22299_10001439 | JGI24739J22299_100014396 | 320 |
| 182 | 3300001990 | JGI24737J22298_10006660 | JGI24737J22298_100066601 | 320 |
| 183 | 3300002070 | JGI24750J21931_1000236 | JGI24750J21931_10002365 | 320 |
| 184 | 3300002073 | JGI24745J21846_1000672 | JGI24745J21846_10006724 | 320 |
| 185 | 3300002074 | JGI24748J21848_1000246 | JGI24748J21848_10002466 | 320 |
| 186 | 3300002075 | JGI24738J21930_10000321 | JGI24738J21930_100003212 | 320 |
| 187 | 3300002076 | JGI24749J21850_1001668 | JGI24749J21850_10016682 | 320 |
| 188 | 3300002244 | JGI24742J22300_10003211 | JGI24742J22300_100032113 | 320 |
| 189 | 3300005293 | Ga0065715_10110340 | Ga0065715_101103402 | 320 |
| 190 | 3300005328 | Ga0070676_10014872 | Ga0070676_100148723 | 320 |
| 191 | 3300005329 | Ga0070683_100015103 | Ga0070683_1000151035 | 320 |
| 192 | 3300005330 | Ga0070690_100009004 | Ga0070690_1000090045 | 320 |
| 193 | 3300005331 | Ga0070670_100002552 | Ga0070670_1000025526 | 320 |
| 194 | 3300005333 | Ga0070677_10000229 | Ga0070677_100002294 | 320 |
| 195 | 3300005334 | Ga0068869_100000813 | Ga0068869_1000008136 | 320 |
| 196 | 3300005335 | Ga0070666_10016756 | Ga0070666_100167563 | 320 |
| 197 | 3300005337 | Ga0070682_100001697 | Ga0070682_1000016979 | 320 |
| 198 | 3300005338 | Ga0068868_100119733 | Ga0068868_1001197332 | 320 |
| 199 | 3300005339 | Ga0070660_100003220 | Ga0070660_1000032202 | 320 |
| 200 | 3300005340 | Ga0070689_100001674 | Ga0070689_10000167416 | 320 |
| 201 | 3300005341 | Ga0070691_10012615 | Ga0070691_100126153 | 320 |
| 202 | 3300005343 | Ga0070687_100000287 | Ga0070687_10000028715 | 320 |
| 203 | 3300005344 | Ga0070661_100001342 | Ga0070661_10000134215 | 320 |
| 204 | 3300005345 | Ga0070692_10031678 | Ga0070692_100316782 | 320 |
| 205 | 3300005347 | Ga0070668_100002613 | Ga0070668_1000026132 | 320 |
| 206 | 3300005353 | Ga0070669_100009501 | Ga0070669_1000095013 | 320 |
| 207 | 3300005354 | Ga0070675_100030373 | Ga0070675_1000303733 | 320 |
| 208 | 3300005355 | Ga0070671_100001574 | Ga0070671_1000015746 | 320 |
| 209 | 3300005356 | Ga0070674_100006844 | Ga0070674_1000068445 | 320 |
| 210 | 3300005364 | Ga0070673_100002949 | Ga0070673_1000029496 | 320 |
| 211 | 3300005365 | Ga0070688_100038858 | Ga0070688_1000388582 | 320 |
| 212 | 3300005366 | Ga0070659_100001372 | Ga0070659_10000137218 | 320 |
| 213 | 3300005367 | Ga0070667_100004661 | Ga0070667_10000466113 | 320 |
| 214 | 3300005406 | Ga0070703_10006082 | Ga0070703_100060822 | 320 |
| 215 | 3300005438 | Ga0070701_10012182 | Ga0070701_100121823 | 320 |
| 216 | 3300005440 | Ga0070705_100004113 | Ga0070705_1000041133 | 320 |
| 217 | 3300005441 | Ga0070700_100008630 | Ga0070700_1000086303 | 320 |
| 218 | 3300005445 | Ga0070708_100140660 | Ga0070708_1001406602 | 320 |
| 219 | 3300005455 | Ga0070663_100027620 | Ga0070663_1000276203 | 320 |
| 220 | 3300005456 | Ga0070678_100005790 | Ga0070678_1000057905 | 320 |
| 221 | 3300005457 | Ga0070662_100008362 | Ga0070662_1000083628 | 320 |
| 222 | 3300005458 | Ga0070681_10106963 | Ga0070681_101069633 | 320 |
| 223 | 3300005459 | Ga0068867_100000628 | Ga0068867_10000062816 | 320 |
| 224 | 3300005466 | Ga0070685_10042444 | Ga0070685_100424442 | 320 |
| 225 | 3300005530 | Ga0070679_100014494 | Ga0070679_1000144949 | 320 |
| 226 | 3300005535 | Ga0070684_100004311 | Ga0070684_1000043113 | 320 |
| 227 | 3300005536 | Ga0070697_100350061 | Ga0070697_1003500611 | 320 |
| 228 | 3300005543 | Ga0070672_100000991 | Ga0070672_1000009916 | 320 |
| 229 | 3300005544 | Ga0070686_100001041 | Ga0070686_1000010416 | 320 |
| 230 | 3300005545 | Ga0070695_100003393 | Ga0070695_1000033936 | 320 |
| 231 | 3300005548 | Ga0070665_100065244 | Ga0070665_1000652443 | 320 |
| 232 | 3300005549 | Ga0070704_100001471 | Ga0070704_10000147116 | 320 |
| 233 | 3300005564 | Ga0070664_100088982 | Ga0070664_1000889822 | 320 |
| 234 | 3300005577 | Ga0068857_100003798 | Ga0068857_10000379815 | 320 |
| 235 | 3300005614 | Ga0068856_100004576 | Ga0068856_1000045762 | 320 |
| 236 | 3300005615 | Ga0070702_100014828 | Ga0070702_1000148283 | 320 |
| 237 | 3300005616 | Ga0068852_100004573 | Ga0068852_1000045733 | 320 |
| 238 | 3300005617 | Ga0068859_100006571 | Ga0068859_1000065713 | 320 |
| 239 | 3300005841 | Ga0068863_100006108 | Ga0068863_10000610813 | 320 |
| 240 | 3300005842 | Ga0068858_100006462 | Ga0068858_1000064622 | 320 |
| 241 | 3300005844 | Ga0068862_100002184 | Ga0068862_1000021846 | 320 |
| 242 | 3300006931 | Ga0097620_100006571 | Ga0097620_1000065713 | 320 |
| 243 | 3300009036 | Ga0105244_10078598 | Ga0105244_100785982 | 320 |
| 244 | 3300009092 | Ga0105250_10048962 | Ga0105250_100489622 | 320 |
| 245 | 3300009093 | Ga0105240_10197688 | Ga0105240_101976882 | 320 |
| 246 | 3300009094 | Ga0111539_10028897 | Ga0111539_100288973 | 320 |
| 247 | 3300009098 | Ga0105245_10013826 | Ga0105245_100138265 | 320 |
| 248 | 3300009101 | Ga0105247_10008270 | Ga0105247_100082706 | 320 |
| 249 | 3300009148 | Ga0105243_10020347 | Ga0105243_100203473 | 320 |
| 250 | 3300009174 | Ga0105241_10030482 | Ga0105241_100304824 | 320 |
| 251 | 3300009176 | Ga0105242_10008746 | Ga0105242_100087465 | 320 |
| 252 | 3300009177 | Ga0105248_10006183 | Ga0105248_1000618316 | 320 |
| 253 | 3300009553 | Ga0105249_10057226 | Ga0105249_100572263 | 320 |
| 254 | 3300010375 | Ga0105239_10020880 | Ga0105239_100208803 | 320 |
| 255 | 3300011119 | Ga0105246_10001801 | Ga0105246_1000180110 | 320 |
| 256 | 3300013100 | Ga0157373_10033846 | Ga0157373_100338463 | 320 |
| 257 | 3300013102 | Ga0157371_10015753 | Ga0157371_100157532 | 320 |
| 258 | 3300013296 | Ga0157374_10070918 | Ga0157374_100709184 | 320 |
| 259 | 3300013297 | Ga0157378_10046130 | Ga0157378_100461304 | 320 |
| 260 | 3300013306 | Ga0163162_10003576 | Ga0163162_1000357611 | 320 |
| 261 | 3300013307 | Ga0157372_10156057 | Ga0157372_101560573 | 320 |
| 262 | 3300013308 | Ga0157375_10002114 | Ga0157375_1000211416 | 320 |
| 263 | 3300014325 | Ga0163163_10024233 | Ga0163163_100242335 | 320 |
| 264 | 3300014325 | Ga0163163_10058909 | Ga0163163_100589092 | 320 |
| 265 | 3300014326 | Ga0157380_10001040 | Ga0157380_100010405 | 320 |
| 266 | 3300014745 | Ga0157377_10000448 | Ga0157377_100004486 | 320 |
| 267 | 3300014968 | Ga0157379_10017754 | Ga0157379_100177542 | 320 |
| 268 | 3300014969 | Ga0157376_10009420 | Ga0157376_100094206 | 320 |
| 269 | 3300025271 | Ga0207666_1000094 | Ga0207666_100009416 | 320 |
| 270 | 3300025893 | Ga0207682_10000360 | Ga0207682_1000036019 | 320 |
| 271 | 3300025907 | Ga0207645_10001827 | Ga0207645_1000182716 | 320 |
| 272 | 3300025908 | Ga0207643_10000035 | Ga0207643_1000003584 | 320 |
| 273 | 3300025911 | Ga0207654_10074341 | Ga0207654_100743412 | 320 |
| 274 | 3300025912 | Ga0207707_10007090 | Ga0207707_100070902 | 320 |
| 275 | 3300025913 | Ga0207695_10121584 | Ga0207695_101215842 | 320 |
| 276 | 3300025918 | Ga0207662_10022714 | Ga0207662_100227143 | 320 |
| 277 | 3300025923 | Ga0207681_10001121 | Ga0207681_1000112113 | 320 |
| 278 | 3300025926 | Ga0207659_10000899 | Ga0207659_1000089916 | 320 |
| 279 | 3300025927 | Ga0207687_10002095 | Ga0207687_1000209511 | 320 |
| 280 | 3300025931 | Ga0207644_10001933 | Ga0207644_1000193315 | 320 |
| 281 | 3300025932 | Ga0207690_10001009 | Ga0207690_100010096 | 320 |
| 282 | 3300025935 | Ga0207709_10000575 | Ga0207709_1000057534 | 320 |
| 283 | 3300025938 | Ga0207704_10000642 | Ga0207704_100006425 | 320 |
| 284 | 3300025940 | Ga0207691_10002681 | Ga0207691_100026816 | 320 |
| 285 | 3300025942 | Ga0207689_10002374 | Ga0207689_1000237416 | 320 |
| 286 | 3300025986 | Ga0207658_10003553 | Ga0207658_100035534 | 320 |
| 287 | 3300026035 | Ga0207703_10002471 | Ga0207703_1000247114 | 320 |
| 288 | 3300026088 | Ga0207641_10002628 | Ga0207641_1000262814 | 320 |
| 289 | 3300026116 | Ga0207674_10002767 | Ga0207674_1000276720 | 320 |
| 290 | 3300026121 | Ga0207683_10002564 | Ga0207683_1000256413 | 320 |
| 291 | 3300027617 | Ga0210002_1001374 | Ga0210002_10013743 | 320 |
| 292 | 3300028379 | Ga0268266_10065473 | Ga0268266_100654733 | 320 |
| 293 | 3300028380 | Ga0268265_10001891 | Ga0268265_100018915 | 320 |
| 294 | 3300028381 | Ga0268264_10050126 | Ga0268264_100501263 | 320 |
| 295 | 3300031249 | Ga0265339_10002967 | Ga0265339_100029677 | 320 |
| 296 | 3300031595 | Ga0265313_10024495 | Ga0265313_100244952 | 320 |
| 297 | 3300035090 | Ga0373949_0001994 | Ga0373949_0001994_3932_4900 | 320 |
| 298 | 3300035092 | Ga0373952_0016091 | Ga0373952_0016091_365_1333 | 320 |
| 299 | 3300035112 | Ga0373932_0003639 | Ga0373932_0003639_1351_2319 | 320 |
| 300 | 3300035114 | Ga0373939_0001079 | Ga0373939_0001079_4549_5517 | 320 |
| 301 | 3300035115 | Ga0373941_0002631 | Ga0373941_0002631_1613_2581 | 320 |
| 302 | 3300035121 | Ga0373960_0020112 | Ga0373960_0020112_354_1322 | 320 |
| 303 | 3300035691 | Ga0373931_0004505 | Ga0373931_0004505_1378_2346 | 320 |
| 304 | 3300046684 | Ga0495669_0097053 | Ga0495669_0097053_246_1214 | 320 |
| 305 | 3300048903 | Ga0496100_0000806 | Ga0496100_0000806_13749_14717 | 320 |
| 306 | 3300048904 | Ga0496101_0008655 | Ga0496101_0008655_4522_5490 | 320 |
| 307 | 3300048905 | Ga0496102_0005850 | Ga0496102_0005850_1335_2303 | 320 |
| 308 | 3300048909 | Ga0496106_0000782 | Ga0496106_0000782_13766_14734 | 320 |
| 309 | 3300048910 | Ga0496107_0001064 | Ga0496107_0001064_11562_12530 | 320 |
| 310 | 3300048911 | Ga0496108_0008984 | Ga0496108_0008984_6927_7895 | 320 |
| 311 | 3300048912 | Ga0496109_0042508 | Ga0496109_0042508_2954_3922 | 320 |
| 312 | 3300048913 | Ga0496110_0111674 | Ga0496110_0111674_1340_2308 | 320 |
| 313 | 3300048914 | Ga0496111_0073417 | Ga0496111_0073417_541_1509 | 320 |
| 314 | 3300048916 | Ga0496113_0049503 | Ga0496113_0049503_1487_2455 | 320 |
| 315 | 3300048917 | Ga0496114_0018697 | Ga0496114_0018697_631_1599 | 320 |
| 316 | 3300048918 | Ga0496115_0001718 | Ga0496115_0001718_1921_2889 | 320 |
| 317 | 3300049592 | Ga0501076_0166375 | Ga0501076_0166375_266_1234 | 320 |
| 318 | 3300049593 | Ga0501077_0013226 | Ga0501077_0013226_30_998 | 320 |
| 319 | 3300049743 | Ga0501081_0055263 | Ga0501081_0055263_168_1136 | 320 |
| 320 | 3300050507 | nmdc:mga05p37_20486_c1 | nmdc:mga05p37_20486_c1_3536_4510 | 320 |
| 321 | 3300050511 | nmdc:mga08y16_73993_c1 | nmdc:mga08y16_73993_c1_1164_2132 | 320 |
| 322 | 3300050512 | nmdc:mga0n895_4071_c1 | nmdc:mga0n895_4071_c1_3743_4711 | 320 |
| 323 | 3300050513 | nmdc:mga0rr50_152109_c1 | nmdc:mga0rr50_152109_c1_432_1400 | 320 |
| 324 | 3300050514 | nmdc:mga08x19_107498_c1 | nmdc:mga08x19_107498_c1_610_1578 | 320 |
| 325 | 3300050514 | nmdc:mga08x19_137288_c1 | nmdc:mga08x19_137288_c1_648_1616 | 320 |
| 326 | 3300050515 | nmdc:mga0a205_63882_c1 | nmdc:mga0a205_63882_c1_1437_2405 | 320 |
| 327 | 3300060353 | Ga0501082_0076653 | Ga0501082_0076653_335_1303 | 320 |
| 328 | 3300005564 | Ga0070664_100232450 | Ga0070664_1002324502 | 321 |
| 329 | 3300005842 | Ga0068858_100223543 | Ga0068858_1002235432 | 321 |
| 330 | 3300006844 | Ga0075428_100040633 | Ga0075428_1000406333 | 321 |
| 331 | 3300009094 | Ga0111539_10045686 | Ga0111539_100456865 | 321 |
| 332 | 3300009147 | Ga0114129_10095344 | Ga0114129_100953443 | 321 |
| 333 | 3300025925 | Ga0207650_10000743 | Ga0207650_1000074324 | 321 |
| 334 | 3300037418 | Ga0395900_0120177 | Ga0395900_0120177_1232_2284 | 321 |
| 335 | 3300046474 | Ga0495605_0091546 | Ga0495605_0091546_187_1218 | 321 |
| 336 | 3300046491 | Ga0495584_0019984 | Ga0495584_0019984_611_1642 | 321 |
| 337 | 3300046506 | Ga0495583_0001070 | Ga0495583_0001070_20591_21631 | 321 |
| 338 | 3300046506 | Ga0495583_0011275 | Ga0495583_0011275_3837_4868 | 321 |
| 339 | 3300046513 | Ga0495616_0010739 | Ga0495616_0010739_2431_3462 | 321 |
| 340 | 3300046519 | Ga0495632_0000530 | Ga0495632_0000530_34760_35791 | 321 |
| 341 | 3300046810 | Ga0495660_0018224 | Ga0495660_0018224_139_1170 | 321 |
| 342 | 3300047446 | Ga0495679_016361 | Ga0495679_016361_122_1153 | 321 |
| 343 | 3300048903 | Ga0496100_0030965 | Ga0496100_0030965_2129_3118 | 321 |
| 344 | 3300048904 | Ga0496101_0027887 | Ga0496101_0027887_2432_3421 | 321 |
| 345 | 3300048905 | Ga0496102_0014158 | Ga0496102_0014158_5244_6233 | 321 |
| 346 | 3300048907 | Ga0496104_0086386 | Ga0496104_0086386_523_1512 | 321 |
| 347 | 3300048908 | Ga0496105_0002273 | Ga0496105_0002273_10143_11132 | 321 |
| 348 | 3300048909 | Ga0496106_0013575 | Ga0496106_0013575_278_1267 | 321 |
| 349 | 3300048911 | Ga0496108_0001587 | Ga0496108_0001587_3333_4322 | 321 |
| 350 | 3300048912 | Ga0496109_0001253 | Ga0496109_0001253_6814_7803 | 321 |
| 351 | 3300048914 | Ga0496111_0000416 | Ga0496111_0000416_10663_11652 | 321 |
| 352 | 3300048915 | Ga0496112_0002998 | Ga0496112_0002998_11226_12215 | 321 |
| 353 | 3300048916 | Ga0496113_0000215 | Ga0496113_0000215_1365_2354 | 321 |
| 354 | 3300050507 | nmdc:mga05p37_122041_c1 | nmdc:mga05p37_122041_c1_761_1750 | 321 |
| 355 | 3300050511 | nmdc:mga08y16_116492_c1 | nmdc:mga08y16_116492_c1_257_1246 | 321 |
| 356 | 3300053153 | Ga0500616_0020313 | Ga0500616_0020313_778_1785 | 321 |
| 357 | 3300025900 | Ga0207710_10031004 | Ga0207710_100310042 | 322 |
| 358 | 3300035170 | Ga0373943_0201897 | Ga0373943_0201897_53_1027 | 322 |
| 359 | iso_pu_bacteria | 2808606418 | 2809143223 | 322 |
| 360 | 3300025901 | Ga0207688_10087598 | Ga0207688_100875982 | 323 |
| 361 | 3300047320 | Ga0495672_0001752 | Ga0495672_0001752_3970_5043 | 323 |
| 362 | 3300053098 | Ga0500650_0091834 | Ga0500650_0091834_179_1159 | 323 |
| 363 | iso_pu_bacteria | 2643221547 | 2643758414 | 323 |
| 364 | 3300005436 | Ga0070713_100003127 | Ga0070713_10000312711 | 324 |
| 365 | 3300005439 | Ga0070711_100102484 | Ga0070711_1001024843 | 324 |
| 366 | 3300006042 | Ga0075368_10066955 | Ga0075368_100669552 | 324 |
| 367 | 3300006051 | Ga0075364_10024740 | Ga0075364_100247404 | 324 |
| 368 | 3300006847 | Ga0075431_100070583 | Ga0075431_1000705833 | 324 |
| 369 | 3300020081 | Ga0206354_11320193 | Ga0206354_113201932 | 324 |
| 370 | 3300025915 | Ga0207693_10203121 | Ga0207693_102031212 | 324 |
| 371 | 3300046471 | Ga0495650_0000322 | Ga0495650_0000322_7768_8826 | 324 |
| 372 | 3300046665 | Ga0495661_0000049 | Ga0495661_0000049_46731_47783 | 324 |
| 373 | 3300046683 | Ga0495658_0021021 | Ga0495658_0021021_145_1125 | 324 |
| 374 | 3300048904 | Ga0496101_0062004 | Ga0496101_0062004_268_1320 | 324 |
| 375 | 3300048912 | Ga0496109_0161799 | Ga0496109_0161799_259_1311 | 324 |
| 376 | 3300048915 | Ga0496112_0015232 | Ga0496112_0015232_5971_7023 | 324 |
| 377 | 3300048916 | Ga0496113_0249270 | Ga0496113_0249270_199_1251 | 324 |
| 378 | 3300048925 | Ga0496122_0001753 | Ga0496122_0001753_7940_8992 | 324 |
| 379 | 3300048926 | Ga0496123_0003783 | Ga0496123_0003783_3566_4618 | 324 |
| 380 | 3300048928 | Ga0496125_0006247 | Ga0496125_0006247_3966_5018 | 324 |
| 381 | 3300050490 | nmdc:mga03n38_47518_c1 | nmdc:mga03n38_47518_c1_363_1388 | 324 |
| 382 | 3300050496 | nmdc:mga07m45_42260_c1 | nmdc:mga07m45_42260_c1_1454_2479 | 324 |
| 383 | 3300050507 | nmdc:mga05p37_120335_c1 | nmdc:mga05p37_120335_c1_1902_2885 | 324 |
| 384 | 3300050509 | nmdc:mga0qj67_67130_c1 | nmdc:mga0qj67_67130_c1_1739_2722 | 324 |
| 385 | 3300050510 | nmdc:mga06r32_135821_c1 | nmdc:mga06r32_135821_c1_1083_2066 | 324 |
| 386 | 3300053119 | Ga0500595_006007 | Ga0500595_006007_1967_2992 | 324 |
| 387 | 3300053153 | Ga0500616_0073191 | Ga0500616_0073191_513_1538 | 324 |
| 388 | 3300005354 | Ga0070675_100049682 | Ga0070675_1000496824 | 325 |
| 389 | 3300005546 | Ga0070696_100225652 | Ga0070696_1002256522 | 325 |
| 390 | 3300006847 | Ga0075431_100336755 | Ga0075431_1003367552 | 325 |
| 391 | 3300013307 | Ga0157372_10006003 | Ga0157372_1000600316 | 325 |
| 392 | 3300014968 | Ga0157379_10070713 | Ga0157379_100707134 | 325 |
| 393 | 3300025315 | Ga0207697_10106732 | Ga0207697_101067322 | 325 |
| 394 | 3300025901 | Ga0207688_10081666 | Ga0207688_100816662 | 325 |
| 395 | 3300025933 | Ga0207706_10276072 | Ga0207706_102760722 | 325 |
| 396 | 3300027682 | Ga0209971_1006118 | Ga0209971_10061182 | 325 |
| 397 | 3300027695 | Ga0209966_1003962 | Ga0209966_10039621 | 325 |
| 398 | 3300031241 | Ga0265325_10011730 | Ga0265325_100117302 | 325 |
| 399 | 3300034957 | Ga0373938_0000151 | Ga0373938_0000151_8748_9731 | 325 |
| 400 | 3300037312 | Ga0395899_0031176 | Ga0395899_0031176_1488_2471 | 325 |
| 401 | 3300037418 | Ga0395900_0015232 | Ga0395900_0015232_5289_6272 | 325 |
| 402 | 3300037418 | Ga0395900_0187776 | Ga0395900_0187776_732_1715 | 325 |
| 403 | 3300037466 | Ga0395898_0080033 | Ga0395898_0080033_1464_2447 | 325 |
| 404 | 3300037466 | Ga0395898_0105504 | Ga0395898_0105504_1030_2016 | 325 |
| 405 | 3300038443 | Ga0395901_0081984 | Ga0395901_0081984_1326_2309 | 325 |
| 406 | 3300044694 | Ga0466963_0000255 | Ga0466963_0000255_10393_11376 | 325 |
| 407 | 3300044694 | Ga0466963_0190919 | Ga0466963_0190919_373_1356 | 325 |
| 408 | 3300044694 | Ga0466963_0241059 | Ga0466963_0241059_205_1188 | 325 |
| 409 | 3300044842 | Ga0466957_0021505 | Ga0466957_0021505_167_1150 | 325 |
| 410 | 3300045976 | Ga0466967_0002672 | Ga0466967_0002672_1315_2298 | 325 |
| 411 | 3300048091 | Ga0495626_0095564 | Ga0495626_0095564_120_1163 | 325 |
| 412 | 3300049571 | Ga0501034_0072331 | Ga0501034_0072331_2459_3442 | 325 |
| 413 | 3300049574 | Ga0501038_0139520 | Ga0501038_0139520_60_1043 | 325 |
| 414 | 3300049577 | Ga0501041_0111693 | Ga0501041_0111693_190_1188 | 325 |
| 415 | 3300049581 | Ga0501047_0085291 | Ga0501047_0085291_849_1832 | 325 |
| 416 | 3300049587 | Ga0501071_0054905 | Ga0501071_0054905_820_1818 | 325 |
| 417 | 3300049588 | Ga0501072_0055797 | Ga0501072_0055797_73_1062 | 325 |
| 418 | 3300049588 | Ga0501072_0132378 | Ga0501072_0132378_960_1943 | 325 |
| 419 | 3300049591 | Ga0501075_0021286 | Ga0501075_0021286_1795_2784 | 325 |
| 420 | 3300049591 | Ga0501075_0122141 | Ga0501075_0122141_575_1573 | 325 |
| 421 | 3300049592 | Ga0501076_0037727 | Ga0501076_0037727_1906_2895 | 325 |
| 422 | 3300049592 | Ga0501076_0059533 | Ga0501076_0059533_1281_2279 | 325 |
| 423 | 3300049593 | Ga0501077_0006663 | Ga0501077_0006663_3324_4313 | 325 |
| 424 | 3300049741 | Ga0501079_0002094 | Ga0501079_0002094_5289_6278 | 325 |
| 425 | 3300049824 | Ga0501045_0232864 | Ga0501045_0232864_325_1323 | 325 |
| 426 | 3300050513 | nmdc:mga0rr50_216119_c1 | nmdc:mga0rr50_216119_c1_503_1489 | 325 |
| 427 | 3300054114 | Ga0501084_0002873 | Ga0501084_0002873_3013_4002 | 325 |
| 428 | 3300054114 | Ga0501084_0240306 | Ga0501084_0240306_361_1344 | 325 |
| 429 | 3300060353 | Ga0501082_0080565 | Ga0501082_0080565_1484_2482 | 325 |
| 430 | 3300061734 | Ga0530510_0052308 | Ga0530510_0052308_1440_2429 | 325 |
| 431 | 3300003215 | JGI25153J46596_10003330 | JGI25153J46596_100033303 | 326 |
| 432 | 3300005330 | Ga0070690_100015717 | Ga0070690_1000157174 | 326 |
| 433 | 3300005333 | Ga0070677_10010167 | Ga0070677_100101673 | 326 |
| 434 | 3300005334 | Ga0068869_100046245 | Ga0068869_1000462452 | 326 |
| 435 | 3300005336 | Ga0070680_100031606 | Ga0070680_1000316062 | 326 |
| 436 | 3300005338 | Ga0068868_100097555 | Ga0068868_1000975552 | 326 |
| 437 | 3300005339 | Ga0070660_100321427 | Ga0070660_1003214271 | 326 |
| 438 | 3300005339 | Ga0070660_100334729 | Ga0070660_1003347292 | 326 |
| 439 | 3300005344 | Ga0070661_100059600 | Ga0070661_1000596003 | 326 |
| 440 | 3300005353 | Ga0070669_100038922 | Ga0070669_1000389223 | 326 |
| 441 | 3300005354 | Ga0070675_100011412 | Ga0070675_1000114122 | 326 |
| 442 | 3300005355 | Ga0070671_100070337 | Ga0070671_1000703372 | 326 |
| 443 | 3300005356 | Ga0070674_100016960 | Ga0070674_1000169602 | 326 |
| 444 | 3300005356 | Ga0070674_100210849 | Ga0070674_1002108491 | 326 |
| 445 | 3300005364 | Ga0070673_100327494 | Ga0070673_1003274941 | 326 |
| 446 | 3300005366 | Ga0070659_100172661 | Ga0070659_1001726612 | 326 |
| 447 | 3300005406 | Ga0070703_10028431 | Ga0070703_100284312 | 326 |
| 448 | 3300005435 | Ga0070714_100013144 | Ga0070714_1000131444 | 326 |
| 449 | 3300005435 | Ga0070714_100150094 | Ga0070714_1001500942 | 326 |
| 450 | 3300005437 | Ga0070710_10041225 | Ga0070710_100412252 | 326 |
| 451 | 3300005437 | Ga0070710_10060527 | Ga0070710_100605272 | 326 |
| 452 | 3300005438 | Ga0070701_10020616 | Ga0070701_100206162 | 326 |
| 453 | 3300005455 | Ga0070663_100049988 | Ga0070663_1000499884 | 326 |
| 454 | 3300005455 | Ga0070663_100162645 | Ga0070663_1001626452 | 326 |
| 455 | 3300005456 | Ga0070678_100052827 | Ga0070678_1000528272 | 326 |
| 456 | 3300005457 | Ga0070662_100040719 | Ga0070662_1000407193 | 326 |
| 457 | 3300005457 | Ga0070662_100243235 | Ga0070662_1002432352 | 326 |
| 458 | 3300005458 | Ga0070681_10008531 | Ga0070681_100085313 | 326 |
| 459 | 3300005466 | Ga0070685_10029919 | Ga0070685_100299192 | 326 |
| 460 | 3300005468 | Ga0070707_100204783 | Ga0070707_1002047832 | 326 |
| 461 | 3300005518 | Ga0070699_100003093 | Ga0070699_10000309317 | 326 |
| 462 | 3300005530 | Ga0070679_100017445 | Ga0070679_1000174452 | 326 |
| 463 | 3300005536 | Ga0070697_100060873 | Ga0070697_1000608733 | 326 |
| 464 | 3300005536 | Ga0070697_100312320 | Ga0070697_1003123201 | 326 |
| 465 | 3300005539 | Ga0068853_100087460 | Ga0068853_1000874602 | 326 |
| 466 | 3300005543 | Ga0070672_100079454 | Ga0070672_1000794543 | 326 |
| 467 | 3300005545 | Ga0070695_100185533 | Ga0070695_1001855332 | 326 |
| 468 | 3300005548 | Ga0070665_100089591 | Ga0070665_1000895913 | 326 |
| 469 | 3300005563 | Ga0068855_100040118 | Ga0068855_1000401186 | 326 |
| 470 | 3300005564 | Ga0070664_100049659 | Ga0070664_1000496595 | 326 |
| 471 | 3300005615 | Ga0070702_100058381 | Ga0070702_1000583811 | 326 |
| 472 | 3300005616 | Ga0068852_100087545 | Ga0068852_1000875453 | 326 |
| 473 | 3300005617 | Ga0068859_100073377 | Ga0068859_1000733773 | 326 |
| 474 | 3300005617 | Ga0068859_100263538 | Ga0068859_1002635382 | 326 |
| 475 | 3300005718 | Ga0068866_10041065 | Ga0068866_100410653 | 326 |
| 476 | 3300005841 | Ga0068863_100071965 | Ga0068863_1000719652 | 326 |
| 477 | 3300005843 | Ga0068860_100010732 | Ga0068860_1000107324 | 326 |
| 478 | 3300005844 | Ga0068862_100107984 | Ga0068862_1001079842 | 326 |
| 479 | 3300005844 | Ga0068862_100185952 | Ga0068862_1001859521 | 326 |
| 480 | 3300005937 | Ga0081455_10000209 | Ga0081455_1000020960 | 326 |
| 481 | 3300005937 | Ga0081455_10001640 | Ga0081455_100016402 | 326 |
| 482 | 3300005937 | Ga0081455_10052830 | Ga0081455_100528303 | 326 |
| 483 | 3300005937 | Ga0081455_10149165 | Ga0081455_101491652 | 326 |
| 484 | 3300005937 | Ga0081455_10160779 | Ga0081455_101607792 | 326 |
| 485 | 3300005981 | Ga0081538_10061674 | Ga0081538_100616743 | 326 |
| 486 | 3300005983 | Ga0081540_1019759 | Ga0081540_10197595 | 326 |
| 487 | 3300005985 | Ga0081539_10029790 | Ga0081539_100297902 | 326 |
| 488 | 3300005985 | Ga0081539_10039242 | Ga0081539_100392421 | 326 |
| 489 | 3300006028 | Ga0070717_10040382 | Ga0070717_100403821 | 326 |
| 490 | 3300006028 | Ga0070717_10095309 | Ga0070717_100953093 | 326 |
| 491 | 3300006028 | Ga0070717_10290733 | Ga0070717_102907331 | 326 |
| 492 | 3300006173 | Ga0070716_100157913 | Ga0070716_1001579132 | 326 |
| 493 | 3300006353 | Ga0075370_10160632 | Ga0075370_101606322 | 326 |
| 494 | 3300006844 | Ga0075428_100158465 | Ga0075428_1001584653 | 326 |
| 495 | 3300006844 | Ga0075428_100174930 | Ga0075428_1001749303 | 326 |
| 496 | 3300006844 | Ga0075428_100189560 | Ga0075428_1001895602 | 326 |
| 497 | 3300006847 | Ga0075431_100080913 | Ga0075431_1000809132 | 326 |
| 498 | 3300006847 | Ga0075431_100206396 | Ga0075431_1002063963 | 326 |
| 499 | 3300006931 | Ga0097620_100073377 | Ga0097620_1000733773 | 326 |
| 500 | 3300006931 | Ga0097620_100263548 | Ga0097620_1002635482 | 326 |
| 501 | 3300009094 | Ga0111539_10159158 | Ga0111539_101591582 | 326 |
| 502 | 3300009094 | Ga0111539_10196236 | Ga0111539_101962363 | 326 |
| 503 | 3300009098 | Ga0105245_10178764 | Ga0105245_101787642 | 326 |
| 504 | 3300009098 | Ga0105245_10205176 | Ga0105245_102051762 | 326 |
| 505 | 3300009101 | Ga0105247_10016996 | Ga0105247_100169963 | 326 |
| 506 | 3300009101 | Ga0105247_10171123 | Ga0105247_101711232 | 326 |
| 507 | 3300009147 | Ga0114129_10100655 | Ga0114129_101006553 | 326 |
| 508 | 3300009147 | Ga0114129_10347780 | Ga0114129_103477802 | 326 |
| 509 | 3300009176 | Ga0105242_10308819 | Ga0105242_103088192 | 326 |
| 510 | 3300009177 | Ga0105248_10452980 | Ga0105248_104529801 | 326 |
| 511 | 3300009545 | Ga0105237_10205699 | Ga0105237_102056992 | 326 |
| 512 | 3300009551 | Ga0105238_10087006 | Ga0105238_100870062 | 326 |
| 513 | 3300009553 | Ga0105249_10032452 | Ga0105249_100324523 | 326 |
| 514 | 3300011119 | Ga0105246_10046723 | Ga0105246_100467231 | 326 |
| 515 | 3300013306 | Ga0163162_10404595 | Ga0163162_104045952 | 326 |
| 516 | 3300013307 | Ga0157372_10232613 | Ga0157372_102326132 | 326 |
| 517 | 3300013307 | Ga0157372_10398222 | Ga0157372_103982222 | 326 |
| 518 | 3300013308 | Ga0157375_10246725 | Ga0157375_102467252 | 326 |
| 519 | 3300013308 | Ga0157375_10311881 | Ga0157375_103118812 | 326 |
| 520 | 3300014326 | Ga0157380_10008840 | Ga0157380_100088405 | 326 |
| 521 | 3300014326 | Ga0157380_10157758 | Ga0157380_101577582 | 326 |
| 522 | 3300014745 | Ga0157377_10002924 | Ga0157377_100029245 | 326 |
| 523 | 3300014968 | Ga0157379_10024836 | Ga0157379_100248364 | 326 |
| 524 | 3300014969 | Ga0157376_10204644 | Ga0157376_102046442 | 326 |
| 525 | 3300017792 | Ga0163161_10148822 | Ga0163161_101488222 | 326 |
| 526 | 3300021384 | Ga0213876_10008996 | Ga0213876_100089962 | 326 |
| 527 | 3300021384 | Ga0213876_10029221 | Ga0213876_100292212 | 326 |
| 528 | 3300025297 | Ga0209758_1000158 | Ga0209758_1000158152 | 326 |
| 529 | 3300025302 | Ga0207426_1020337 | Ga0207426_10203373 | 326 |
| 530 | 3300025893 | Ga0207682_10006222 | Ga0207682_100062225 | 326 |
| 531 | 3300025898 | Ga0207692_10015830 | Ga0207692_100158304 | 326 |
| 532 | 3300025898 | Ga0207692_10060212 | Ga0207692_100602122 | 326 |
| 533 | 3300025898 | Ga0207692_10098876 | Ga0207692_100988762 | 326 |
| 534 | 3300025899 | Ga0207642_10013792 | Ga0207642_100137922 | 326 |
| 535 | 3300025900 | Ga0207710_10008348 | Ga0207710_100083482 | 326 |
| 536 | 3300025901 | Ga0207688_10000262 | Ga0207688_100002625 | 326 |
| 537 | 3300025903 | Ga0207680_10053610 | Ga0207680_100536103 | 326 |
| 538 | 3300025905 | Ga0207685_10042113 | Ga0207685_100421132 | 326 |
| 539 | 3300025907 | Ga0207645_10013182 | Ga0207645_100131824 | 326 |
| 540 | 3300025908 | Ga0207643_10002713 | Ga0207643_100027137 | 326 |
| 541 | 3300025909 | Ga0207705_10079496 | Ga0207705_100794962 | 326 |
| 542 | 3300025912 | Ga0207707_10025302 | Ga0207707_100253023 | 326 |
| 543 | 3300025914 | Ga0207671_10149440 | Ga0207671_101494402 | 326 |
| 544 | 3300025918 | Ga0207662_10044859 | Ga0207662_100448593 | 326 |
| 545 | 3300025919 | Ga0207657_10034331 | Ga0207657_100343315 | 326 |
| 546 | 3300025920 | Ga0207649_10031396 | Ga0207649_100313962 | 326 |
| 547 | 3300025921 | Ga0207652_10061488 | Ga0207652_100614882 | 326 |
| 548 | 3300025924 | Ga0207694_10036921 | Ga0207694_100369214 | 326 |
| 549 | 3300025926 | Ga0207659_10022466 | Ga0207659_100224662 | 326 |
| 550 | 3300025927 | Ga0207687_10073745 | Ga0207687_100737452 | 326 |
| 551 | 3300025932 | Ga0207690_10249889 | Ga0207690_102498892 | 326 |
| 552 | 3300025933 | Ga0207706_10005187 | Ga0207706_100051875 | 326 |
| 553 | 3300025935 | Ga0207709_10117034 | Ga0207709_101170342 | 326 |
| 554 | 3300025936 | Ga0207670_10005380 | Ga0207670_100053805 | 326 |
| 555 | 3300025936 | Ga0207670_10371119 | Ga0207670_103711191 | 326 |
| 556 | 3300025937 | Ga0207669_10011106 | Ga0207669_100111064 | 326 |
| 557 | 3300025937 | Ga0207669_10077664 | Ga0207669_100776642 | 326 |
| 558 | 3300025939 | Ga0207665_10020078 | Ga0207665_100200784 | 326 |
| 559 | 3300025940 | Ga0207691_10001015 | Ga0207691_1000101512 | 326 |
| 560 | 3300025941 | Ga0207711_10165963 | Ga0207711_101659632 | 326 |
| 561 | 3300025941 | Ga0207711_10401790 | Ga0207711_104017902 | 326 |
| 562 | 3300025942 | Ga0207689_10036395 | Ga0207689_100363954 | 326 |
| 563 | 3300025960 | Ga0207651_10085264 | Ga0207651_100852642 | 326 |
| 564 | 3300025981 | Ga0207640_10146369 | Ga0207640_101463692 | 326 |
| 565 | 3300026035 | Ga0207703_10140304 | Ga0207703_101403042 | 326 |
| 566 | 3300026067 | Ga0207678_10034290 | Ga0207678_100342903 | 326 |
| 567 | 3300026067 | Ga0207678_10079722 | Ga0207678_100797223 | 326 |
| 568 | 3300026075 | Ga0207708_10000358 | Ga0207708_1000035811 | 326 |
| 569 | 3300026088 | Ga0207641_10080365 | Ga0207641_100803652 | 326 |
| 570 | 3300026089 | Ga0207648_10001075 | Ga0207648_1000107528 | 326 |
| 571 | 3300026089 | Ga0207648_10136005 | Ga0207648_101360052 | 326 |
| 572 | 3300026095 | Ga0207676_10052251 | Ga0207676_100522512 | 326 |
| 573 | 3300026118 | Ga0207675_100034640 | Ga0207675_1000346402 | 326 |
| 574 | 3300026121 | Ga0207683_10005615 | Ga0207683_100056157 | 326 |
| 575 | 3300026121 | Ga0207683_10051838 | Ga0207683_100518384 | 326 |
| 576 | 3300028379 | Ga0268266_10152012 | Ga0268266_101520123 | 326 |
| 577 | 3300028380 | Ga0268265_10008056 | Ga0268265_100080565 | 326 |
| 578 | 3300028380 | Ga0268265_10120219 | Ga0268265_101202192 | 326 |
| 579 | 3300028381 | Ga0268264_10096411 | Ga0268264_100964112 | 326 |
| 580 | 3300031240 | Ga0265320_10032363 | Ga0265320_100323632 | 326 |
| 581 | 3300031241 | Ga0265325_10094433 | Ga0265325_100944332 | 326 |
| 582 | 3300031247 | Ga0265340_10027878 | Ga0265340_100278782 | 326 |
| 583 | 3300031249 | Ga0265339_10031835 | Ga0265339_100318352 | 326 |
| 584 | 3300031344 | Ga0265316_10027004 | Ga0265316_100270044 | 326 |
| 585 | 3300031712 | Ga0265342_10017708 | Ga0265342_100177084 | 326 |
| 586 | 3300032133 | Ga0316583_10000603 | Ga0316583_100006034 | 326 |
| 587 | 3300035088 | Ga0373940_0030186 | Ga0373940_0030186_24_1082 | 326 |
| 588 | 3300035119 | Ga0373956_0014993 | Ga0373956_0014993_1520_2506 | 326 |
| 589 | 3300035120 | Ga0373957_0062008 | Ga0373957_0062008_171_1157 | 326 |
| 590 | 3300035121 | Ga0373960_0004279 | Ga0373960_0004279_565_1623 | 326 |
| 591 | 3300035172 | Ga0373955_0012410 | Ga0373955_0012410_1556_2542 | 326 |
| 592 | 3300035241 | Ga0373961_0008943 | Ga0373961_0008943_29_1069 | 326 |
| 593 | 3300035692 | Ga0373935_0197096 | Ga0373935_0197096_248_1234 | 326 |
| 594 | 3300035724 | Ga0373933_0201583 | Ga0373933_0201583_78_1064 | 326 |
| 595 | 3300036401 | Ga0373937_0053125 | Ga0373937_0053125_1556_2542 | 326 |
| 596 | 3300037466 | Ga0395898_0052801 | Ga0395898_0052801_2025_3071 | 326 |
| 597 | 3300037471 | Ga0395905_0161254 | Ga0395905_0161254_931_1977 | 326 |
| 598 | 3300037471 | Ga0395905_0437463 | Ga0395905_0437463_47_1036 | 326 |
| 599 | 3300039437 | Ga0436365_0932459 | Ga0436365_0932459_1686_2675 | 326 |
| 600 | 3300039447 | Ga0436361_0726405 | Ga0436361_0726405_3029_4024 | 326 |
| 601 | 3300041512 | Ga0451853_0997884 | Ga0451853_0997884_89_1078 | 326 |
| 602 | 3300044683 | Ga0466965_0008580 | Ga0466965_0008580_2589_3626 | 326 |
| 603 | 3300044684 | Ga0466966_0015172 | Ga0466966_0015172_1761_2798 | 326 |
| 604 | 3300044684 | Ga0466966_0059790 | Ga0466966_0059790_1022_2062 | 326 |
| 605 | 3300046457 | Ga0495590_0000013 | Ga0495590_0000013_194663_195709 | 326 |
| 606 | 3300046458 | Ga0495591_000109 | Ga0495591_000109_24080_25126 | 326 |
| 607 | 3300046460 | Ga0495638_0004233 | Ga0495638_0004233_7880_8869 | 326 |
| 608 | 3300046462 | Ga0495651_0056264 | Ga0495651_0056264_485_1471 | 326 |
| 609 | 3300046491 | Ga0495584_0000029 | Ga0495584_0000029_8162_9208 | 326 |
| 610 | 3300046491 | Ga0495584_0004385 | Ga0495584_0004385_6073_7122 | 326 |
| 611 | 3300046492 | Ga0495585_0077342 | Ga0495585_0077342_122_1171 | 326 |
| 612 | 3300046492 | Ga0495585_0131863 | Ga0495585_0131863_171_1160 | 326 |
| 613 | 3300046500 | Ga0495596_0004688 | Ga0495596_0004688_2575_3627 | 326 |
| 614 | 3300046500 | Ga0495596_0009396 | Ga0495596_0009396_1396_2442 | 326 |
| 615 | 3300046501 | Ga0495607_0002596 | Ga0495607_0002596_10269_11315 | 326 |
| 616 | 3300046501 | Ga0495607_0011649 | Ga0495607_0011649_4480_5517 | 326 |
| 617 | 3300046501 | Ga0495607_0023691 | Ga0495607_0023691_1788_2837 | 326 |
| 618 | 3300046506 | Ga0495583_0009969 | Ga0495583_0009969_4284_5330 | 326 |
| 619 | 3300046506 | Ga0495583_0046864 | Ga0495583_0046864_111_1151 | 326 |
| 620 | 3300046507 | Ga0495606_0030335 | Ga0495606_0030335_2541_3590 | 326 |
| 621 | 3300046512 | Ga0495610_0048174 | Ga0495610_0048174_828_1877 | 326 |
| 622 | 3300046513 | Ga0495616_0003207 | Ga0495616_0003207_5660_6700 | 326 |
| 623 | 3300046513 | Ga0495616_0056302 | Ga0495616_0056302_592_1641 | 326 |
| 624 | 3300046514 | Ga0495618_0082799 | Ga0495618_0082799_1017_2006 | 326 |
| 625 | 3300046516 | Ga0495628_0006258 | Ga0495628_0006258_1062_2048 | 326 |
| 626 | 3300046516 | Ga0495628_0153375 | Ga0495628_0153375_702_1691 | 326 |
| 627 | 3300046518 | Ga0495631_0009316 | Ga0495631_0009316_1496_2545 | 326 |
| 628 | 3300046518 | Ga0495631_0011171 | Ga0495631_0011171_2760_3806 | 326 |
| 629 | 3300046518 | Ga0495631_0015481 | Ga0495631_0015481_196_1236 | 326 |
| 630 | 3300046520 | Ga0495637_0000008 | Ga0495637_0000008_75915_76961 | 326 |
| 631 | 3300046523 | Ga0495644_0028261 | Ga0495644_0028261_218_1258 | 326 |
| 632 | 3300046524 | Ga0495648_0012819 | Ga0495648_0012819_1077_2129 | 326 |
| 633 | 3300046524 | Ga0495648_0016800 | Ga0495648_0016800_580_1629 | 326 |
| 634 | 3300046528 | Ga0495642_0093966 | Ga0495642_0093966_82_1128 | 326 |
| 635 | 3300046529 | Ga0495652_0058188 | Ga0495652_0058188_753_1739 | 326 |
| 636 | 3300046538 | Ga0495609_0004835 | Ga0495609_0004835_3698_4750 | 326 |
| 637 | 3300046538 | Ga0495609_0101618 | Ga0495609_0101618_153_1199 | 326 |
| 638 | 3300046558 | Ga0495633_0000874 | Ga0495633_0000874_2597_3643 | 326 |
| 639 | 3300046559 | Ga0495667_0050977 | Ga0495667_0050977_574_1560 | 326 |
| 640 | 3300046615 | Ga0495656_0067904 | Ga0495656_0067904_144_1181 | 326 |
| 641 | 3300046648 | Ga0495611_0000410 | Ga0495611_0000410_17907_18953 | 326 |
| 642 | 3300046663 | Ga0495635_0085362 | Ga0495635_0085362_734_1720 | 326 |
| 643 | 3300046675 | Ga0495657_0020435 | Ga0495657_0020435_739_1725 | 326 |
| 644 | 3300046683 | Ga0495658_0099415 | Ga0495658_0099415_329_1318 | 326 |
| 645 | 3300046691 | Ga0495670_0030691 | Ga0495670_0030691_595_1644 | 326 |
| 646 | 3300046694 | Ga0495649_0000071 | Ga0495649_0000071_65339_66385 | 326 |
| 647 | 3300046794 | Ga0495589_0036872 | Ga0495589_0036872_764_1804 | 326 |
| 648 | 3300046810 | Ga0495660_0007687 | Ga0495660_0007687_5260_6306 | 326 |
| 649 | 3300047317 | Ga0495604_0004634 | Ga0495604_0004634_8720_9706 | 326 |
| 650 | 3300047320 | Ga0495672_0000033 | Ga0495672_0000033_191123_192169 | 326 |
| 651 | 3300047322 | Ga0495680_0073679 | Ga0495680_0073679_1009_1995 | 326 |
| 652 | 3300047323 | Ga0495683_0000168 | Ga0495683_0000168_23200_24246 | 326 |
| 653 | 3300047323 | Ga0495683_0041154 | Ga0495683_0041154_1109_2158 | 326 |
| 654 | 3300047323 | Ga0495683_0063091 | Ga0495683_0063091_560_1612 | 326 |
| 655 | 3300047443 | Ga0495687_002679 | Ga0495687_002679_11587_12627 | 326 |
| 656 | 3300047445 | Ga0495677_0000910 | Ga0495677_0000910_7958_9004 | 326 |
| 657 | 3300047446 | Ga0495679_033131 | Ga0495679_033131_332_1378 | 326 |
| 658 | 3300047470 | Ga0495681_0006172 | Ga0495681_0006172_3887_4927 | 326 |
| 659 | 3300047470 | Ga0495681_0083340 | Ga0495681_0083340_127_1173 | 326 |
| 660 | 3300047471 | Ga0495684_0166451 | Ga0495684_0166451_216_1202 | 326 |
| 661 | 3300047472 | Ga0495686_0025648 | Ga0495686_0025648_1048_2094 | 326 |
| 662 | 3300048088 | Ga0495602_0006383 | Ga0495602_0006383_1507_2493 | 326 |
| 663 | 3300048091 | Ga0495626_0037034 | Ga0495626_0037034_1107_2153 | 326 |
| 664 | 3300048903 | Ga0496100_0031708 | Ga0496100_0031708_429_1418 | 326 |
| 665 | 3300048905 | Ga0496102_0179152 | Ga0496102_0179152_720_1709 | 326 |
| 666 | 3300048906 | Ga0496103_0012301 | Ga0496103_0012301_728_1717 | 326 |
| 667 | 3300048907 | Ga0496104_0148862 | Ga0496104_0148862_111_1100 | 326 |
| 668 | 3300048908 | Ga0496105_0025717 | Ga0496105_0025717_1931_2920 | 326 |
| 669 | 3300048909 | Ga0496106_0029782 | Ga0496106_0029782_2219_3208 | 326 |
| 670 | 3300048909 | Ga0496106_0386495 | Ga0496106_0386495_46_1092 | 326 |
| 671 | 3300048910 | Ga0496107_0002049 | Ga0496107_0002049_2759_3748 | 326 |
| 672 | 3300048910 | Ga0496107_0029290 | Ga0496107_0029290_2276_3322 | 326 |
| 673 | 3300048910 | Ga0496107_0043893 | Ga0496107_0043893_1392_2381 | 326 |
| 674 | 3300048911 | Ga0496108_0040406 | Ga0496108_0040406_1384_2373 | 326 |
| 675 | 3300048913 | Ga0496110_0028356 | Ga0496110_0028356_320_1312 | 326 |
| 676 | 3300048914 | Ga0496111_0046274 | Ga0496111_0046274_756_1745 | 326 |
| 677 | 3300048916 | Ga0496113_0174989 | Ga0496113_0174989_549_1538 | 326 |
| 678 | 3300048917 | Ga0496114_0040057 | Ga0496114_0040057_1482_2471 | 326 |
| 679 | 3300048918 | Ga0496115_0024187 | Ga0496115_0024187_3101_4090 | 326 |
| 680 | 3300048918 | Ga0496115_0077466 | Ga0496115_0077466_1436_2494 | 326 |
| 681 | 3300048918 | Ga0496115_0184135 | Ga0496115_0184135_109_1098 | 326 |
| 682 | 3300049459 | Ga0495678_000024 | Ga0495678_000024_133138_134184 | 326 |
| 683 | 3300049459 | Ga0495678_000061 | Ga0495678_000061_96941_97981 | 326 |
| 684 | 3300049460 | Ga0495682_0001519 | Ga0495682_0001519_7877_8917 | 326 |
| 685 | 3300049460 | Ga0495682_0023599 | Ga0495682_0023599_169_1215 | 326 |
| 686 | 3300049568 | Ga0501031_0007697 | Ga0501031_0007697_1224_2213 | 326 |
| 687 | 3300049568 | Ga0501031_0076562 | Ga0501031_0076562_227_1267 | 326 |
| 688 | 3300049569 | Ga0501032_0012676 | Ga0501032_0012676_806_1795 | 326 |
| 689 | 3300049569 | Ga0501032_0047591 | Ga0501032_0047591_914_1954 | 326 |
| 690 | 3300049570 | Ga0501033_0010744 | Ga0501033_0010744_1050_2090 | 326 |
| 691 | 3300049570 | Ga0501033_0014803 | Ga0501033_0014803_3725_4714 | 326 |
| 692 | 3300049570 | Ga0501033_0041519 | Ga0501033_0041519_736_1740 | 326 |
| 693 | 3300049571 | Ga0501034_0069583 | Ga0501034_0069583_1050_2090 | 326 |
| 694 | 3300049571 | Ga0501034_0079371 | Ga0501034_0079371_2133_3122 | 326 |
| 695 | 3300049572 | Ga0501036_0001896 | Ga0501036_0001896_15003_16043 | 326 |
| 696 | 3300049572 | Ga0501036_0012065 | Ga0501036_0012065_5239_6243 | 326 |
| 697 | 3300049573 | Ga0501037_0013364 | Ga0501037_0013364_4743_5732 | 326 |
| 698 | 3300049573 | Ga0501037_0034705 | Ga0501037_0034705_442_1482 | 326 |
| 699 | 3300049574 | Ga0501038_0011296 | Ga0501038_0011296_5990_6979 | 326 |
| 700 | 3300049574 | Ga0501038_0015310 | Ga0501038_0015310_3345_4349 | 326 |
| 701 | 3300049575 | Ga0501039_0026855 | Ga0501039_0026855_534_1538 | 326 |
| 702 | 3300049575 | Ga0501039_0066303 | Ga0501039_0066303_819_1808 | 326 |
| 703 | 3300049576 | Ga0501040_0005348 | Ga0501040_0005348_1933_2937 | 326 |
| 704 | 3300049577 | Ga0501041_0008980 | Ga0501041_0008980_4050_5054 | 326 |
| 705 | 3300049578 | Ga0501042_0008836 | Ga0501042_0008836_3193_4197 | 326 |
| 706 | 3300049581 | Ga0501047_0046651 | Ga0501047_0046651_974_1963 | 326 |
| 707 | 3300049581 | Ga0501047_0206302 | Ga0501047_0206302_200_1240 | 326 |
| 708 | 3300049582 | Ga0501048_0025358 | Ga0501048_0025358_1646_2650 | 326 |
| 709 | 3300049583 | Ga0501067_0039738 | Ga0501067_0039738_1069_2109 | 326 |
| 710 | 3300049584 | Ga0501068_0057648 | Ga0501068_0057648_433_1473 | 326 |
| 711 | 3300049584 | Ga0501068_0058676 | Ga0501068_0058676_753_1757 | 326 |
| 712 | 3300049585 | Ga0501069_0006910 | Ga0501069_0006910_199_1239 | 326 |
| 713 | 3300049586 | Ga0501070_0020457 | Ga0501070_0020457_958_1947 | 326 |
| 714 | 3300049588 | Ga0501072_0001618 | Ga0501072_0001618_13102_14106 | 326 |
| 715 | 3300049589 | Ga0501073_0024329 | Ga0501073_0024329_2395_3435 | 326 |
| 716 | 3300049591 | Ga0501075_0000784 | Ga0501075_0000784_10131_11135 | 326 |
| 717 | 3300049592 | Ga0501076_0001426 | Ga0501076_0001426_12440_13444 | 326 |
| 718 | 3300049741 | Ga0501079_0005043 | Ga0501079_0005043_7945_8949 | 326 |
| 719 | 3300049742 | Ga0501080_0042100 | Ga0501080_0042100_828_1832 | 326 |
| 720 | 3300049743 | Ga0501081_0011772 | Ga0501081_0011772_4370_5374 | 326 |
| 721 | 3300049744 | Ga0501083_0005838 | Ga0501083_0005838_6344_7384 | 326 |
| 722 | 3300049744 | Ga0501083_0026484 | Ga0501083_0026484_698_1702 | 326 |
| 723 | 3300049744 | Ga0501083_0107285 | Ga0501083_0107285_474_1466 | 326 |
| 724 | 3300049823 | Ga0501044_0000084 | Ga0501044_0000084_22466_23506 | 326 |
| 725 | 3300049823 | Ga0501044_0111899 | Ga0501044_0111899_353_1342 | 326 |
| 726 | 3300049823 | Ga0501044_0278065 | Ga0501044_0278065_466_1455 | 326 |
| 727 | 3300049824 | Ga0501045_0148243 | Ga0501045_0148243_292_1296 | 326 |
| 728 | 3300050489 | nmdc:mga03683_21567_c1 | nmdc:mga03683_21567_c1_1192_2181 | 326 |
| 729 | 3300050492 | nmdc:mga0yw44_167638_c1 | nmdc:mga0yw44_167638_c1_280_1269 | 326 |
| 730 | 3300050507 | nmdc:mga05p37_224789_c1 | nmdc:mga05p37_224789_c1_112_1101 | 326 |
| 731 | 3300050508 | nmdc:mga09592_74927_c1 | nmdc:mga09592_74927_c1_960_1958 | 326 |
| 732 | 3300050510 | nmdc:mga06r32_96585_c1 | nmdc:mga06r32_96585_c1_1404_2402 | 326 |
| 733 | 3300050511 | nmdc:mga08y16_129212_c1 | nmdc:mga08y16_129212_c1_678_1667 | 326 |
| 734 | 3300050512 | nmdc:mga0n895_389536_c1 | nmdc:mga0n895_389536_c1_117_1109 | 326 |
| 735 | 3300050513 | nmdc:mga0rr50_159095_c1 | nmdc:mga0rr50_159095_c1_305_1297 | 326 |
| 736 | 3300050515 | nmdc:mga0a205_111119_c1 | nmdc:mga0a205_111119_c1_589_1581 | 326 |
| 737 | 3300053077 | Ga0495601_0001025 | Ga0495601_0001025_10215_11201 | 326 |
| 738 | 3300053084 | Ga0495595_0001239 | Ga0495595_0001239_8532_9518 | 326 |
| 739 | 3300053084 | Ga0495595_0100010 | Ga0495595_0100010_168_1157 | 326 |
| 740 | 3300053085 | Ga0495619_0001774 | Ga0495619_0001774_9357_10343 | 326 |
| 741 | 3300053085 | Ga0495619_0273583 | Ga0495619_0273583_92_1081 | 326 |
| 742 | 3300053131 | Ga0500652_058240 | Ga0500652_058240_37_1074 | 326 |
| 743 | 3300060353 | Ga0501082_0012045 | Ga0501082_0012045_1234_2238 | 326 |
| 744 | 3300061734 | Ga0530510_0000158 | Ga0530510_0000158_27549_28553 | 326 |
| 745 | 3300061734 | Ga0530510_0128852 | Ga0530510_0128852_222_1211 | 326 |
| 746 | 3300000041 | ARcpr5oldR_c000022 | ARcpr5oldR_00002212 | 327 |
| 747 | 3300000042 | ARSoilYngRDRAFT_c00124 | ARSoilYngRDRAFT_001245 | 327 |
| 748 | 3300000043 | ARcpr5yngRDRAFT_c000127 | ARcpr5yngRDRAFT_0001275 | 327 |
| 749 | 3300000044 | ARSoilOldRDRAFT_c000182 | ARSoilOldRDRAFT_0001825 | 327 |
| 750 | 3300000045 | ARCol0oldRDRAFT_c00133 | ARCol0oldRDRAFT_001336 | 327 |
| 751 | 3300000652 | ARCol0yngRDRAFT_1000244 | ARCol0yngRDRAFT_10002445 | 327 |
| 752 | 3300001990 | JGI24737J22298_10003452 | JGI24737J22298_100034522 | 327 |
| 753 | 3300005290 | Ga0065712_10073486 | Ga0065712_100734864 | 327 |
| 754 | 3300005328 | Ga0070676_10017202 | Ga0070676_100172023 | 327 |
| 755 | 3300005330 | Ga0070690_100083018 | Ga0070690_1000830183 | 327 |
| 756 | 3300005330 | Ga0070690_100289108 | Ga0070690_1002891081 | 327 |
| 757 | 3300005331 | Ga0070670_100392200 | Ga0070670_1003922001 | 327 |
| 758 | 3300005334 | Ga0068869_100084615 | Ga0068869_1000846152 | 327 |
| 759 | 3300005335 | Ga0070666_10006602 | Ga0070666_100066023 | 327 |
| 760 | 3300005335 | Ga0070666_10062024 | Ga0070666_100620243 | 327 |
| 761 | 3300005336 | Ga0070680_100016299 | Ga0070680_1000162992 | 327 |
| 762 | 3300005336 | Ga0070680_100033258 | Ga0070680_1000332583 | 327 |
| 763 | 3300005336 | Ga0070680_100146404 | Ga0070680_1001464041 | 327 |
| 764 | 3300005337 | Ga0070682_100006283 | Ga0070682_1000062838 | 327 |
| 765 | 3300005337 | Ga0070682_100128359 | Ga0070682_1001283591 | 327 |
| 766 | 3300005339 | Ga0070660_100092905 | Ga0070660_1000929052 | 327 |
| 767 | 3300005344 | Ga0070661_100057287 | Ga0070661_1000572872 | 327 |
| 768 | 3300005347 | Ga0070668_100148599 | Ga0070668_1001485992 | 327 |
| 769 | 3300005367 | Ga0070667_100009580 | Ga0070667_1000095808 | 327 |
| 770 | 3300005367 | Ga0070667_100557304 | Ga0070667_1005573041 | 327 |
| 771 | 3300005434 | Ga0070709_10001382 | Ga0070709_1000138210 | 327 |
| 772 | 3300005434 | Ga0070709_10082042 | Ga0070709_100820423 | 327 |
| 773 | 3300005435 | Ga0070714_100003309 | Ga0070714_1000033099 | 327 |
| 774 | 3300005435 | Ga0070714_100091829 | Ga0070714_1000918292 | 327 |
| 775 | 3300005436 | Ga0070713_100006430 | Ga0070713_1000064302 | 327 |
| 776 | 3300005437 | Ga0070710_10010291 | Ga0070710_100102912 | 327 |
| 777 | 3300005437 | Ga0070710_10023419 | Ga0070710_100234192 | 327 |
| 778 | 3300005439 | Ga0070711_100038864 | Ga0070711_1000388644 | 327 |
| 779 | 3300005439 | Ga0070711_100093216 | Ga0070711_1000932162 | 327 |
| 780 | 3300005441 | Ga0070700_100237365 | Ga0070700_1002373652 | 327 |
| 781 | 3300005444 | Ga0070694_100055279 | Ga0070694_1000552792 | 327 |
| 782 | 3300005444 | Ga0070694_100148370 | Ga0070694_1001483701 | 327 |
| 783 | 3300005455 | Ga0070663_100012485 | Ga0070663_1000124853 | 327 |
| 784 | 3300005455 | Ga0070663_100028209 | Ga0070663_1000282093 | 327 |
| 785 | 3300005457 | Ga0070662_100007259 | Ga0070662_1000072596 | 327 |
| 786 | 3300005457 | Ga0070662_100057910 | Ga0070662_1000579103 | 327 |
| 787 | 3300005458 | Ga0070681_10034265 | Ga0070681_100342654 | 327 |
| 788 | 3300005530 | Ga0070679_100037757 | Ga0070679_1000377574 | 327 |
| 789 | 3300005530 | Ga0070679_100232897 | Ga0070679_1002328972 | 327 |
| 790 | 3300005544 | Ga0070686_100184039 | Ga0070686_1001840391 | 327 |
| 791 | 3300005545 | Ga0070695_100177787 | Ga0070695_1001777871 | 327 |
| 792 | 3300005546 | Ga0070696_100262306 | Ga0070696_1002623061 | 327 |
| 793 | 3300005547 | Ga0070693_100006238 | Ga0070693_1000062384 | 327 |
| 794 | 3300005548 | Ga0070665_100220572 | Ga0070665_1002205721 | 327 |
| 795 | 3300005564 | Ga0070664_100090632 | Ga0070664_1000906321 | 327 |
| 796 | 3300005564 | Ga0070664_100349043 | Ga0070664_1003490432 | 327 |
| 797 | 3300005578 | Ga0068854_100003622 | Ga0068854_1000036226 | 327 |
| 798 | 3300005614 | Ga0068856_100021694 | Ga0068856_1000216947 | 327 |
| 799 | 3300005614 | Ga0068856_100397280 | Ga0068856_1003972802 | 327 |
| 800 | 3300005615 | Ga0070702_100025792 | Ga0070702_1000257923 | 327 |
| 801 | 3300005618 | Ga0068864_100005577 | Ga0068864_1000055776 | 327 |
| 802 | 3300005618 | Ga0068864_100036637 | Ga0068864_1000366372 | 327 |
| 803 | 3300005718 | Ga0068866_10037168 | Ga0068866_100371682 | 327 |
| 804 | 3300005719 | Ga0068861_100062966 | Ga0068861_1000629662 | 327 |
| 805 | 3300005719 | Ga0068861_100270621 | Ga0068861_1002706212 | 327 |
| 806 | 3300005840 | Ga0068870_10001295 | Ga0068870_100012955 | 327 |
| 807 | 3300005842 | Ga0068858_100055331 | Ga0068858_1000553314 | 327 |
| 808 | 3300005843 | Ga0068860_100009949 | Ga0068860_1000099496 | 327 |
| 809 | 3300005937 | Ga0081455_10003885 | Ga0081455_100038856 | 327 |
| 810 | 3300005937 | Ga0081455_10007107 | Ga0081455_100071078 | 327 |
| 811 | 3300006163 | Ga0070715_10046818 | Ga0070715_100468181 | 327 |
| 812 | 3300006175 | Ga0070712_100026284 | Ga0070712_1000262842 | 327 |
| 813 | 3300006175 | Ga0070712_100063268 | Ga0070712_1000632683 | 327 |
| 814 | 3300006237 | Ga0097621_100012683 | Ga0097621_1000126832 | 327 |
| 815 | 3300006353 | Ga0075370_10231347 | Ga0075370_102313472 | 327 |
| 816 | 3300006358 | Ga0068871_100003984 | Ga0068871_1000039846 | 327 |
| 817 | 3300006358 | Ga0068871_100014697 | Ga0068871_1000146974 | 327 |
| 818 | 3300006844 | Ga0075428_100008075 | Ga0075428_1000080756 | 327 |
| 819 | 3300006846 | Ga0075430_100000304 | Ga0075430_10000030426 | 327 |
| 820 | 3300006846 | Ga0075430_100228067 | Ga0075430_1002280671 | 327 |
| 821 | 3300006847 | Ga0075431_100006534 | Ga0075431_1000065345 | 327 |
| 822 | 3300006852 | Ga0075433_10000958 | Ga0075433_1000095814 | 327 |
| 823 | 3300006871 | Ga0075434_100001677 | Ga0075434_1000016775 | 327 |
| 824 | 3300006871 | Ga0075434_100026434 | Ga0075434_1000264345 | 327 |
| 825 | 3300006871 | Ga0075434_100052639 | Ga0075434_1000526394 | 327 |
| 826 | 3300006871 | Ga0075434_100094886 | Ga0075434_1000948862 | 327 |
| 827 | 3300006871 | Ga0075434_100142354 | Ga0075434_1001423542 | 327 |
| 828 | 3300006880 | Ga0075429_100013390 | Ga0075429_1000133903 | 327 |
| 829 | 3300006881 | Ga0068865_100006167 | Ga0068865_1000061676 | 327 |
| 830 | 3300007076 | Ga0075435_100098556 | Ga0075435_1000985563 | 327 |
| 831 | 3300009011 | Ga0105251_10025235 | Ga0105251_100252352 | 327 |
| 832 | 3300009093 | Ga0105240_10059489 | Ga0105240_100594895 | 327 |
| 833 | 3300009094 | Ga0111539_10000138 | Ga0111539_1000013871 | 327 |
| 834 | 3300009094 | Ga0111539_10013242 | Ga0111539_1001324210 | 327 |
| 835 | 3300009094 | Ga0111539_10041591 | Ga0111539_100415913 | 327 |
| 836 | 3300009094 | Ga0111539_10097609 | Ga0111539_100976092 | 327 |
| 837 | 3300009098 | Ga0105245_10374113 | Ga0105245_103741132 | 327 |
| 838 | 3300009101 | Ga0105247_10058153 | Ga0105247_100581532 | 327 |
| 839 | 3300009147 | Ga0114129_10213207 | Ga0114129_102132071 | 327 |
| 840 | 3300009174 | Ga0105241_10252399 | Ga0105241_102523992 | 327 |
| 841 | 3300009176 | Ga0105242_10042237 | Ga0105242_100422374 | 327 |
| 842 | 3300009177 | Ga0105248_10020983 | Ga0105248_100209833 | 327 |
| 843 | 3300009545 | Ga0105237_10093716 | Ga0105237_100937162 | 327 |
| 844 | 3300009551 | Ga0105238_10154016 | Ga0105238_101540162 | 327 |
| 845 | 3300009553 | Ga0105249_10164553 | Ga0105249_101645533 | 327 |
| 846 | 3300009553 | Ga0105249_10195887 | Ga0105249_101958872 | 327 |
| 847 | 3300012498 | Ga0157345_1001131 | Ga0157345_10011312 | 327 |
| 848 | 3300012505 | Ga0157339_1002850 | Ga0157339_10028501 | 327 |
| 849 | 3300012510 | Ga0157316_1001901 | Ga0157316_10019012 | 327 |
| 850 | 3300013100 | Ga0157373_10040198 | Ga0157373_100401983 | 327 |
| 851 | 3300013104 | Ga0157370_10042057 | Ga0157370_100420572 | 327 |
| 852 | 3300013105 | Ga0157369_10088552 | Ga0157369_100885522 | 327 |
| 853 | 3300013296 | Ga0157374_10100128 | Ga0157374_101001282 | 327 |
| 854 | 3300013296 | Ga0157374_10160667 | Ga0157374_101606671 | 327 |
| 855 | 3300013296 | Ga0157374_10285228 | Ga0157374_102852282 | 327 |
| 856 | 3300013297 | Ga0157378_10121402 | Ga0157378_101214022 | 327 |
| 857 | 3300013297 | Ga0157378_10139422 | Ga0157378_101394223 | 327 |
| 858 | 3300013306 | Ga0163162_10065114 | Ga0163162_100651144 | 327 |
| 859 | 3300013306 | Ga0163162_10100584 | Ga0163162_101005843 | 327 |
| 860 | 3300013307 | Ga0157372_10178558 | Ga0157372_101785581 | 327 |
| 861 | 3300013308 | Ga0157375_10002488 | Ga0157375_1000248815 | 327 |
| 862 | 3300013308 | Ga0157375_10117399 | Ga0157375_101173993 | 327 |
| 863 | 3300014968 | Ga0157379_10126245 | Ga0157379_101262453 | 327 |
| 864 | 3300014969 | Ga0157376_10008924 | Ga0157376_100089243 | 327 |
| 865 | 3300014969 | Ga0157376_10062958 | Ga0157376_100629582 | 327 |
| 866 | 3300017792 | Ga0163161_10006692 | Ga0163161_100066925 | 327 |
| 867 | 3300017792 | Ga0163161_10107885 | Ga0163161_101078852 | 327 |
| 868 | 3300021384 | Ga0213876_10090496 | Ga0213876_100904962 | 327 |
| 869 | 3300025261 | Ga0209233_1016691 | Ga0209233_10166912 | 327 |
| 870 | 3300025290 | Ga0207673_1000042 | Ga0207673_10000425 | 327 |
| 871 | 3300025315 | Ga0207697_10011526 | Ga0207697_100115263 | 327 |
| 872 | 3300025898 | Ga0207692_10016295 | Ga0207692_100162953 | 327 |
| 873 | 3300025899 | Ga0207642_10002194 | Ga0207642_100021945 | 327 |
| 874 | 3300025900 | Ga0207710_10007821 | Ga0207710_100078213 | 327 |
| 875 | 3300025900 | Ga0207710_10036632 | Ga0207710_100366323 | 327 |
| 876 | 3300025901 | Ga0207688_10000024 | Ga0207688_1000002443 | 327 |
| 877 | 3300025901 | Ga0207688_10075463 | Ga0207688_100754631 | 327 |
| 878 | 3300025904 | Ga0207647_10020019 | Ga0207647_100200194 | 327 |
| 879 | 3300025905 | Ga0207685_10003863 | Ga0207685_100038634 | 327 |
| 880 | 3300025905 | Ga0207685_10020245 | Ga0207685_100202452 | 327 |
| 881 | 3300025907 | Ga0207645_10027609 | Ga0207645_100276093 | 327 |
| 882 | 3300025912 | Ga0207707_10031302 | Ga0207707_100313023 | 327 |
| 883 | 3300025912 | Ga0207707_10039822 | Ga0207707_100398221 | 327 |
| 884 | 3300025912 | Ga0207707_10058970 | Ga0207707_100589703 | 327 |
| 885 | 3300025913 | Ga0207695_10089660 | Ga0207695_100896602 | 327 |
| 886 | 3300025915 | Ga0207693_10003819 | Ga0207693_1000381911 | 327 |
| 887 | 3300025915 | Ga0207693_10004725 | Ga0207693_100047255 | 327 |
| 888 | 3300025915 | Ga0207693_10266677 | Ga0207693_102666772 | 327 |
| 889 | 3300025916 | Ga0207663_10157689 | Ga0207663_101576891 | 327 |
| 890 | 3300025916 | Ga0207663_10313092 | Ga0207663_103130922 | 327 |
| 891 | 3300025917 | Ga0207660_10000104 | Ga0207660_1000010440 | 327 |
| 892 | 3300025917 | Ga0207660_10256357 | Ga0207660_102563572 | 327 |
| 893 | 3300025919 | Ga0207657_10008208 | Ga0207657_100082087 | 327 |
| 894 | 3300025919 | Ga0207657_10064983 | Ga0207657_100649833 | 327 |
| 895 | 3300025919 | Ga0207657_10100631 | Ga0207657_101006312 | 327 |
| 896 | 3300025920 | Ga0207649_10002932 | Ga0207649_100029325 | 327 |
| 897 | 3300025920 | Ga0207649_10252061 | Ga0207649_102520611 | 327 |
| 898 | 3300025921 | Ga0207652_10001464 | Ga0207652_100014644 | 327 |
| 899 | 3300025921 | Ga0207652_10049899 | Ga0207652_100498991 | 327 |
| 900 | 3300025921 | Ga0207652_10158295 | Ga0207652_101582952 | 327 |
| 901 | 3300025924 | Ga0207694_10096619 | Ga0207694_100966192 | 327 |
| 902 | 3300025925 | Ga0207650_10006629 | Ga0207650_100066295 | 327 |
| 903 | 3300025927 | Ga0207687_10059806 | Ga0207687_100598061 | 327 |
| 904 | 3300025928 | Ga0207700_10001350 | Ga0207700_100013502 | 327 |
| 905 | 3300025928 | Ga0207700_10214051 | Ga0207700_102140511 | 327 |
| 906 | 3300025929 | Ga0207664_10004320 | Ga0207664_100043203 | 327 |
| 907 | 3300025929 | Ga0207664_10049839 | Ga0207664_100498393 | 327 |
| 908 | 3300025933 | Ga0207706_10012802 | Ga0207706_100128024 | 327 |
| 909 | 3300025933 | Ga0207706_10203277 | Ga0207706_102032772 | 327 |
| 910 | 3300025934 | Ga0207686_10006384 | Ga0207686_100063842 | 327 |
| 911 | 3300025934 | Ga0207686_10039418 | Ga0207686_100394182 | 327 |
| 912 | 3300025936 | Ga0207670_10000182 | Ga0207670_1000018238 | 327 |
| 913 | 3300025936 | Ga0207670_10240532 | Ga0207670_102405322 | 327 |
| 914 | 3300025937 | Ga0207669_10004684 | Ga0207669_100046842 | 327 |
| 915 | 3300025939 | Ga0207665_10001219 | Ga0207665_100012195 | 327 |
| 916 | 3300025941 | Ga0207711_10057458 | Ga0207711_100574582 | 327 |
| 917 | 3300025941 | Ga0207711_10074015 | Ga0207711_100740153 | 327 |
| 918 | 3300025941 | Ga0207711_10153970 | Ga0207711_101539702 | 327 |
| 919 | 3300025942 | Ga0207689_10013837 | Ga0207689_100138375 | 327 |
| 920 | 3300025944 | Ga0207661_10001332 | Ga0207661_1000133210 | 327 |
| 921 | 3300025945 | Ga0207679_10000035 | Ga0207679_1000003555 | 327 |
| 922 | 3300025949 | Ga0207667_10177458 | Ga0207667_101774582 | 327 |
| 923 | 3300025960 | Ga0207651_10000180 | Ga0207651_1000018014 | 327 |
| 924 | 3300025960 | Ga0207651_10135299 | Ga0207651_101352992 | 327 |
| 925 | 3300025961 | Ga0207712_10008108 | Ga0207712_100081083 | 327 |
| 926 | 3300025961 | Ga0207712_10310602 | Ga0207712_103106021 | 327 |
| 927 | 3300025972 | Ga0207668_10000149 | Ga0207668_1000014939 | 327 |
| 928 | 3300025972 | Ga0207668_10089867 | Ga0207668_100898673 | 327 |
| 929 | 3300025981 | Ga0207640_10014682 | Ga0207640_100146824 | 327 |
| 930 | 3300025981 | Ga0207640_10039474 | Ga0207640_100394742 | 327 |
| 931 | 3300025986 | Ga0207658_10043386 | Ga0207658_100433862 | 327 |
| 932 | 3300026023 | Ga0207677_10004580 | Ga0207677_100045804 | 327 |
| 933 | 3300026035 | Ga0207703_10079135 | Ga0207703_100791352 | 327 |
| 934 | 3300026035 | Ga0207703_10128856 | Ga0207703_101288562 | 327 |
| 935 | 3300026041 | Ga0207639_10002906 | Ga0207639_100029063 | 327 |
| 936 | 3300026041 | Ga0207639_10063477 | Ga0207639_100634772 | 327 |
| 937 | 3300026067 | Ga0207678_10009048 | Ga0207678_100090485 | 327 |
| 938 | 3300026067 | Ga0207678_10015567 | Ga0207678_100155675 | 327 |
| 939 | 3300026067 | Ga0207678_10020228 | Ga0207678_100202285 | 327 |
| 940 | 3300026067 | Ga0207678_10091621 | Ga0207678_100916213 | 327 |
| 941 | 3300026075 | Ga0207708_10039584 | Ga0207708_100395844 | 327 |
| 942 | 3300026075 | Ga0207708_10295341 | Ga0207708_102953412 | 327 |
| 943 | 3300026078 | Ga0207702_10006764 | Ga0207702_100067647 | 327 |
| 944 | 3300026078 | Ga0207702_10168387 | Ga0207702_101683873 | 327 |
| 945 | 3300026089 | Ga0207648_10035823 | Ga0207648_100358233 | 327 |
| 946 | 3300026095 | Ga0207676_10001216 | Ga0207676_100012166 | 327 |
| 947 | 3300026095 | Ga0207676_10068056 | Ga0207676_100680563 | 327 |
| 948 | 3300026118 | Ga0207675_100026983 | Ga0207675_1000269835 | 327 |
| 949 | 3300026118 | Ga0207675_100077875 | Ga0207675_1000778752 | 327 |
| 950 | 3300026121 | Ga0207683_10006130 | Ga0207683_1000613012 | 327 |
| 951 | 3300026121 | Ga0207683_10009850 | Ga0207683_100098508 | 327 |
| 952 | 3300026142 | Ga0207698_10007529 | Ga0207698_100075295 | 327 |
| 953 | 3300027682 | Ga0209971_1013547 | Ga0209971_10135472 | 327 |
| 954 | 3300027717 | Ga0209998_10002490 | Ga0209998_100024904 | 327 |
| 955 | 3300027717 | Ga0209998_10007384 | Ga0209998_100073843 | 327 |
| 956 | 3300027876 | Ga0209974_10010975 | Ga0209974_100109752 | 327 |
| 957 | 3300027876 | Ga0209974_10024633 | Ga0209974_100246332 | 327 |
| 958 | 3300027907 | Ga0207428_10000075 | Ga0207428_10000075108 | 327 |
| 959 | 3300027907 | Ga0207428_10002495 | Ga0207428_1000249515 | 327 |
| 960 | 3300027907 | Ga0207428_10004858 | Ga0207428_100048587 | 327 |
| 961 | 3300028381 | Ga0268264_10346131 | Ga0268264_103461311 | 327 |
| 962 | 3300031241 | Ga0265325_10008594 | Ga0265325_100085943 | 327 |
| 963 | 3300031595 | Ga0265313_10015070 | Ga0265313_100150705 | 327 |
| 964 | 3300034816 | Ga0373930_0000182 | Ga0373930_0000182_5209_6198 | 327 |
| 965 | 3300034817 | Ga0373948_0000591 | Ga0373948_0000591_1881_2870 | 327 |
| 966 | 3300034820 | Ga0373959_0001645 | Ga0373959_0001645_2368_3357 | 327 |
| 967 | 3300035083 | Ga0373926_0092652 | Ga0373926_0092652_60_1049 | 327 |
| 968 | 3300035084 | Ga0373928_0007047 | Ga0373928_0007047_1000_1989 | 327 |
| 969 | 3300035085 | Ga0373929_0001158 | Ga0373929_0001158_2371_3360 | 327 |
| 970 | 3300035088 | Ga0373940_0000142 | Ga0373940_0000142_4989_5978 | 327 |
| 971 | 3300035089 | Ga0373944_0016090 | Ga0373944_0016090_165_1154 | 327 |
| 972 | 3300035090 | Ga0373949_0003060 | Ga0373949_0003060_1327_2316 | 327 |
| 973 | 3300035090 | Ga0373949_0003729 | Ga0373949_0003729_952_1941 | 327 |
| 974 | 3300035090 | Ga0373949_0014713 | Ga0373949_0014713_702_1712 | 327 |
| 975 | 3300035091 | Ga0373951_0001484 | Ga0373951_0001484_3515_4504 | 327 |
| 976 | 3300035092 | Ga0373952_0010722 | Ga0373952_0010722_276_1265 | 327 |
| 977 | 3300035111 | Ga0373923_0013137 | Ga0373923_0013137_323_1312 | 327 |
| 978 | 3300035112 | Ga0373932_0000611 | Ga0373932_0000611_5452_6441 | 327 |
| 979 | 3300035114 | Ga0373939_0002011 | Ga0373939_0002011_2778_3767 | 327 |
| 980 | 3300035115 | Ga0373941_0001642 | Ga0373941_0001642_1660_2649 | 327 |
| 981 | 3300035117 | Ga0373953_0040545 | Ga0373953_0040545_166_1155 | 327 |
| 982 | 3300035118 | Ga0373954_0009184 | Ga0373954_0009184_360_1349 | 327 |
| 983 | 3300035119 | Ga0373956_0005298 | Ga0373956_0005298_1807_2796 | 327 |
| 984 | 3300035120 | Ga0373957_0036910 | Ga0373957_0036910_662_1651 | 327 |
| 985 | 3300035121 | Ga0373960_0030235 | Ga0373960_0030235_308_1297 | 327 |
| 986 | 3300035170 | Ga0373943_0003515 | Ga0373943_0003515_2297_3286 | 327 |
| 987 | 3300035170 | Ga0373943_0037169 | Ga0373943_0037169_225_1214 | 327 |
| 988 | 3300035171 | Ga0373946_0133444 | Ga0373946_0133444_53_1042 | 327 |
| 989 | 3300035207 | Ga0373942_0001627 | Ga0373942_0001627_4432_5421 | 327 |
| 990 | 3300035241 | Ga0373961_0018987 | Ga0373961_0018987_505_1494 | 327 |
| 991 | 3300035241 | Ga0373961_0035394 | Ga0373961_0035394_54_1043 | 327 |
| 992 | 3300035691 | Ga0373931_0009578 | Ga0373931_0009578_177_1166 | 327 |
| 993 | 3300035692 | Ga0373935_0004817 | Ga0373935_0004817_6778_7767 | 327 |
| 994 | 3300035695 | Ga0373927_0105788 | Ga0373927_0105788_427_1416 | 327 |
| 995 | 3300035724 | Ga0373933_0008478 | Ga0373933_0008478_1860_2849 | 327 |
| 996 | 3300035724 | Ga0373933_0098430 | Ga0373933_0098430_689_1678 | 327 |
| 997 | 3300035725 | Ga0373947_0005443 | Ga0373947_0005443_43_1032 | 327 |
| 998 | 3300035725 | Ga0373947_0029566 | Ga0373947_0029566_902_1906 | 327 |
| 999 | 3300037068 | Ga0373925_0005226 | Ga0373925_0005226_5756_6745 | 327 |
| 1000 | 3300037068 | Ga0373925_0111196 | Ga0373925_0111196_477_1466 | 327 |
| 1001 | 3300037853 | Ga0436364_0609713 | Ga0436364_0609713_158_1162 | 327 |
| 1002 | 3300039437 | Ga0436365_0534746 | Ga0436365_0534746_5424_6428 | 327 |
| 1003 | 3300039437 | Ga0436365_1516841 | Ga0436365_1516841_473_1477 | 327 |
| 1004 | 3300039438 | Ga0436360_0728136 | Ga0436360_0728136_699_1703 | 327 |
| 1005 | 3300039438 | Ga0436360_1357448 | Ga0436360_1357448_485_1489 | 327 |
| 1006 | 3300039450 | Ga0436363_0810999 | Ga0436363_0810999_245_1249 | 327 |
| 1007 | 3300042012 | Ga0439455_0008055 | Ga0439455_0008055_711_1700 | 327 |
| 1008 | 3300046454 | Ga0495592_0053098 | Ga0495592_0053098_1697_2686 | 327 |
| 1009 | 3300046455 | Ga0495603_0000816 | Ga0495603_0000816_12040_13029 | 327 |
| 1010 | 3300046455 | Ga0495603_0052530 | Ga0495603_0052530_756_1745 | 327 |
| 1011 | 3300046459 | Ga0495629_0000140 | Ga0495629_0000140_7778_8767 | 327 |
| 1012 | 3300046462 | Ga0495651_0242165 | Ga0495651_0242165_166_1155 | 327 |
| 1013 | 3300046463 | Ga0495653_0009696 | Ga0495653_0009696_5672_6661 | 327 |
| 1014 | 3300046463 | Ga0495653_0047492 | Ga0495653_0047492_1512_2501 | 327 |
| 1015 | 3300046472 | Ga0495580_0058773 | Ga0495580_0058773_1271_2260 | 327 |
| 1016 | 3300046472 | Ga0495580_0078199 | Ga0495580_0078199_1167_2156 | 327 |
| 1017 | 3300046473 | Ga0495582_0005878 | Ga0495582_0005878_3591_4580 | 327 |
| 1018 | 3300046475 | Ga0495639_0012290 | Ga0495639_0012290_2011_3000 | 327 |
| 1019 | 3300046476 | Ga0495662_0075454 | Ga0495662_0075454_240_1229 | 327 |
| 1020 | 3300046477 | Ga0495664_0005918 | Ga0495664_0005918_3892_4881 | 327 |
| 1021 | 3300046477 | Ga0495664_0038354 | Ga0495664_0038354_82_1071 | 327 |
| 1022 | 3300046492 | Ga0495585_0002257 | Ga0495585_0002257_4620_5609 | 327 |
| 1023 | 3300046499 | Ga0495594_0042704 | Ga0495594_0042704_723_1712 | 327 |
| 1024 | 3300046499 | Ga0495594_0200662 | Ga0495594_0200662_118_1107 | 327 |
| 1025 | 3300046501 | Ga0495607_0037500 | Ga0495607_0037500_798_1787 | 327 |
| 1026 | 3300046506 | Ga0495583_0077909 | Ga0495583_0077909_349_1338 | 327 |
| 1027 | 3300046511 | Ga0495608_0023230 | Ga0495608_0023230_1808_2797 | 327 |
| 1028 | 3300046511 | Ga0495608_0068600 | Ga0495608_0068600_1097_2086 | 327 |
| 1029 | 3300046511 | Ga0495608_0133031 | Ga0495608_0133031_113_1102 | 327 |
| 1030 | 3300046513 | Ga0495616_0074748 | Ga0495616_0074748_580_1569 | 327 |
| 1031 | 3300046514 | Ga0495618_0051343 | Ga0495618_0051343_1190_2179 | 327 |
| 1032 | 3300046514 | Ga0495618_0088817 | Ga0495618_0088817_158_1147 | 327 |
| 1033 | 3300046514 | Ga0495618_0153880 | Ga0495618_0153880_222_1211 | 327 |
| 1034 | 3300046516 | Ga0495628_0152301 | Ga0495628_0152301_321_1310 | 327 |
| 1035 | 3300046517 | Ga0495630_0083972 | Ga0495630_0083972_510_1499 | 327 |
| 1036 | 3300046523 | Ga0495644_0001244 | Ga0495644_0001244_3696_4685 | 327 |
| 1037 | 3300046529 | Ga0495652_0090548 | Ga0495652_0090548_741_1730 | 327 |
| 1038 | 3300046529 | Ga0495652_0131223 | Ga0495652_0131223_761_1750 | 327 |
| 1039 | 3300046531 | Ga0495665_0004725 | Ga0495665_0004725_151_1140 | 327 |
| 1040 | 3300046531 | Ga0495665_0063110 | Ga0495665_0063110_78_1082 | 327 |
| 1041 | 3300046533 | Ga0495640_0016839 | Ga0495640_0016839_161_1150 | 327 |
| 1042 | 3300046533 | Ga0495640_0044715 | Ga0495640_0044715_122_1111 | 327 |
| 1043 | 3300046535 | Ga0495586_0013278 | Ga0495586_0013278_871_1860 | 327 |
| 1044 | 3300046536 | Ga0495587_0027310 | Ga0495587_0027310_177_1166 | 327 |
| 1045 | 3300046543 | Ga0495645_0009517 | Ga0495645_0009517_4868_5857 | 327 |
| 1046 | 3300046557 | Ga0495622_0053196 | Ga0495622_0053196_125_1114 | 327 |
| 1047 | 3300046558 | Ga0495633_0006563 | Ga0495633_0006563_3483_4472 | 327 |
| 1048 | 3300046559 | Ga0495667_0005276 | Ga0495667_0005276_2487_3476 | 327 |
| 1049 | 3300046559 | Ga0495667_0131876 | Ga0495667_0131876_201_1190 | 327 |
| 1050 | 3300046615 | Ga0495656_0003395 | Ga0495656_0003395_2673_3662 | 327 |
| 1051 | 3300046642 | Ga0495634_0015355 | Ga0495634_0015355_1246_2250 | 327 |
| 1052 | 3300046642 | Ga0495634_0038064 | Ga0495634_0038064_1600_2589 | 327 |
| 1053 | 3300046642 | Ga0495634_0076834 | Ga0495634_0076834_163_1152 | 327 |
| 1054 | 3300046648 | Ga0495611_0005586 | Ga0495611_0005586_604_1593 | 327 |
| 1055 | 3300046663 | Ga0495635_0009872 | Ga0495635_0009872_3241_4230 | 327 |
| 1056 | 3300046664 | Ga0495659_0002292 | Ga0495659_0002292_318_1307 | 327 |
| 1057 | 3300046675 | Ga0495657_0035218 | Ga0495657_0035218_1692_2681 | 327 |
| 1058 | 3300046678 | Ga0495599_0005271 | Ga0495599_0005271_2308_3297 | 327 |
| 1059 | 3300046678 | Ga0495599_0039395 | Ga0495599_0039395_1044_2033 | 327 |
| 1060 | 3300046683 | Ga0495658_0009443 | Ga0495658_0009443_2253_3242 | 327 |
| 1061 | 3300046689 | Ga0495613_0013393 | Ga0495613_0013393_822_1826 | 327 |
| 1062 | 3300046689 | Ga0495613_0040585 | Ga0495613_0040585_1392_2381 | 327 |
| 1063 | 3300046690 | Ga0495624_0010799 | Ga0495624_0010799_1799_2788 | 327 |
| 1064 | 3300046691 | Ga0495670_0006450 | Ga0495670_0006450_4212_5201 | 327 |
| 1065 | 3300046692 | Ga0495671_0107130 | Ga0495671_0107130_133_1122 | 327 |
| 1066 | 3300046809 | Ga0495600_0055706 | Ga0495600_0055706_108_1097 | 327 |
| 1067 | 3300046809 | Ga0495600_0128497 | Ga0495600_0128497_592_1581 | 327 |
| 1068 | 3300047315 | Ga0495581_0020190 | Ga0495581_0020190_1280_2269 | 327 |
| 1069 | 3300047315 | Ga0495581_0085284 | Ga0495581_0085284_167_1156 | 327 |
| 1070 | 3300047317 | Ga0495604_0015973 | Ga0495604_0015973_2645_3634 | 327 |
| 1071 | 3300047317 | Ga0495604_0049732 | Ga0495604_0049732_472_1461 | 327 |
| 1072 | 3300047319 | Ga0495674_0009246 | Ga0495674_0009246_3157_4161 | 327 |
| 1073 | 3300047319 | Ga0495674_0123965 | Ga0495674_0123965_929_1918 | 327 |
| 1074 | 3300047319 | Ga0495674_0208245 | Ga0495674_0208245_399_1388 | 327 |
| 1075 | 3300047321 | Ga0495676_0012611 | Ga0495676_0012611_2263_3252 | 327 |
| 1076 | 3300047321 | Ga0495676_0065576 | Ga0495676_0065576_694_1698 | 327 |
| 1077 | 3300047321 | Ga0495676_0142816 | Ga0495676_0142816_163_1152 | 327 |
| 1078 | 3300047321 | Ga0495676_0258450 | Ga0495676_0258450_178_1167 | 327 |
| 1079 | 3300047322 | Ga0495680_0005304 | Ga0495680_0005304_8681_9670 | 327 |
| 1080 | 3300047322 | Ga0495680_0098692 | Ga0495680_0098692_267_1256 | 327 |
| 1081 | 3300047322 | Ga0495680_0215297 | Ga0495680_0215297_320_1309 | 327 |
| 1082 | 3300047444 | Ga0495675_0003024 | Ga0495675_0003024_8204_9193 | 327 |
| 1083 | 3300047444 | Ga0495675_0187204 | Ga0495675_0187204_94_1083 | 327 |
| 1084 | 3300047446 | Ga0495679_031274 | Ga0495679_031274_648_1637 | 327 |
| 1085 | 3300047471 | Ga0495684_0140287 | Ga0495684_0140287_161_1150 | 327 |
| 1086 | 3300047673 | Ga0495593_0020219 | Ga0495593_0020219_904_1893 | 327 |
| 1087 | 3300048088 | Ga0495602_0072323 | Ga0495602_0072323_57_1046 | 327 |
| 1088 | 3300048088 | Ga0495602_0082044 | Ga0495602_0082044_32_1021 | 327 |
| 1089 | 3300048091 | Ga0495626_0022127 | Ga0495626_0022127_820_1872 | 327 |
| 1090 | 3300048903 | Ga0496100_0013729 | Ga0496100_0013729_688_1677 | 327 |
| 1091 | 3300048904 | Ga0496101_0026703 | Ga0496101_0026703_1980_2969 | 327 |
| 1092 | 3300048905 | Ga0496102_0044345 | Ga0496102_0044345_2208_3212 | 327 |
| 1093 | 3300048905 | Ga0496102_0075742 | Ga0496102_0075742_803_1792 | 327 |
| 1094 | 3300048906 | Ga0496103_0053490 | Ga0496103_0053490_1118_2107 | 327 |
| 1095 | 3300048907 | Ga0496104_0000079 | Ga0496104_0000079_39047_40036 | 327 |
| 1096 | 3300048907 | Ga0496104_0000905 | Ga0496104_0000905_8655_9662 | 327 |
| 1097 | 3300048907 | Ga0496104_0023005 | Ga0496104_0023005_3631_4620 | 327 |
| 1098 | 3300048907 | Ga0496104_0025752 | Ga0496104_0025752_1930_2919 | 327 |
| 1099 | 3300048907 | Ga0496104_0077766 | Ga0496104_0077766_545_1534 | 327 |
| 1100 | 3300048907 | Ga0496104_0242297 | Ga0496104_0242297_686_1675 | 327 |
| 1101 | 3300048908 | Ga0496105_0000225 | Ga0496105_0000225_34318_35307 | 327 |
| 1102 | 3300048908 | Ga0496105_0001448 | Ga0496105_0001448_9183_10172 | 327 |
| 1103 | 3300048908 | Ga0496105_0042175 | Ga0496105_0042175_2386_3375 | 327 |
| 1104 | 3300048908 | Ga0496105_0159666 | Ga0496105_0159666_399_1388 | 327 |
| 1105 | 3300048909 | Ga0496106_0067750 | Ga0496106_0067750_696_1685 | 327 |
| 1106 | 3300048909 | Ga0496106_0122005 | Ga0496106_0122005_366_1370 | 327 |
| 1107 | 3300048910 | Ga0496107_0015114 | Ga0496107_0015114_1616_2605 | 327 |
| 1108 | 3300048911 | Ga0496108_0047868 | Ga0496108_0047868_2349_3338 | 327 |
| 1109 | 3300048912 | Ga0496109_0010418 | Ga0496109_0010418_2352_3341 | 327 |
| 1110 | 3300048912 | Ga0496109_0151178 | Ga0496109_0151178_553_1542 | 327 |
| 1111 | 3300048913 | Ga0496110_0100491 | Ga0496110_0100491_643_1647 | 327 |
| 1112 | 3300048913 | Ga0496110_0375520 | Ga0496110_0375520_275_1264 | 327 |
| 1113 | 3300048914 | Ga0496111_0007782 | Ga0496111_0007782_2382_3371 | 327 |
| 1114 | 3300048915 | Ga0496112_0003843 | Ga0496112_0003843_2522_3511 | 327 |
| 1115 | 3300048915 | Ga0496112_0102249 | Ga0496112_0102249_1493_2482 | 327 |
| 1116 | 3300048915 | Ga0496112_0149775 | Ga0496112_0149775_184_1173 | 327 |
| 1117 | 3300048916 | Ga0496113_0108825 | Ga0496113_0108825_713_1702 | 327 |
| 1118 | 3300048916 | Ga0496113_0192885 | Ga0496113_0192885_609_1598 | 327 |
| 1119 | 3300048916 | Ga0496113_0264016 | Ga0496113_0264016_34_1023 | 327 |
| 1120 | 3300048917 | Ga0496114_0002900 | Ga0496114_0002900_3559_4548 | 327 |
| 1121 | 3300048917 | Ga0496114_0026644 | Ga0496114_0026644_2185_3174 | 327 |
| 1122 | 3300048918 | Ga0496115_0008715 | Ga0496115_0008715_5246_6235 | 327 |
| 1123 | 3300048918 | Ga0496115_0021185 | Ga0496115_0021185_1673_2662 | 327 |
| 1124 | 3300048918 | Ga0496115_0048443 | Ga0496115_0048443_1155_2174 | 327 |
| 1125 | 3300049568 | Ga0501031_0000643 | Ga0501031_0000643_2288_3292 | 327 |
| 1126 | 3300049570 | Ga0501033_0077981 | Ga0501033_0077981_977_1984 | 327 |
| 1127 | 3300049571 | Ga0501034_0149849 | Ga0501034_0149849_202_1191 | 327 |
| 1128 | 3300049572 | Ga0501036_0073557 | Ga0501036_0073557_1215_2219 | 327 |
| 1129 | 3300049573 | Ga0501037_0082587 | Ga0501037_0082587_473_1477 | 327 |
| 1130 | 3300049573 | Ga0501037_0122063 | Ga0501037_0122063_67_1059 | 327 |
| 1131 | 3300049574 | Ga0501038_0004733 | Ga0501038_0004733_86_1090 | 327 |
| 1132 | 3300049575 | Ga0501039_0004579 | Ga0501039_0004579_8507_9511 | 327 |
| 1133 | 3300049576 | Ga0501040_0000761 | Ga0501040_0000761_4195_5199 | 327 |
| 1134 | 3300049577 | Ga0501041_0005396 | Ga0501041_0005396_105_1109 | 327 |
| 1135 | 3300049578 | Ga0501042_0003840 | Ga0501042_0003840_994_1998 | 327 |
| 1136 | 3300049580 | Ga0501046_0002981 | Ga0501046_0002981_12479_13483 | 327 |
| 1137 | 3300049582 | Ga0501048_0003011 | Ga0501048_0003011_10538_11542 | 327 |
| 1138 | 3300049584 | Ga0501068_0033037 | Ga0501068_0033037_1590_2594 | 327 |
| 1139 | 3300049587 | Ga0501071_0000078 | Ga0501071_0000078_6260_7264 | 327 |
| 1140 | 3300049588 | Ga0501072_0013652 | Ga0501072_0013652_106_1110 | 327 |
| 1141 | 3300049588 | Ga0501072_0134688 | Ga0501072_0134688_785_1819 | 327 |
| 1142 | 3300049589 | Ga0501073_0072835 | Ga0501073_0072835_427_1428 | 327 |
| 1143 | 3300049590 | Ga0501074_0032389 | Ga0501074_0032389_2251_3255 | 327 |
| 1144 | 3300049590 | Ga0501074_0336853 | Ga0501074_0336853_61_1050 | 327 |
| 1145 | 3300049591 | Ga0501075_0002758 | Ga0501075_0002758_680_1684 | 327 |
| 1146 | 3300049592 | Ga0501076_0002404 | Ga0501076_0002404_9458_10462 | 327 |
| 1147 | 3300049593 | Ga0501077_0002379 | Ga0501077_0002379_3686_4690 | 327 |
| 1148 | 3300049741 | Ga0501079_0000213 | Ga0501079_0000213_5110_6114 | 327 |
| 1149 | 3300049742 | Ga0501080_0001183 | Ga0501080_0001183_8210_9214 | 327 |
| 1150 | 3300049742 | Ga0501080_0013912 | Ga0501080_0013912_6120_7130 | 327 |
| 1151 | 3300049743 | Ga0501081_0006277 | Ga0501081_0006277_5913_6917 | 327 |
| 1152 | 3300049744 | Ga0501083_0005926 | Ga0501083_0005926_5514_6518 | 327 |
| 1153 | 3300049822 | Ga0501035_0108543 | Ga0501035_0108543_554_1558 | 327 |
| 1154 | 3300049822 | Ga0501035_0209166 | Ga0501035_0209166_464_1459 | 327 |
| 1155 | 3300049823 | Ga0501044_0064866 | Ga0501044_0064866_1189_2181 | 327 |
| 1156 | 3300049823 | Ga0501044_0101084 | Ga0501044_0101084_914_1921 | 327 |
| 1157 | 3300049824 | Ga0501045_0001082 | Ga0501045_0001082_6585_7589 | 327 |
| 1158 | 3300050491 | nmdc:mga00v17_99901_c1 | nmdc:mga00v17_99901_c1_756_1814 | 327 |
| 1159 | 3300050507 | nmdc:mga05p37_32_c1 | nmdc:mga05p37_32_c1_3538_4536 | 327 |
| 1160 | 3300050507 | nmdc:mga05p37_35373_c1 | nmdc:mga05p37_35373_c1_1998_2987 | 327 |
| 1161 | 3300050508 | nmdc:mga09592_7970_c1 | nmdc:mga09592_7970_c1_93_1091 | 327 |
| 1162 | 3300050509 | nmdc:mga0qj67_1240_c1 | nmdc:mga0qj67_1240_c1_2774_3772 | 327 |
| 1163 | 3300050509 | nmdc:mga0qj67_214126_c1 | nmdc:mga0qj67_214126_c1_114_1151 | 327 |
| 1164 | 3300050510 | nmdc:mga06r32_1670_c1 | nmdc:mga06r32_1670_c1_7518_8516 | 327 |
| 1165 | 3300050511 | nmdc:mga08y16_66352_c1 | nmdc:mga08y16_66352_c1_1917_2906 | 327 |
| 1166 | 3300050511 | nmdc:mga08y16_6877_c1 | nmdc:mga08y16_6877_c1_1528_2517 | 327 |
| 1167 | 3300050511 | nmdc:mga08y16_997_c1 | nmdc:mga08y16_997_c1_23805_24803 | 327 |
| 1168 | 3300050512 | nmdc:mga0n895_184916_c1 | nmdc:mga0n895_184916_c1_522_1511 | 327 |
| 1169 | 3300050512 | nmdc:mga0n895_60104_c1 | nmdc:mga0n895_60104_c1_2004_3002 | 327 |
| 1170 | 3300050514 | nmdc:mga08x19_91457_c1 | nmdc:mga08x19_91457_c1_245_1234 | 327 |
| 1171 | 3300050515 | nmdc:mga0a205_1694_c1 | nmdc:mga0a205_1694_c1_4989_5987 | 327 |
| 1172 | 3300050515 | nmdc:mga0a205_374115_c1 | nmdc:mga0a205_374115_c1_119_1108 | 327 |
| 1173 | 3300050515 | nmdc:mga0a205_43990_c1 | nmdc:mga0a205_43990_c1_1462_2451 | 327 |
| 1174 | 3300053077 | Ga0495601_0000334 | Ga0495601_0000334_2715_3719 | 327 |
| 1175 | 3300053077 | Ga0495601_0002590 | Ga0495601_0002590_5191_6180 | 327 |
| 1176 | 3300053077 | Ga0495601_0210986 | Ga0495601_0210986_237_1226 | 327 |
| 1177 | 3300053084 | Ga0495595_0001716 | Ga0495595_0001716_2336_3325 | 327 |
| 1178 | 3300053084 | Ga0495595_0006503 | Ga0495595_0006503_2863_3852 | 327 |
| 1179 | 3300053084 | Ga0495595_0021468 | Ga0495595_0021468_790_1794 | 327 |
| 1180 | 3300053085 | Ga0495619_0000016 | Ga0495619_0000016_51263_52252 | 327 |
| 1181 | 3300053085 | Ga0495619_0000384 | Ga0495619_0000384_23827_24816 | 327 |
| 1182 | 3300053085 | Ga0495619_0018412 | Ga0495619_0018412_2348_3337 | 327 |
| 1183 | 3300053085 | Ga0495619_0047152 | Ga0495619_0047152_1118_2107 | 327 |
| 1184 | 3300054114 | Ga0501084_0000457 | Ga0501084_0000457_25677_26681 | 327 |
| 1185 | 3300060353 | Ga0501082_0013927 | Ga0501082_0013927_5402_6406 | 327 |
| 1186 | 3300061734 | Ga0530510_0011122 | Ga0530510_0011122_1887_2891 | 327 |
| 1187 | 2209111006 | 2214544943 | 2213593703 | 330 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7lb8-assembly1.cif.gz_B | structure of a ferrichrome importer fhucdb from e. coli | 0.4794 | 41 | 307 |
| 5b57-assembly1.cif.gz_A | inward-facing conformation of abc heme importer bhuuv from burkholderia cenocepacia | 0.4606 | 41 | 288 |
| 2nq2-assembly1.cif.gz_B | an inward-facing conformation of a putative metal-chelate type abc transporter. | 0.4458 | 10 | 292 |
| 2nq2-assembly1.cif.gz_A | an inward-facing conformation of a putative metal-chelate type abc transporter. | 0.4377 | 36 | 284 |
| 2nq2-assembly1.cif.gz_B | an inward-facing conformation of a putative metal-chelate type abc transporter. | 0.4241 | 10 | 292 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0AEX7_11_292_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.7632 | 42 | 305 | 1.10.3470.10 |
| af_Q58666_4_320_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.74 | 44 | 306 | 1.10.3470.10 |
| af_Q58665_14_295_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.7389 | 42 | 305 | 1.10.3470.10 |
| af_P0AEX7_11_292_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.7169 | 42 | 305 | 1.10.3470.10 |
| af_Q58665_14_295_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.6937 | 42 | 305 | 1.10.3470.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A536T171-F1-model_v4 | Branched-chain amino acid ABC transporter permease | 0.9107 | 19 | 280 |
GO:0005886
GO:0015658 |
| AF-W3RJ89-F1-model_v4 | ABC transporter permease | 0.9063 | 10 | 326 |
GO:0005886
GO:0015658 |
| AF-A0A4R5UBA5-F1-model_v4 | Branched-chain amino acid ABC transporter permease | 0.9021 | 10 | 319 |
GO:0005886
GO:0015658 |
| AF-A0A1H4HMZ3-F1-model_v4 | Amino acid/amide ABC transporter membrane protein 2, HAAT family | 0.9013 | 38 | 322 |
GO:0005886
GO:0015658 |
| AF-A0A2M6VMG7-F1-model_v4 | Branched-chain amino acid ABC transporter permease | 0.9011 | 24 | 324 |
GO:0005886
GO:0015658 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar