F491399

General Info

Members Datasets Scaffolds Average Seq Length
1187 472 1185 329

Family's Representative Sequence

Representative Sequence 3300005937|Ga0081455_10007107|Ga0081455_100071078
Length 360
Sequence VGIQSPHFSFGELLPWIPAFAGMSEKVPAMSVASRSAAMTPQGYLQAQSRWHPLEIAFWLATLLPFVLFPNYLSLASQIAITALFALSLDIILGYAGVVSLGHAAFFGIGAYSAGLLAKHGWGEPLTGLVAATAIAGLVGFAVSFMIARFRHFTLIMITLGLGLLAFEAANRAHWLTGGSDGLQGVSMWPVLGLFKFDLYGYTAYTYSLVVLFLVFLGARRLINSPFGLALRGIRENWVRMPAIGADSLAHIRKAYTIAAAMAGLAGALLTQTTESVSLESISFQRSADVLVMLVLGGAGRLYGGLIGAIIFMVARDQFSGIAPQYWYFWIGVLLVAVVMVLPNGILGGLSHFYARWRGK

Samples

Sample ID Description Type Environment
1 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
2 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
3 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
4 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
5 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
6 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
7 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
8 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
9 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
10 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
11 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
12 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
13 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
14 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
15 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
16 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
17 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
18 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
19 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
20 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
21 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
22 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
23 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
24 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
25 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
26 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
27 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
28 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
29 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
30 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
31 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
32 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
33 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
34 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
35 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
36 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
37 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
38 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
39 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
40 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
41 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
42 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
43 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
44 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
45 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
46 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
47 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
48 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
49 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
50 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
51 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
52 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
53 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
54 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
55 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
56 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
57 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
58 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
59 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
60 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
61 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
62 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
63 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
64 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
65 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
66 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
67 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
68 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
69 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
70 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
71 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
72 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
73 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
74 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
75 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
76 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
77 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
78 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
79 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
80 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
81 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
82 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
83 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
84 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
85 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
86 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
87 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
88 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
89 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
90 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
91 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
92 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
93 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
94 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
95 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
96 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
97 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
98 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
99 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
100 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
101 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
102 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
103 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
104 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
105 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
106 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
107 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
108 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
109 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
110 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
111 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
112 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
113 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
114 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
115 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
116 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
117 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
118 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
119 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
120 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
121 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
122 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
123 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
124 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
125 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
126 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
127 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
128 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
129 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
130 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
131 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
132 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
133 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
134 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
135 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
136 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
137 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
138 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
139 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
140 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
141 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
142 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
143 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
144 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
145 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
146 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
147 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
148 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
149 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
150 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
151 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
152 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
153 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
154 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
155 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
156 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
157 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
159 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
160 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
161 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
225 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
226 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
227 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
228 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
229 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
230 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
234 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
235 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
236 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
237 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
238 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
239 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
240 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
241 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
242 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
243 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
244 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
245 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
246 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
247 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
248 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
249 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
250 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
251 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
252 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
253 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
254 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
255 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
256 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
257 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
258 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
259 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
260 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
261 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
262 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
263 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
264 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
265 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
266 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
267 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
268 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
269 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
270 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
271 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
272 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
273 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
274 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
275 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
276 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
277 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
278 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
279 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
280 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
281 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
282 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
283 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
284 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
285 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
286 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
287 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
288 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
289 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
290 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
291 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
292 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
293 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
294 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
295 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
296 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
297 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
298 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
299 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
300 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
301 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
302 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
303 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
304 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
305 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
306 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
307 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
308 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
309 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
310 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
311 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
312 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
313 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
314 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
315 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
316 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
317 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
318 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
319 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
320 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
321 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
322 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
323 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
324 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
325 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
326 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
327 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
328 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
329 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
330 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
331 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
332 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
333 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
334 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
335 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
336 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
337 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
338 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
339 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
340 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
341 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
342 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
343 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
344 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
345 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
346 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
347 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
348 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
349 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
350 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
351 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
352 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
353 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
354 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
355 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
356 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
357 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
358 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
359 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
360 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
361 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
362 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
363 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
364 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
365 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
366 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
367 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
368 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
369 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
370 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
371 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
372 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
373 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
374 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
375 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
376 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
377 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
378 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
379 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
380 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
381 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
382 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
383 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
384 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
385 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
386 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
387 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
388 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
389 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
390 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
391 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
392 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
393 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
394 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
395 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
396 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
397 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
398 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
399 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
400 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
401 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
402 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
403 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
404 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
405 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
406 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
407 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
408 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
409 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
410 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
411 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
412 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
413 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
414 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
415 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
416 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
417 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
418 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
419 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
420 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
421 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
422 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
423 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
424 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
425 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
426 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
427 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
428 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
429 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
430 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
431 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
432 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
433 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
434 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
435 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
436 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
437 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
438 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
439 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
440 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
441 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
442 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
443 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
444 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
445 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
446 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
447 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
448 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
449 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
450 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
451 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
452 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
453 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
454 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
455 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
456 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
457 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
458 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
459 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
460 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
461 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
462 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
463 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
464 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
465 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
466 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
467 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
468 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
469 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
470 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
471 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
472 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.66
Metatranscriptomes 0.17
Isolates 0.17

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.11
Nodule 0
Rhizoplane 7.25
Rhizosphere 89.55
Stem 0
Stem Tuber 0
Unclassified 1.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 2214544943 2209111006 Bacteria 6169
2 ARcpr5oldR_c000022 3300000041 Bacteria 31880
3 ARSoilYngRDRAFT_c00124 3300000042 Bacteria 13179
4 ARcpr5yngRDRAFT_c000127 3300000043 Bacteria 11898
5 ARSoilOldRDRAFT_c000182 3300000044 Bacteria 10255
6 ARCol0oldRDRAFT_c00133 3300000045 Bacteria 6647
7 ARCol0yngRDRAFT_1000244 3300000652 Bacteria 8794
8 JGI24752J21851_1003015 3300001976 Bacteria 2233
9 JGI24739J22299_10001439 3300001989 Bacteria 8974
10 JGI24737J22298_10003452 3300001990 Bacteria 5585
11 JGI24737J22298_10006660 3300001990 Bacteria 3933
12 JGI24750J21931_1000236 3300002070 Bacteria 9434
13 JGI24745J21846_1000672 3300002073 Bacteria 3087
14 JGI24748J21848_1000246 3300002074 Bacteria 6419
15 JGI24738J21930_10000321 3300002075 Bacteria 13225
16 JGI24749J21850_1001668 3300002076 Bacteria 3149
17 JGI24742J22300_10003211 3300002244 Bacteria 2646
18 JGI25153J46596_10003330 3300003215 Bacteria 9029
19 Ga0065712_10014721 3300005290 Bacteria 1944
20 Ga0065712_10073486 3300005290 Bacteria 4375
21 Ga0065715_10110340 3300005293 Bacteria 2617
22 Ga0065707_10115366 3300005295 Bacteria 2269
23 Ga0070676_10014872 3300005328 Bacteria 4282
24 Ga0070676_10017202 3300005328 Bacteria 4001
25 Ga0070683_100015103 3300005329 Bacteria 6777
26 Ga0070690_100009004 3300005330 Bacteria 5771
27 Ga0070690_100015717 3300005330 Bacteria 4521
28 Ga0070690_100083018 3300005330 Bacteria 2099
29 Ga0070690_100289108 3300005330 Bacteria 1172
30 Ga0070670_100002552 3300005331 Bacteria 15030
31 Ga0070670_100392200 3300005331 Bacteria 1224
32 Ga0070677_10000229 3300005333 Bacteria 19338
33 Ga0070677_10010167 3300005333 Bacteria 3211
34 Ga0068869_100000813 3300005334 Bacteria 17841
35 Ga0068869_100046245 3300005334 Bacteria 3137
36 Ga0068869_100084615 3300005334 Bacteria 2374
37 Ga0068869_100287558 3300005334 Bacteria 1324
38 Ga0070666_10006602 3300005335 Bacteria 7132
39 Ga0070666_10016756 3300005335 Bacteria 4691
40 Ga0070666_10017385 3300005335 Bacteria 4611
41 Ga0070666_10062024 3300005335 Bacteria 2532
42 Ga0070680_100016299 3300005336 Bacteria 5846
43 Ga0070680_100031606 3300005336 Bacteria 4257
44 Ga0070680_100033258 3300005336 Bacteria 4154
45 Ga0070680_100146404 3300005336 Bacteria 1982
46 Ga0070682_100001697 3300005337 Bacteria 12242
47 Ga0070682_100006283 3300005337 Bacteria 6663
48 Ga0070682_100128359 3300005337 Bacteria 1712
49 Ga0068868_100097555 3300005338 Bacteria 2375
50 Ga0068868_100119733 3300005338 Bacteria 2146
51 Ga0070660_100003220 3300005339 Bacteria 11218
52 Ga0070660_100092905 3300005339 Bacteria 2382
53 Ga0070660_100321427 3300005339 Bacteria 1271
54 Ga0070660_100334729 3300005339 Bacteria 1245
55 Ga0070689_100001674 3300005340 Bacteria 14154
56 Ga0070689_100132728 3300005340 Bacteria 1997
57 Ga0070691_10012615 3300005341 Bacteria 3870
58 Ga0070687_100000287 3300005343 Bacteria 17083
59 Ga0070661_100001342 3300005344 Bacteria 17213
60 Ga0070661_100057287 3300005344 Bacteria 2856
61 Ga0070661_100059600 3300005344 Bacteria 2800
62 Ga0070692_10031678 3300005345 Bacteria 2652
63 Ga0070668_100002613 3300005347 Bacteria 13234
64 Ga0070668_100148599 3300005347 Bacteria 1893
65 Ga0070669_100009501 3300005353 Bacteria 6927
66 Ga0070669_100038922 3300005353 Bacteria 3453
67 Ga0070669_100088541 3300005353 Bacteria 2317
68 Ga0070669_100103055 3300005353 Bacteria 2155
69 Ga0070675_100011412 3300005354 Bacteria 6953
70 Ga0070675_100030373 3300005354 Bacteria 4363
71 Ga0070675_100049682 3300005354 Bacteria 3443
72 Ga0070671_100001574 3300005355 Bacteria 17176
73 Ga0070671_100009073 3300005355 Bacteria 7981
74 Ga0070671_100070337 3300005355 Bacteria 2919
75 Ga0070674_100006844 3300005356 Bacteria 6684
76 Ga0070674_100016960 3300005356 Bacteria 4571
77 Ga0070674_100210849 3300005356 Bacteria 1505
78 Ga0070673_100002949 3300005364 Bacteria 10488
79 Ga0070673_100327494 3300005364 Bacteria 1354
80 Ga0070688_100038858 3300005365 Bacteria 2909
81 Ga0070688_100097177 3300005365 Bacteria 1935
82 Ga0070659_100001372 3300005366 Bacteria 17532
83 Ga0070659_100172661 3300005366 Bacteria 1771
84 Ga0070667_100004661 3300005367 Bacteria 11506
85 Ga0070667_100009580 3300005367 Bacteria 8031
86 Ga0070667_100557304 3300005367 Bacteria 1054
87 Ga0070703_10006082 3300005406 Bacteria 3379
88 Ga0070703_10028431 3300005406 Bacteria 1671
89 Ga0070709_10001382 3300005434 Bacteria 13210
90 Ga0070709_10029146 3300005434 Bacteria 3298
91 Ga0070709_10082042 3300005434 Bacteria 2106
92 Ga0070714_100003309 3300005435 Bacteria 12019
93 Ga0070714_100013144 3300005435 Bacteria 6628
94 Ga0070714_100091829 3300005435 Bacteria 2660
95 Ga0070714_100150094 3300005435 Bacteria 2099
96 Ga0070713_100003127 3300005436 Bacteria 10895
97 Ga0070713_100006430 3300005436 Bacteria 8146
98 Ga0070710_10010291 3300005437 Bacteria 4593
99 Ga0070710_10023419 3300005437 Bacteria 3246
100 Ga0070710_10041225 3300005437 Bacteria 2548
101 Ga0070710_10060527 3300005437 Bacteria 2154
102 Ga0070701_10012182 3300005438 Bacteria 3870
103 Ga0070701_10020616 3300005438 Bacteria 3133
104 Ga0070711_100038864 3300005439 Bacteria 3202
105 Ga0070711_100093216 3300005439 Bacteria 2174
106 Ga0070711_100102484 3300005439 Bacteria 2085
107 Ga0070711_100206981 3300005439 Bacteria 1517
108 Ga0070705_100004113 3300005440 Bacteria 7107
109 Ga0070700_100008630 3300005441 Bacteria 5554
110 Ga0070700_100237365 3300005441 Bacteria 1301
111 Ga0070694_100055279 3300005444 Bacteria 2692
112 Ga0070694_100148370 3300005444 Bacteria 1710
113 Ga0070708_100140660 3300005445 Bacteria 2238
114 Ga0070663_100012485 3300005455 Bacteria 5375
115 Ga0070663_100027620 3300005455 Bacteria 3855
116 Ga0070663_100028209 3300005455 Bacteria 3819
117 Ga0070663_100049988 3300005455 Bacteria 2972
118 Ga0070663_100162645 3300005455 Bacteria 1719
119 Ga0070678_100005790 3300005456 Bacteria 7193
120 Ga0070678_100052827 3300005456 Bacteria 2952
121 Ga0070662_100007259 3300005457 Bacteria 7182
122 Ga0070662_100008362 3300005457 Bacteria 6745
123 Ga0070662_100040719 3300005457 Bacteria 3310
124 Ga0070662_100057910 3300005457 Bacteria 2817
125 Ga0070662_100164305 3300005457 Bacteria 1738
126 Ga0070662_100243235 3300005457 Bacteria 1444
127 Ga0070681_10008531 3300005458 Bacteria 10034
128 Ga0070681_10034265 3300005458 Bacteria 5099
129 Ga0070681_10039942 3300005458 Bacteria 4704
130 Ga0070681_10106963 3300005458 Bacteria 2738
131 Ga0068867_100000628 3300005459 Bacteria 23309
132 Ga0068867_100044629 3300005459 Bacteria 3248
133 Ga0070685_10029919 3300005466 Bacteria 3029
134 Ga0070685_10042444 3300005466 Bacteria 2596
135 Ga0070707_100204783 3300005468 Bacteria 1923
136 Ga0070699_100003093 3300005518 Bacteria 14735
137 Ga0070679_100014494 3300005530 Bacteria 7573
138 Ga0070679_100017445 3300005530 Bacteria 6948
139 Ga0070679_100037757 3300005530 Bacteria 4799
140 Ga0070679_100232897 3300005530 Bacteria 1801
141 Ga0070679_100330528 3300005530 Bacteria 1473
142 Ga0070684_100004311 3300005535 Bacteria 10805
143 Ga0070697_100060873 3300005536 Bacteria 3078
144 Ga0070697_100312320 3300005536 Bacteria 1353
145 Ga0070697_100350061 3300005536 Bacteria 1276
146 Ga0068853_100087460 3300005539 Bacteria 2735
147 Ga0070672_100000991 3300005543 Bacteria 17181
148 Ga0070672_100066373 3300005543 Bacteria 2857
149 Ga0070672_100079454 3300005543 Bacteria 2626
150 Ga0070686_100001041 3300005544 Bacteria 15960
151 Ga0070686_100184039 3300005544 Bacteria 1486
152 Ga0070695_100003393 3300005545 Bacteria 9316
153 Ga0070695_100177787 3300005545 Bacteria 1506
154 Ga0070695_100185533 3300005545 Bacteria 1477
155 Ga0070696_100225652 3300005546 Bacteria 1407
156 Ga0070696_100262306 3300005546 Bacteria 1310
157 Ga0070693_100006238 3300005547 Bacteria 5775
158 Ga0070665_100065244 3300005548 Bacteria 3652
159 Ga0070665_100089591 3300005548 Bacteria 3082
160 Ga0070665_100220572 3300005548 Bacteria 1897
161 Ga0070704_100001471 3300005549 Bacteria 12643
162 Ga0068855_100040118 3300005563 Bacteria 5557
163 Ga0068855_100052442 3300005563 Bacteria 4802
164 Ga0070664_100049659 3300005564 Bacteria 3548
165 Ga0070664_100088982 3300005564 Bacteria 2670
166 Ga0070664_100090632 3300005564 Bacteria 2646
167 Ga0070664_100232450 3300005564 Bacteria 1653
168 Ga0070664_100349043 3300005564 Bacteria 1345
169 Ga0068857_100003798 3300005577 Bacteria 12713
170 Ga0068854_100003622 3300005578 Bacteria 9664
171 Ga0068856_100004576 3300005614 Bacteria 13748
172 Ga0068856_100021694 3300005614 Bacteria 6241
173 Ga0068856_100397280 3300005614 Bacteria 1398
174 Ga0070702_100014828 3300005615 Bacteria 3964
175 Ga0070702_100025792 3300005615 Bacteria 3153
176 Ga0070702_100058381 3300005615 Bacteria 2235
177 Ga0068852_100004573 3300005616 Bacteria 9795
178 Ga0068852_100087545 3300005616 Bacteria 2779
179 Ga0068859_100006571 3300005617 Bacteria 11800
180 Ga0068859_100026815 3300005617 Bacteria 5780
181 Ga0068859_100073377 3300005617 Bacteria 3460
182 Ga0068859_100263538 3300005617 Bacteria 1815
183 Ga0068864_100005577 3300005618 Bacteria 10320
184 Ga0068864_100036637 3300005618 Bacteria 4182
185 Ga0068864_100117170 3300005618 Bacteria 2377
186 Ga0068866_10037168 3300005718 Bacteria 2390
187 Ga0068866_10041065 3300005718 Bacteria 2293
188 Ga0068861_100062966 3300005719 Bacteria 2850
189 Ga0068861_100270621 3300005719 Bacteria 1459
190 Ga0068870_10001295 3300005840 Bacteria 10067
191 Ga0068863_100006108 3300005841 Bacteria 11814
192 Ga0068863_100071965 3300005841 Bacteria 3271
193 Ga0068858_100006462 3300005842 Bacteria 11411
194 Ga0068858_100055331 3300005842 Bacteria 3667
195 Ga0068858_100223543 3300005842 Bacteria 1784
196 Ga0068860_100009949 3300005843 Bacteria 9424
197 Ga0068860_100010732 3300005843 Bacteria 9045
198 Ga0068862_100002184 3300005844 Bacteria 17550
199 Ga0068862_100107984 3300005844 Bacteria 2440
200 Ga0068862_100185952 3300005844 Bacteria 1867
201 Ga0081455_10000209 3300005937 Bacteria 74597
202 Ga0081455_10001640 3300005937 Bacteria 27256
203 Ga0081455_10003885 3300005937 Bacteria 17016
204 Ga0081455_10007107 3300005937 Bacteria 11855
205 Ga0081455_10052830 3300005937 Bacteria 3476
206 Ga0081455_10149165 3300005937 Bacteria 1805
207 Ga0081455_10160779 3300005937 Bacteria 1722
208 Ga0081538_10061674 3300005981 Bacteria 2145
209 Ga0081540_1019759 3300005983 Bacteria 4080
210 Ga0081539_10029790 3300005985 Bacteria 3402
211 Ga0081539_10039242 3300005985 Bacteria 2797
212 Ga0081539_10049773 3300005985 Bacteria 2375
213 Ga0070717_10040382 3300006028 Bacteria 3800
214 Ga0070717_10095309 3300006028 Bacteria 2519
215 Ga0070717_10290733 3300006028 Bacteria 1451
216 Ga0075368_10066955 3300006042 Bacteria 1445
217 Ga0075363_100002037 3300006048 Bacteria 8062
218 Ga0075364_10006763 3300006051 Bacteria 6762
219 Ga0075364_10024740 3300006051 Bacteria 3815
220 Ga0070715_10017578 3300006163 Bacteria 2709
221 Ga0070715_10046818 3300006163 Bacteria 1840
222 Ga0070716_100157913 3300006173 Bacteria 1466
223 Ga0070712_100026284 3300006175 Bacteria 3876
224 Ga0070712_100063268 3300006175 Bacteria 2619
225 Ga0070712_100075359 3300006175 Bacteria 2426
226 Ga0075362_10036152 3300006177 Bacteria 2159
227 Ga0075369_10044119 3300006186 Bacteria 1915
228 Ga0097621_100002538 3300006237 Bacteria 12508
229 Ga0097621_100012683 3300006237 Bacteria 6259
230 Ga0075370_10160632 3300006353 Bacteria 1319
231 Ga0075370_10231347 3300006353 Bacteria 1094
232 Ga0068871_100003984 3300006358 Bacteria 10210
233 Ga0068871_100014697 3300006358 Bacteria 5841
234 Ga0075428_100008075 3300006844 Bacteria 11688
235 Ga0075428_100040633 3300006844 Bacteria 5116
236 Ga0075428_100158465 3300006844 Bacteria 2458
237 Ga0075428_100174930 3300006844 Bacteria 2325
238 Ga0075428_100189560 3300006844 Bacteria 2224
239 Ga0075430_100000304 3300006846 Bacteria 34813
240 Ga0075430_100228067 3300006846 Bacteria 1545
241 Ga0075431_100006534 3300006847 Bacteria 11581
242 Ga0075431_100070583 3300006847 Bacteria 3604
243 Ga0075431_100080913 3300006847 Bacteria 3354
244 Ga0075431_100206396 3300006847 Bacteria 2009
245 Ga0075431_100336755 3300006847 Bacteria 1519
246 Ga0075433_10000958 3300006852 Bacteria 20392
247 Ga0075434_100001677 3300006871 Bacteria 18913
248 Ga0075434_100026434 3300006871 Bacteria 5685
249 Ga0075434_100052639 3300006871 Bacteria 4045
250 Ga0075434_100094886 3300006871 Bacteria 2988
251 Ga0075434_100142354 3300006871 Bacteria 2418
252 Ga0075429_100013390 3300006880 Bacteria 7111
253 Ga0068865_100006167 3300006881 Bacteria 7308
254 Ga0097620_100006571 3300006931 Bacteria 11800
255 Ga0097620_100026813 3300006931 Bacteria 5780
256 Ga0097620_100073377 3300006931 Bacteria 3460
257 Ga0097620_100263548 3300006931 Bacteria 1815
258 Ga0075435_100098556 3300007076 Bacteria 2420
259 Ga0105251_10025235 3300009011 Bacteria 3043
260 Ga0105244_10078598 3300009036 Bacteria 1636
261 Ga0105250_10048962 3300009092 Bacteria 1694
262 Ga0105240_10059489 3300009093 Bacteria 4768
263 Ga0105240_10197688 3300009093 Bacteria 2359
264 Ga0111539_10000138 3300009094 Bacteria 82968
265 Ga0111539_10013242 3300009094 Bacteria 10308
266 Ga0111539_10028897 3300009094 Bacteria 6760
267 Ga0111539_10041591 3300009094 Bacteria 5524
268 Ga0111539_10045686 3300009094 Bacteria 5242
269 Ga0111539_10097609 3300009094 Bacteria 3451
270 Ga0111539_10159158 3300009094 Bacteria 2641
271 Ga0111539_10196236 3300009094 Bacteria 2354
272 Ga0105245_10013826 3300009098 Bacteria 7031
273 Ga0105245_10178764 3300009098 Bacteria 2026
274 Ga0105245_10205176 3300009098 Bacteria 1894
275 Ga0105245_10374113 3300009098 Bacteria 1417
276 Ga0105247_10008270 3300009101 Bacteria 6350
277 Ga0105247_10016996 3300009101 Bacteria 4364
278 Ga0105247_10058153 3300009101 Bacteria 2392
279 Ga0105247_10171123 3300009101 Bacteria 1444
280 Ga0114129_10095344 3300009147 Bacteria 4121
281 Ga0114129_10100655 3300009147 Bacteria 3999
282 Ga0114129_10116952 3300009147 Bacteria 3674
283 Ga0114129_10213207 3300009147 Bacteria 2609
284 Ga0114129_10347780 3300009147 Bacteria 1965
285 Ga0105243_10020347 3300009148 Bacteria 5033
286 Ga0105241_10030482 3300009174 Bacteria 4031
287 Ga0105241_10252399 3300009174 Bacteria 1496
288 Ga0105242_10008746 3300009176 Bacteria 7771
289 Ga0105242_10042237 3300009176 Bacteria 3681
290 Ga0105242_10308819 3300009176 Bacteria 1446
291 Ga0105248_10003287 3300009177 Bacteria 17938
292 Ga0105248_10006183 3300009177 Bacteria 13124
293 Ga0105248_10020983 3300009177 Bacteria 7239
294 Ga0105248_10452980 3300009177 Bacteria 1446
295 Ga0105237_10093716 3300009545 Bacteria 2992
296 Ga0105237_10205699 3300009545 Bacteria 1969
297 Ga0105238_10087006 3300009551 Bacteria 3112
298 Ga0105238_10154016 3300009551 Bacteria 2273
299 Ga0105249_10032452 3300009553 Bacteria 4724
300 Ga0105249_10057226 3300009553 Bacteria 3571
301 Ga0105249_10164553 3300009553 Bacteria 2146
302 Ga0105249_10195887 3300009553 Bacteria 1975
303 Ga0105239_10020880 3300010375 Bacteria 7226
304 Ga0105246_10001801 3300011119 Bacteria 12821
305 Ga0105246_10046723 3300011119 Bacteria 2954
306 Ga0157345_1001131 3300012498 Bacteria 1921
307 Ga0157339_1002850 3300012505 Bacteria 1202
308 Ga0157316_1001901 3300012510 Bacteria 1360
309 Ga0157373_10033846 3300013100 Bacteria 3672
310 Ga0157373_10040198 3300013100 Bacteria 3347
311 Ga0157371_10015753 3300013102 Bacteria 5658
312 Ga0157371_10229260 3300013102 Bacteria 1335
313 Ga0157370_10042057 3300013104 Bacteria 4405
314 Ga0157369_10088552 3300013105 Bacteria 3304
315 Ga0157374_10070918 3300013296 Bacteria 3284
316 Ga0157374_10100128 3300013296 Bacteria 2777
317 Ga0157374_10160667 3300013296 Bacteria 2188
318 Ga0157374_10285228 3300013296 Bacteria 1631
319 Ga0157378_10046130 3300013297 Bacteria 3874
320 Ga0157378_10121402 3300013297 Bacteria 2409
321 Ga0157378_10139422 3300013297 Bacteria 2251
322 Ga0157378_10222958 3300013297 Bacteria 1793
323 Ga0163162_10003576 3300013306 Bacteria 14865
324 Ga0163162_10065114 3300013306 Bacteria 3691
325 Ga0163162_10100584 3300013306 Bacteria 2982
326 Ga0163162_10404595 3300013306 Bacteria 1498
327 Ga0157372_10006003 3300013307 Bacteria 12905
328 Ga0157372_10156057 3300013307 Bacteria 2636
329 Ga0157372_10178558 3300013307 Bacteria 2458
330 Ga0157372_10232613 3300013307 Bacteria 2137
331 Ga0157372_10398222 3300013307 Bacteria 1604
332 Ga0157375_10002114 3300013308 Bacteria 17161
333 Ga0157375_10002488 3300013308 Bacteria 15965
334 Ga0157375_10117399 3300013308 Bacteria 2766
335 Ga0157375_10246725 3300013308 Bacteria 1946
336 Ga0157375_10311881 3300013308 Bacteria 1737
337 Ga0163163_10024233 3300014325 Bacteria 5773
338 Ga0163163_10058909 3300014325 Bacteria 3797
339 Ga0157380_10001040 3300014326 Bacteria 17720
340 Ga0157380_10008840 3300014326 Bacteria 7198
341 Ga0157380_10157758 3300014326 Bacteria 1968
342 Ga0157377_10000448 3300014745 Bacteria 17743
343 Ga0157377_10002924 3300014745 Bacteria 7634
344 Ga0157379_10017754 3300014968 Bacteria 6269
345 Ga0157379_10024836 3300014968 Bacteria 5319
346 Ga0157379_10070713 3300014968 Bacteria 3122
347 Ga0157379_10126245 3300014968 Bacteria 2302
348 Ga0157376_10008924 3300014969 Bacteria 7260
349 Ga0157376_10009420 3300014969 Bacteria 7090
350 Ga0157376_10062958 3300014969 Bacteria 3123
351 Ga0157376_10204644 3300014969 Bacteria 1819
352 Ga0163161_10006692 3300017792 Bacteria 7976
353 Ga0163161_10107885 3300017792 Bacteria 2078
354 Ga0163161_10148822 3300017792 Bacteria 1778
355 Ga0163161_10326392 3300017792 Bacteria 1214
356 Ga0206354_11320193 3300020081 Bacteria 2257
357 Ga0213876_10008996 3300021384 Bacteria 5381
358 Ga0213876_10029221 3300021384 Bacteria 2906
359 Ga0213876_10090496 3300021384 Bacteria 1620
360 Ga0209233_1016691 3300025261 Bacteria 2017
361 Ga0207666_1000094 3300025271 Bacteria 13927
362 Ga0207673_1000042 3300025290 Bacteria 10040
363 Ga0209758_1000158 3300025297 Bacteria 156129
364 Ga0207426_1020337 3300025302 Bacteria 2308
365 Ga0207697_10011526 3300025315 Bacteria 3737
366 Ga0207697_10106732 3300025315 Bacteria 1197
367 Ga0207682_10000360 3300025893 Bacteria 20873
368 Ga0207682_10006222 3300025893 Bacteria 4822
369 Ga0207692_10015830 3300025898 Bacteria 3327
370 Ga0207692_10016295 3300025898 Bacteria 3287
371 Ga0207692_10060212 3300025898 Bacteria 1963
372 Ga0207692_10098876 3300025898 Bacteria 1598
373 Ga0207642_10002194 3300025899 Bacteria 6051
374 Ga0207642_10013792 3300025899 Bacteria 2960
375 Ga0207710_10007821 3300025900 Bacteria 4525
376 Ga0207710_10008348 3300025900 Bacteria 4367
377 Ga0207710_10031004 3300025900 Bacteria 2335
378 Ga0207710_10036632 3300025900 Bacteria 2164
379 Ga0207688_10000024 3300025901 Bacteria 48792
380 Ga0207688_10000262 3300025901 Bacteria 23919
381 Ga0207688_10075463 3300025901 Unclassified 1919
382 Ga0207688_10081666 3300025901 Bacteria 1846
383 Ga0207688_10087598 3300025901 Bacteria 1785
384 Ga0207680_10003320 3300025903 Bacteria 7577
385 Ga0207680_10053610 3300025903 Bacteria 2422
386 Ga0207647_10020019 3300025904 Bacteria 4493
387 Ga0207647_10068896 3300025904 Bacteria 2140
388 Ga0207685_10003863 3300025905 Bacteria 3713
389 Ga0207685_10020245 3300025905 Bacteria 2208
390 Ga0207685_10042113 3300025905 Bacteria 1713
391 Ga0207645_10001827 3300025907 Bacteria 17160
392 Ga0207645_10013182 3300025907 Bacteria 5579
393 Ga0207645_10027609 3300025907 Bacteria 3663
394 Ga0207645_10137723 3300025907 Bacteria 1590
395 Ga0207643_10000035 3300025908 Bacteria 90905
396 Ga0207643_10002713 3300025908 Bacteria 9574
397 Ga0207705_10079496 3300025909 Bacteria 2388
398 Ga0207654_10074341 3300025911 Bacteria 2028
399 Ga0207707_10007090 3300025912 Bacteria 9768
400 Ga0207707_10025302 3300025912 Bacteria 5193
401 Ga0207707_10031302 3300025912 Bacteria 4655
402 Ga0207707_10039822 3300025912 Bacteria 4106
403 Ga0207707_10058970 3300025912 Bacteria 3339
404 Ga0207707_10072826 3300025912 Bacteria 2995
405 Ga0207695_10089660 3300025913 Bacteria 3092
406 Ga0207695_10121584 3300025913 Bacteria 2578
407 Ga0207671_10149440 3300025914 Bacteria 1804
408 Ga0207693_10003819 3300025915 Bacteria 12829
409 Ga0207693_10004725 3300025915 Bacteria 11455
410 Ga0207693_10203121 3300025915 Bacteria 1558
411 Ga0207693_10266677 3300025915 Unclassified 1342
412 Ga0207663_10062209 3300025916 Bacteria 2372
413 Ga0207663_10157689 3300025916 Bacteria 1598
414 Ga0207663_10313092 3300025916 Bacteria 1177
415 Ga0207660_10000104 3300025917 Bacteria 47254
416 Ga0207660_10064971 3300025917 Bacteria 2635
417 Ga0207660_10256357 3300025917 Bacteria 1382
418 Ga0207662_10022714 3300025918 Bacteria 3599
419 Ga0207662_10044859 3300025918 Bacteria 2612
420 Ga0207662_10188611 3300025918 Bacteria 1330
421 Ga0207657_10008208 3300025919 Bacteria 10637
422 Ga0207657_10034331 3300025919 Bacteria 4563
423 Ga0207657_10064983 3300025919 Bacteria 3112
424 Ga0207657_10080606 3300025919 Bacteria 2736
425 Ga0207657_10100631 3300025919 Bacteria 2399
426 Ga0207649_10002932 3300025920 Bacteria 9389
427 Ga0207649_10031396 3300025920 Bacteria 3157
428 Ga0207649_10252061 3300025920 Bacteria 1272
429 Ga0207652_10001464 3300025921 Bacteria 20891
430 Ga0207652_10049899 3300025921 Bacteria 3584
431 Ga0207652_10061488 3300025921 Bacteria 3243
432 Ga0207652_10158295 3300025921 Bacteria 2029
433 Ga0207652_10164786 3300025921 Bacteria 1987
434 Ga0207681_10001121 3300025923 Bacteria 17344
435 Ga0207694_10036921 3300025924 Bacteria 3750
436 Ga0207694_10096619 3300025924 Bacteria 2337
437 Ga0207650_10000743 3300025925 Bacteria 25164
438 Ga0207650_10006629 3300025925 Bacteria 7896
439 Ga0207659_10000899 3300025926 Bacteria 17704
440 Ga0207659_10022466 3300025926 Bacteria 4200
441 Ga0207687_10002095 3300025927 Bacteria 13631
442 Ga0207687_10059806 3300025927 Bacteria 2686
443 Ga0207687_10073745 3300025927 Bacteria 2444
444 Ga0207700_10001350 3300025928 Bacteria 13908
445 Ga0207700_10004335 3300025928 Bacteria 8345
446 Ga0207700_10214051 3300025928 Bacteria 1631
447 Ga0207664_10004320 3300025929 Bacteria 9625
448 Ga0207664_10049839 3300025929 Bacteria 3299
449 Ga0207644_10001933 3300025931 Bacteria 13440
450 Ga0207690_10001009 3300025932 Bacteria 17974
451 Ga0207690_10145160 3300025932 Bacteria 1753
452 Ga0207690_10249889 3300025932 Bacteria 1369
453 Ga0207706_10005187 3300025933 Bacteria 12161
454 Ga0207706_10012802 3300025933 Bacteria 7633
455 Ga0207706_10077468 3300025933 Bacteria 2924
456 Ga0207706_10203277 3300025933 Bacteria 1737
457 Ga0207706_10276072 3300025933 Bacteria 1466
458 Ga0207686_10006384 3300025934 Bacteria 6345
459 Ga0207686_10039418 3300025934 Bacteria 2866
460 Ga0207709_10000575 3300025935 Bacteria 30869
461 Ga0207709_10117034 3300025935 Bacteria 1793
462 Ga0207670_10000182 3300025936 Bacteria 41877
463 Ga0207670_10005380 3300025936 Bacteria 7023
464 Ga0207670_10013702 3300025936 Bacteria 4790
465 Ga0207670_10240532 3300025936 Bacteria 1394
466 Ga0207670_10371119 3300025936 Bacteria 1137
467 Ga0207669_10004684 3300025937 Bacteria 6050
468 Ga0207669_10011106 3300025937 Bacteria 4368
469 Ga0207669_10077664 3300025937 Bacteria 2112
470 Ga0207704_10000642 3300025938 Bacteria 15460
471 Ga0207665_10001219 3300025939 Bacteria 17354
472 Ga0207665_10020078 3300025939 Bacteria 4388
473 Ga0207691_10001015 3300025940 Bacteria 27838
474 Ga0207691_10002681 3300025940 Bacteria 17406
475 Ga0207691_10079326 3300025940 Bacteria 2955
476 Ga0207711_10002482 3300025941 Bacteria 16454
477 Ga0207711_10057458 3300025941 Bacteria 3345
478 Ga0207711_10074015 3300025941 Bacteria 2962
479 Ga0207711_10153970 3300025941 Bacteria 2076
480 Ga0207711_10165963 3300025941 Bacteria 2001
481 Ga0207711_10401790 3300025941 Bacteria 1273
482 Ga0207689_10002374 3300025942 Bacteria 17572
483 Ga0207689_10013837 3300025942 Bacteria 6874
484 Ga0207689_10036395 3300025942 Bacteria 4087
485 Ga0207661_10001332 3300025944 Bacteria 16556
486 Ga0207679_10000035 3300025945 Bacteria 144173
487 Ga0207667_10058946 3300025949 Bacteria 4024
488 Ga0207667_10177458 3300025949 Bacteria 2188
489 Ga0207651_10000180 3300025960 Bacteria 27549
490 Ga0207651_10085264 3300025960 Bacteria 2291
491 Ga0207651_10135299 3300025960 Bacteria 1894
492 Ga0207712_10008108 3300025961 Bacteria 6646
493 Ga0207712_10310602 3300025961 Bacteria 1297
494 Ga0207668_10000149 3300025972 Bacteria 48188
495 Ga0207668_10089867 3300025972 Bacteria 2253
496 Ga0207640_10014682 3300025981 Bacteria 4513
497 Ga0207640_10039474 3300025981 Bacteria 2988
498 Ga0207640_10146369 3300025981 Bacteria 1729
499 Ga0207658_10003553 3300025986 Bacteria 11007
500 Ga0207658_10043386 3300025986 Bacteria 3269
501 Ga0207677_10004580 3300026023 Bacteria 7434
502 Ga0207677_10120803 3300026023 Bacteria 1970
503 Ga0207703_10002471 3300026035 Bacteria 16028
504 Ga0207703_10079135 3300026035 Bacteria 2734
505 Ga0207703_10128856 3300026035 Bacteria 2182
506 Ga0207703_10140304 3300026035 Bacteria 2096
507 Ga0207639_10002906 3300026041 Bacteria 11517
508 Ga0207639_10063477 3300026041 Bacteria 2860
509 Ga0207678_10009048 3300026067 Bacteria 8768
510 Ga0207678_10015567 3300026067 Bacteria 6688
511 Ga0207678_10020228 3300026067 Bacteria 5844
512 Ga0207678_10034290 3300026067 Bacteria 4421
513 Ga0207678_10079722 3300026067 Bacteria 2803
514 Ga0207678_10091621 3300026067 Bacteria 2598
515 Ga0207708_10000358 3300026075 Bacteria 35755
516 Ga0207708_10039584 3300026075 Bacteria 3592
517 Ga0207708_10295341 3300026075 Bacteria 1316
518 Ga0207702_10006764 3300026078 Bacteria 9835
519 Ga0207702_10168387 3300026078 Bacteria 2007
520 Ga0207641_10002628 3300026088 Bacteria 16468
521 Ga0207641_10080365 3300026088 Bacteria 2828
522 Ga0207648_10001075 3300026089 Bacteria 30605
523 Ga0207648_10035823 3300026089 Bacteria 4372
524 Ga0207648_10098034 3300026089 Bacteria 2566
525 Ga0207648_10136005 3300026089 Bacteria 2165
526 Ga0207676_10001216 3300026095 Bacteria 19200
527 Ga0207676_10052251 3300026095 Bacteria 3193
528 Ga0207676_10068056 3300026095 Bacteria 2846
529 Ga0207674_10002767 3300026116 Bacteria 21863
530 Ga0207674_10162393 3300026116 Bacteria 2188
531 Ga0207675_100026983 3300026118 Bacteria 5347
532 Ga0207675_100034640 3300026118 Bacteria 4709
533 Ga0207675_100077875 3300026118 Bacteria 3106
534 Ga0207675_100366112 3300026118 Bacteria 1415
535 Ga0207683_10002564 3300026121 Bacteria 15846
536 Ga0207683_10005615 3300026121 Bacteria 10761
537 Ga0207683_10006130 3300026121 Bacteria 10299
538 Ga0207683_10009850 3300026121 Bacteria 8151
539 Ga0207683_10051838 3300026121 Bacteria 3595
540 Ga0207683_10235638 3300026121 Bacteria 1669
541 Ga0207698_10007529 3300026142 Bacteria 6823
542 Ga0207698_10170021 3300026142 Bacteria 1918
543 Ga0210002_1001374 3300027617 Bacteria 3409
544 Ga0209971_1004676 3300027682 Bacteria 3247
545 Ga0209971_1006118 3300027682 Bacteria 2849
546 Ga0209971_1013547 3300027682 Bacteria 1931
547 Ga0209966_1003962 3300027695 Bacteria 2499
548 Ga0209998_10002490 3300027717 Bacteria 4201
549 Ga0209998_10007384 3300027717 Bacteria 2282
550 Ga0209974_10000880 3300027876 Bacteria 10422
551 Ga0209974_10010975 3300027876 Bacteria 3049
552 Ga0209974_10024633 3300027876 Bacteria 1991
553 Ga0207428_10000075 3300027907 Bacteria 137887
554 Ga0207428_10002495 3300027907 Bacteria 18379
555 Ga0207428_10004858 3300027907 Bacteria 12675
556 Ga0268266_10065473 3300028379 Bacteria 3142
557 Ga0268266_10152012 3300028379 Bacteria 2087
558 Ga0268265_10001891 3300028380 Bacteria 16658
559 Ga0268265_10008056 3300028380 Bacteria 7118
560 Ga0268265_10120219 3300028380 Bacteria 2163
561 Ga0268264_10050126 3300028381 Bacteria 3475
562 Ga0268264_10096411 3300028381 Bacteria 2562
563 Ga0268264_10346131 3300028381 Bacteria 1413
564 Ga0265334_10054621 3300028573 Bacteria 1523
565 Ga0265338_10132968 3300028800 Bacteria 1961
566 Ga0265763_1004377 3300030763 Bacteria 1155
567 Ga0265320_10032363 3300031240 Bacteria 2678
568 Ga0265325_10008594 3300031241 Bacteria 6016
569 Ga0265325_10011730 3300031241 Bacteria 5027
570 Ga0265325_10094433 3300031241 Bacteria 1471
571 Ga0265340_10027878 3300031247 Bacteria 2844
572 Ga0265339_10002967 3300031249 Bacteria 11987
573 Ga0265339_10014744 3300031249 Bacteria 4704
574 Ga0265339_10031835 3300031249 Bacteria 2978
575 Ga0265339_10087310 3300031249 Bacteria 1640
576 Ga0265316_10027004 3300031344 Bacteria 4764
577 Ga0265313_10015070 3300031595 Bacteria 4530
578 Ga0265313_10024495 3300031595 Bacteria 3222
579 Ga0316575_10006778 3300031665 Bacteria 4137
580 Ga0265314_10099824 3300031711 Bacteria 1869
581 Ga0265342_10000510 3300031712 Bacteria 41579
582 Ga0265342_10017708 3300031712 Bacteria 4627
583 Ga0265342_10069525 3300031712 Bacteria 2055
584 Ga0307413_10379883 3300031824 Bacteria 1100
585 Ga0307406_10113666 3300031901 Bacteria 1869
586 Ga0307409_100416364 3300031995 Bacteria 1288
587 Ga0316583_10000603 3300032133 Bacteria 10926
588 Ga0373930_0000182 3300034816 Bacteria 7519
589 Ga0373948_0000591 3300034817 Bacteria 4645
590 Ga0373959_0001645 3300034820 Bacteria 3554
591 Ga0373938_0000151 3300034957 Bacteria 10052
592 Ga0373926_0092652 3300035083 Unclassified 1124
593 Ga0373928_0007047 3300035084 Bacteria 2167
594 Ga0373929_0001158 3300035085 Bacteria 5102
595 Ga0373940_0000142 3300035088 Bacteria 9220
596 Ga0373940_0030186 3300035088 Bacteria 1441
597 Ga0373944_0016090 3300035089 Bacteria 2104
598 Ga0373949_0001994 3300035090 Bacteria 5457
599 Ga0373949_0003060 3300035090 Bacteria 4091
600 Ga0373949_0003729 3300035090 Bacteria 3560
601 Ga0373949_0014713 3300035090 Bacteria 1744
602 Ga0373951_0001484 3300035091 Bacteria 6116
603 Ga0373952_0010722 3300035092 Bacteria 1776
604 Ga0373952_0016091 3300035092 Bacteria 1516
605 Ga0373923_0013137 3300035111 Bacteria 3079
606 Ga0373932_0000611 3300035112 Bacteria 10816
607 Ga0373932_0003639 3300035112 Bacteria 3684
608 Ga0373939_0001079 3300035114 Bacteria 6712
609 Ga0373939_0002011 3300035114 Bacteria 4855
610 Ga0373941_0001642 3300035115 Bacteria 4770
611 Ga0373941_0002631 3300035115 Bacteria 3978
612 Ga0373945_0007601 3300035116 Bacteria 3514
613 Ga0373953_0040545 3300035117 Bacteria 1850
614 Ga0373954_0009184 3300035118 Bacteria 4349
615 Ga0373956_0005298 3300035119 Bacteria 5164
616 Ga0373956_0014565 3300035119 Bacteria 3288
617 Ga0373956_0014993 3300035119 Bacteria 3242
618 Ga0373957_0036910 3300035120 Bacteria 1823
619 Ga0373957_0062008 3300035120 Bacteria 1450
620 Ga0373960_0004279 3300035121 Bacteria 3261
621 Ga0373960_0020112 3300035121 Bacteria 1762
622 Ga0373960_0030235 3300035121 Bacteria 1507
623 Ga0373943_0003515 3300035170 Bacteria 7140
624 Ga0373943_0037169 3300035170 Bacteria 2336
625 Ga0373943_0201897 3300035170 Bacteria 1101
626 Ga0373946_0133444 3300035171 Bacteria 1144
627 Ga0373955_0012410 3300035172 Bacteria 4095
628 Ga0373955_0017584 3300035172 Bacteria 3541
629 Ga0373942_0001627 3300035207 Bacteria 5728
630 Ga0373961_0008943 3300035241 Bacteria 2443
631 Ga0373961_0018987 3300035241 Bacteria 1801
632 Ga0373961_0035394 3300035241 Bacteria 1417
633 Ga0373931_0004505 3300035691 Bacteria 6370
634 Ga0373931_0009578 3300035691 Bacteria 4634
635 Ga0373935_0004817 3300035692 Bacteria 7935
636 Ga0373935_0197096 3300035692 Bacteria 1390
637 Ga0373927_0105788 3300035695 Bacteria 1832
638 Ga0373933_0008478 3300035724 Bacteria 5608
639 Ga0373933_0098430 3300035724 Bacteria 1812
640 Ga0373933_0201583 3300035724 Bacteria 1273
641 Ga0373947_0005443 3300035725 Bacteria 7428
642 Ga0373947_0029566 3300035725 Bacteria 3215
643 Ga0373937_0023033 3300036401 Bacteria 5602
644 Ga0373937_0053125 3300036401 Bacteria 3716
645 Ga0373937_0357967 3300036401 Bacteria 1383
646 Ga0373937_0528808 3300036401 Bacteria 1120
647 Ga0373925_0005226 3300037068 Bacteria 9706
648 Ga0373925_0070249 3300037068 Bacteria 2646
649 Ga0373925_0111196 3300037068 Bacteria 2116
650 Ga0395899_0003128 3300037312 Bacteria 13176
651 Ga0395899_0031176 3300037312 Bacteria 4007
652 Ga0395900_0015232 3300037418 Bacteria 7841
653 Ga0395900_0120177 3300037418 Bacteria 2696
654 Ga0395900_0187776 3300037418 Bacteria 2097
655 Ga0395898_0052801 3300037466 Bacteria 3971
656 Ga0395898_0080033 3300037466 Bacteria 3151
657 Ga0395898_0105504 3300037466 Bacteria 2702
658 Ga0395905_0011373 3300037471 Bacteria 8604
659 Ga0395905_0161254 3300037471 Bacteria 2107
660 Ga0395905_0437463 3300037471 Bacteria 1205
661 Ga0436364_0609713 3300037853 Bacteria 1494
662 Ga0395901_0081984 3300038443 Bacteria 3369
663 Ga0395901_0112885 3300038443 Bacteria 2854
664 Ga0436365_0534746 3300039437 Bacteria 6587
665 Ga0436365_0932459 3300039437 Bacteria 27077
666 Ga0436365_1516841 3300039437 Bacteria 1832
667 Ga0436360_0635187 3300039438 Bacteria 1104
668 Ga0436360_0728136 3300039438 Bacteria 1779
669 Ga0436360_1357448 3300039438 Bacteria 1596
670 Ga0436361_0726405 3300039447 Bacteria 14368
671 Ga0436363_0810999 3300039450 Bacteria 2117
672 Ga0451853_0997884 3300041512 Bacteria 2031
673 Ga0439455_0008055 3300042012 Bacteria 2249
674 Ga0453683_0162827 3300044673 Bacteria 1412
675 Ga0466965_0008580 3300044683 Bacteria 4729
676 Ga0466966_0015172 3300044684 Bacteria 5097
677 Ga0466966_0028792 3300044684 Bacteria 3616
678 Ga0466966_0059790 3300044684 Bacteria 2406
679 Ga0466961_0020886 3300044693 Bacteria 4213
680 Ga0466963_0000255 3300044694 Bacteria 23380
681 Ga0466963_0017165 3300044694 Bacteria 4508
682 Ga0466963_0114234 3300044694 Bacteria 1855
683 Ga0466963_0190919 3300044694 Bacteria 1431
684 Ga0466963_0206837 3300044694 Bacteria 1373
685 Ga0466963_0241059 3300044694 Bacteria 1268
686 Ga0466971_0021322 3300044719 Bacteria 2884
687 Ga0466957_0003978 3300044842 Bacteria 8171
688 Ga0466957_0021505 3300044842 Bacteria 3802
689 Ga0466960_0161758 3300044901 Bacteria 1202
690 Ga0466959_0064395 3300045049 Bacteria 2661
691 Ga0466958_0026431 3300045836 Bacteria 3430
692 Ga0466958_0124893 3300045836 Bacteria 1613
693 Ga0466958_0133022 3300045836 Bacteria 1563
694 Ga0466967_0002672 3300045976 Bacteria 11251
695 Ga0466967_0060796 3300045976 Bacteria 3350
696 Ga0466967_0212576 3300045976 Bacteria 1835
697 Ga0495592_0053098 3300046454 Bacteria 3006
698 Ga0495603_0000816 3300046455 Bacteria 17875
699 Ga0495603_0052530 3300046455 Bacteria 2419
700 Ga0495590_0000013 3300046457 Bacteria 271977
701 Ga0495591_000109 3300046458 Bacteria 94877
702 Ga0495629_0000140 3300046459 Bacteria 63496
703 Ga0495638_0004233 3300046460 Bacteria 10916
704 Ga0495651_0056264 3300046462 Bacteria 3022
705 Ga0495651_0242165 3300046462 Bacteria 1236
706 Ga0495653_0009696 3300046463 Bacteria 7874
707 Ga0495653_0047492 3300046463 Bacteria 3320
708 Ga0495650_0000322 3300046471 Bacteria 85802
709 Ga0495580_0058773 3300046472 Bacteria 2703
710 Ga0495580_0078199 3300046472 Bacteria 2307
711 Ga0495582_0005878 3300046473 Bacteria 6837
712 Ga0495605_0011394 3300046474 Bacteria 4957
713 Ga0495605_0091546 3300046474 Bacteria 1408
714 Ga0495639_0001632 3300046475 Bacteria 10003
715 Ga0495639_0012290 3300046475 Bacteria 3692
716 Ga0495662_0015537 3300046476 Bacteria 3695
717 Ga0495662_0075454 3300046476 Bacteria 1636
718 Ga0495664_0005918 3300046477 Bacteria 6732
719 Ga0495664_0038354 3300046477 Bacteria 2828
720 Ga0495584_0000029 3300046491 Bacteria 105850
721 Ga0495584_0004385 3300046491 Bacteria 7599
722 Ga0495584_0019984 3300046491 Bacteria 3402
723 Ga0495585_0002257 3300046492 Bacteria 13934
724 Ga0495585_0077342 3300046492 Bacteria 1806
725 Ga0495585_0131863 3300046492 Bacteria 1315
726 Ga0495594_0019830 3300046499 Bacteria 3576
727 Ga0495594_0042704 3300046499 Bacteria 2483
728 Ga0495594_0200662 3300046499 Bacteria 1137
729 Ga0495596_0004688 3300046500 Bacteria 6615
730 Ga0495596_0009396 3300046500 Bacteria 4302
731 Ga0495607_0002596 3300046501 Bacteria 14539
732 Ga0495607_0011649 3300046501 Bacteria 5844
733 Ga0495607_0023691 3300046501 Bacteria 3839
734 Ga0495607_0037500 3300046501 Bacteria 2911
735 Ga0495583_0001070 3300046506 Bacteria 30573
736 Ga0495583_0009969 3300046506 Bacteria 5603
737 Ga0495583_0011275 3300046506 Bacteria 5143
738 Ga0495583_0046864 3300046506 Bacteria 1991
739 Ga0495583_0077909 3300046506 Bacteria 1445
740 Ga0495606_0030335 3300046507 Bacteria 3779
741 Ga0495606_0237736 3300046507 Bacteria 1017
742 Ga0495608_0023230 3300046511 Bacteria 4250
743 Ga0495608_0068600 3300046511 Bacteria 2318
744 Ga0495608_0133031 3300046511 Bacteria 1590
745 Ga0495610_0048174 3300046512 Bacteria 2093
746 Ga0495616_0003207 3300046513 Bacteria 10544
747 Ga0495616_0010739 3300046513 Bacteria 5282
748 Ga0495616_0056302 3300046513 Bacteria 1942
749 Ga0495616_0074748 3300046513 Bacteria 1632
750 Ga0495618_0051343 3300046514 Bacteria 2605
751 Ga0495618_0082799 3300046514 Bacteria 2049
752 Ga0495618_0088817 3300046514 Bacteria 1976
753 Ga0495618_0153880 3300046514 Bacteria 1468
754 Ga0495628_0006258 3300046516 Bacteria 10403
755 Ga0495628_0152301 3300046516 Bacteria 1760
756 Ga0495628_0153375 3300046516 Bacteria 1754
757 Ga0495630_0012741 3300046517 Bacteria 6107
758 Ga0495630_0083972 3300046517 Bacteria 2405
759 Ga0495631_0009316 3300046518 Bacteria 4908
760 Ga0495631_0011171 3300046518 Bacteria 4423
761 Ga0495631_0015481 3300046518 Bacteria 3652
762 Ga0495632_0000530 3300046519 Bacteria 36061
763 Ga0495632_0096819 3300046519 Bacteria 1393
764 Ga0495637_0000008 3300046520 Bacteria 404658
765 Ga0495643_0010264 3300046522 Bacteria 5768
766 Ga0495643_0014879 3300046522 Bacteria 4616
767 Ga0495644_0001244 3300046523 Bacteria 10440
768 Ga0495644_0028261 3300046523 Bacteria 2122
769 Ga0495648_0012819 3300046524 Bacteria 6224
770 Ga0495648_0016800 3300046524 Bacteria 5260
771 Ga0495642_0031569 3300046528 Bacteria 2124
772 Ga0495642_0093966 3300046528 Bacteria 1271
773 Ga0495652_0032347 3300046529 Bacteria 4575
774 Ga0495652_0058188 3300046529 Bacteria 3274
775 Ga0495652_0090548 3300046529 Bacteria 2502
776 Ga0495652_0131223 3300046529 Bacteria 1983
777 Ga0495665_0004725 3300046531 Bacteria 7354
778 Ga0495665_0016123 3300046531 Bacteria 4025
779 Ga0495665_0063110 3300046531 Bacteria 1956
780 Ga0495640_0016839 3300046533 Bacteria 5463
781 Ga0495640_0044715 3300046533 Bacteria 3078
782 Ga0495640_0051481 3300046533 Bacteria 2831
783 Ga0495586_0013278 3300046535 Bacteria 4366
784 Ga0495587_0027310 3300046536 Bacteria 3476
785 Ga0495609_0004835 3300046538 Bacteria 7264
786 Ga0495609_0101618 3300046538 Bacteria 1245
787 Ga0495621_0019441 3300046539 Bacteria 2218
788 Ga0495645_0009517 3300046543 Bacteria 6793
789 Ga0495622_0053196 3300046557 Bacteria 1878
790 Ga0495633_0000874 3300046558 Bacteria 26052
791 Ga0495633_0006563 3300046558 Bacteria 6877
792 Ga0495667_0005276 3300046559 Bacteria 8739
793 Ga0495667_0005868 3300046559 Bacteria 8317
794 Ga0495667_0050977 3300046559 Bacteria 2731
795 Ga0495667_0119655 3300046559 Bacteria 1701
796 Ga0495667_0131876 3300046559 Bacteria 1612
797 Ga0495656_0003395 3300046615 Bacteria 5386
798 Ga0495656_0067904 3300046615 Bacteria 1575
799 Ga0495634_0015355 3300046642 Bacteria 5505
800 Ga0495634_0038064 3300046642 Bacteria 3280
801 Ga0495634_0076834 3300046642 Bacteria 2191
802 Ga0495611_0000410 3300046648 Bacteria 26643
803 Ga0495611_0005586 3300046648 Bacteria 5365
804 Ga0495635_0009872 3300046663 Bacteria 6672
805 Ga0495635_0052879 3300046663 Bacteria 2797
806 Ga0495635_0085362 3300046663 Bacteria 2160
807 Ga0495659_0002292 3300046664 Bacteria 6207
808 Ga0495661_0000049 3300046665 Bacteria 144060
809 Ga0495661_0015113 3300046665 Bacteria 5158
810 Ga0495661_0039401 3300046665 Bacteria 2937
811 Ga0495588_0065461 3300046674 Bacteria 1885
812 Ga0495657_0020435 3300046675 Bacteria 4759
813 Ga0495657_0032788 3300046675 Bacteria 3622
814 Ga0495657_0035218 3300046675 Bacteria 3471
815 Ga0495599_0005271 3300046678 Bacteria 7714
816 Ga0495599_0039395 3300046678 Bacteria 2969
817 Ga0495623_0054138 3300046679 Bacteria 2532
818 Ga0495647_0003703 3300046681 Bacteria 4909
819 Ga0495658_0009443 3300046683 Bacteria 4863
820 Ga0495658_0021021 3300046683 Bacteria 3435
821 Ga0495658_0099415 3300046683 Bacteria 1734
822 Ga0495669_0097053 3300046684 Bacteria 1366
823 Ga0495613_0013393 3300046689 Bacteria 6093
824 Ga0495613_0040585 3300046689 Bacteria 3448
825 Ga0495624_0010799 3300046690 Bacteria 6295
826 Ga0495670_0006450 3300046691 Bacteria 5762
827 Ga0495670_0030691 3300046691 Bacteria 2670
828 Ga0495671_0107130 3300046692 Bacteria 1365
829 Ga0495649_0000071 3300046694 Bacteria 89386
830 Ga0495649_0010074 3300046694 Bacteria 5587
831 Ga0495589_0036872 3300046794 Bacteria 2450
832 Ga0495589_0090005 3300046794 Bacteria 1490
833 Ga0495600_0001615 3300046809 Bacteria 12569
834 Ga0495600_0055706 3300046809 Bacteria 2582
835 Ga0495600_0128497 3300046809 Bacteria 1647
836 Ga0495660_0007687 3300046810 Bacteria 6332
837 Ga0495660_0018224 3300046810 Bacteria 4035
838 Ga0495581_0020190 3300047315 Bacteria 3868
839 Ga0495581_0085284 3300047315 Bacteria 1830
840 Ga0495604_0004634 3300047317 Bacteria 10899
841 Ga0495604_0015973 3300047317 Bacteria 5994
842 Ga0495604_0023059 3300047317 Bacteria 4967
843 Ga0495604_0049732 3300047317 Bacteria 3255
844 Ga0495604_0270936 3300047317 Bacteria 1150
845 Ga0495674_0009246 3300047319 Bacteria 9366
846 Ga0495674_0123965 3300047319 Bacteria 2181
847 Ga0495674_0208245 3300047319 Bacteria 1620
848 Ga0495672_0000033 3300047320 Bacteria 291992
849 Ga0495672_0001752 3300047320 Bacteria 20938
850 Ga0495676_0012611 3300047321 Bacteria 7610
851 Ga0495676_0065576 3300047321 Bacteria 2818
852 Ga0495676_0142816 3300047321 Bacteria 1713
853 Ga0495676_0258450 3300047321 Bacteria 1185
854 Ga0495680_0005304 3300047322 Bacteria 12168
855 Ga0495680_0005608 3300047322 Bacteria 11762
856 Ga0495680_0073679 3300047322 Bacteria 2594
857 Ga0495680_0098692 3300047322 Bacteria 2179
858 Ga0495680_0183861 3300047322 Bacteria 1507
859 Ga0495680_0215297 3300047322 Bacteria 1373
860 Ga0495683_0000168 3300047323 Bacteria 63828
861 Ga0495683_0041154 3300047323 Bacteria 2332
862 Ga0495683_0063091 3300047323 Bacteria 1831
863 Ga0495687_002679 3300047443 Bacteria 13854
864 Ga0495687_004011 3300047443 Bacteria 10234
865 Ga0495675_0003024 3300047444 Bacteria 10101
866 Ga0495675_0187204 3300047444 Bacteria 1265
867 Ga0495677_0000910 3300047445 Bacteria 11901
868 Ga0495677_0003825 3300047445 Bacteria 5823
869 Ga0495679_016361 3300047446 Bacteria 2685
870 Ga0495679_031274 3300047446 Bacteria 1718
871 Ga0495679_033131 3300047446 Bacteria 1652
872 Ga0495685_033408 3300047447 Bacteria 1767
873 Ga0495685_050020 3300047447 Bacteria 1419
874 Ga0495681_0006172 3300047470 Bacteria 7913
875 Ga0495681_0083340 3300047470 Bacteria 1423
876 Ga0495684_0026140 3300047471 Bacteria 4485
877 Ga0495684_0140287 3300047471 Bacteria 1812
878 Ga0495684_0166451 3300047471 Bacteria 1642
879 Ga0495686_0025648 3300047472 Bacteria 3863
880 Ga0495593_0020219 3300047673 Bacteria 3729
881 Ga0495602_0006383 3300048088 Bacteria 12370
882 Ga0495602_0043428 3300048088 Bacteria 4087
883 Ga0495602_0072323 3300048088 Bacteria 2941
884 Ga0495602_0082044 3300048088 Bacteria 2707
885 Ga0495614_0003972 3300048089 Bacteria 6640
886 Ga0495626_0022127 3300048091 Bacteria 3142
887 Ga0495626_0033656 3300048091 Bacteria 2454
888 Ga0495626_0037034 3300048091 Bacteria 2320
889 Ga0495626_0060530 3300048091 Bacteria 1725
890 Ga0495626_0095564 3300048091 Bacteria 1301
891 Ga0496100_0000806 3300048903 Bacteria 15000
892 Ga0496100_0013729 3300048903 Bacteria 4683
893 Ga0496100_0030965 3300048903 Bacteria 3323
894 Ga0496100_0031708 3300048903 Bacteria 3288
895 Ga0496101_0008655 3300048904 Bacteria 6653
896 Ga0496101_0026703 3300048904 Bacteria 4015
897 Ga0496101_0027887 3300048904 Bacteria 3938
898 Ga0496101_0061494 3300048904 Bacteria 2728
899 Ga0496101_0062004 3300048904 Bacteria 2717
900 Ga0496102_0005850 3300048905 Bacteria 10465
901 Ga0496102_0014158 3300048905 Bacteria 6929
902 Ga0496102_0038976 3300048905 Bacteria 4291
903 Ga0496102_0044345 3300048905 Bacteria 4036
904 Ga0496102_0075742 3300048905 Bacteria 3093
905 Ga0496102_0179152 3300048905 Bacteria 1996
906 Ga0496103_0012301 3300048906 Bacteria 5079
907 Ga0496103_0053490 3300048906 Bacteria 2502
908 Ga0496104_0000079 3300048907 Bacteria 98874
909 Ga0496104_0000905 3300048907 Bacteria 25438
910 Ga0496104_0023005 3300048907 Bacteria 5727
911 Ga0496104_0025752 3300048907 Bacteria 5425
912 Ga0496104_0077766 3300048907 Bacteria 3161
913 Ga0496104_0086386 3300048907 Bacteria 2994
914 Ga0496104_0148862 3300048907 Bacteria 2247
915 Ga0496104_0242297 3300048907 Bacteria 1715
916 Ga0496105_0000225 3300048908 Bacteria 38002
917 Ga0496105_0001448 3300048908 Bacteria 16699
918 Ga0496105_0002273 3300048908 Bacteria 13939
919 Ga0496105_0025717 3300048908 Bacteria 4794
920 Ga0496105_0042175 3300048908 Bacteria 3760
921 Ga0496105_0067130 3300048908 Bacteria 2961
922 Ga0496105_0159666 3300048908 Bacteria 1851
923 Ga0496106_0000782 3300048909 Bacteria 22988
924 Ga0496106_0013575 3300048909 Bacteria 6012
925 Ga0496106_0029782 3300048909 Bacteria 4069
926 Ga0496106_0067750 3300048909 Bacteria 2721
927 Ga0496106_0122005 3300048909 Bacteria 2038
928 Ga0496106_0386495 3300048909 Bacteria 1125
929 Ga0496107_0001064 3300048910 Bacteria 16457
930 Ga0496107_0002049 3300048910 Bacteria 12883
931 Ga0496107_0015114 3300048910 Bacteria 5407
932 Ga0496107_0020789 3300048910 Bacteria 4638
933 Ga0496107_0029290 3300048910 Bacteria 3916
934 Ga0496107_0043893 3300048910 Bacteria 3213
935 Ga0496108_0001587 3300048911 Bacteria 18010
936 Ga0496108_0008984 3300048911 Bacteria 8098
937 Ga0496108_0040406 3300048911 Bacteria 3888
938 Ga0496108_0047868 3300048911 Bacteria 3574
939 Ga0496108_0088726 3300048911 Bacteria 2628
940 Ga0496109_0001253 3300048912 Bacteria 21077
941 Ga0496109_0010418 3300048912 Bacteria 7940
942 Ga0496109_0042508 3300048912 Bacteria 4117
943 Ga0496109_0151178 3300048912 Bacteria 2173
944 Ga0496109_0161799 3300048912 Bacteria 2097
945 Ga0496110_0028356 3300048913 Bacteria 4808
946 Ga0496110_0100491 3300048913 Bacteria 2593
947 Ga0496110_0111674 3300048913 Bacteria 2457
948 Ga0496110_0199355 3300048913 Bacteria 1818
949 Ga0496110_0375520 3300048913 Bacteria 1295
950 Ga0496111_0000416 3300048914 Bacteria 21461
951 Ga0496111_0007782 3300048914 Bacteria 7056
952 Ga0496111_0046274 3300048914 Bacteria 3132
953 Ga0496111_0073417 3300048914 Bacteria 2491
954 Ga0496112_0002998 3300048915 Bacteria 13796
955 Ga0496112_0003843 3300048915 Bacteria 12540
956 Ga0496112_0015232 3300048915 Bacteria 7168
957 Ga0496112_0102249 3300048915 Bacteria 2835
958 Ga0496112_0149775 3300048915 Bacteria 2300
959 Ga0496113_0000215 3300048916 Bacteria 27020
960 Ga0496113_0049503 3300048916 Bacteria 3129
961 Ga0496113_0108825 3300048916 Bacteria 2154
962 Ga0496113_0174989 3300048916 Bacteria 1700
963 Ga0496113_0192885 3300048916 Bacteria 1617
964 Ga0496113_0249270 3300048916 Bacteria 1417
965 Ga0496113_0264016 3300048916 Bacteria 1375
966 Ga0496114_0002900 3300048917 Bacteria 13140
967 Ga0496114_0018697 3300048917 Bacteria 5607
968 Ga0496114_0026644 3300048917 Bacteria 4735
969 Ga0496114_0040057 3300048917 Bacteria 3877
970 Ga0496115_0001718 3300048918 Bacteria 15712
971 Ga0496115_0008715 3300048918 Bacteria 7517
972 Ga0496115_0021185 3300048918 Bacteria 5018
973 Ga0496115_0024187 3300048918 Bacteria 4718
974 Ga0496115_0048443 3300048918 Bacteria 3399
975 Ga0496115_0077466 3300048918 Bacteria 2703
976 Ga0496115_0184135 3300048918 Bacteria 1726
977 Ga0496122_0001753 3300048925 Bacteria 33345
978 Ga0496123_0003783 3300048926 Bacteria 16574
979 Ga0496125_0006247 3300048928 Bacteria 12950
980 Ga0495678_000024 3300049459 Bacteria 229034
981 Ga0495678_000061 3300049459 Bacteria 142649
982 Ga0495682_0001519 3300049460 Bacteria 12302
983 Ga0495682_0023599 3300049460 Bacteria 2295
984 Ga0501031_0000643 3300049568 Bacteria 20718
985 Ga0501031_0007697 3300049568 Bacteria 7013
986 Ga0501031_0076562 3300049568 Bacteria 2179
987 Ga0501032_0012676 3300049569 Bacteria 6011
988 Ga0501032_0047591 3300049569 Bacteria 2895
989 Ga0501033_0010744 3300049570 Bacteria 7018
990 Ga0501033_0014803 3300049570 Bacteria 5922
991 Ga0501033_0023102 3300049570 Bacteria 4689
992 Ga0501033_0041519 3300049570 Bacteria 3432
993 Ga0501033_0077981 3300049570 Bacteria 2431
994 Ga0501034_0069583 3300049571 Bacteria 3530
995 Ga0501034_0072331 3300049571 Bacteria 3457
996 Ga0501034_0079371 3300049571 Bacteria 3285
997 Ga0501034_0149849 3300049571 Bacteria 2309
998 Ga0501036_0001896 3300049572 Bacteria 16262
999 Ga0501036_0012065 3300049572 Bacteria 7159
1000 Ga0501036_0073557 3300049572 Bacteria 2889
1001 Ga0501036_0163731 3300049572 Bacteria 1875
1002 Ga0501037_0013364 3300049573 Bacteria 6048
1003 Ga0501037_0034705 3300049573 Bacteria 3721
1004 Ga0501037_0082587 3300049573 Bacteria 2328
1005 Ga0501037_0122063 3300049573 Bacteria 1873
1006 Ga0501038_0004733 3300049574 Bacteria 12659
1007 Ga0501038_0011296 3300049574 Bacteria 8152
1008 Ga0501038_0015310 3300049574 Bacteria 6973
1009 Ga0501038_0032332 3300049574 Bacteria 4617
1010 Ga0501038_0139520 3300049574 Bacteria 1984
1011 Ga0501038_0163315 3300049574 Bacteria 1808
1012 Ga0501039_0004579 3300049575 Bacteria 10449
1013 Ga0501039_0026855 3300049575 Bacteria 4425
1014 Ga0501039_0066121 3300049575 Bacteria 2806
1015 Ga0501039_0066303 3300049575 Bacteria 2802
1016 Ga0501040_0000761 3300049576 Bacteria 19995
1017 Ga0501040_0005348 3300049576 Bacteria 8302
1018 Ga0501040_0075445 3300049576 Bacteria 2330
1019 Ga0501041_0005396 3300049577 Bacteria 7491
1020 Ga0501041_0008980 3300049577 Bacteria 5881
1021 Ga0501041_0111693 3300049577 Bacteria 1695
1022 Ga0501042_0003840 3300049578 Bacteria 9501
1023 Ga0501042_0008836 3300049578 Bacteria 6679
1024 Ga0501042_0112913 3300049578 Bacteria 1956
1025 Ga0501046_0002981 3300049580 Bacteria 15644
1026 Ga0501047_0046651 3300049581 Bacteria 4187
1027 Ga0501047_0085291 3300049581 Bacteria 3034
1028 Ga0501047_0157589 3300049581 Bacteria 2143
1029 Ga0501047_0206302 3300049581 Bacteria 1824
1030 Ga0501048_0003011 3300049582 Bacteria 12860
1031 Ga0501048_0011184 3300049582 Bacteria 6690
1032 Ga0501048_0025358 3300049582 Bacteria 4321
1033 Ga0501067_0039738 3300049583 Bacteria 2612
1034 Ga0501068_0033037 3300049584 Bacteria 3080
1035 Ga0501068_0057648 3300049584 Bacteria 2355
1036 Ga0501068_0058676 3300049584 Bacteria 2336
1037 Ga0501069_0006910 3300049585 Bacteria 5932
1038 Ga0501070_0020457 3300049586 Bacteria 5551
1039 Ga0501071_0000078 3300049587 Bacteria 34978
1040 Ga0501071_0054905 3300049587 Bacteria 2875
1041 Ga0501072_0001618 3300049588 Bacteria 16843
1042 Ga0501072_0013652 3300049588 Bacteria 6219
1043 Ga0501072_0050631 3300049588 Bacteria 3270
1044 Ga0501072_0055797 3300049588 Bacteria 3113
1045 Ga0501072_0132378 3300049588 Bacteria 1988
1046 Ga0501072_0134688 3300049588 Bacteria 1970
1047 Ga0501072_0403812 3300049588 Bacteria 1084
1048 Ga0501073_0024329 3300049589 Bacteria 4348
1049 Ga0501073_0072835 3300049589 Bacteria 2393
1050 Ga0501073_0271441 3300049589 Bacteria 1170
1051 Ga0501074_0032389 3300049590 Bacteria 3787
1052 Ga0501074_0244576 3300049590 Bacteria 1276
1053 Ga0501074_0336853 3300049590 Bacteria 1071
1054 Ga0501075_0000784 3300049591 Bacteria 19847
1055 Ga0501075_0002758 3300049591 Bacteria 11765
1056 Ga0501075_0021286 3300049591 Bacteria 4726
1057 Ga0501075_0072073 3300049591 Bacteria 2611
1058 Ga0501075_0122141 3300049591 Bacteria 1982
1059 Ga0501076_0001426 3300049592 Bacteria 16037
1060 Ga0501076_0002404 3300049592 Bacteria 12827
1061 Ga0501076_0037727 3300049592 Bacteria 3791
1062 Ga0501076_0059533 3300049592 Bacteria 3038
1063 Ga0501076_0166375 3300049592 Bacteria 1797
1064 Ga0501077_0002379 3300049593 Bacteria 11287
1065 Ga0501077_0006663 3300049593 Bacteria 7097
1066 Ga0501077_0013226 3300049593 Bacteria 5172
1067 Ga0501077_0108584 3300049593 Bacteria 1758
1068 Ga0501079_0000213 3300049741 Bacteria 34053
1069 Ga0501079_0002094 3300049741 Bacteria 14313
1070 Ga0501079_0005043 3300049741 Bacteria 9802
1071 Ga0501079_0034239 3300049741 Bacteria 3908
1072 Ga0501079_0058357 3300049741 Bacteria 2978
1073 Ga0501079_0209956 3300049741 Bacteria 1521
1074 Ga0501080_0001183 3300049742 Bacteria 21629
1075 Ga0501080_0013912 3300049742 Bacteria 7407
1076 Ga0501080_0042100 3300049742 Bacteria 4255
1077 Ga0501080_0106635 3300049742 Bacteria 2597
1078 Ga0501080_0150193 3300049742 Bacteria 2154
1079 Ga0501081_0006277 3300049743 Bacteria 7705
1080 Ga0501081_0011772 3300049743 Bacteria 5728
1081 Ga0501081_0024126 3300049743 Bacteria 4083
1082 Ga0501081_0055263 3300049743 Bacteria 2743
1083 Ga0501083_0005838 3300049744 Bacteria 8717
1084 Ga0501083_0005926 3300049744 Bacteria 8653
1085 Ga0501083_0026484 3300049744 Bacteria 4008
1086 Ga0501083_0107285 3300049744 Bacteria 1838
1087 Ga0501035_0108543 3300049822 Bacteria 2433
1088 Ga0501035_0209166 3300049822 Bacteria 1670
1089 Ga0501044_0000084 3300049823 Bacteria 114544
1090 Ga0501044_0064866 3300049823 Bacteria 3726
1091 Ga0501044_0101084 3300049823 Bacteria 2901
1092 Ga0501044_0111899 3300049823 Bacteria 2737
1093 Ga0501044_0278065 3300049823 Bacteria 1608
1094 Ga0501045_0001082 3300049824 Bacteria 18002
1095 Ga0501045_0018252 3300049824 Bacteria 4989
1096 Ga0501045_0148243 3300049824 Bacteria 1745
1097 Ga0501045_0232864 3300049824 Bacteria 1371
1098 nmdc:mga03683_21567_c1 3300050489 Bacteria 2485
1099 nmdc:mga03n38_47518_c1 3300050490 Bacteria 1900
1100 nmdc:mga00v17_99901_c1 3300050491 Bacteria 1831
1101 nmdc:mga0yw44_167638_c1 3300050492 Bacteria 1441
1102 nmdc:mga0yw44_211992_c1 3300050492 Bacteria 1281
1103 nmdc:mga0k408_7449_c1 3300050493 Bacteria 5844
1104 nmdc:mga07m45_42260_c1 3300050496 Bacteria 2555
1105 nmdc:mga05p37_120335_c1 3300050507 Bacteria 3226
1106 nmdc:mga05p37_122041_c1 3300050507 Bacteria 3200
1107 nmdc:mga05p37_20486_c1 3300050507 Bacteria 8000
1108 nmdc:mga05p37_224789_c1 3300050507 Bacteria 2264
1109 nmdc:mga05p37_32_c1 3300050507 Bacteria 112982
1110 nmdc:mga05p37_35373_c1 3300050507 Bacteria 6124
1111 nmdc:mga09592_74927_c1 3300050508 Bacteria 2877
1112 nmdc:mga09592_7970_c1 3300050508 Bacteria 8608
1113 nmdc:mga0qj67_1240_c1 3300050509 Bacteria 17825
1114 nmdc:mga0qj67_214126_c1 3300050509 Bacteria 1564
1115 nmdc:mga0qj67_67130_c1 3300050509 Bacteria 2857
1116 nmdc:mga06r32_135821_c1 3300050510 Bacteria 2434
1117 nmdc:mga06r32_1670_c1 3300050510 Bacteria 20024
1118 nmdc:mga06r32_96585_c1 3300050510 Bacteria 2894
1119 nmdc:mga08y16_116492_c1 3300050511 Bacteria 2781
1120 nmdc:mga08y16_129212_c1 3300050511 Bacteria 2628
1121 nmdc:mga08y16_66352_c1 3300050511 Bacteria 3766
1122 nmdc:mga08y16_6877_c1 3300050511 Bacteria 11928
1123 nmdc:mga08y16_73993_c1 3300050511 Bacteria 3550
1124 nmdc:mga08y16_997_c1 3300050511 Bacteria 27611
1125 nmdc:mga0n895_184916_c1 3300050512 Bacteria 2115
1126 nmdc:mga0n895_389536_c1 3300050512 Bacteria 1410
1127 nmdc:mga0n895_4071_c1 3300050512 Bacteria 11900
1128 nmdc:mga0n895_60104_c1 3300050512 Bacteria 3750
1129 nmdc:mga0rr50_152109_c1 3300050513 Bacteria 1871
1130 nmdc:mga0rr50_159095_c1 3300050513 Bacteria 1832
1131 nmdc:mga0rr50_216119_c1 3300050513 Bacteria 1581
1132 nmdc:mga08x19_107498_c1 3300050514 Bacteria 1857
1133 nmdc:mga08x19_137288_c1 3300050514 Bacteria 1649
1134 nmdc:mga08x19_91457_c1 3300050514 Bacteria 2009
1135 nmdc:mga0a205_111119_c1 3300050515 Bacteria 2639
1136 nmdc:mga0a205_1694_c1 3300050515 Bacteria 19038
1137 nmdc:mga0a205_374115_c1 3300050515 Bacteria 1290
1138 nmdc:mga0a205_43990_c1 3300050515 Bacteria 4304
1139 nmdc:mga0a205_63882_c1 3300050515 Bacteria 3556
1140 nmdc:mga0sz30_48518_c1 3300050516 Bacteria 1796
1141 Ga0495601_0000334 3300053077 Bacteria 24822
1142 Ga0495601_0001025 3300053077 Bacteria 15278
1143 Ga0495601_0002590 3300053077 Bacteria 10252
1144 Ga0495601_0019507 3300053077 Bacteria 4135
1145 Ga0495601_0026030 3300053077 Bacteria 3610
1146 Ga0495601_0092352 3300053077 Bacteria 1949
1147 Ga0495601_0116912 3300053077 Bacteria 1730
1148 Ga0495601_0161301 3300053077 Bacteria 1465
1149 Ga0495601_0210986 3300053077 Unclassified 1268
1150 Ga0495612_0045604 3300053078 Bacteria 1794
1151 Ga0495595_0001239 3300053084 Bacteria 9939
1152 Ga0495595_0001716 3300053084 Bacteria 8577
1153 Ga0495595_0006503 3300053084 Bacteria 4767
1154 Ga0495595_0008339 3300053084 Bacteria 4253
1155 Ga0495595_0021468 3300053084 Bacteria 2822
1156 Ga0495595_0100010 3300053084 Bacteria 1399
1157 Ga0495619_0000016 3300053085 Bacteria 231442
1158 Ga0495619_0000384 3300053085 Bacteria 30338
1159 Ga0495619_0001774 3300053085 Bacteria 14345
1160 Ga0495619_0012701 3300053085 Bacteria 5301
1161 Ga0495619_0018412 3300053085 Bacteria 4431
1162 Ga0495619_0038680 3300053085 Bacteria 3112
1163 Ga0495619_0047152 3300053085 Bacteria 2836
1164 Ga0495619_0273583 3300053085 Bacteria 1170
1165 Ga0500650_0091834 3300053098 Bacteria 1421
1166 Ga0500595_006007 3300053119 Bacteria 5219
1167 Ga0500652_058240 3300053131 Bacteria 1586
1168 Ga0500616_0020313 3300053153 Bacteria 3732
1169 Ga0500616_0073191 3300053153 Bacteria 1740
1170 Ga0501084_0000457 3300054114 Bacteria 31427
1171 Ga0501084_0002873 3300054114 Bacteria 13931
1172 Ga0501084_0090621 3300054114 Bacteria 2567
1173 Ga0501084_0091849 3300054114 Bacteria 2549
1174 Ga0501084_0240306 3300054114 Bacteria 1529
1175 Ga0501082_0012045 3300060353 Bacteria 7431
1176 Ga0501082_0013927 3300060353 Bacteria 6915
1177 Ga0501082_0076653 3300060353 Bacteria 2882
1178 Ga0501082_0080565 3300060353 Bacteria 2810
1179 Ga0466962_0047914 3300061719 Bacteria 2042
1180 Ga0466962_0058785 3300061719 Bacteria 1835
1181 Ga0530510_0000158 3300061734 Bacteria 40587
1182 Ga0530510_0011122 3300061734 Bacteria 6312
1183 Ga0530510_0051650 3300061734 Bacteria 2971
1184 Ga0530510_0052308 3300061734 Bacteria 2952
1185 Ga0530510_0128852 3300061734 Bacteria 1861

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049588 Ga0501072_0403812 Ga0501072_0403812_319_1053 240
2 3300039438 Ga0436360_0635187 Ga0436360_0635187_17_841 271
3 3300005458 Ga0070681_10039942 Ga0070681_100399422 274
4 3300025912 Ga0207707_10072826 Ga0207707_100728262 274
5 3300049576 Ga0501040_0075445 Ga0501040_0075445_892_1887 285
6 3300049741 Ga0501079_0034239 Ga0501079_0034239_149_1144 285
7 3300049743 Ga0501081_0024126 Ga0501081_0024126_1306_2301 285
8 3300047443 Ga0495687_004011 Ga0495687_004011_2301_3299 288
9 3300049572 Ga0501036_0163731 Ga0501036_0163731_103_1098 288
10 3300049588 Ga0501072_0050631 Ga0501072_0050631_399_1394 288
11 3300049591 Ga0501075_0072073 Ga0501075_0072073_723_1718 288
12 3300049742 Ga0501080_0106635 Ga0501080_0106635_944_1939 288
13 3300046528 Ga0495642_0031569 Ga0495642_0031569_274_1272 289
14 3300005295 Ga0065707_10115366 Ga0065707_101153661 292
15 3300025932 Ga0207690_10145160 Ga0207690_101451602 292
16 3300046679 Ga0495623_0054138 Ga0495623_0054138_1637_2521 292
17 3300035116 Ga0373945_0007601 Ga0373945_0007601_806_1735 296
18 3300046531 Ga0495665_0016123 Ga0495665_0016123_300_1274 296
19 3300053077 Ga0495601_0116912 Ga0495601_0116912_626_1612 301
20 3300036401 Ga0373937_0357967 Ga0373937_0357967_198_1115 302
21 3300005530 Ga0070679_100330528 Ga0070679_1003305282 303
22 3300030763 Ga0265763_1004377 Ga0265763_10043771 303
23 3300035119 Ga0373956_0014565 Ga0373956_0014565_2234_3223 303
24 3300035172 Ga0373955_0017584 Ga0373955_0017584_528_1517 303
25 3300036401 Ga0373937_0023033 Ga0373937_0023033_3669_4658 303
26 3300046559 Ga0495667_0119655 Ga0495667_0119655_165_1154 303
27 3300046675 Ga0495657_0032788 Ga0495657_0032788_1600_2589 303
28 3300047317 Ga0495604_0270936 Ga0495604_0270936_120_1109 303
29 3300047322 Ga0495680_0183861 Ga0495680_0183861_106_1095 303
30 3300048088 Ga0495602_0043428 Ga0495602_0043428_423_1412 303
31 3300049589 Ga0501073_0271441 Ga0501073_0271441_30_950 303
32 3300053077 Ga0495601_0019507 Ga0495601_0019507_1126_2115 303
33 3300053084 Ga0495595_0008339 Ga0495595_0008339_2696_3685 303
34 3300053085 Ga0495619_0038680 Ga0495619_0038680_1606_2595 303
35 3300009147 Ga0114129_10116952 Ga0114129_101169522 305
36 3300036401 Ga0373937_0528808 Ga0373937_0528808_104_1090 305
37 3300049590 Ga0501074_0244576 Ga0501074_0244576_16_942 305
38 3300028800 Ga0265338_10132968 Ga0265338_101329681 306
39 3300038443 Ga0395901_0112885 Ga0395901_0112885_1787_2794 306
40 3300054114 Ga0501084_0091849 Ga0501084_0091849_1160_2152 306
41 3300005335 Ga0070666_10017385 Ga0070666_100173856 307
42 3300005355 Ga0070671_100009073 Ga0070671_1000090736 307
43 3300005457 Ga0070662_100164305 Ga0070662_1001643052 307
44 3300005543 Ga0070672_100066373 Ga0070672_1000663732 307
45 3300009177 Ga0105248_10003287 Ga0105248_100032878 307
46 3300025903 Ga0207680_10003320 Ga0207680_100033206 307
47 3300025907 Ga0207645_10137723 Ga0207645_101377232 307
48 3300025933 Ga0207706_10077468 Ga0207706_100774682 307
49 3300025940 Ga0207691_10079326 Ga0207691_100793262 307
50 3300025941 Ga0207711_10002482 Ga0207711_100024827 307
51 3300026118 Ga0207675_100366112 Ga0207675_1003661122 307
52 3300026121 Ga0207683_10235638 Ga0207683_102356382 307
53 3300026142 Ga0207698_10170021 Ga0207698_101700212 307
54 3300027682 Ga0209971_1004676 Ga0209971_10046762 307
55 3300027876 Ga0209974_10000880 Ga0209974_100008807 307
56 3300048911 Ga0496108_0088726 Ga0496108_0088726_1052_2065 307
57 3300031901 Ga0307406_10113666 Ga0307406_101136662 308
58 3300031995 Ga0307409_100416364 Ga0307409_1004163642 308
59 3300037471 Ga0395905_0011373 Ga0395905_0011373_2930_3937 308
60 3300006175 Ga0070712_100075359 Ga0070712_1000753593 309
61 3300044684 Ga0466966_0028792 Ga0466966_0028792_672_1658 309
62 3300044693 Ga0466961_0020886 Ga0466961_0020886_1602_2588 309
63 3300044694 Ga0466963_0017165 Ga0466963_0017165_2980_3966 309
64 3300044719 Ga0466971_0021322 Ga0466971_0021322_40_1026 309
65 3300044842 Ga0466957_0003978 Ga0466957_0003978_2714_3700 309
66 3300045049 Ga0466959_0064395 Ga0466959_0064395_1218_2204 309
67 3300045836 Ga0466958_0026431 Ga0466958_0026431_1686_2672 309
68 3300045976 Ga0466967_0212576 Ga0466967_0212576_489_1475 309
69 3300044694 Ga0466963_0206837 Ga0466963_0206837_246_1235 310
70 3300049574 Ga0501038_0163315 Ga0501038_0163315_604_1548 310
71 3300050492 nmdc:mga0yw44_211992_c1 nmdc:mga0yw44_211992_c1_183_1169 310
72 3300025918 Ga0207662_10188611 Ga0207662_101886112 311
73 3300031249 Ga0265339_10014744 Ga0265339_100147443 311
74 3300031665 Ga0316575_10006778 Ga0316575_100067783 311
75 3300044694 Ga0466963_0114234 Ga0466963_0114234_195_1181 311
76 3300044901 Ga0466960_0161758 Ga0466960_0161758_173_1159 311
77 3300045836 Ga0466958_0124893 Ga0466958_0124893_348_1334 311
78 3300061719 Ga0466962_0047914 Ga0466962_0047914_354_1340 311
79 3300031712 Ga0265342_10069525 Ga0265342_100695252 312
80 3300031824 Ga0307413_10379883 Ga0307413_103798831 312
81 3300048910 Ga0496107_0020789 Ga0496107_0020789_1594_2532 312
82 3300049741 Ga0501079_0209956 Ga0501079_0209956_15_1013 312
83 3300005563 Ga0068855_100052442 Ga0068855_1000524422 313
84 3300006048 Ga0075363_100002037 Ga0075363_1000020373 313
85 3300006051 Ga0075364_10006763 Ga0075364_100067636 313
86 3300013102 Ga0157371_10229260 Ga0157371_102292602 313
87 3300025917 Ga0207660_10064971 Ga0207660_100649712 313
88 3300025919 Ga0207657_10080606 Ga0207657_100806062 313
89 3300025921 Ga0207652_10164786 Ga0207652_101647862 313
90 3300025936 Ga0207670_10013702 Ga0207670_100137023 313
91 3300025949 Ga0207667_10058946 Ga0207667_100589462 313
92 3300028573 Ga0265334_10054621 Ga0265334_100546212 313
93 3300031249 Ga0265339_10087310 Ga0265339_100873102 313
94 3300031711 Ga0265314_10099824 Ga0265314_100998242 313
95 3300031712 Ga0265342_10000510 Ga0265342_1000051027 313
96 3300048904 Ga0496101_0061494 Ga0496101_0061494_108_1106 313
97 3300048905 Ga0496102_0038976 Ga0496102_0038976_2887_3885 313
98 3300048908 Ga0496105_0067130 Ga0496105_0067130_1892_2890 313
99 3300048913 Ga0496110_0199355 Ga0496110_0199355_587_1585 313
100 3300049581 Ga0501047_0157589 Ga0501047_0157589_951_1943 313
101 3300049742 Ga0501080_0150193 Ga0501080_0150193_149_1120 313
102 3300005439 Ga0070711_100206981 Ga0070711_1002069811 314
103 3300006177 Ga0075362_10036152 Ga0075362_100361522 314
104 3300006186 Ga0075369_10044119 Ga0075369_100441192 314
105 3300025904 Ga0207647_10068896 Ga0207647_100688962 314
106 3300046507 Ga0495606_0237736 Ga0495606_0237736_20_1000 314
107 3300046519 Ga0495632_0096819 Ga0495632_0096819_15_986 314
108 3300046522 Ga0495643_0014879 Ga0495643_0014879_3026_4099 314
109 3300046665 Ga0495661_0015113 Ga0495661_0015113_4165_5136 314
110 3300046794 Ga0495589_0090005 Ga0495589_0090005_12_995 314
111 3300047447 Ga0495685_033408 Ga0495685_033408_73_1044 314
112 3300048091 Ga0495626_0033656 Ga0495626_0033656_1316_2284 314
113 3300049570 Ga0501033_0023102 Ga0501033_0023102_1961_2959 314
114 3300049574 Ga0501038_0032332 Ga0501038_0032332_3398_4396 314
115 3300050493 nmdc:mga0k408_7449_c1 nmdc:mga0k408_7449_c1_657_1652 314
116 3300050516 nmdc:mga0sz30_48518_c1 nmdc:mga0sz30_48518_c1_297_1292 314
117 3300005290 Ga0065712_10014721 Ga0065712_100147212 315
118 3300005334 Ga0068869_100287558 Ga0068869_1002875582 315
119 3300005340 Ga0070689_100132728 Ga0070689_1001327282 315
120 3300005353 Ga0070669_100103055 Ga0070669_1001030552 315
121 3300005365 Ga0070688_100097177 Ga0070688_1000971772 315
122 3300005459 Ga0068867_100044629 Ga0068867_1000446293 315
123 3300005617 Ga0068859_100026815 Ga0068859_1000268155 315
124 3300005618 Ga0068864_100117170 Ga0068864_1001171702 315
125 3300006931 Ga0097620_100026813 Ga0097620_1000268135 315
126 3300013297 Ga0157378_10222958 Ga0157378_102229582 315
127 3300026023 Ga0207677_10120803 Ga0207677_101208032 315
128 3300026089 Ga0207648_10098034 Ga0207648_100980343 315
129 3300026116 Ga0207674_10162393 Ga0207674_101623932 315
130 3300046539 Ga0495621_0019441 Ga0495621_0019441_1071_2075 315
131 3300047447 Ga0495685_050020 Ga0495685_050020_105_1109 315
132 3300044673 Ga0453683_0162827 Ga0453683_0162827_318_1316 316
133 3300049575 Ga0501039_0066121 Ga0501039_0066121_1093_2052 316
134 3300049578 Ga0501042_0112913 Ga0501042_0112913_149_1108 316
135 3300049582 Ga0501048_0011184 Ga0501048_0011184_3914_4873 316
136 3300049741 Ga0501079_0058357 Ga0501079_0058357_1189_2148 316
137 3300049824 Ga0501045_0018252 Ga0501045_0018252_3487_4446 316
138 3300054114 Ga0501084_0090621 Ga0501084_0090621_1250_2209 316
139 3300061734 Ga0530510_0051650 Ga0530510_0051650_1539_2549 316
140 3300037312 Ga0395899_0003128 Ga0395899_0003128_11448_12455 317
141 3300045836 Ga0466958_0133022 Ga0466958_0133022_407_1396 317
142 3300046474 Ga0495605_0011394 Ga0495605_0011394_1411_2400 317
143 3300046665 Ga0495661_0039401 Ga0495661_0039401_1013_1972 317
144 3300047445 Ga0495677_0003825 Ga0495677_0003825_3961_4950 317
145 3300048091 Ga0495626_0060530 Ga0495626_0060530_123_1112 317
146 3300053077 Ga0495601_0161301 Ga0495601_0161301_207_1265 317
147 3300061719 Ga0466962_0058785 Ga0466962_0058785_25_1014 317
148 3300045976 Ga0466967_0060796 Ga0466967_0060796_2268_3260 318
149 3300049593 Ga0501077_0108584 Ga0501077_0108584_404_1405 318
150 3300005353 Ga0070669_100088541 Ga0070669_1000885412 319
151 3300005434 Ga0070709_10029146 Ga0070709_100291464 319
152 3300005985 Ga0081539_10049773 Ga0081539_100497732 319
153 3300006163 Ga0070715_10017578 Ga0070715_100175784 319
154 3300006237 Ga0097621_100002538 Ga0097621_1000025386 319
155 3300017792 Ga0163161_10326392 Ga0163161_103263921 319
156 3300025916 Ga0207663_10062209 Ga0207663_100622094 319
157 3300025928 Ga0207700_10004335 Ga0207700_100043355 319
158 3300037068 Ga0373925_0070249 Ga0373925_0070249_1106_2095 319
159 3300046475 Ga0495639_0001632 Ga0495639_0001632_5183_6172 319
160 3300046476 Ga0495662_0015537 Ga0495662_0015537_65_1054 319
161 3300046499 Ga0495594_0019830 Ga0495594_0019830_2527_3516 319
162 3300046517 Ga0495630_0012741 Ga0495630_0012741_2142_3131 319
163 3300046522 Ga0495643_0010264 Ga0495643_0010264_183_1205 319
164 3300046529 Ga0495652_0032347 Ga0495652_0032347_3137_4126 319
165 3300046533 Ga0495640_0051481 Ga0495640_0051481_80_1069 319
166 3300046559 Ga0495667_0005868 Ga0495667_0005868_5566_6555 319
167 3300046663 Ga0495635_0052879 Ga0495635_0052879_773_1762 319
168 3300046674 Ga0495588_0065461 Ga0495588_0065461_417_1406 319
169 3300046681 Ga0495647_0003703 Ga0495647_0003703_91_1080 319
170 3300046694 Ga0495649_0010074 Ga0495649_0010074_1033_2055 319
171 3300046809 Ga0495600_0001615 Ga0495600_0001615_10126_11115 319
172 3300047317 Ga0495604_0023059 Ga0495604_0023059_1036_2025 319
173 3300047322 Ga0495680_0005608 Ga0495680_0005608_3101_4090 319
174 3300047471 Ga0495684_0026140 Ga0495684_0026140_2723_3712 319
175 3300048089 Ga0495614_0003972 Ga0495614_0003972_4822_5811 319
176 3300053077 Ga0495601_0026030 Ga0495601_0026030_472_1461 319
177 3300053077 Ga0495601_0092352 Ga0495601_0092352_399_1388 319
178 3300053078 Ga0495612_0045604 Ga0495612_0045604_432_1421 319
179 3300053085 Ga0495619_0012701 Ga0495619_0012701_2093_3082 319
180 3300001976 JGI24752J21851_1003015 JGI24752J21851_10030152 320
181 3300001989 JGI24739J22299_10001439 JGI24739J22299_100014396 320
182 3300001990 JGI24737J22298_10006660 JGI24737J22298_100066601 320
183 3300002070 JGI24750J21931_1000236 JGI24750J21931_10002365 320
184 3300002073 JGI24745J21846_1000672 JGI24745J21846_10006724 320
185 3300002074 JGI24748J21848_1000246 JGI24748J21848_10002466 320
186 3300002075 JGI24738J21930_10000321 JGI24738J21930_100003212 320
187 3300002076 JGI24749J21850_1001668 JGI24749J21850_10016682 320
188 3300002244 JGI24742J22300_10003211 JGI24742J22300_100032113 320
189 3300005293 Ga0065715_10110340 Ga0065715_101103402 320
190 3300005328 Ga0070676_10014872 Ga0070676_100148723 320
191 3300005329 Ga0070683_100015103 Ga0070683_1000151035 320
192 3300005330 Ga0070690_100009004 Ga0070690_1000090045 320
193 3300005331 Ga0070670_100002552 Ga0070670_1000025526 320
194 3300005333 Ga0070677_10000229 Ga0070677_100002294 320
195 3300005334 Ga0068869_100000813 Ga0068869_1000008136 320
196 3300005335 Ga0070666_10016756 Ga0070666_100167563 320
197 3300005337 Ga0070682_100001697 Ga0070682_1000016979 320
198 3300005338 Ga0068868_100119733 Ga0068868_1001197332 320
199 3300005339 Ga0070660_100003220 Ga0070660_1000032202 320
200 3300005340 Ga0070689_100001674 Ga0070689_10000167416 320
201 3300005341 Ga0070691_10012615 Ga0070691_100126153 320
202 3300005343 Ga0070687_100000287 Ga0070687_10000028715 320
203 3300005344 Ga0070661_100001342 Ga0070661_10000134215 320
204 3300005345 Ga0070692_10031678 Ga0070692_100316782 320
205 3300005347 Ga0070668_100002613 Ga0070668_1000026132 320
206 3300005353 Ga0070669_100009501 Ga0070669_1000095013 320
207 3300005354 Ga0070675_100030373 Ga0070675_1000303733 320
208 3300005355 Ga0070671_100001574 Ga0070671_1000015746 320
209 3300005356 Ga0070674_100006844 Ga0070674_1000068445 320
210 3300005364 Ga0070673_100002949 Ga0070673_1000029496 320
211 3300005365 Ga0070688_100038858 Ga0070688_1000388582 320
212 3300005366 Ga0070659_100001372 Ga0070659_10000137218 320
213 3300005367 Ga0070667_100004661 Ga0070667_10000466113 320
214 3300005406 Ga0070703_10006082 Ga0070703_100060822 320
215 3300005438 Ga0070701_10012182 Ga0070701_100121823 320
216 3300005440 Ga0070705_100004113 Ga0070705_1000041133 320
217 3300005441 Ga0070700_100008630 Ga0070700_1000086303 320
218 3300005445 Ga0070708_100140660 Ga0070708_1001406602 320
219 3300005455 Ga0070663_100027620 Ga0070663_1000276203 320
220 3300005456 Ga0070678_100005790 Ga0070678_1000057905 320
221 3300005457 Ga0070662_100008362 Ga0070662_1000083628 320
222 3300005458 Ga0070681_10106963 Ga0070681_101069633 320
223 3300005459 Ga0068867_100000628 Ga0068867_10000062816 320
224 3300005466 Ga0070685_10042444 Ga0070685_100424442 320
225 3300005530 Ga0070679_100014494 Ga0070679_1000144949 320
226 3300005535 Ga0070684_100004311 Ga0070684_1000043113 320
227 3300005536 Ga0070697_100350061 Ga0070697_1003500611 320
228 3300005543 Ga0070672_100000991 Ga0070672_1000009916 320
229 3300005544 Ga0070686_100001041 Ga0070686_1000010416 320
230 3300005545 Ga0070695_100003393 Ga0070695_1000033936 320
231 3300005548 Ga0070665_100065244 Ga0070665_1000652443 320
232 3300005549 Ga0070704_100001471 Ga0070704_10000147116 320
233 3300005564 Ga0070664_100088982 Ga0070664_1000889822 320
234 3300005577 Ga0068857_100003798 Ga0068857_10000379815 320
235 3300005614 Ga0068856_100004576 Ga0068856_1000045762 320
236 3300005615 Ga0070702_100014828 Ga0070702_1000148283 320
237 3300005616 Ga0068852_100004573 Ga0068852_1000045733 320
238 3300005617 Ga0068859_100006571 Ga0068859_1000065713 320
239 3300005841 Ga0068863_100006108 Ga0068863_10000610813 320
240 3300005842 Ga0068858_100006462 Ga0068858_1000064622 320
241 3300005844 Ga0068862_100002184 Ga0068862_1000021846 320
242 3300006931 Ga0097620_100006571 Ga0097620_1000065713 320
243 3300009036 Ga0105244_10078598 Ga0105244_100785982 320
244 3300009092 Ga0105250_10048962 Ga0105250_100489622 320
245 3300009093 Ga0105240_10197688 Ga0105240_101976882 320
246 3300009094 Ga0111539_10028897 Ga0111539_100288973 320
247 3300009098 Ga0105245_10013826 Ga0105245_100138265 320
248 3300009101 Ga0105247_10008270 Ga0105247_100082706 320
249 3300009148 Ga0105243_10020347 Ga0105243_100203473 320
250 3300009174 Ga0105241_10030482 Ga0105241_100304824 320
251 3300009176 Ga0105242_10008746 Ga0105242_100087465 320
252 3300009177 Ga0105248_10006183 Ga0105248_1000618316 320
253 3300009553 Ga0105249_10057226 Ga0105249_100572263 320
254 3300010375 Ga0105239_10020880 Ga0105239_100208803 320
255 3300011119 Ga0105246_10001801 Ga0105246_1000180110 320
256 3300013100 Ga0157373_10033846 Ga0157373_100338463 320
257 3300013102 Ga0157371_10015753 Ga0157371_100157532 320
258 3300013296 Ga0157374_10070918 Ga0157374_100709184 320
259 3300013297 Ga0157378_10046130 Ga0157378_100461304 320
260 3300013306 Ga0163162_10003576 Ga0163162_1000357611 320
261 3300013307 Ga0157372_10156057 Ga0157372_101560573 320
262 3300013308 Ga0157375_10002114 Ga0157375_1000211416 320
263 3300014325 Ga0163163_10024233 Ga0163163_100242335 320
264 3300014325 Ga0163163_10058909 Ga0163163_100589092 320
265 3300014326 Ga0157380_10001040 Ga0157380_100010405 320
266 3300014745 Ga0157377_10000448 Ga0157377_100004486 320
267 3300014968 Ga0157379_10017754 Ga0157379_100177542 320
268 3300014969 Ga0157376_10009420 Ga0157376_100094206 320
269 3300025271 Ga0207666_1000094 Ga0207666_100009416 320
270 3300025893 Ga0207682_10000360 Ga0207682_1000036019 320
271 3300025907 Ga0207645_10001827 Ga0207645_1000182716 320
272 3300025908 Ga0207643_10000035 Ga0207643_1000003584 320
273 3300025911 Ga0207654_10074341 Ga0207654_100743412 320
274 3300025912 Ga0207707_10007090 Ga0207707_100070902 320
275 3300025913 Ga0207695_10121584 Ga0207695_101215842 320
276 3300025918 Ga0207662_10022714 Ga0207662_100227143 320
277 3300025923 Ga0207681_10001121 Ga0207681_1000112113 320
278 3300025926 Ga0207659_10000899 Ga0207659_1000089916 320
279 3300025927 Ga0207687_10002095 Ga0207687_1000209511 320
280 3300025931 Ga0207644_10001933 Ga0207644_1000193315 320
281 3300025932 Ga0207690_10001009 Ga0207690_100010096 320
282 3300025935 Ga0207709_10000575 Ga0207709_1000057534 320
283 3300025938 Ga0207704_10000642 Ga0207704_100006425 320
284 3300025940 Ga0207691_10002681 Ga0207691_100026816 320
285 3300025942 Ga0207689_10002374 Ga0207689_1000237416 320
286 3300025986 Ga0207658_10003553 Ga0207658_100035534 320
287 3300026035 Ga0207703_10002471 Ga0207703_1000247114 320
288 3300026088 Ga0207641_10002628 Ga0207641_1000262814 320
289 3300026116 Ga0207674_10002767 Ga0207674_1000276720 320
290 3300026121 Ga0207683_10002564 Ga0207683_1000256413 320
291 3300027617 Ga0210002_1001374 Ga0210002_10013743 320
292 3300028379 Ga0268266_10065473 Ga0268266_100654733 320
293 3300028380 Ga0268265_10001891 Ga0268265_100018915 320
294 3300028381 Ga0268264_10050126 Ga0268264_100501263 320
295 3300031249 Ga0265339_10002967 Ga0265339_100029677 320
296 3300031595 Ga0265313_10024495 Ga0265313_100244952 320
297 3300035090 Ga0373949_0001994 Ga0373949_0001994_3932_4900 320
298 3300035092 Ga0373952_0016091 Ga0373952_0016091_365_1333 320
299 3300035112 Ga0373932_0003639 Ga0373932_0003639_1351_2319 320
300 3300035114 Ga0373939_0001079 Ga0373939_0001079_4549_5517 320
301 3300035115 Ga0373941_0002631 Ga0373941_0002631_1613_2581 320
302 3300035121 Ga0373960_0020112 Ga0373960_0020112_354_1322 320
303 3300035691 Ga0373931_0004505 Ga0373931_0004505_1378_2346 320
304 3300046684 Ga0495669_0097053 Ga0495669_0097053_246_1214 320
305 3300048903 Ga0496100_0000806 Ga0496100_0000806_13749_14717 320
306 3300048904 Ga0496101_0008655 Ga0496101_0008655_4522_5490 320
307 3300048905 Ga0496102_0005850 Ga0496102_0005850_1335_2303 320
308 3300048909 Ga0496106_0000782 Ga0496106_0000782_13766_14734 320
309 3300048910 Ga0496107_0001064 Ga0496107_0001064_11562_12530 320
310 3300048911 Ga0496108_0008984 Ga0496108_0008984_6927_7895 320
311 3300048912 Ga0496109_0042508 Ga0496109_0042508_2954_3922 320
312 3300048913 Ga0496110_0111674 Ga0496110_0111674_1340_2308 320
313 3300048914 Ga0496111_0073417 Ga0496111_0073417_541_1509 320
314 3300048916 Ga0496113_0049503 Ga0496113_0049503_1487_2455 320
315 3300048917 Ga0496114_0018697 Ga0496114_0018697_631_1599 320
316 3300048918 Ga0496115_0001718 Ga0496115_0001718_1921_2889 320
317 3300049592 Ga0501076_0166375 Ga0501076_0166375_266_1234 320
318 3300049593 Ga0501077_0013226 Ga0501077_0013226_30_998 320
319 3300049743 Ga0501081_0055263 Ga0501081_0055263_168_1136 320
320 3300050507 nmdc:mga05p37_20486_c1 nmdc:mga05p37_20486_c1_3536_4510 320
321 3300050511 nmdc:mga08y16_73993_c1 nmdc:mga08y16_73993_c1_1164_2132 320
322 3300050512 nmdc:mga0n895_4071_c1 nmdc:mga0n895_4071_c1_3743_4711 320
323 3300050513 nmdc:mga0rr50_152109_c1 nmdc:mga0rr50_152109_c1_432_1400 320
324 3300050514 nmdc:mga08x19_107498_c1 nmdc:mga08x19_107498_c1_610_1578 320
325 3300050514 nmdc:mga08x19_137288_c1 nmdc:mga08x19_137288_c1_648_1616 320
326 3300050515 nmdc:mga0a205_63882_c1 nmdc:mga0a205_63882_c1_1437_2405 320
327 3300060353 Ga0501082_0076653 Ga0501082_0076653_335_1303 320
328 3300005564 Ga0070664_100232450 Ga0070664_1002324502 321
329 3300005842 Ga0068858_100223543 Ga0068858_1002235432 321
330 3300006844 Ga0075428_100040633 Ga0075428_1000406333 321
331 3300009094 Ga0111539_10045686 Ga0111539_100456865 321
332 3300009147 Ga0114129_10095344 Ga0114129_100953443 321
333 3300025925 Ga0207650_10000743 Ga0207650_1000074324 321
334 3300037418 Ga0395900_0120177 Ga0395900_0120177_1232_2284 321
335 3300046474 Ga0495605_0091546 Ga0495605_0091546_187_1218 321
336 3300046491 Ga0495584_0019984 Ga0495584_0019984_611_1642 321
337 3300046506 Ga0495583_0001070 Ga0495583_0001070_20591_21631 321
338 3300046506 Ga0495583_0011275 Ga0495583_0011275_3837_4868 321
339 3300046513 Ga0495616_0010739 Ga0495616_0010739_2431_3462 321
340 3300046519 Ga0495632_0000530 Ga0495632_0000530_34760_35791 321
341 3300046810 Ga0495660_0018224 Ga0495660_0018224_139_1170 321
342 3300047446 Ga0495679_016361 Ga0495679_016361_122_1153 321
343 3300048903 Ga0496100_0030965 Ga0496100_0030965_2129_3118 321
344 3300048904 Ga0496101_0027887 Ga0496101_0027887_2432_3421 321
345 3300048905 Ga0496102_0014158 Ga0496102_0014158_5244_6233 321
346 3300048907 Ga0496104_0086386 Ga0496104_0086386_523_1512 321
347 3300048908 Ga0496105_0002273 Ga0496105_0002273_10143_11132 321
348 3300048909 Ga0496106_0013575 Ga0496106_0013575_278_1267 321
349 3300048911 Ga0496108_0001587 Ga0496108_0001587_3333_4322 321
350 3300048912 Ga0496109_0001253 Ga0496109_0001253_6814_7803 321
351 3300048914 Ga0496111_0000416 Ga0496111_0000416_10663_11652 321
352 3300048915 Ga0496112_0002998 Ga0496112_0002998_11226_12215 321
353 3300048916 Ga0496113_0000215 Ga0496113_0000215_1365_2354 321
354 3300050507 nmdc:mga05p37_122041_c1 nmdc:mga05p37_122041_c1_761_1750 321
355 3300050511 nmdc:mga08y16_116492_c1 nmdc:mga08y16_116492_c1_257_1246 321
356 3300053153 Ga0500616_0020313 Ga0500616_0020313_778_1785 321
357 3300025900 Ga0207710_10031004 Ga0207710_100310042 322
358 3300035170 Ga0373943_0201897 Ga0373943_0201897_53_1027 322
359 iso_pu_bacteria 2808606418 2809143223 322
360 3300025901 Ga0207688_10087598 Ga0207688_100875982 323
361 3300047320 Ga0495672_0001752 Ga0495672_0001752_3970_5043 323
362 3300053098 Ga0500650_0091834 Ga0500650_0091834_179_1159 323
363 iso_pu_bacteria 2643221547 2643758414 323
364 3300005436 Ga0070713_100003127 Ga0070713_10000312711 324
365 3300005439 Ga0070711_100102484 Ga0070711_1001024843 324
366 3300006042 Ga0075368_10066955 Ga0075368_100669552 324
367 3300006051 Ga0075364_10024740 Ga0075364_100247404 324
368 3300006847 Ga0075431_100070583 Ga0075431_1000705833 324
369 3300020081 Ga0206354_11320193 Ga0206354_113201932 324
370 3300025915 Ga0207693_10203121 Ga0207693_102031212 324
371 3300046471 Ga0495650_0000322 Ga0495650_0000322_7768_8826 324
372 3300046665 Ga0495661_0000049 Ga0495661_0000049_46731_47783 324
373 3300046683 Ga0495658_0021021 Ga0495658_0021021_145_1125 324
374 3300048904 Ga0496101_0062004 Ga0496101_0062004_268_1320 324
375 3300048912 Ga0496109_0161799 Ga0496109_0161799_259_1311 324
376 3300048915 Ga0496112_0015232 Ga0496112_0015232_5971_7023 324
377 3300048916 Ga0496113_0249270 Ga0496113_0249270_199_1251 324
378 3300048925 Ga0496122_0001753 Ga0496122_0001753_7940_8992 324
379 3300048926 Ga0496123_0003783 Ga0496123_0003783_3566_4618 324
380 3300048928 Ga0496125_0006247 Ga0496125_0006247_3966_5018 324
381 3300050490 nmdc:mga03n38_47518_c1 nmdc:mga03n38_47518_c1_363_1388 324
382 3300050496 nmdc:mga07m45_42260_c1 nmdc:mga07m45_42260_c1_1454_2479 324
383 3300050507 nmdc:mga05p37_120335_c1 nmdc:mga05p37_120335_c1_1902_2885 324
384 3300050509 nmdc:mga0qj67_67130_c1 nmdc:mga0qj67_67130_c1_1739_2722 324
385 3300050510 nmdc:mga06r32_135821_c1 nmdc:mga06r32_135821_c1_1083_2066 324
386 3300053119 Ga0500595_006007 Ga0500595_006007_1967_2992 324
387 3300053153 Ga0500616_0073191 Ga0500616_0073191_513_1538 324
388 3300005354 Ga0070675_100049682 Ga0070675_1000496824 325
389 3300005546 Ga0070696_100225652 Ga0070696_1002256522 325
390 3300006847 Ga0075431_100336755 Ga0075431_1003367552 325
391 3300013307 Ga0157372_10006003 Ga0157372_1000600316 325
392 3300014968 Ga0157379_10070713 Ga0157379_100707134 325
393 3300025315 Ga0207697_10106732 Ga0207697_101067322 325
394 3300025901 Ga0207688_10081666 Ga0207688_100816662 325
395 3300025933 Ga0207706_10276072 Ga0207706_102760722 325
396 3300027682 Ga0209971_1006118 Ga0209971_10061182 325
397 3300027695 Ga0209966_1003962 Ga0209966_10039621 325
398 3300031241 Ga0265325_10011730 Ga0265325_100117302 325
399 3300034957 Ga0373938_0000151 Ga0373938_0000151_8748_9731 325
400 3300037312 Ga0395899_0031176 Ga0395899_0031176_1488_2471 325
401 3300037418 Ga0395900_0015232 Ga0395900_0015232_5289_6272 325
402 3300037418 Ga0395900_0187776 Ga0395900_0187776_732_1715 325
403 3300037466 Ga0395898_0080033 Ga0395898_0080033_1464_2447 325
404 3300037466 Ga0395898_0105504 Ga0395898_0105504_1030_2016 325
405 3300038443 Ga0395901_0081984 Ga0395901_0081984_1326_2309 325
406 3300044694 Ga0466963_0000255 Ga0466963_0000255_10393_11376 325
407 3300044694 Ga0466963_0190919 Ga0466963_0190919_373_1356 325
408 3300044694 Ga0466963_0241059 Ga0466963_0241059_205_1188 325
409 3300044842 Ga0466957_0021505 Ga0466957_0021505_167_1150 325
410 3300045976 Ga0466967_0002672 Ga0466967_0002672_1315_2298 325
411 3300048091 Ga0495626_0095564 Ga0495626_0095564_120_1163 325
412 3300049571 Ga0501034_0072331 Ga0501034_0072331_2459_3442 325
413 3300049574 Ga0501038_0139520 Ga0501038_0139520_60_1043 325
414 3300049577 Ga0501041_0111693 Ga0501041_0111693_190_1188 325
415 3300049581 Ga0501047_0085291 Ga0501047_0085291_849_1832 325
416 3300049587 Ga0501071_0054905 Ga0501071_0054905_820_1818 325
417 3300049588 Ga0501072_0055797 Ga0501072_0055797_73_1062 325
418 3300049588 Ga0501072_0132378 Ga0501072_0132378_960_1943 325
419 3300049591 Ga0501075_0021286 Ga0501075_0021286_1795_2784 325
420 3300049591 Ga0501075_0122141 Ga0501075_0122141_575_1573 325
421 3300049592 Ga0501076_0037727 Ga0501076_0037727_1906_2895 325
422 3300049592 Ga0501076_0059533 Ga0501076_0059533_1281_2279 325
423 3300049593 Ga0501077_0006663 Ga0501077_0006663_3324_4313 325
424 3300049741 Ga0501079_0002094 Ga0501079_0002094_5289_6278 325
425 3300049824 Ga0501045_0232864 Ga0501045_0232864_325_1323 325
426 3300050513 nmdc:mga0rr50_216119_c1 nmdc:mga0rr50_216119_c1_503_1489 325
427 3300054114 Ga0501084_0002873 Ga0501084_0002873_3013_4002 325
428 3300054114 Ga0501084_0240306 Ga0501084_0240306_361_1344 325
429 3300060353 Ga0501082_0080565 Ga0501082_0080565_1484_2482 325
430 3300061734 Ga0530510_0052308 Ga0530510_0052308_1440_2429 325
431 3300003215 JGI25153J46596_10003330 JGI25153J46596_100033303 326
432 3300005330 Ga0070690_100015717 Ga0070690_1000157174 326
433 3300005333 Ga0070677_10010167 Ga0070677_100101673 326
434 3300005334 Ga0068869_100046245 Ga0068869_1000462452 326
435 3300005336 Ga0070680_100031606 Ga0070680_1000316062 326
436 3300005338 Ga0068868_100097555 Ga0068868_1000975552 326
437 3300005339 Ga0070660_100321427 Ga0070660_1003214271 326
438 3300005339 Ga0070660_100334729 Ga0070660_1003347292 326
439 3300005344 Ga0070661_100059600 Ga0070661_1000596003 326
440 3300005353 Ga0070669_100038922 Ga0070669_1000389223 326
441 3300005354 Ga0070675_100011412 Ga0070675_1000114122 326
442 3300005355 Ga0070671_100070337 Ga0070671_1000703372 326
443 3300005356 Ga0070674_100016960 Ga0070674_1000169602 326
444 3300005356 Ga0070674_100210849 Ga0070674_1002108491 326
445 3300005364 Ga0070673_100327494 Ga0070673_1003274941 326
446 3300005366 Ga0070659_100172661 Ga0070659_1001726612 326
447 3300005406 Ga0070703_10028431 Ga0070703_100284312 326
448 3300005435 Ga0070714_100013144 Ga0070714_1000131444 326
449 3300005435 Ga0070714_100150094 Ga0070714_1001500942 326
450 3300005437 Ga0070710_10041225 Ga0070710_100412252 326
451 3300005437 Ga0070710_10060527 Ga0070710_100605272 326
452 3300005438 Ga0070701_10020616 Ga0070701_100206162 326
453 3300005455 Ga0070663_100049988 Ga0070663_1000499884 326
454 3300005455 Ga0070663_100162645 Ga0070663_1001626452 326
455 3300005456 Ga0070678_100052827 Ga0070678_1000528272 326
456 3300005457 Ga0070662_100040719 Ga0070662_1000407193 326
457 3300005457 Ga0070662_100243235 Ga0070662_1002432352 326
458 3300005458 Ga0070681_10008531 Ga0070681_100085313 326
459 3300005466 Ga0070685_10029919 Ga0070685_100299192 326
460 3300005468 Ga0070707_100204783 Ga0070707_1002047832 326
461 3300005518 Ga0070699_100003093 Ga0070699_10000309317 326
462 3300005530 Ga0070679_100017445 Ga0070679_1000174452 326
463 3300005536 Ga0070697_100060873 Ga0070697_1000608733 326
464 3300005536 Ga0070697_100312320 Ga0070697_1003123201 326
465 3300005539 Ga0068853_100087460 Ga0068853_1000874602 326
466 3300005543 Ga0070672_100079454 Ga0070672_1000794543 326
467 3300005545 Ga0070695_100185533 Ga0070695_1001855332 326
468 3300005548 Ga0070665_100089591 Ga0070665_1000895913 326
469 3300005563 Ga0068855_100040118 Ga0068855_1000401186 326
470 3300005564 Ga0070664_100049659 Ga0070664_1000496595 326
471 3300005615 Ga0070702_100058381 Ga0070702_1000583811 326
472 3300005616 Ga0068852_100087545 Ga0068852_1000875453 326
473 3300005617 Ga0068859_100073377 Ga0068859_1000733773 326
474 3300005617 Ga0068859_100263538 Ga0068859_1002635382 326
475 3300005718 Ga0068866_10041065 Ga0068866_100410653 326
476 3300005841 Ga0068863_100071965 Ga0068863_1000719652 326
477 3300005843 Ga0068860_100010732 Ga0068860_1000107324 326
478 3300005844 Ga0068862_100107984 Ga0068862_1001079842 326
479 3300005844 Ga0068862_100185952 Ga0068862_1001859521 326
480 3300005937 Ga0081455_10000209 Ga0081455_1000020960 326
481 3300005937 Ga0081455_10001640 Ga0081455_100016402 326
482 3300005937 Ga0081455_10052830 Ga0081455_100528303 326
483 3300005937 Ga0081455_10149165 Ga0081455_101491652 326
484 3300005937 Ga0081455_10160779 Ga0081455_101607792 326
485 3300005981 Ga0081538_10061674 Ga0081538_100616743 326
486 3300005983 Ga0081540_1019759 Ga0081540_10197595 326
487 3300005985 Ga0081539_10029790 Ga0081539_100297902 326
488 3300005985 Ga0081539_10039242 Ga0081539_100392421 326
489 3300006028 Ga0070717_10040382 Ga0070717_100403821 326
490 3300006028 Ga0070717_10095309 Ga0070717_100953093 326
491 3300006028 Ga0070717_10290733 Ga0070717_102907331 326
492 3300006173 Ga0070716_100157913 Ga0070716_1001579132 326
493 3300006353 Ga0075370_10160632 Ga0075370_101606322 326
494 3300006844 Ga0075428_100158465 Ga0075428_1001584653 326
495 3300006844 Ga0075428_100174930 Ga0075428_1001749303 326
496 3300006844 Ga0075428_100189560 Ga0075428_1001895602 326
497 3300006847 Ga0075431_100080913 Ga0075431_1000809132 326
498 3300006847 Ga0075431_100206396 Ga0075431_1002063963 326
499 3300006931 Ga0097620_100073377 Ga0097620_1000733773 326
500 3300006931 Ga0097620_100263548 Ga0097620_1002635482 326
501 3300009094 Ga0111539_10159158 Ga0111539_101591582 326
502 3300009094 Ga0111539_10196236 Ga0111539_101962363 326
503 3300009098 Ga0105245_10178764 Ga0105245_101787642 326
504 3300009098 Ga0105245_10205176 Ga0105245_102051762 326
505 3300009101 Ga0105247_10016996 Ga0105247_100169963 326
506 3300009101 Ga0105247_10171123 Ga0105247_101711232 326
507 3300009147 Ga0114129_10100655 Ga0114129_101006553 326
508 3300009147 Ga0114129_10347780 Ga0114129_103477802 326
509 3300009176 Ga0105242_10308819 Ga0105242_103088192 326
510 3300009177 Ga0105248_10452980 Ga0105248_104529801 326
511 3300009545 Ga0105237_10205699 Ga0105237_102056992 326
512 3300009551 Ga0105238_10087006 Ga0105238_100870062 326
513 3300009553 Ga0105249_10032452 Ga0105249_100324523 326
514 3300011119 Ga0105246_10046723 Ga0105246_100467231 326
515 3300013306 Ga0163162_10404595 Ga0163162_104045952 326
516 3300013307 Ga0157372_10232613 Ga0157372_102326132 326
517 3300013307 Ga0157372_10398222 Ga0157372_103982222 326
518 3300013308 Ga0157375_10246725 Ga0157375_102467252 326
519 3300013308 Ga0157375_10311881 Ga0157375_103118812 326
520 3300014326 Ga0157380_10008840 Ga0157380_100088405 326
521 3300014326 Ga0157380_10157758 Ga0157380_101577582 326
522 3300014745 Ga0157377_10002924 Ga0157377_100029245 326
523 3300014968 Ga0157379_10024836 Ga0157379_100248364 326
524 3300014969 Ga0157376_10204644 Ga0157376_102046442 326
525 3300017792 Ga0163161_10148822 Ga0163161_101488222 326
526 3300021384 Ga0213876_10008996 Ga0213876_100089962 326
527 3300021384 Ga0213876_10029221 Ga0213876_100292212 326
528 3300025297 Ga0209758_1000158 Ga0209758_1000158152 326
529 3300025302 Ga0207426_1020337 Ga0207426_10203373 326
530 3300025893 Ga0207682_10006222 Ga0207682_100062225 326
531 3300025898 Ga0207692_10015830 Ga0207692_100158304 326
532 3300025898 Ga0207692_10060212 Ga0207692_100602122 326
533 3300025898 Ga0207692_10098876 Ga0207692_100988762 326
534 3300025899 Ga0207642_10013792 Ga0207642_100137922 326
535 3300025900 Ga0207710_10008348 Ga0207710_100083482 326
536 3300025901 Ga0207688_10000262 Ga0207688_100002625 326
537 3300025903 Ga0207680_10053610 Ga0207680_100536103 326
538 3300025905 Ga0207685_10042113 Ga0207685_100421132 326
539 3300025907 Ga0207645_10013182 Ga0207645_100131824 326
540 3300025908 Ga0207643_10002713 Ga0207643_100027137 326
541 3300025909 Ga0207705_10079496 Ga0207705_100794962 326
542 3300025912 Ga0207707_10025302 Ga0207707_100253023 326
543 3300025914 Ga0207671_10149440 Ga0207671_101494402 326
544 3300025918 Ga0207662_10044859 Ga0207662_100448593 326
545 3300025919 Ga0207657_10034331 Ga0207657_100343315 326
546 3300025920 Ga0207649_10031396 Ga0207649_100313962 326
547 3300025921 Ga0207652_10061488 Ga0207652_100614882 326
548 3300025924 Ga0207694_10036921 Ga0207694_100369214 326
549 3300025926 Ga0207659_10022466 Ga0207659_100224662 326
550 3300025927 Ga0207687_10073745 Ga0207687_100737452 326
551 3300025932 Ga0207690_10249889 Ga0207690_102498892 326
552 3300025933 Ga0207706_10005187 Ga0207706_100051875 326
553 3300025935 Ga0207709_10117034 Ga0207709_101170342 326
554 3300025936 Ga0207670_10005380 Ga0207670_100053805 326
555 3300025936 Ga0207670_10371119 Ga0207670_103711191 326
556 3300025937 Ga0207669_10011106 Ga0207669_100111064 326
557 3300025937 Ga0207669_10077664 Ga0207669_100776642 326
558 3300025939 Ga0207665_10020078 Ga0207665_100200784 326
559 3300025940 Ga0207691_10001015 Ga0207691_1000101512 326
560 3300025941 Ga0207711_10165963 Ga0207711_101659632 326
561 3300025941 Ga0207711_10401790 Ga0207711_104017902 326
562 3300025942 Ga0207689_10036395 Ga0207689_100363954 326
563 3300025960 Ga0207651_10085264 Ga0207651_100852642 326
564 3300025981 Ga0207640_10146369 Ga0207640_101463692 326
565 3300026035 Ga0207703_10140304 Ga0207703_101403042 326
566 3300026067 Ga0207678_10034290 Ga0207678_100342903 326
567 3300026067 Ga0207678_10079722 Ga0207678_100797223 326
568 3300026075 Ga0207708_10000358 Ga0207708_1000035811 326
569 3300026088 Ga0207641_10080365 Ga0207641_100803652 326
570 3300026089 Ga0207648_10001075 Ga0207648_1000107528 326
571 3300026089 Ga0207648_10136005 Ga0207648_101360052 326
572 3300026095 Ga0207676_10052251 Ga0207676_100522512 326
573 3300026118 Ga0207675_100034640 Ga0207675_1000346402 326
574 3300026121 Ga0207683_10005615 Ga0207683_100056157 326
575 3300026121 Ga0207683_10051838 Ga0207683_100518384 326
576 3300028379 Ga0268266_10152012 Ga0268266_101520123 326
577 3300028380 Ga0268265_10008056 Ga0268265_100080565 326
578 3300028380 Ga0268265_10120219 Ga0268265_101202192 326
579 3300028381 Ga0268264_10096411 Ga0268264_100964112 326
580 3300031240 Ga0265320_10032363 Ga0265320_100323632 326
581 3300031241 Ga0265325_10094433 Ga0265325_100944332 326
582 3300031247 Ga0265340_10027878 Ga0265340_100278782 326
583 3300031249 Ga0265339_10031835 Ga0265339_100318352 326
584 3300031344 Ga0265316_10027004 Ga0265316_100270044 326
585 3300031712 Ga0265342_10017708 Ga0265342_100177084 326
586 3300032133 Ga0316583_10000603 Ga0316583_100006034 326
587 3300035088 Ga0373940_0030186 Ga0373940_0030186_24_1082 326
588 3300035119 Ga0373956_0014993 Ga0373956_0014993_1520_2506 326
589 3300035120 Ga0373957_0062008 Ga0373957_0062008_171_1157 326
590 3300035121 Ga0373960_0004279 Ga0373960_0004279_565_1623 326
591 3300035172 Ga0373955_0012410 Ga0373955_0012410_1556_2542 326
592 3300035241 Ga0373961_0008943 Ga0373961_0008943_29_1069 326
593 3300035692 Ga0373935_0197096 Ga0373935_0197096_248_1234 326
594 3300035724 Ga0373933_0201583 Ga0373933_0201583_78_1064 326
595 3300036401 Ga0373937_0053125 Ga0373937_0053125_1556_2542 326
596 3300037466 Ga0395898_0052801 Ga0395898_0052801_2025_3071 326
597 3300037471 Ga0395905_0161254 Ga0395905_0161254_931_1977 326
598 3300037471 Ga0395905_0437463 Ga0395905_0437463_47_1036 326
599 3300039437 Ga0436365_0932459 Ga0436365_0932459_1686_2675 326
600 3300039447 Ga0436361_0726405 Ga0436361_0726405_3029_4024 326
601 3300041512 Ga0451853_0997884 Ga0451853_0997884_89_1078 326
602 3300044683 Ga0466965_0008580 Ga0466965_0008580_2589_3626 326
603 3300044684 Ga0466966_0015172 Ga0466966_0015172_1761_2798 326
604 3300044684 Ga0466966_0059790 Ga0466966_0059790_1022_2062 326
605 3300046457 Ga0495590_0000013 Ga0495590_0000013_194663_195709 326
606 3300046458 Ga0495591_000109 Ga0495591_000109_24080_25126 326
607 3300046460 Ga0495638_0004233 Ga0495638_0004233_7880_8869 326
608 3300046462 Ga0495651_0056264 Ga0495651_0056264_485_1471 326
609 3300046491 Ga0495584_0000029 Ga0495584_0000029_8162_9208 326
610 3300046491 Ga0495584_0004385 Ga0495584_0004385_6073_7122 326
611 3300046492 Ga0495585_0077342 Ga0495585_0077342_122_1171 326
612 3300046492 Ga0495585_0131863 Ga0495585_0131863_171_1160 326
613 3300046500 Ga0495596_0004688 Ga0495596_0004688_2575_3627 326
614 3300046500 Ga0495596_0009396 Ga0495596_0009396_1396_2442 326
615 3300046501 Ga0495607_0002596 Ga0495607_0002596_10269_11315 326
616 3300046501 Ga0495607_0011649 Ga0495607_0011649_4480_5517 326
617 3300046501 Ga0495607_0023691 Ga0495607_0023691_1788_2837 326
618 3300046506 Ga0495583_0009969 Ga0495583_0009969_4284_5330 326
619 3300046506 Ga0495583_0046864 Ga0495583_0046864_111_1151 326
620 3300046507 Ga0495606_0030335 Ga0495606_0030335_2541_3590 326
621 3300046512 Ga0495610_0048174 Ga0495610_0048174_828_1877 326
622 3300046513 Ga0495616_0003207 Ga0495616_0003207_5660_6700 326
623 3300046513 Ga0495616_0056302 Ga0495616_0056302_592_1641 326
624 3300046514 Ga0495618_0082799 Ga0495618_0082799_1017_2006 326
625 3300046516 Ga0495628_0006258 Ga0495628_0006258_1062_2048 326
626 3300046516 Ga0495628_0153375 Ga0495628_0153375_702_1691 326
627 3300046518 Ga0495631_0009316 Ga0495631_0009316_1496_2545 326
628 3300046518 Ga0495631_0011171 Ga0495631_0011171_2760_3806 326
629 3300046518 Ga0495631_0015481 Ga0495631_0015481_196_1236 326
630 3300046520 Ga0495637_0000008 Ga0495637_0000008_75915_76961 326
631 3300046523 Ga0495644_0028261 Ga0495644_0028261_218_1258 326
632 3300046524 Ga0495648_0012819 Ga0495648_0012819_1077_2129 326
633 3300046524 Ga0495648_0016800 Ga0495648_0016800_580_1629 326
634 3300046528 Ga0495642_0093966 Ga0495642_0093966_82_1128 326
635 3300046529 Ga0495652_0058188 Ga0495652_0058188_753_1739 326
636 3300046538 Ga0495609_0004835 Ga0495609_0004835_3698_4750 326
637 3300046538 Ga0495609_0101618 Ga0495609_0101618_153_1199 326
638 3300046558 Ga0495633_0000874 Ga0495633_0000874_2597_3643 326
639 3300046559 Ga0495667_0050977 Ga0495667_0050977_574_1560 326
640 3300046615 Ga0495656_0067904 Ga0495656_0067904_144_1181 326
641 3300046648 Ga0495611_0000410 Ga0495611_0000410_17907_18953 326
642 3300046663 Ga0495635_0085362 Ga0495635_0085362_734_1720 326
643 3300046675 Ga0495657_0020435 Ga0495657_0020435_739_1725 326
644 3300046683 Ga0495658_0099415 Ga0495658_0099415_329_1318 326
645 3300046691 Ga0495670_0030691 Ga0495670_0030691_595_1644 326
646 3300046694 Ga0495649_0000071 Ga0495649_0000071_65339_66385 326
647 3300046794 Ga0495589_0036872 Ga0495589_0036872_764_1804 326
648 3300046810 Ga0495660_0007687 Ga0495660_0007687_5260_6306 326
649 3300047317 Ga0495604_0004634 Ga0495604_0004634_8720_9706 326
650 3300047320 Ga0495672_0000033 Ga0495672_0000033_191123_192169 326
651 3300047322 Ga0495680_0073679 Ga0495680_0073679_1009_1995 326
652 3300047323 Ga0495683_0000168 Ga0495683_0000168_23200_24246 326
653 3300047323 Ga0495683_0041154 Ga0495683_0041154_1109_2158 326
654 3300047323 Ga0495683_0063091 Ga0495683_0063091_560_1612 326
655 3300047443 Ga0495687_002679 Ga0495687_002679_11587_12627 326
656 3300047445 Ga0495677_0000910 Ga0495677_0000910_7958_9004 326
657 3300047446 Ga0495679_033131 Ga0495679_033131_332_1378 326
658 3300047470 Ga0495681_0006172 Ga0495681_0006172_3887_4927 326
659 3300047470 Ga0495681_0083340 Ga0495681_0083340_127_1173 326
660 3300047471 Ga0495684_0166451 Ga0495684_0166451_216_1202 326
661 3300047472 Ga0495686_0025648 Ga0495686_0025648_1048_2094 326
662 3300048088 Ga0495602_0006383 Ga0495602_0006383_1507_2493 326
663 3300048091 Ga0495626_0037034 Ga0495626_0037034_1107_2153 326
664 3300048903 Ga0496100_0031708 Ga0496100_0031708_429_1418 326
665 3300048905 Ga0496102_0179152 Ga0496102_0179152_720_1709 326
666 3300048906 Ga0496103_0012301 Ga0496103_0012301_728_1717 326
667 3300048907 Ga0496104_0148862 Ga0496104_0148862_111_1100 326
668 3300048908 Ga0496105_0025717 Ga0496105_0025717_1931_2920 326
669 3300048909 Ga0496106_0029782 Ga0496106_0029782_2219_3208 326
670 3300048909 Ga0496106_0386495 Ga0496106_0386495_46_1092 326
671 3300048910 Ga0496107_0002049 Ga0496107_0002049_2759_3748 326
672 3300048910 Ga0496107_0029290 Ga0496107_0029290_2276_3322 326
673 3300048910 Ga0496107_0043893 Ga0496107_0043893_1392_2381 326
674 3300048911 Ga0496108_0040406 Ga0496108_0040406_1384_2373 326
675 3300048913 Ga0496110_0028356 Ga0496110_0028356_320_1312 326
676 3300048914 Ga0496111_0046274 Ga0496111_0046274_756_1745 326
677 3300048916 Ga0496113_0174989 Ga0496113_0174989_549_1538 326
678 3300048917 Ga0496114_0040057 Ga0496114_0040057_1482_2471 326
679 3300048918 Ga0496115_0024187 Ga0496115_0024187_3101_4090 326
680 3300048918 Ga0496115_0077466 Ga0496115_0077466_1436_2494 326
681 3300048918 Ga0496115_0184135 Ga0496115_0184135_109_1098 326
682 3300049459 Ga0495678_000024 Ga0495678_000024_133138_134184 326
683 3300049459 Ga0495678_000061 Ga0495678_000061_96941_97981 326
684 3300049460 Ga0495682_0001519 Ga0495682_0001519_7877_8917 326
685 3300049460 Ga0495682_0023599 Ga0495682_0023599_169_1215 326
686 3300049568 Ga0501031_0007697 Ga0501031_0007697_1224_2213 326
687 3300049568 Ga0501031_0076562 Ga0501031_0076562_227_1267 326
688 3300049569 Ga0501032_0012676 Ga0501032_0012676_806_1795 326
689 3300049569 Ga0501032_0047591 Ga0501032_0047591_914_1954 326
690 3300049570 Ga0501033_0010744 Ga0501033_0010744_1050_2090 326
691 3300049570 Ga0501033_0014803 Ga0501033_0014803_3725_4714 326
692 3300049570 Ga0501033_0041519 Ga0501033_0041519_736_1740 326
693 3300049571 Ga0501034_0069583 Ga0501034_0069583_1050_2090 326
694 3300049571 Ga0501034_0079371 Ga0501034_0079371_2133_3122 326
695 3300049572 Ga0501036_0001896 Ga0501036_0001896_15003_16043 326
696 3300049572 Ga0501036_0012065 Ga0501036_0012065_5239_6243 326
697 3300049573 Ga0501037_0013364 Ga0501037_0013364_4743_5732 326
698 3300049573 Ga0501037_0034705 Ga0501037_0034705_442_1482 326
699 3300049574 Ga0501038_0011296 Ga0501038_0011296_5990_6979 326
700 3300049574 Ga0501038_0015310 Ga0501038_0015310_3345_4349 326
701 3300049575 Ga0501039_0026855 Ga0501039_0026855_534_1538 326
702 3300049575 Ga0501039_0066303 Ga0501039_0066303_819_1808 326
703 3300049576 Ga0501040_0005348 Ga0501040_0005348_1933_2937 326
704 3300049577 Ga0501041_0008980 Ga0501041_0008980_4050_5054 326
705 3300049578 Ga0501042_0008836 Ga0501042_0008836_3193_4197 326
706 3300049581 Ga0501047_0046651 Ga0501047_0046651_974_1963 326
707 3300049581 Ga0501047_0206302 Ga0501047_0206302_200_1240 326
708 3300049582 Ga0501048_0025358 Ga0501048_0025358_1646_2650 326
709 3300049583 Ga0501067_0039738 Ga0501067_0039738_1069_2109 326
710 3300049584 Ga0501068_0057648 Ga0501068_0057648_433_1473 326
711 3300049584 Ga0501068_0058676 Ga0501068_0058676_753_1757 326
712 3300049585 Ga0501069_0006910 Ga0501069_0006910_199_1239 326
713 3300049586 Ga0501070_0020457 Ga0501070_0020457_958_1947 326
714 3300049588 Ga0501072_0001618 Ga0501072_0001618_13102_14106 326
715 3300049589 Ga0501073_0024329 Ga0501073_0024329_2395_3435 326
716 3300049591 Ga0501075_0000784 Ga0501075_0000784_10131_11135 326
717 3300049592 Ga0501076_0001426 Ga0501076_0001426_12440_13444 326
718 3300049741 Ga0501079_0005043 Ga0501079_0005043_7945_8949 326
719 3300049742 Ga0501080_0042100 Ga0501080_0042100_828_1832 326
720 3300049743 Ga0501081_0011772 Ga0501081_0011772_4370_5374 326
721 3300049744 Ga0501083_0005838 Ga0501083_0005838_6344_7384 326
722 3300049744 Ga0501083_0026484 Ga0501083_0026484_698_1702 326
723 3300049744 Ga0501083_0107285 Ga0501083_0107285_474_1466 326
724 3300049823 Ga0501044_0000084 Ga0501044_0000084_22466_23506 326
725 3300049823 Ga0501044_0111899 Ga0501044_0111899_353_1342 326
726 3300049823 Ga0501044_0278065 Ga0501044_0278065_466_1455 326
727 3300049824 Ga0501045_0148243 Ga0501045_0148243_292_1296 326
728 3300050489 nmdc:mga03683_21567_c1 nmdc:mga03683_21567_c1_1192_2181 326
729 3300050492 nmdc:mga0yw44_167638_c1 nmdc:mga0yw44_167638_c1_280_1269 326
730 3300050507 nmdc:mga05p37_224789_c1 nmdc:mga05p37_224789_c1_112_1101 326
731 3300050508 nmdc:mga09592_74927_c1 nmdc:mga09592_74927_c1_960_1958 326
732 3300050510 nmdc:mga06r32_96585_c1 nmdc:mga06r32_96585_c1_1404_2402 326
733 3300050511 nmdc:mga08y16_129212_c1 nmdc:mga08y16_129212_c1_678_1667 326
734 3300050512 nmdc:mga0n895_389536_c1 nmdc:mga0n895_389536_c1_117_1109 326
735 3300050513 nmdc:mga0rr50_159095_c1 nmdc:mga0rr50_159095_c1_305_1297 326
736 3300050515 nmdc:mga0a205_111119_c1 nmdc:mga0a205_111119_c1_589_1581 326
737 3300053077 Ga0495601_0001025 Ga0495601_0001025_10215_11201 326
738 3300053084 Ga0495595_0001239 Ga0495595_0001239_8532_9518 326
739 3300053084 Ga0495595_0100010 Ga0495595_0100010_168_1157 326
740 3300053085 Ga0495619_0001774 Ga0495619_0001774_9357_10343 326
741 3300053085 Ga0495619_0273583 Ga0495619_0273583_92_1081 326
742 3300053131 Ga0500652_058240 Ga0500652_058240_37_1074 326
743 3300060353 Ga0501082_0012045 Ga0501082_0012045_1234_2238 326
744 3300061734 Ga0530510_0000158 Ga0530510_0000158_27549_28553 326
745 3300061734 Ga0530510_0128852 Ga0530510_0128852_222_1211 326
746 3300000041 ARcpr5oldR_c000022 ARcpr5oldR_00002212 327
747 3300000042 ARSoilYngRDRAFT_c00124 ARSoilYngRDRAFT_001245 327
748 3300000043 ARcpr5yngRDRAFT_c000127 ARcpr5yngRDRAFT_0001275 327
749 3300000044 ARSoilOldRDRAFT_c000182 ARSoilOldRDRAFT_0001825 327
750 3300000045 ARCol0oldRDRAFT_c00133 ARCol0oldRDRAFT_001336 327
751 3300000652 ARCol0yngRDRAFT_1000244 ARCol0yngRDRAFT_10002445 327
752 3300001990 JGI24737J22298_10003452 JGI24737J22298_100034522 327
753 3300005290 Ga0065712_10073486 Ga0065712_100734864 327
754 3300005328 Ga0070676_10017202 Ga0070676_100172023 327
755 3300005330 Ga0070690_100083018 Ga0070690_1000830183 327
756 3300005330 Ga0070690_100289108 Ga0070690_1002891081 327
757 3300005331 Ga0070670_100392200 Ga0070670_1003922001 327
758 3300005334 Ga0068869_100084615 Ga0068869_1000846152 327
759 3300005335 Ga0070666_10006602 Ga0070666_100066023 327
760 3300005335 Ga0070666_10062024 Ga0070666_100620243 327
761 3300005336 Ga0070680_100016299 Ga0070680_1000162992 327
762 3300005336 Ga0070680_100033258 Ga0070680_1000332583 327
763 3300005336 Ga0070680_100146404 Ga0070680_1001464041 327
764 3300005337 Ga0070682_100006283 Ga0070682_1000062838 327
765 3300005337 Ga0070682_100128359 Ga0070682_1001283591 327
766 3300005339 Ga0070660_100092905 Ga0070660_1000929052 327
767 3300005344 Ga0070661_100057287 Ga0070661_1000572872 327
768 3300005347 Ga0070668_100148599 Ga0070668_1001485992 327
769 3300005367 Ga0070667_100009580 Ga0070667_1000095808 327
770 3300005367 Ga0070667_100557304 Ga0070667_1005573041 327
771 3300005434 Ga0070709_10001382 Ga0070709_1000138210 327
772 3300005434 Ga0070709_10082042 Ga0070709_100820423 327
773 3300005435 Ga0070714_100003309 Ga0070714_1000033099 327
774 3300005435 Ga0070714_100091829 Ga0070714_1000918292 327
775 3300005436 Ga0070713_100006430 Ga0070713_1000064302 327
776 3300005437 Ga0070710_10010291 Ga0070710_100102912 327
777 3300005437 Ga0070710_10023419 Ga0070710_100234192 327
778 3300005439 Ga0070711_100038864 Ga0070711_1000388644 327
779 3300005439 Ga0070711_100093216 Ga0070711_1000932162 327
780 3300005441 Ga0070700_100237365 Ga0070700_1002373652 327
781 3300005444 Ga0070694_100055279 Ga0070694_1000552792 327
782 3300005444 Ga0070694_100148370 Ga0070694_1001483701 327
783 3300005455 Ga0070663_100012485 Ga0070663_1000124853 327
784 3300005455 Ga0070663_100028209 Ga0070663_1000282093 327
785 3300005457 Ga0070662_100007259 Ga0070662_1000072596 327
786 3300005457 Ga0070662_100057910 Ga0070662_1000579103 327
787 3300005458 Ga0070681_10034265 Ga0070681_100342654 327
788 3300005530 Ga0070679_100037757 Ga0070679_1000377574 327
789 3300005530 Ga0070679_100232897 Ga0070679_1002328972 327
790 3300005544 Ga0070686_100184039 Ga0070686_1001840391 327
791 3300005545 Ga0070695_100177787 Ga0070695_1001777871 327
792 3300005546 Ga0070696_100262306 Ga0070696_1002623061 327
793 3300005547 Ga0070693_100006238 Ga0070693_1000062384 327
794 3300005548 Ga0070665_100220572 Ga0070665_1002205721 327
795 3300005564 Ga0070664_100090632 Ga0070664_1000906321 327
796 3300005564 Ga0070664_100349043 Ga0070664_1003490432 327
797 3300005578 Ga0068854_100003622 Ga0068854_1000036226 327
798 3300005614 Ga0068856_100021694 Ga0068856_1000216947 327
799 3300005614 Ga0068856_100397280 Ga0068856_1003972802 327
800 3300005615 Ga0070702_100025792 Ga0070702_1000257923 327
801 3300005618 Ga0068864_100005577 Ga0068864_1000055776 327
802 3300005618 Ga0068864_100036637 Ga0068864_1000366372 327
803 3300005718 Ga0068866_10037168 Ga0068866_100371682 327
804 3300005719 Ga0068861_100062966 Ga0068861_1000629662 327
805 3300005719 Ga0068861_100270621 Ga0068861_1002706212 327
806 3300005840 Ga0068870_10001295 Ga0068870_100012955 327
807 3300005842 Ga0068858_100055331 Ga0068858_1000553314 327
808 3300005843 Ga0068860_100009949 Ga0068860_1000099496 327
809 3300005937 Ga0081455_10003885 Ga0081455_100038856 327
810 3300005937 Ga0081455_10007107 Ga0081455_100071078 327
811 3300006163 Ga0070715_10046818 Ga0070715_100468181 327
812 3300006175 Ga0070712_100026284 Ga0070712_1000262842 327
813 3300006175 Ga0070712_100063268 Ga0070712_1000632683 327
814 3300006237 Ga0097621_100012683 Ga0097621_1000126832 327
815 3300006353 Ga0075370_10231347 Ga0075370_102313472 327
816 3300006358 Ga0068871_100003984 Ga0068871_1000039846 327
817 3300006358 Ga0068871_100014697 Ga0068871_1000146974 327
818 3300006844 Ga0075428_100008075 Ga0075428_1000080756 327
819 3300006846 Ga0075430_100000304 Ga0075430_10000030426 327
820 3300006846 Ga0075430_100228067 Ga0075430_1002280671 327
821 3300006847 Ga0075431_100006534 Ga0075431_1000065345 327
822 3300006852 Ga0075433_10000958 Ga0075433_1000095814 327
823 3300006871 Ga0075434_100001677 Ga0075434_1000016775 327
824 3300006871 Ga0075434_100026434 Ga0075434_1000264345 327
825 3300006871 Ga0075434_100052639 Ga0075434_1000526394 327
826 3300006871 Ga0075434_100094886 Ga0075434_1000948862 327
827 3300006871 Ga0075434_100142354 Ga0075434_1001423542 327
828 3300006880 Ga0075429_100013390 Ga0075429_1000133903 327
829 3300006881 Ga0068865_100006167 Ga0068865_1000061676 327
830 3300007076 Ga0075435_100098556 Ga0075435_1000985563 327
831 3300009011 Ga0105251_10025235 Ga0105251_100252352 327
832 3300009093 Ga0105240_10059489 Ga0105240_100594895 327
833 3300009094 Ga0111539_10000138 Ga0111539_1000013871 327
834 3300009094 Ga0111539_10013242 Ga0111539_1001324210 327
835 3300009094 Ga0111539_10041591 Ga0111539_100415913 327
836 3300009094 Ga0111539_10097609 Ga0111539_100976092 327
837 3300009098 Ga0105245_10374113 Ga0105245_103741132 327
838 3300009101 Ga0105247_10058153 Ga0105247_100581532 327
839 3300009147 Ga0114129_10213207 Ga0114129_102132071 327
840 3300009174 Ga0105241_10252399 Ga0105241_102523992 327
841 3300009176 Ga0105242_10042237 Ga0105242_100422374 327
842 3300009177 Ga0105248_10020983 Ga0105248_100209833 327
843 3300009545 Ga0105237_10093716 Ga0105237_100937162 327
844 3300009551 Ga0105238_10154016 Ga0105238_101540162 327
845 3300009553 Ga0105249_10164553 Ga0105249_101645533 327
846 3300009553 Ga0105249_10195887 Ga0105249_101958872 327
847 3300012498 Ga0157345_1001131 Ga0157345_10011312 327
848 3300012505 Ga0157339_1002850 Ga0157339_10028501 327
849 3300012510 Ga0157316_1001901 Ga0157316_10019012 327
850 3300013100 Ga0157373_10040198 Ga0157373_100401983 327
851 3300013104 Ga0157370_10042057 Ga0157370_100420572 327
852 3300013105 Ga0157369_10088552 Ga0157369_100885522 327
853 3300013296 Ga0157374_10100128 Ga0157374_101001282 327
854 3300013296 Ga0157374_10160667 Ga0157374_101606671 327
855 3300013296 Ga0157374_10285228 Ga0157374_102852282 327
856 3300013297 Ga0157378_10121402 Ga0157378_101214022 327
857 3300013297 Ga0157378_10139422 Ga0157378_101394223 327
858 3300013306 Ga0163162_10065114 Ga0163162_100651144 327
859 3300013306 Ga0163162_10100584 Ga0163162_101005843 327
860 3300013307 Ga0157372_10178558 Ga0157372_101785581 327
861 3300013308 Ga0157375_10002488 Ga0157375_1000248815 327
862 3300013308 Ga0157375_10117399 Ga0157375_101173993 327
863 3300014968 Ga0157379_10126245 Ga0157379_101262453 327
864 3300014969 Ga0157376_10008924 Ga0157376_100089243 327
865 3300014969 Ga0157376_10062958 Ga0157376_100629582 327
866 3300017792 Ga0163161_10006692 Ga0163161_100066925 327
867 3300017792 Ga0163161_10107885 Ga0163161_101078852 327
868 3300021384 Ga0213876_10090496 Ga0213876_100904962 327
869 3300025261 Ga0209233_1016691 Ga0209233_10166912 327
870 3300025290 Ga0207673_1000042 Ga0207673_10000425 327
871 3300025315 Ga0207697_10011526 Ga0207697_100115263 327
872 3300025898 Ga0207692_10016295 Ga0207692_100162953 327
873 3300025899 Ga0207642_10002194 Ga0207642_100021945 327
874 3300025900 Ga0207710_10007821 Ga0207710_100078213 327
875 3300025900 Ga0207710_10036632 Ga0207710_100366323 327
876 3300025901 Ga0207688_10000024 Ga0207688_1000002443 327
877 3300025901 Ga0207688_10075463 Ga0207688_100754631 327
878 3300025904 Ga0207647_10020019 Ga0207647_100200194 327
879 3300025905 Ga0207685_10003863 Ga0207685_100038634 327
880 3300025905 Ga0207685_10020245 Ga0207685_100202452 327
881 3300025907 Ga0207645_10027609 Ga0207645_100276093 327
882 3300025912 Ga0207707_10031302 Ga0207707_100313023 327
883 3300025912 Ga0207707_10039822 Ga0207707_100398221 327
884 3300025912 Ga0207707_10058970 Ga0207707_100589703 327
885 3300025913 Ga0207695_10089660 Ga0207695_100896602 327
886 3300025915 Ga0207693_10003819 Ga0207693_1000381911 327
887 3300025915 Ga0207693_10004725 Ga0207693_100047255 327
888 3300025915 Ga0207693_10266677 Ga0207693_102666772 327
889 3300025916 Ga0207663_10157689 Ga0207663_101576891 327
890 3300025916 Ga0207663_10313092 Ga0207663_103130922 327
891 3300025917 Ga0207660_10000104 Ga0207660_1000010440 327
892 3300025917 Ga0207660_10256357 Ga0207660_102563572 327
893 3300025919 Ga0207657_10008208 Ga0207657_100082087 327
894 3300025919 Ga0207657_10064983 Ga0207657_100649833 327
895 3300025919 Ga0207657_10100631 Ga0207657_101006312 327
896 3300025920 Ga0207649_10002932 Ga0207649_100029325 327
897 3300025920 Ga0207649_10252061 Ga0207649_102520611 327
898 3300025921 Ga0207652_10001464 Ga0207652_100014644 327
899 3300025921 Ga0207652_10049899 Ga0207652_100498991 327
900 3300025921 Ga0207652_10158295 Ga0207652_101582952 327
901 3300025924 Ga0207694_10096619 Ga0207694_100966192 327
902 3300025925 Ga0207650_10006629 Ga0207650_100066295 327
903 3300025927 Ga0207687_10059806 Ga0207687_100598061 327
904 3300025928 Ga0207700_10001350 Ga0207700_100013502 327
905 3300025928 Ga0207700_10214051 Ga0207700_102140511 327
906 3300025929 Ga0207664_10004320 Ga0207664_100043203 327
907 3300025929 Ga0207664_10049839 Ga0207664_100498393 327
908 3300025933 Ga0207706_10012802 Ga0207706_100128024 327
909 3300025933 Ga0207706_10203277 Ga0207706_102032772 327
910 3300025934 Ga0207686_10006384 Ga0207686_100063842 327
911 3300025934 Ga0207686_10039418 Ga0207686_100394182 327
912 3300025936 Ga0207670_10000182 Ga0207670_1000018238 327
913 3300025936 Ga0207670_10240532 Ga0207670_102405322 327
914 3300025937 Ga0207669_10004684 Ga0207669_100046842 327
915 3300025939 Ga0207665_10001219 Ga0207665_100012195 327
916 3300025941 Ga0207711_10057458 Ga0207711_100574582 327
917 3300025941 Ga0207711_10074015 Ga0207711_100740153 327
918 3300025941 Ga0207711_10153970 Ga0207711_101539702 327
919 3300025942 Ga0207689_10013837 Ga0207689_100138375 327
920 3300025944 Ga0207661_10001332 Ga0207661_1000133210 327
921 3300025945 Ga0207679_10000035 Ga0207679_1000003555 327
922 3300025949 Ga0207667_10177458 Ga0207667_101774582 327
923 3300025960 Ga0207651_10000180 Ga0207651_1000018014 327
924 3300025960 Ga0207651_10135299 Ga0207651_101352992 327
925 3300025961 Ga0207712_10008108 Ga0207712_100081083 327
926 3300025961 Ga0207712_10310602 Ga0207712_103106021 327
927 3300025972 Ga0207668_10000149 Ga0207668_1000014939 327
928 3300025972 Ga0207668_10089867 Ga0207668_100898673 327
929 3300025981 Ga0207640_10014682 Ga0207640_100146824 327
930 3300025981 Ga0207640_10039474 Ga0207640_100394742 327
931 3300025986 Ga0207658_10043386 Ga0207658_100433862 327
932 3300026023 Ga0207677_10004580 Ga0207677_100045804 327
933 3300026035 Ga0207703_10079135 Ga0207703_100791352 327
934 3300026035 Ga0207703_10128856 Ga0207703_101288562 327
935 3300026041 Ga0207639_10002906 Ga0207639_100029063 327
936 3300026041 Ga0207639_10063477 Ga0207639_100634772 327
937 3300026067 Ga0207678_10009048 Ga0207678_100090485 327
938 3300026067 Ga0207678_10015567 Ga0207678_100155675 327
939 3300026067 Ga0207678_10020228 Ga0207678_100202285 327
940 3300026067 Ga0207678_10091621 Ga0207678_100916213 327
941 3300026075 Ga0207708_10039584 Ga0207708_100395844 327
942 3300026075 Ga0207708_10295341 Ga0207708_102953412 327
943 3300026078 Ga0207702_10006764 Ga0207702_100067647 327
944 3300026078 Ga0207702_10168387 Ga0207702_101683873 327
945 3300026089 Ga0207648_10035823 Ga0207648_100358233 327
946 3300026095 Ga0207676_10001216 Ga0207676_100012166 327
947 3300026095 Ga0207676_10068056 Ga0207676_100680563 327
948 3300026118 Ga0207675_100026983 Ga0207675_1000269835 327
949 3300026118 Ga0207675_100077875 Ga0207675_1000778752 327
950 3300026121 Ga0207683_10006130 Ga0207683_1000613012 327
951 3300026121 Ga0207683_10009850 Ga0207683_100098508 327
952 3300026142 Ga0207698_10007529 Ga0207698_100075295 327
953 3300027682 Ga0209971_1013547 Ga0209971_10135472 327
954 3300027717 Ga0209998_10002490 Ga0209998_100024904 327
955 3300027717 Ga0209998_10007384 Ga0209998_100073843 327
956 3300027876 Ga0209974_10010975 Ga0209974_100109752 327
957 3300027876 Ga0209974_10024633 Ga0209974_100246332 327
958 3300027907 Ga0207428_10000075 Ga0207428_10000075108 327
959 3300027907 Ga0207428_10002495 Ga0207428_1000249515 327
960 3300027907 Ga0207428_10004858 Ga0207428_100048587 327
961 3300028381 Ga0268264_10346131 Ga0268264_103461311 327
962 3300031241 Ga0265325_10008594 Ga0265325_100085943 327
963 3300031595 Ga0265313_10015070 Ga0265313_100150705 327
964 3300034816 Ga0373930_0000182 Ga0373930_0000182_5209_6198 327
965 3300034817 Ga0373948_0000591 Ga0373948_0000591_1881_2870 327
966 3300034820 Ga0373959_0001645 Ga0373959_0001645_2368_3357 327
967 3300035083 Ga0373926_0092652 Ga0373926_0092652_60_1049 327
968 3300035084 Ga0373928_0007047 Ga0373928_0007047_1000_1989 327
969 3300035085 Ga0373929_0001158 Ga0373929_0001158_2371_3360 327
970 3300035088 Ga0373940_0000142 Ga0373940_0000142_4989_5978 327
971 3300035089 Ga0373944_0016090 Ga0373944_0016090_165_1154 327
972 3300035090 Ga0373949_0003060 Ga0373949_0003060_1327_2316 327
973 3300035090 Ga0373949_0003729 Ga0373949_0003729_952_1941 327
974 3300035090 Ga0373949_0014713 Ga0373949_0014713_702_1712 327
975 3300035091 Ga0373951_0001484 Ga0373951_0001484_3515_4504 327
976 3300035092 Ga0373952_0010722 Ga0373952_0010722_276_1265 327
977 3300035111 Ga0373923_0013137 Ga0373923_0013137_323_1312 327
978 3300035112 Ga0373932_0000611 Ga0373932_0000611_5452_6441 327
979 3300035114 Ga0373939_0002011 Ga0373939_0002011_2778_3767 327
980 3300035115 Ga0373941_0001642 Ga0373941_0001642_1660_2649 327
981 3300035117 Ga0373953_0040545 Ga0373953_0040545_166_1155 327
982 3300035118 Ga0373954_0009184 Ga0373954_0009184_360_1349 327
983 3300035119 Ga0373956_0005298 Ga0373956_0005298_1807_2796 327
984 3300035120 Ga0373957_0036910 Ga0373957_0036910_662_1651 327
985 3300035121 Ga0373960_0030235 Ga0373960_0030235_308_1297 327
986 3300035170 Ga0373943_0003515 Ga0373943_0003515_2297_3286 327
987 3300035170 Ga0373943_0037169 Ga0373943_0037169_225_1214 327
988 3300035171 Ga0373946_0133444 Ga0373946_0133444_53_1042 327
989 3300035207 Ga0373942_0001627 Ga0373942_0001627_4432_5421 327
990 3300035241 Ga0373961_0018987 Ga0373961_0018987_505_1494 327
991 3300035241 Ga0373961_0035394 Ga0373961_0035394_54_1043 327
992 3300035691 Ga0373931_0009578 Ga0373931_0009578_177_1166 327
993 3300035692 Ga0373935_0004817 Ga0373935_0004817_6778_7767 327
994 3300035695 Ga0373927_0105788 Ga0373927_0105788_427_1416 327
995 3300035724 Ga0373933_0008478 Ga0373933_0008478_1860_2849 327
996 3300035724 Ga0373933_0098430 Ga0373933_0098430_689_1678 327
997 3300035725 Ga0373947_0005443 Ga0373947_0005443_43_1032 327
998 3300035725 Ga0373947_0029566 Ga0373947_0029566_902_1906 327
999 3300037068 Ga0373925_0005226 Ga0373925_0005226_5756_6745 327
1000 3300037068 Ga0373925_0111196 Ga0373925_0111196_477_1466 327
1001 3300037853 Ga0436364_0609713 Ga0436364_0609713_158_1162 327
1002 3300039437 Ga0436365_0534746 Ga0436365_0534746_5424_6428 327
1003 3300039437 Ga0436365_1516841 Ga0436365_1516841_473_1477 327
1004 3300039438 Ga0436360_0728136 Ga0436360_0728136_699_1703 327
1005 3300039438 Ga0436360_1357448 Ga0436360_1357448_485_1489 327
1006 3300039450 Ga0436363_0810999 Ga0436363_0810999_245_1249 327
1007 3300042012 Ga0439455_0008055 Ga0439455_0008055_711_1700 327
1008 3300046454 Ga0495592_0053098 Ga0495592_0053098_1697_2686 327
1009 3300046455 Ga0495603_0000816 Ga0495603_0000816_12040_13029 327
1010 3300046455 Ga0495603_0052530 Ga0495603_0052530_756_1745 327
1011 3300046459 Ga0495629_0000140 Ga0495629_0000140_7778_8767 327
1012 3300046462 Ga0495651_0242165 Ga0495651_0242165_166_1155 327
1013 3300046463 Ga0495653_0009696 Ga0495653_0009696_5672_6661 327
1014 3300046463 Ga0495653_0047492 Ga0495653_0047492_1512_2501 327
1015 3300046472 Ga0495580_0058773 Ga0495580_0058773_1271_2260 327
1016 3300046472 Ga0495580_0078199 Ga0495580_0078199_1167_2156 327
1017 3300046473 Ga0495582_0005878 Ga0495582_0005878_3591_4580 327
1018 3300046475 Ga0495639_0012290 Ga0495639_0012290_2011_3000 327
1019 3300046476 Ga0495662_0075454 Ga0495662_0075454_240_1229 327
1020 3300046477 Ga0495664_0005918 Ga0495664_0005918_3892_4881 327
1021 3300046477 Ga0495664_0038354 Ga0495664_0038354_82_1071 327
1022 3300046492 Ga0495585_0002257 Ga0495585_0002257_4620_5609 327
1023 3300046499 Ga0495594_0042704 Ga0495594_0042704_723_1712 327
1024 3300046499 Ga0495594_0200662 Ga0495594_0200662_118_1107 327
1025 3300046501 Ga0495607_0037500 Ga0495607_0037500_798_1787 327
1026 3300046506 Ga0495583_0077909 Ga0495583_0077909_349_1338 327
1027 3300046511 Ga0495608_0023230 Ga0495608_0023230_1808_2797 327
1028 3300046511 Ga0495608_0068600 Ga0495608_0068600_1097_2086 327
1029 3300046511 Ga0495608_0133031 Ga0495608_0133031_113_1102 327
1030 3300046513 Ga0495616_0074748 Ga0495616_0074748_580_1569 327
1031 3300046514 Ga0495618_0051343 Ga0495618_0051343_1190_2179 327
1032 3300046514 Ga0495618_0088817 Ga0495618_0088817_158_1147 327
1033 3300046514 Ga0495618_0153880 Ga0495618_0153880_222_1211 327
1034 3300046516 Ga0495628_0152301 Ga0495628_0152301_321_1310 327
1035 3300046517 Ga0495630_0083972 Ga0495630_0083972_510_1499 327
1036 3300046523 Ga0495644_0001244 Ga0495644_0001244_3696_4685 327
1037 3300046529 Ga0495652_0090548 Ga0495652_0090548_741_1730 327
1038 3300046529 Ga0495652_0131223 Ga0495652_0131223_761_1750 327
1039 3300046531 Ga0495665_0004725 Ga0495665_0004725_151_1140 327
1040 3300046531 Ga0495665_0063110 Ga0495665_0063110_78_1082 327
1041 3300046533 Ga0495640_0016839 Ga0495640_0016839_161_1150 327
1042 3300046533 Ga0495640_0044715 Ga0495640_0044715_122_1111 327
1043 3300046535 Ga0495586_0013278 Ga0495586_0013278_871_1860 327
1044 3300046536 Ga0495587_0027310 Ga0495587_0027310_177_1166 327
1045 3300046543 Ga0495645_0009517 Ga0495645_0009517_4868_5857 327
1046 3300046557 Ga0495622_0053196 Ga0495622_0053196_125_1114 327
1047 3300046558 Ga0495633_0006563 Ga0495633_0006563_3483_4472 327
1048 3300046559 Ga0495667_0005276 Ga0495667_0005276_2487_3476 327
1049 3300046559 Ga0495667_0131876 Ga0495667_0131876_201_1190 327
1050 3300046615 Ga0495656_0003395 Ga0495656_0003395_2673_3662 327
1051 3300046642 Ga0495634_0015355 Ga0495634_0015355_1246_2250 327
1052 3300046642 Ga0495634_0038064 Ga0495634_0038064_1600_2589 327
1053 3300046642 Ga0495634_0076834 Ga0495634_0076834_163_1152 327
1054 3300046648 Ga0495611_0005586 Ga0495611_0005586_604_1593 327
1055 3300046663 Ga0495635_0009872 Ga0495635_0009872_3241_4230 327
1056 3300046664 Ga0495659_0002292 Ga0495659_0002292_318_1307 327
1057 3300046675 Ga0495657_0035218 Ga0495657_0035218_1692_2681 327
1058 3300046678 Ga0495599_0005271 Ga0495599_0005271_2308_3297 327
1059 3300046678 Ga0495599_0039395 Ga0495599_0039395_1044_2033 327
1060 3300046683 Ga0495658_0009443 Ga0495658_0009443_2253_3242 327
1061 3300046689 Ga0495613_0013393 Ga0495613_0013393_822_1826 327
1062 3300046689 Ga0495613_0040585 Ga0495613_0040585_1392_2381 327
1063 3300046690 Ga0495624_0010799 Ga0495624_0010799_1799_2788 327
1064 3300046691 Ga0495670_0006450 Ga0495670_0006450_4212_5201 327
1065 3300046692 Ga0495671_0107130 Ga0495671_0107130_133_1122 327
1066 3300046809 Ga0495600_0055706 Ga0495600_0055706_108_1097 327
1067 3300046809 Ga0495600_0128497 Ga0495600_0128497_592_1581 327
1068 3300047315 Ga0495581_0020190 Ga0495581_0020190_1280_2269 327
1069 3300047315 Ga0495581_0085284 Ga0495581_0085284_167_1156 327
1070 3300047317 Ga0495604_0015973 Ga0495604_0015973_2645_3634 327
1071 3300047317 Ga0495604_0049732 Ga0495604_0049732_472_1461 327
1072 3300047319 Ga0495674_0009246 Ga0495674_0009246_3157_4161 327
1073 3300047319 Ga0495674_0123965 Ga0495674_0123965_929_1918 327
1074 3300047319 Ga0495674_0208245 Ga0495674_0208245_399_1388 327
1075 3300047321 Ga0495676_0012611 Ga0495676_0012611_2263_3252 327
1076 3300047321 Ga0495676_0065576 Ga0495676_0065576_694_1698 327
1077 3300047321 Ga0495676_0142816 Ga0495676_0142816_163_1152 327
1078 3300047321 Ga0495676_0258450 Ga0495676_0258450_178_1167 327
1079 3300047322 Ga0495680_0005304 Ga0495680_0005304_8681_9670 327
1080 3300047322 Ga0495680_0098692 Ga0495680_0098692_267_1256 327
1081 3300047322 Ga0495680_0215297 Ga0495680_0215297_320_1309 327
1082 3300047444 Ga0495675_0003024 Ga0495675_0003024_8204_9193 327
1083 3300047444 Ga0495675_0187204 Ga0495675_0187204_94_1083 327
1084 3300047446 Ga0495679_031274 Ga0495679_031274_648_1637 327
1085 3300047471 Ga0495684_0140287 Ga0495684_0140287_161_1150 327
1086 3300047673 Ga0495593_0020219 Ga0495593_0020219_904_1893 327
1087 3300048088 Ga0495602_0072323 Ga0495602_0072323_57_1046 327
1088 3300048088 Ga0495602_0082044 Ga0495602_0082044_32_1021 327
1089 3300048091 Ga0495626_0022127 Ga0495626_0022127_820_1872 327
1090 3300048903 Ga0496100_0013729 Ga0496100_0013729_688_1677 327
1091 3300048904 Ga0496101_0026703 Ga0496101_0026703_1980_2969 327
1092 3300048905 Ga0496102_0044345 Ga0496102_0044345_2208_3212 327
1093 3300048905 Ga0496102_0075742 Ga0496102_0075742_803_1792 327
1094 3300048906 Ga0496103_0053490 Ga0496103_0053490_1118_2107 327
1095 3300048907 Ga0496104_0000079 Ga0496104_0000079_39047_40036 327
1096 3300048907 Ga0496104_0000905 Ga0496104_0000905_8655_9662 327
1097 3300048907 Ga0496104_0023005 Ga0496104_0023005_3631_4620 327
1098 3300048907 Ga0496104_0025752 Ga0496104_0025752_1930_2919 327
1099 3300048907 Ga0496104_0077766 Ga0496104_0077766_545_1534 327
1100 3300048907 Ga0496104_0242297 Ga0496104_0242297_686_1675 327
1101 3300048908 Ga0496105_0000225 Ga0496105_0000225_34318_35307 327
1102 3300048908 Ga0496105_0001448 Ga0496105_0001448_9183_10172 327
1103 3300048908 Ga0496105_0042175 Ga0496105_0042175_2386_3375 327
1104 3300048908 Ga0496105_0159666 Ga0496105_0159666_399_1388 327
1105 3300048909 Ga0496106_0067750 Ga0496106_0067750_696_1685 327
1106 3300048909 Ga0496106_0122005 Ga0496106_0122005_366_1370 327
1107 3300048910 Ga0496107_0015114 Ga0496107_0015114_1616_2605 327
1108 3300048911 Ga0496108_0047868 Ga0496108_0047868_2349_3338 327
1109 3300048912 Ga0496109_0010418 Ga0496109_0010418_2352_3341 327
1110 3300048912 Ga0496109_0151178 Ga0496109_0151178_553_1542 327
1111 3300048913 Ga0496110_0100491 Ga0496110_0100491_643_1647 327
1112 3300048913 Ga0496110_0375520 Ga0496110_0375520_275_1264 327
1113 3300048914 Ga0496111_0007782 Ga0496111_0007782_2382_3371 327
1114 3300048915 Ga0496112_0003843 Ga0496112_0003843_2522_3511 327
1115 3300048915 Ga0496112_0102249 Ga0496112_0102249_1493_2482 327
1116 3300048915 Ga0496112_0149775 Ga0496112_0149775_184_1173 327
1117 3300048916 Ga0496113_0108825 Ga0496113_0108825_713_1702 327
1118 3300048916 Ga0496113_0192885 Ga0496113_0192885_609_1598 327
1119 3300048916 Ga0496113_0264016 Ga0496113_0264016_34_1023 327
1120 3300048917 Ga0496114_0002900 Ga0496114_0002900_3559_4548 327
1121 3300048917 Ga0496114_0026644 Ga0496114_0026644_2185_3174 327
1122 3300048918 Ga0496115_0008715 Ga0496115_0008715_5246_6235 327
1123 3300048918 Ga0496115_0021185 Ga0496115_0021185_1673_2662 327
1124 3300048918 Ga0496115_0048443 Ga0496115_0048443_1155_2174 327
1125 3300049568 Ga0501031_0000643 Ga0501031_0000643_2288_3292 327
1126 3300049570 Ga0501033_0077981 Ga0501033_0077981_977_1984 327
1127 3300049571 Ga0501034_0149849 Ga0501034_0149849_202_1191 327
1128 3300049572 Ga0501036_0073557 Ga0501036_0073557_1215_2219 327
1129 3300049573 Ga0501037_0082587 Ga0501037_0082587_473_1477 327
1130 3300049573 Ga0501037_0122063 Ga0501037_0122063_67_1059 327
1131 3300049574 Ga0501038_0004733 Ga0501038_0004733_86_1090 327
1132 3300049575 Ga0501039_0004579 Ga0501039_0004579_8507_9511 327
1133 3300049576 Ga0501040_0000761 Ga0501040_0000761_4195_5199 327
1134 3300049577 Ga0501041_0005396 Ga0501041_0005396_105_1109 327
1135 3300049578 Ga0501042_0003840 Ga0501042_0003840_994_1998 327
1136 3300049580 Ga0501046_0002981 Ga0501046_0002981_12479_13483 327
1137 3300049582 Ga0501048_0003011 Ga0501048_0003011_10538_11542 327
1138 3300049584 Ga0501068_0033037 Ga0501068_0033037_1590_2594 327
1139 3300049587 Ga0501071_0000078 Ga0501071_0000078_6260_7264 327
1140 3300049588 Ga0501072_0013652 Ga0501072_0013652_106_1110 327
1141 3300049588 Ga0501072_0134688 Ga0501072_0134688_785_1819 327
1142 3300049589 Ga0501073_0072835 Ga0501073_0072835_427_1428 327
1143 3300049590 Ga0501074_0032389 Ga0501074_0032389_2251_3255 327
1144 3300049590 Ga0501074_0336853 Ga0501074_0336853_61_1050 327
1145 3300049591 Ga0501075_0002758 Ga0501075_0002758_680_1684 327
1146 3300049592 Ga0501076_0002404 Ga0501076_0002404_9458_10462 327
1147 3300049593 Ga0501077_0002379 Ga0501077_0002379_3686_4690 327
1148 3300049741 Ga0501079_0000213 Ga0501079_0000213_5110_6114 327
1149 3300049742 Ga0501080_0001183 Ga0501080_0001183_8210_9214 327
1150 3300049742 Ga0501080_0013912 Ga0501080_0013912_6120_7130 327
1151 3300049743 Ga0501081_0006277 Ga0501081_0006277_5913_6917 327
1152 3300049744 Ga0501083_0005926 Ga0501083_0005926_5514_6518 327
1153 3300049822 Ga0501035_0108543 Ga0501035_0108543_554_1558 327
1154 3300049822 Ga0501035_0209166 Ga0501035_0209166_464_1459 327
1155 3300049823 Ga0501044_0064866 Ga0501044_0064866_1189_2181 327
1156 3300049823 Ga0501044_0101084 Ga0501044_0101084_914_1921 327
1157 3300049824 Ga0501045_0001082 Ga0501045_0001082_6585_7589 327
1158 3300050491 nmdc:mga00v17_99901_c1 nmdc:mga00v17_99901_c1_756_1814 327
1159 3300050507 nmdc:mga05p37_32_c1 nmdc:mga05p37_32_c1_3538_4536 327
1160 3300050507 nmdc:mga05p37_35373_c1 nmdc:mga05p37_35373_c1_1998_2987 327
1161 3300050508 nmdc:mga09592_7970_c1 nmdc:mga09592_7970_c1_93_1091 327
1162 3300050509 nmdc:mga0qj67_1240_c1 nmdc:mga0qj67_1240_c1_2774_3772 327
1163 3300050509 nmdc:mga0qj67_214126_c1 nmdc:mga0qj67_214126_c1_114_1151 327
1164 3300050510 nmdc:mga06r32_1670_c1 nmdc:mga06r32_1670_c1_7518_8516 327
1165 3300050511 nmdc:mga08y16_66352_c1 nmdc:mga08y16_66352_c1_1917_2906 327
1166 3300050511 nmdc:mga08y16_6877_c1 nmdc:mga08y16_6877_c1_1528_2517 327
1167 3300050511 nmdc:mga08y16_997_c1 nmdc:mga08y16_997_c1_23805_24803 327
1168 3300050512 nmdc:mga0n895_184916_c1 nmdc:mga0n895_184916_c1_522_1511 327
1169 3300050512 nmdc:mga0n895_60104_c1 nmdc:mga0n895_60104_c1_2004_3002 327
1170 3300050514 nmdc:mga08x19_91457_c1 nmdc:mga08x19_91457_c1_245_1234 327
1171 3300050515 nmdc:mga0a205_1694_c1 nmdc:mga0a205_1694_c1_4989_5987 327
1172 3300050515 nmdc:mga0a205_374115_c1 nmdc:mga0a205_374115_c1_119_1108 327
1173 3300050515 nmdc:mga0a205_43990_c1 nmdc:mga0a205_43990_c1_1462_2451 327
1174 3300053077 Ga0495601_0000334 Ga0495601_0000334_2715_3719 327
1175 3300053077 Ga0495601_0002590 Ga0495601_0002590_5191_6180 327
1176 3300053077 Ga0495601_0210986 Ga0495601_0210986_237_1226 327
1177 3300053084 Ga0495595_0001716 Ga0495595_0001716_2336_3325 327
1178 3300053084 Ga0495595_0006503 Ga0495595_0006503_2863_3852 327
1179 3300053084 Ga0495595_0021468 Ga0495595_0021468_790_1794 327
1180 3300053085 Ga0495619_0000016 Ga0495619_0000016_51263_52252 327
1181 3300053085 Ga0495619_0000384 Ga0495619_0000384_23827_24816 327
1182 3300053085 Ga0495619_0018412 Ga0495619_0018412_2348_3337 327
1183 3300053085 Ga0495619_0047152 Ga0495619_0047152_1118_2107 327
1184 3300054114 Ga0501084_0000457 Ga0501084_0000457_25677_26681 327
1185 3300060353 Ga0501082_0013927 Ga0501082_0013927_5402_6406 327
1186 3300061734 Ga0530510_0011122 Ga0530510_0011122_1887_2891 327
1187 2209111006 2214544943 2213593703 330

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02653

BPD_transp_2

Branched-chain amino acid transport system / permease component

71

339

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
7lb8-assembly1.cif.gz_B structure of a ferrichrome importer fhucdb from e. coli 0.4794 41 307
5b57-assembly1.cif.gz_A inward-facing conformation of abc heme importer bhuuv from burkholderia cenocepacia 0.4606 41 288
2nq2-assembly1.cif.gz_B an inward-facing conformation of a putative metal-chelate type abc transporter. 0.4458 10 292
2nq2-assembly1.cif.gz_A an inward-facing conformation of a putative metal-chelate type abc transporter. 0.4377 36 284
2nq2-assembly1.cif.gz_B an inward-facing conformation of a putative metal-chelate type abc transporter. 0.4241 10 292
ID Description Score Start End Superfamily
af_P0AEX7_11_292_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.7632 42 305 1.10.3470.10
af_Q58666_4_320_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.74 44 306 1.10.3470.10
af_Q58665_14_295_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.7389 42 305 1.10.3470.10
af_P0AEX7_11_292_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.7169 42 305 1.10.3470.10
af_Q58665_14_295_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.6937 42 305 1.10.3470.10
ID Description Score Start End GO Terms
AF-A0A536T171-F1-model_v4 Branched-chain amino acid ABC transporter permease 0.9107 19 280 GO:0005886
GO:0015658
AF-W3RJ89-F1-model_v4 ABC transporter permease 0.9063 10 326 GO:0005886
GO:0015658
AF-A0A4R5UBA5-F1-model_v4 Branched-chain amino acid ABC transporter permease 0.9021 10 319 GO:0005886
GO:0015658
AF-A0A1H4HMZ3-F1-model_v4 Amino acid/amide ABC transporter membrane protein 2, HAAT family 0.9013 38 322 GO:0005886
GO:0015658
AF-A0A2M6VMG7-F1-model_v4 Branched-chain amino acid ABC transporter permease 0.9011 24 324 GO:0005886
GO:0015658

Feature Viewer

pLDDT pTM Quality
62.42 0.63 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map