F491361

General Info

Members Datasets Scaffolds Average Seq Length
1184 527 1159 159

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2508501128|2509147658
Length 194
Sequence HFPINRFALSQHGTALLIFPTNSVSVGEAQFVIESPIMAVYEPWDETRGAEIITEHANREGATLLILHALQEAFGYVPEPAIPMVAAALNLSRAEVYGVFTFYHDFRKEPAGRHVLKLCRAEACQAAGGDALAARAEAKLGIACGNTTADNRVTLEPIYCLGLCATAPSAMLDGRLVGRLDQTRLDALIAEAQQ

Samples

Sample ID Description Type Environment
1 2010549000 Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes Metagenome Endosphere
2 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
3 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
4 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
5 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
6 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
7 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
8 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
9 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
10 2842694124 Methylopila sp. R-72369 Isolate Unclassified
11 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
12 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
13 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
14 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
15 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
16 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
17 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
18 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
19 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
20 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
21 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
22 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
23 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
24 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
25 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
26 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
27 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
28 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
29 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
30 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
31 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
32 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
33 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
34 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
35 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
36 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
37 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
38 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
39 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
40 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
41 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
42 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
43 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
44 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
45 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
46 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
47 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
48 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
49 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
50 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
51 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
52 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
53 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
54 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
55 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
56 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
57 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
58 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
59 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
60 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
61 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
62 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
63 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
64 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
65 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
66 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
67 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
68 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
69 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
70 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
71 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
72 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
73 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
74 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
75 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
76 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
77 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
78 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
79 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
80 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
81 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
82 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
83 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
84 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
85 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
86 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
87 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
88 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
89 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
90 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
91 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
92 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
93 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
94 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
95 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
96 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
97 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
98 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
99 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
100 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
101 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
102 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
103 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
104 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
105 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
106 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
107 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
108 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
109 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
110 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
111 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
112 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
113 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
114 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
115 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
116 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
117 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
118 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
119 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
120 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
121 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
122 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
123 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
124 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
125 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
126 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
127 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
128 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
129 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
130 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
131 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
132 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
133 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
134 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
135 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
136 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
137 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
138 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
139 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
140 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
141 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
142 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
143 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
144 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
145 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
146 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
147 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
148 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
149 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
150 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
151 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
152 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
153 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
154 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
155 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
156 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
157 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
158 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
159 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
160 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
161 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
162 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
163 3300024123 Spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU5 Metagenome Unclassified
164 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
165 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
166 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
167 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
168 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
169 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
170 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
171 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
172 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
173 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
174 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
175 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
228 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
229 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
230 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
231 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
232 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
236 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
237 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
238 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
239 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
240 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
241 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
242 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
243 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
244 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
245 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
246 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
247 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
248 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
249 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
250 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
251 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
252 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
253 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
254 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
255 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
256 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
257 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
258 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
259 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
260 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
261 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
262 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
263 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
264 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
265 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
266 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
267 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
268 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
269 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
270 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
271 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
272 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
273 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
274 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
275 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
276 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
277 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
278 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
279 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
280 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
281 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
282 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
283 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
284 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
285 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
286 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
287 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
288 3300036458 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
289 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
290 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
291 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
292 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
293 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
294 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
295 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
296 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
297 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
298 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
299 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
300 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
301 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
302 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
303 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
304 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
305 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
306 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
307 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
308 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
309 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
310 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
311 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
312 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
313 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
314 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
315 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
316 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
317 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
318 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
319 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
320 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
321 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
322 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
323 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
324 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
325 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
326 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
327 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
328 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
329 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
330 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
331 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
332 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
333 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
334 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
335 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
336 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
337 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
338 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
339 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
340 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
341 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
342 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
343 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
344 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
345 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
346 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
347 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
348 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
349 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
350 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
351 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
352 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
353 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
354 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
355 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
356 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
357 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
358 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
359 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
360 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
361 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
362 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
363 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
364 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
365 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
366 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
367 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
368 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
369 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
370 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
371 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
372 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
373 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
374 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
375 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
376 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
377 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
378 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
379 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
380 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
381 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
382 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
383 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
384 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
385 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
386 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
387 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
388 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
389 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
390 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
391 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
392 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
393 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
394 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
395 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
396 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
397 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
398 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
399 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
400 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
401 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
402 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
403 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
404 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
405 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
406 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
407 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
408 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
409 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
410 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
411 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
412 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
413 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
414 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
415 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
416 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
417 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
418 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
419 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
420 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
421 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
422 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
423 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
424 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
425 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
426 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
427 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
428 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
429 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
430 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
431 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
432 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
433 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
434 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
435 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
436 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
437 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
438 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
439 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
440 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
441 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
442 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
443 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
444 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
445 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
446 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
447 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
448 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
449 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
450 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
451 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
452 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
453 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
454 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
455 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
456 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
457 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
458 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
459 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
460 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
461 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
462 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
463 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
464 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
465 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
466 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
467 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
468 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
469 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
470 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
471 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
472 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
473 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
474 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
475 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
476 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
477 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
478 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
479 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
480 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
481 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
482 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
483 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
484 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
485 3300053106 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere Metagenome Endosphere
486 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
487 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
488 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
489 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
490 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
491 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
492 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
493 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
494 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
495 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
496 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
497 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
498 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
499 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
500 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
501 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
502 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
503 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
504 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
505 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
506 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
507 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
508 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
509 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
510 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
511 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
512 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
513 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
514 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
515 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
516 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
517 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
518 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
519 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
520 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
521 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
522 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
523 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
524 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
525 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
526 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
527 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.55
Metatranscriptomes 0.34
Isolates 2.11

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.95
Nodule 1.35
Rhizoplane 4.31
Rhizosphere 69.76
Stem 0
Stem Tuber 0
Unclassified 9.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 RicEn_FSXC7958_b1 2010549000 Bacteria 813
2 JGI24743J22301_10011029 3300001991 Bacteria 1621
3 JGI25406J46586_10002869 3300003203 Bacteria 8121
4 JGI25406J46586_10023761 3300003203 Bacteria 2417
5 JGI25153J46596_10005767 3300003215 Bacteria 6450
6 JGI25153J46596_10006684 3300003215 Bacteria 5797
7 JGI25153J46596_10039667 3300003215 Bacteria 1469
8 rootL2_10123755 3300003322 Bacteria 1852
9 rootH1_10291242 3300003323 Bacteria 1286
10 JGI25404J52841_10040049 3300003659 Bacteria 992
11 JGI25404J52841_10049835 3300003659 Bacteria 881
12 JGI25404J52841_10053153 3300003659 Bacteria 850
13 JGI25404J52841_10054410 3300003659 Bacteria 840
14 Ga0055526_1053332 3300003771 Bacteria 906
15 Ga0055524_1037314 3300003775 Bacteria 1291
16 Ga0055531_10009335 3300003794 Bacteria 5026
17 Ga0070658_10087205 3300005327 Bacteria 2568
18 Ga0070683_100517205 3300005329 Bacteria 1140
19 Ga0070690_100456427 3300005330 Bacteria 948
20 Ga0070670_100185219 3300005331 Bacteria 1808
21 Ga0068869_100007229 3300005334 Bacteria 7077
22 Ga0068869_100096279 3300005334 Bacteria 2234
23 Ga0068869_100172023 3300005334 Bacteria 1692
24 Ga0068869_100432435 3300005334 Bacteria 1088
25 Ga0070666_10397492 3300005335 Bacteria 990
26 Ga0070682_100043669 3300005337 Bacteria 2773
27 Ga0068868_100041351 3300005338 Bacteria 3591
28 Ga0068868_100701434 3300005338 Bacteria 905
29 Ga0068868_101118823 3300005338 Bacteria 725
30 Ga0070660_100165420 3300005339 Bacteria 1784
31 Ga0070689_100011394 3300005340 Bacteria 6368
32 Ga0070689_100387082 3300005340 Bacteria 1180
33 Ga0070661_100373491 3300005344 Bacteria 1123
34 Ga0070668_100058386 3300005347 Bacteria 2984
35 Ga0070668_100132950 3300005347 Bacteria 1998
36 Ga0070668_100161292 3300005347 Bacteria 1819
37 Ga0070668_100211531 3300005347 Bacteria 1595
38 Ga0070668_100236330 3300005347 Bacteria 1512
39 Ga0070668_101189192 3300005347 Bacteria 690
40 Ga0070669_100287154 3300005353 Bacteria 1320
41 Ga0070675_100128047 3300005354 Bacteria 2161
42 Ga0070671_100105888 3300005355 Bacteria 2360
43 Ga0070674_100293469 3300005356 Bacteria 1293
44 Ga0070688_100121147 3300005365 Bacteria 1753
45 Ga0070659_100176151 3300005366 Bacteria 1754
46 Ga0070659_100192084 3300005366 Bacteria 1678
47 Ga0070659_100228988 3300005366 Bacteria 1536
48 Ga0070659_101313265 3300005366 Bacteria 642
49 Ga0070667_100145691 3300005367 Bacteria 2077
50 Ga0070667_100541244 3300005367 Bacteria 1070
51 Ga0070714_100044316 3300005435 Bacteria 3766
52 Ga0070714_100098675 3300005435 Bacteria 2570
53 Ga0070714_100271872 3300005435 Bacteria 1572
54 Ga0070714_100529735 3300005435 Bacteria 1126
55 Ga0070713_100003607 3300005436 Bacteria 10231
56 Ga0070713_100360934 3300005436 Bacteria 1350
57 Ga0070713_101071863 3300005436 Bacteria 778
58 Ga0070710_10106555 3300005437 Bacteria 1677
59 Ga0070701_10145770 3300005438 Bacteria 1359
60 Ga0070711_100147899 3300005439 Bacteria 1768
61 Ga0070711_100855728 3300005439 Bacteria 774
62 Ga0070705_100096685 3300005440 Bacteria 1854
63 Ga0070694_100242697 3300005444 Bacteria 1359
64 Ga0070708_100809812 3300005445 Bacteria 880
65 Ga0070708_100998391 3300005445 Bacteria 785
66 Ga0070663_100034961 3300005455 Bacteria 3483
67 Ga0070663_100102625 3300005455 Bacteria 2137
68 Ga0070663_100117649 3300005455 Bacteria 2004
69 Ga0070663_100159673 3300005455 Bacteria 1734
70 Ga0070663_100193574 3300005455 Bacteria 1584
71 Ga0070663_100218136 3300005455 Bacteria 1496
72 Ga0070663_100450437 3300005455 Bacteria 1061
73 Ga0070663_101330521 3300005455 Bacteria 634
74 Ga0070663_101337446 3300005455 Bacteria 633
75 Ga0070678_100024023 3300005456 Bacteria 4073
76 Ga0070678_100120571 3300005456 Bacteria 2067
77 Ga0070678_100121766 3300005456 Bacteria 2058
78 Ga0070678_100228043 3300005456 Bacteria 1551
79 Ga0070678_100600858 3300005456 Bacteria 982
80 Ga0070678_101192585 3300005456 Bacteria 706
81 Ga0070662_100179164 3300005457 Bacteria 1670
82 Ga0070662_100292099 3300005457 Bacteria 1322
83 Ga0070662_100469560 3300005457 Bacteria 1046
84 Ga0070662_100710338 3300005457 Bacteria 851
85 Ga0070681_10009165 3300005458 Bacteria 9724
86 Ga0068867_100812716 3300005459 Bacteria 835
87 Ga0070706_100220654 3300005467 Bacteria 1770
88 Ga0070706_100236911 3300005467 Bacteria 1704
89 Ga0070707_100268855 3300005468 Bacteria 1658
90 Ga0070698_100269806 3300005471 Bacteria 1633
91 Ga0070698_100403203 3300005471 Bacteria 1301
92 Ga0070699_100872038 3300005518 Bacteria 824
93 Ga0070679_100026502 3300005530 Bacteria 5695
94 Ga0070679_100810466 3300005530 Bacteria 879
95 Ga0070697_100165297 3300005536 Bacteria 1871
96 Ga0068853_100064892 3300005539 Bacteria 3168
97 Ga0068853_100323117 3300005539 Bacteria 1431
98 Ga0070672_100350867 3300005543 Bacteria 1258
99 Ga0070672_101161600 3300005543 Bacteria 687
100 Ga0070686_101198616 3300005544 Bacteria 631
101 Ga0070695_100226048 3300005545 Bacteria 1351
102 Ga0070696_100341225 3300005546 Bacteria 1158
103 Ga0070693_100041420 3300005547 Bacteria 2591
104 Ga0070693_100262788 3300005547 Bacteria 1149
105 Ga0070665_100040083 3300005548 Bacteria 4708
106 Ga0070665_100329230 3300005548 Bacteria 1532
107 Ga0070665_100356056 3300005548 Bacteria 1469
108 Ga0070665_100774426 3300005548 Bacteria 972
109 Ga0070665_100821489 3300005548 Bacteria 942
110 Ga0070665_100971484 3300005548 Bacteria 862
111 Ga0070665_101373324 3300005548 Bacteria 716
112 Ga0070704_100579738 3300005549 Bacteria 983
113 Ga0068855_100228274 3300005563 Bacteria 2086
114 Ga0068855_100240424 3300005563 Bacteria 2024
115 Ga0068855_100288298 3300005563 Bacteria 1821
116 Ga0068855_100507450 3300005563 Bacteria 1310
117 Ga0068855_102144244 3300005563 Bacteria 562
118 Ga0070664_100030458 3300005564 Bacteria 4502
119 Ga0070664_100435586 3300005564 Bacteria 1202
120 Ga0070664_100857130 3300005564 Bacteria 851
121 Ga0068857_100362513 3300005577 Bacteria 1344
122 Ga0068854_100176039 3300005578 Bacteria 1668
123 Ga0068856_100100329 3300005614 Bacteria 2887
124 Ga0068856_100180346 3300005614 Bacteria 2125
125 Ga0070702_100142800 3300005615 Bacteria 1527
126 Ga0070702_100243258 3300005615 Bacteria 1215
127 Ga0070702_101042054 3300005615 Bacteria 650
128 Ga0068852_100100189 3300005616 Bacteria 2613
129 Ga0068852_100113120 3300005616 Bacteria 2471
130 Ga0068852_100291117 3300005616 Bacteria 1578
131 Ga0068852_101141851 3300005616 Bacteria 800
132 Ga0068852_101566997 3300005616 Bacteria 681
133 Ga0068859_100083940 3300005617 Bacteria 3229
134 Ga0068859_100246441 3300005617 Bacteria 1876
135 Ga0068859_100310837 3300005617 Bacteria 1669
136 Ga0068859_100531733 3300005617 Bacteria 1270
137 Ga0068864_100082585 3300005618 Bacteria 2820
138 Ga0068864_100097823 3300005618 Bacteria 2598
139 Ga0068864_100321378 3300005618 Bacteria 1454
140 Ga0068861_100057639 3300005719 Bacteria 2967
141 Ga0068861_100130371 3300005719 Bacteria 2040
142 Ga0068861_100131553 3300005719 Bacteria 2031
143 Ga0068861_100191087 3300005719 Bacteria 1711
144 Ga0068861_101020815 3300005719 Bacteria 791
145 Ga0068861_101220952 3300005719 Bacteria 728
146 Ga0068851_10098844 3300005834 Bacteria 1546
147 Ga0068870_10112336 3300005840 Bacteria 1558
148 Ga0068858_100277566 3300005842 Bacteria 1595
149 Ga0068858_100347878 3300005842 Bacteria 1419
150 Ga0068858_100453711 3300005842 Bacteria 1236
151 Ga0068858_100512520 3300005842 Bacteria 1159
152 Ga0068858_101847543 3300005842 Bacteria 597
153 Ga0068860_100000429 3300005843 Bacteria 53378
154 Ga0068860_100249964 3300005843 Bacteria 1726
155 Ga0068860_100289155 3300005843 Bacteria 1603
156 Ga0068862_100066839 3300005844 Bacteria 3098
157 Ga0068862_100196256 3300005844 Bacteria 1818
158 Ga0068862_100326643 3300005844 Bacteria 1417
159 Ga0068862_100772072 3300005844 Bacteria 936
160 Ga0068862_100934006 3300005844 Bacteria 854
161 Ga0068862_101153400 3300005844 Bacteria 772
162 Ga0081455_10003715 3300005937 Bacteria 17461
163 Ga0081455_10017606 3300005937 Bacteria 6841
164 Ga0081455_10027966 3300005937 Bacteria 5158
165 Ga0081455_10041857 3300005937 Bacteria 4024
166 Ga0081455_10072038 3300005937 Bacteria 2863
167 Ga0081455_10217963 3300005937 Bacteria 1417
168 Ga0081455_10403567 3300005937 Bacteria 948
169 Ga0081538_10178129 3300005981 Bacteria 914
170 Ga0081540_1003319 3300005983 Bacteria 12755
171 Ga0081540_1006968 3300005983 Bacteria 8140
172 Ga0081540_1009221 3300005983 Bacteria 6805
173 Ga0081540_1009314 3300005983 Bacteria 6773
174 Ga0081540_1012667 3300005983 Bacteria 5532
175 Ga0081540_1013667 3300005983 Bacteria 5264
176 Ga0081540_1017966 3300005983 Bacteria 4358
177 Ga0081540_1035810 3300005983 Bacteria 2656
178 Ga0081540_1081455 3300005983 Bacteria 1456
179 Ga0081540_1087351 3300005983 Bacteria 1382
180 Ga0081540_1105461 3300005983 Bacteria 1204
181 Ga0081540_1217779 3300005983 Bacteria 682
182 Ga0081539_10000824 3300005985 Bacteria 59921
183 Ga0081539_10001826 3300005985 Bacteria 33599
184 Ga0081539_10056696 3300005985 Bacteria 2173
185 Ga0070717_10000402 3300006028 Bacteria 27731
186 Ga0070717_10952087 3300006028 Bacteria 782
187 Ga0075365_10043534 3300006038 Bacteria 2939
188 Ga0075365_11028005 3300006038 Bacteria 580
189 Ga0075368_10143274 3300006042 Bacteria 996
190 Ga0075363_100088101 3300006048 Bacteria 1706
191 Ga0075364_10084087 3300006051 Bacteria 2107
192 Ga0075364_10190859 3300006051 Bacteria 1388
193 Ga0075364_10251323 3300006051 Bacteria 1201
194 Ga0070715_10047572 3300006163 Bacteria 1829
195 Ga0070716_100144483 3300006173 Bacteria 1522
196 Ga0070712_100087639 3300006175 Bacteria 2272
197 Ga0070712_101374804 3300006175 Bacteria 616
198 Ga0075362_10065841 3300006177 Bacteria 1646
199 Ga0075362_10190338 3300006177 Bacteria 996
200 Ga0075367_10089795 3300006178 Bacteria 1868
201 Ga0075367_10140923 3300006178 Bacteria 1493
202 Ga0075367_10188156 3300006178 Bacteria 1288
203 Ga0075367_10231044 3300006178 Bacteria 1158
204 Ga0075367_10491269 3300006178 Bacteria 778
205 Ga0075369_10026014 3300006186 Bacteria 2437
206 Ga0075369_10119017 3300006186 Bacteria 1194
207 Ga0075366_10076670 3300006195 Bacteria 1995
208 Ga0075366_10397838 3300006195 Bacteria 848
209 Ga0075366_10457933 3300006195 Bacteria 787
210 Ga0097621_100509737 3300006237 Bacteria 1091
211 Ga0075370_10029377 3300006353 Bacteria 3062
212 Ga0075370_10114890 3300006353 Bacteria 1564
213 Ga0075370_10135641 3300006353 Bacteria 1438
214 Ga0075370_10424404 3300006353 Bacteria 799
215 Ga0068871_100048459 3300006358 Bacteria 3430
216 Ga0068871_100508668 3300006358 Bacteria 1086
217 Ga0075428_100105629 3300006844 Bacteria 3070
218 Ga0075430_100882865 3300006846 Bacteria 737
219 Ga0075433_10432025 3300006852 Bacteria 1161
220 Ga0075434_100187512 3300006871 Bacteria 2089
221 Ga0075434_100296278 3300006871 Bacteria 1637
222 Ga0075434_100409718 3300006871 Bacteria 1377
223 Ga0075429_100736317 3300006880 Bacteria 864
224 Ga0068865_101288458 3300006881 Bacteria 649
225 Ga0075436_100942288 3300006914 Bacteria 647
226 Ga0097620_100083940 3300006931 Bacteria 3229
227 Ga0097620_100246428 3300006931 Bacteria 1876
228 Ga0097620_100310853 3300006931 Bacteria 1669
229 Ga0097620_100531750 3300006931 Bacteria 1270
230 Ga0099825_1037135 3300006941 Bacteria 1632
231 Ga0099824_1010736 3300006942 Bacteria 10647
232 Ga0099822_1001873 3300006943 Bacteria 25386
233 Ga0075435_100343491 3300007076 Bacteria 1279
234 Ga0099795_10133883 3300007788 Bacteria 1002
235 Ga0105250_10066410 3300009092 Bacteria 1455
236 Ga0105240_10071970 3300009093 Bacteria 4274
237 Ga0105240_10642011 3300009093 Bacteria 1164
238 Ga0105240_10896524 3300009093 Unclassified 954
239 Ga0111539_10589218 3300009094 Bacteria 1295
240 Ga0105245_10023512 3300009098 Bacteria 5410
241 Ga0105245_10025286 3300009098 Bacteria 5220
242 Ga0105245_10094969 3300009098 Bacteria 2750
243 Ga0105245_10366907 3300009098 Bacteria 1430
244 Ga0105247_10027726 3300009101 Bacteria 3425
245 Ga0105247_10108918 3300009101 Bacteria 1780
246 Ga0114129_11383353 3300009147 Bacteria 869
247 Ga0105241_10032187 3300009174 Bacteria 3930
248 Ga0105241_10184354 3300009174 Bacteria 1733
249 Ga0105241_10706151 3300009174 Bacteria 921
250 Ga0105242_10424705 3300009176 Bacteria 1246
251 Ga0105242_10543040 3300009176 Bacteria 1113
252 Ga0105248_10251511 3300009177 Bacteria 1989
253 Ga0105237_10027608 3300009545 Bacteria 5792
254 Ga0105237_10130645 3300009545 Bacteria 2506
255 Ga0105237_10465608 3300009545 Bacteria 1270
256 Ga0105237_11212590 3300009545 Bacteria 761
257 Ga0105238_10247715 3300009551 Bacteria 1760
258 Ga0105238_10286808 3300009551 Bacteria 1628
259 Ga0105238_10548911 3300009551 Bacteria 1160
260 Ga0105249_10759582 3300009553 Bacteria 1032
261 Ga0099796_10366968 3300010159 Bacteria 624
262 Ga0105239_10123545 3300010375 Bacteria 2876
263 Ga0105239_10124134 3300010375 Bacteria 2869
264 Ga0105239_10211103 3300010375 Bacteria 2176
265 Ga0105239_10580837 3300010375 Bacteria 1277
266 Ga0105239_10811210 3300010375 Bacteria 1072
267 Ga0105239_10908722 3300010375 Bacteria 1011
268 Ga0105239_10929289 3300010375 Bacteria 999
269 Ga0105239_11092929 3300010375 Bacteria 918
270 Ga0105246_10139869 3300011119 Bacteria 1819
271 Ga0105246_10194118 3300011119 Bacteria 1574
272 Ga0105246_11380111 3300011119 Bacteria 656
273 Ga0157373_10183735 3300013100 Bacteria 1473
274 Ga0157371_10063398 3300013102 Bacteria 2620
275 Ga0157370_10077272 3300013104 Bacteria 3136
276 Ga0157369_10188588 3300013105 Bacteria 2167
277 Ga0157369_10783463 3300013105 Bacteria 980
278 Ga0157374_10012040 3300013296 Bacteria 7511
279 Ga0157374_10226810 3300013296 Bacteria 1835
280 Ga0157378_10306046 3300013297 Bacteria 1540
281 Ga0157378_10562693 3300013297 Bacteria 1147
282 Ga0157378_10681486 3300013297 Bacteria 1046
283 Ga0163162_10060464 3300013306 Bacteria 3824
284 Ga0163162_10302734 3300013306 Bacteria 1731
285 Ga0157372_10289691 3300013307 Bacteria 1904
286 Ga0157372_10599113 3300013307 Bacteria 1284
287 Ga0157372_10630473 3300013307 Bacteria 1249
288 Ga0157372_13102837 3300013307 Bacteria 530
289 Ga0157375_10026110 3300013308 Bacteria 5439
290 Ga0157375_10206529 3300013308 Bacteria 2121
291 Ga0157375_10320089 3300013308 Bacteria 1716
292 Ga0157375_10464493 3300013308 Bacteria 1431
293 Ga0163163_10116559 3300014325 Bacteria 2702
294 Ga0163163_11333883 3300014325 Bacteria 779
295 Ga0157380_10229183 3300014326 Bacteria 1667
296 Ga0157380_10593340 3300014326 Bacteria 1094
297 Ga0157377_10041917 3300014745 Bacteria 2541
298 Ga0157379_11236216 3300014968 Bacteria 719
299 Ga0157376_10113354 3300014969 Bacteria 2391
300 Ga0157376_10449305 3300014969 Bacteria 1257
301 Ga0157376_10659751 3300014969 Bacteria 1047
302 Ga0163161_10125502 3300017792 Bacteria 1932
303 Ga0163161_10260454 3300017792 Bacteria 1354
304 Ga0163161_10811286 3300017792 Bacteria 787
305 Ga0213872_10107938 3300021361 Bacteria 1237
306 Ga0213876_10110668 3300021384 Bacteria 1458
307 Ga0213876_10460959 3300021384 Bacteria 676
308 Ga0213871_10037190 3300021441 Bacteria 1294
309 Ga0224712_10181980 3300022467 Bacteria 947
310 Ga0228600_1013447 3300024123 Bacteria 651
311 Ga0228598_1004809 3300024227 Bacteria 2853
312 Ga0207425_1035486 3300025245 Bacteria 973
313 Ga0209677_106670 3300025253 Bacteria 2671
314 Ga0209148_1005310 3300025254 Bacteria 2980
315 Ga0209233_1004579 3300025261 Bacteria 4684
316 Ga0209455_1002894 3300025272 Bacteria 6337
317 Ga0209455_1008301 3300025272 Bacteria 2834
318 Ga0209673_1054401 3300025273 Bacteria 1037
319 Ga0209564_1000401 3300025295 Bacteria 76992
320 Ga0209564_1022120 3300025295 Bacteria 2258
321 Ga0209758_1000011 3300025297 Bacteria 1049685
322 Ga0209758_1001959 3300025297 Bacteria 22262
323 Ga0209758_1002046 3300025297 Bacteria 21630
324 Ga0209758_1050262 3300025297 Bacteria 1463
325 Ga0209256_1005722 3300025299 Bacteria 6972
326 Ga0209257_1000620 3300025304 Bacteria 57327
327 Ga0209257_1000729 3300025304 Bacteria 49815
328 Ga0209257_1001767 3300025304 Bacteria 23946
329 Ga0207696_1036714 3300025711 Bacteria 1454
330 Ga0207692_10111818 3300025898 Bacteria 1516
331 Ga0207642_10111716 3300025899 Bacteria 1393
332 Ga0207710_10200352 3300025900 Bacteria 986
333 Ga0207688_10039440 3300025901 Bacteria 2623
334 Ga0207647_10177088 3300025904 Bacteria 1240
335 Ga0207699_10009649 3300025906 Bacteria 4816
336 Ga0207699_10268459 3300025906 Bacteria 1182
337 Ga0207699_10281422 3300025906 Bacteria 1156
338 Ga0207699_10853197 3300025906 Bacteria 671
339 Ga0207645_10119589 3300025907 Bacteria 1709
340 Ga0207643_10082378 3300025908 Bacteria 1865
341 Ga0207705_10525374 3300025909 Bacteria 920
342 Ga0207684_10058728 3300025910 Bacteria 3265
343 Ga0207684_10458146 3300025910 Bacteria 1095
344 Ga0207654_10077674 3300025911 Bacteria 1991
345 Ga0207654_10574180 3300025911 Bacteria 803
346 Ga0207707_10000404 3300025912 Bacteria 45123
347 Ga0207695_10325908 3300025913 Bacteria 1425
348 Ga0207671_10126577 3300025914 Bacteria 1958
349 Ga0207693_10131046 3300025915 Bacteria 1971
350 Ga0207693_10154979 3300025915 Bacteria 1802
351 Ga0207663_10085506 3300025916 Bacteria 2077
352 Ga0207663_10745323 3300025916 Bacteria 778
353 Ga0207660_10136755 3300025917 Bacteria 1870
354 Ga0207657_10116195 3300025919 Bacteria 2205
355 Ga0207649_10489154 3300025920 Bacteria 934
356 Ga0207652_10493807 3300025921 Bacteria 1102
357 Ga0207646_11313267 3300025922 Bacteria 631
358 Ga0207694_10039513 3300025924 Bacteria 3631
359 Ga0207694_10251664 3300025924 Bacteria 1446
360 Ga0207694_10985498 3300025924 Bacteria 713
361 Ga0207650_10054101 3300025925 Bacteria 2976
362 Ga0207650_10191098 3300025925 Bacteria 1636
363 Ga0207659_10280081 3300025926 Bacteria 1363
364 Ga0207687_10012593 3300025927 Bacteria 5525
365 Ga0207687_10013063 3300025927 Bacteria 5426
366 Ga0207687_10185994 3300025927 Bacteria 1613
367 Ga0207687_10354794 3300025927 Bacteria 1195
368 Ga0207687_10905155 3300025927 Bacteria 755
369 Ga0207700_10090898 3300025928 Bacteria 2410
370 Ga0207700_10387267 3300025928 Bacteria 1223
371 Ga0207700_10635373 3300025928 Bacteria 951
372 Ga0207700_10850060 3300025928 Bacteria 816
373 Ga0207664_10027721 3300025929 Bacteria 4299
374 Ga0207664_10159219 3300025929 Bacteria 1924
375 Ga0207664_10325808 3300025929 Bacteria 1356
376 Ga0207664_10525304 3300025929 Bacteria 1061
377 Ga0207664_10688085 3300025929 Bacteria 920
378 Ga0207644_10006424 3300025931 Bacteria 7661
379 Ga0207644_10421888 3300025931 Bacteria 1093
380 Ga0207690_10062525 3300025932 Bacteria 2535
381 Ga0207690_10192603 3300025932 Bacteria 1543
382 Ga0207690_10220162 3300025932 Bacteria 1452
383 Ga0207690_10663833 3300025932 Bacteria 855
384 Ga0207706_10080875 3300025933 Bacteria 2856
385 Ga0207706_10125365 3300025933 Bacteria 2259
386 Ga0207706_10136274 3300025933 Bacteria 2160
387 Ga0207706_10376636 3300025933 Bacteria 1232
388 Ga0207706_10676698 3300025933 Bacteria 883
389 Ga0207706_11030939 3300025933 Bacteria 690
390 Ga0207709_10511112 3300025935 Bacteria 939
391 Ga0207670_10037132 3300025936 Bacteria 3173
392 Ga0207670_10934202 3300025936 Bacteria 728
393 Ga0207665_10132626 3300025939 Bacteria 1770
394 Ga0207665_11032809 3300025939 Bacteria 654
395 Ga0207691_11333352 3300025940 Bacteria 592
396 Ga0207689_10072170 3300025942 Bacteria 2836
397 Ga0207689_10136519 3300025942 Bacteria 2020
398 Ga0207679_10054988 3300025945 Bacteria 2933
399 Ga0207679_10245220 3300025945 Bacteria 1520
400 Ga0207679_10425123 3300025945 Bacteria 1173
401 Ga0207667_10526987 3300025949 Bacteria 1196
402 Ga0207668_10021291 3300025972 Bacteria 4133
403 Ga0207668_10388625 3300025972 Bacteria 1176
404 Ga0207668_11124563 3300025972 Bacteria 704
405 Ga0207640_10142912 3300025981 Bacteria 1747
406 Ga0207640_10317412 3300025981 Bacteria 1239
407 Ga0207640_10777567 3300025981 Bacteria 827
408 Ga0207640_10815082 3300025981 Bacteria 810
409 Ga0207658_10129014 3300025986 Bacteria 2029
410 Ga0207658_10237544 3300025986 Bacteria 1542
411 Ga0207703_10060810 3300026035 Bacteria 3090
412 Ga0207703_10206516 3300026035 Bacteria 1748
413 Ga0207703_10232504 3300026035 Bacteria 1653
414 Ga0207703_10370247 3300026035 Bacteria 1323
415 Ga0207678_10007944 3300026067 Bacteria 9359
416 Ga0207678_10032510 3300026067 Bacteria 4546
417 Ga0207678_10100203 3300026067 Bacteria 2475
418 Ga0207678_10238907 3300026067 Bacteria 1556
419 Ga0207678_10249150 3300026067 Bacteria 1521
420 Ga0207678_10424251 3300026067 Bacteria 1153
421 Ga0207678_10534297 3300026067 Bacteria 1024
422 Ga0207678_10593999 3300026067 Bacteria 970
423 Ga0207678_11054754 3300026067 Bacteria 720
424 Ga0207708_10127239 3300026075 Bacteria 1989
425 Ga0207702_10112696 3300026078 Bacteria 2421
426 Ga0207702_10271195 3300026078 Bacteria 1601
427 Ga0207641_10063006 3300026088 Bacteria 3166
428 Ga0207641_11279738 3300026088 Bacteria 734
429 Ga0207648_10019660 3300026089 Bacteria 6095
430 Ga0207648_10215453 3300026089 Bacteria 1705
431 Ga0207676_10112890 3300026095 Bacteria 2277
432 Ga0207676_10361949 3300026095 Bacteria 1345
433 Ga0207676_10410117 3300026095 Bacteria 1268
434 Ga0207676_10527987 3300026095 Bacteria 1124
435 Ga0207674_10111629 3300026116 Bacteria 2708
436 Ga0207674_10265186 3300026116 Bacteria 1665
437 Ga0207674_10942005 3300026116 Bacteria 832
438 Ga0207675_100057494 3300026118 Bacteria 3629
439 Ga0207675_100062997 3300026118 Bacteria 3465
440 Ga0207675_100069301 3300026118 Bacteria 3296
441 Ga0207675_100105190 3300026118 Bacteria 2660
442 Ga0207675_100200406 3300026118 Bacteria 1917
443 Ga0207675_100318308 3300026118 Bacteria 1518
444 Ga0207683_10049361 3300026121 Bacteria 3684
445 Ga0207683_11006598 3300026121 Bacteria 773
446 Ga0207698_10295555 3300026142 Bacteria 1505
447 Ga0207698_12381597 3300026142 Bacteria 541
448 Ga0209589_1000001 3300027357 Bacteria 794224
449 Ga0209489_100001 3300027361 Bacteria 794224
450 Ga0209700_100001 3300027363 Bacteria 794224
451 Ga0209813_10041706 3300027866 Bacteria 1400
452 Ga0207428_10235629 3300027907 Bacteria 1369
453 Ga0268266_10053456 3300028379 Bacteria 3470
454 Ga0268266_10174815 3300028379 Bacteria 1951
455 Ga0268266_10293753 3300028379 Bacteria 1514
456 Ga0268266_10348365 3300028379 Bacteria 1391
457 Ga0268266_10403373 3300028379 Bacteria 1293
458 Ga0268266_10522194 3300028379 Bacteria 1135
459 Ga0268266_11135391 3300028379 Bacteria 756
460 Ga0268266_11339074 3300028379 Bacteria 691
461 Ga0268265_10065954 3300028380 Bacteria 2796
462 Ga0268265_10466837 3300028380 Bacteria 1182
463 Ga0268265_10840534 3300028380 Bacteria 897
464 Ga0268265_10967213 3300028380 Bacteria 839
465 Ga0268264_10000048 3300028381 Bacteria 334457
466 Ga0268264_10105922 3300028381 Bacteria 2454
467 Ga0268264_10228119 3300028381 Bacteria 1718
468 Ga0268264_10758289 3300028381 Bacteria 967
469 Ga0265337_1014325 3300028556 Bacteria 2631
470 Ga0265318_10055792 3300028577 Bacteria 1478
471 Ga0265336_10002023 3300028666 Bacteria 8653
472 Ga0307517_10401190 3300028786 Bacteria 726
473 Ga0307517_10516633 3300028786 Bacteria 604
474 Ga0307515_10055742 3300028794 Bacteria 5765
475 Ga0307515_10251366 3300028794 Bacteria 1520
476 Ga0265338_10000034 3300028800 Bacteria 244623
477 Ga0265324_10008520 3300029957 Bacteria 4070
478 Ga0307511_10259389 3300030521 Bacteria 826
479 Ga0265332_10001463 3300031238 Bacteria 13211
480 Ga0265332_10020911 3300031238 Bacteria 2890
481 Ga0265332_10026357 3300031238 Bacteria 2550
482 Ga0265332_10104590 3300031238 Bacteria 1194
483 Ga0265328_10000257 3300031239 Bacteria 24470
484 Ga0265328_10107591 3300031239 Bacteria 1035
485 Ga0265325_10055816 3300031241 Bacteria 2018
486 Ga0265340_10001613 3300031247 Bacteria 12952
487 Ga0265340_10486088 3300031247 Bacteria 543
488 Ga0265339_10094694 3300031249 Bacteria 1561
489 Ga0265339_10101408 3300031249 Bacteria 1497
490 Ga0265331_10125071 3300031250 Bacteria 1175
491 Ga0265327_10057949 3300031251 Bacteria 1990
492 Ga0265316_10202469 3300031344 Bacteria 1471
493 Ga0265316_10438173 3300031344 Bacteria 938
494 Ga0265316_10847007 3300031344 Bacteria 640
495 Ga0307513_10124063 3300031456 Bacteria 2543
496 Ga0307513_10257000 3300031456 Bacteria 1539
497 Ga0307509_10004515 3300031507 Bacteria 20009
498 Ga0307509_10083761 3300031507 Bacteria 3286
499 Ga0307509_10242489 3300031507 Bacteria 1593
500 Ga0307509_10468063 3300031507 Bacteria 951
501 Ga0307408_100468626 3300031548 Bacteria 1096
502 Ga0265313_10206662 3300031595 Bacteria 815
503 Ga0265313_10215668 3300031595 Bacteria 793
504 Ga0307508_10124432 3300031616 Bacteria 2181
505 Ga0307508_10350129 3300031616 Bacteria 1068
506 Ga0316579_10330007 3300031691 Bacteria 738
507 Ga0265314_10003438 3300031711 Bacteria 15304
508 Ga0265314_10055608 3300031711 Bacteria 2730
509 Ga0265314_10142572 3300031711 Bacteria 1479
510 Ga0265342_10000039 3300031712 Bacteria 140091
511 Ga0265342_10007997 3300031712 Bacteria 7657
512 Ga0265342_10201252 3300031712 Bacteria 1082
513 Ga0307516_10010023 3300031730 Bacteria 10487
514 Ga0307516_10183347 3300031730 Bacteria 1825
515 Ga0307516_10382672 3300031730 Bacteria 1068
516 Ga0307412_10169904 3300031911 Bacteria 1629
517 Ga0307412_10235461 3300031911 Bacteria 1413
518 Ga0307409_100056209 3300031995 Bacteria 3042
519 Ga0307409_100633657 3300031995 Bacteria 1061
520 Ga0307416_100350332 3300032002 Bacteria 1494
521 Ga0307416_100377813 3300032002 Bacteria 1446
522 Ga0307507_10043168 3300033179 Bacteria 4479
523 Ga0307510_10006198 3300033180 Bacteria 14263
524 Ga0307510_10140057 3300033180 Bacteria 2065
525 Ga0307510_10230653 3300033180 Bacteria 1354
526 Ga0315911_1000002 3300033442 Bacteria 926833
527 Ga0373926_0392280 3300035083 Bacteria 548
528 Ga0373934_0059481 3300035086 Bacteria 1521
529 Ga0373944_0012406 3300035089 Bacteria 2348
530 Ga0373944_0124754 3300035089 Bacteria 890
531 Ga0373923_0005649 3300035111 Bacteria 4261
532 Ga0373923_0052257 3300035111 Bacteria 1716
533 Ga0373932_0256459 3300035112 Bacteria 640
534 Ga0373936_0003425 3300035113 Bacteria 5946
535 Ga0373936_0020001 3300035113 Bacteria 2597
536 Ga0373936_0079192 3300035113 Bacteria 1365
537 Ga0373939_0093342 3300035114 Bacteria 1021
538 Ga0373941_0074741 3300035115 Bacteria 1133
539 Ga0373945_0023360 3300035116 Bacteria 2135
540 Ga0373945_0050258 3300035116 Bacteria 1532
541 Ga0373953_0002986 3300035117 Bacteria 5176
542 Ga0373953_0046725 3300035117 Bacteria 1739
543 Ga0373953_0192179 3300035117 Bacteria 882
544 Ga0373954_0004607 3300035118 Bacteria 5942
545 Ga0373954_0037670 3300035118 Bacteria 2248
546 Ga0373954_0142179 3300035118 Bacteria 1171
547 Ga0373956_0004560 3300035119 Bacteria 5530
548 Ga0373956_0107716 3300035119 Bacteria 1296
549 Ga0373957_0034710 3300035120 Bacteria 1870
550 Ga0373943_0002891 3300035170 Bacteria 7796
551 Ga0373943_0153100 3300035170 Bacteria 1250
552 Ga0373943_0306457 3300035170 Bacteria 903
553 Ga0373946_0011102 3300035171 Bacteria 3351
554 Ga0373946_0022449 3300035171 Bacteria 2456
555 Ga0373955_0003145 3300035172 Bacteria 7221
556 Ga0373955_0018293 3300035172 Bacteria 3483
557 Ga0373955_0019988 3300035172 Bacteria 3358
558 Ga0373924_0057151 3300035410 Bacteria 1626
559 Ga0373935_0001059 3300035692 Bacteria 14992
560 Ga0373935_0101957 3300035692 Bacteria 1893
561 Ga0373935_0103761 3300035692 Bacteria 1878
562 Ga0373935_0712163 3300035692 Bacteria 738
563 Ga0373927_0000456 3300035695 Bacteria 31301
564 Ga0373927_0089176 3300035695 Bacteria 2002
565 Ga0373927_0264690 3300035695 Bacteria 1131
566 Ga0373933_0015188 3300035724 Bacteria 4292
567 Ga0373933_0038486 3300035724 Bacteria 2810
568 Ga0373933_0128241 3300035724 Bacteria 1593
569 Ga0373933_0262592 3300035724 Bacteria 1113
570 Ga0373933_0685728 3300035724 Bacteria 674
571 Ga0373947_0002829 3300035725 Bacteria 10356
572 Ga0373947_0051973 3300035725 Bacteria 2467
573 Ga0373947_0060569 3300035725 Bacteria 2299
574 Ga0373947_0887615 3300035725 Bacteria 609
575 Ga0373937_0311338 3300036401 Bacteria 1489
576 Ga0373937_0321385 3300036401 Bacteria 1464
577 Ga0373937_0608242 3300036401 Bacteria 1037
578 Ga0310112_048466 3300036458 Bacteria 576
579 Ga0372808_007737 3300036459 Bacteria 1475
580 Ga0372808_012541 3300036459 Bacteria 1203
581 Ga0373925_0044802 3300037068 Bacteria 3285
582 Ga0373925_0095058 3300037068 Bacteria 2282
583 Ga0373925_0112212 3300037068 Bacteria 2107
584 Ga0373925_0693607 3300037068 Bacteria 839
585 Ga0395899_0441481 3300037312 Bacteria 854
586 Ga0395900_0062919 3300037418 Bacteria 3814
587 Ga0395898_0037505 3300037466 Bacteria 4807
588 Ga0395898_0209258 3300037466 Bacteria 1861
589 Ga0436364_0169791 3300037853 Bacteria 1599
590 Ga0436364_1233393 3300037853 Bacteria 1490
591 Ga0436364_1554191 3300037853 Bacteria 594
592 Ga0395901_1523453 3300038443 Bacteria 624
593 Ga0436365_0191780 3300039437 Bacteria 3907
594 Ga0436365_0251377 3300039437 Bacteria 2455
595 Ga0436365_0393739 3300039437 Bacteria 765
596 Ga0436365_1908037 3300039437 Bacteria 2107
597 Ga0436361_1005768 3300039447 Bacteria 1128
598 Ga0436361_1008940 3300039447 Bacteria 2288
599 Ga0436363_1267832 3300039450 Bacteria 725
600 Ga0436362_0190408 3300039453 Bacteria 505
601 Ga0451802_0888262 3300041460 Bacteria 1335
602 Ga0451839_1007315 3300041496 Bacteria 994
603 Ga0451851_0273039 3300041507 Bacteria 582
604 Ga0451853_2445747 3300041512 Bacteria 1196
605 Ga0439445_0157835 3300042004 Bacteria 662
606 Ga0466969_0057497 3300044656 Bacteria 1896
607 Ga0466969_0178772 3300044656 Bacteria 971
608 Ga0466972_0030619 3300044658 Bacteria 2648
609 Ga0466965_0403188 3300044683 Bacteria 756
610 Ga0466965_0684660 3300044683 Bacteria 587
611 Ga0466963_0247985 3300044694 Bacteria 1249
612 Ga0466968_0016849 3300044735 Bacteria 2913
613 Ga0466970_0069207 3300044765 Bacteria 1897
614 Ga0466957_0143835 3300044842 Bacteria 1538
615 Ga0466957_0187965 3300044842 Bacteria 1352
616 Ga0466960_0009101 3300044901 Bacteria 4085
617 Ga0466959_0093872 3300045049 Bacteria 2153
618 Ga0466959_0440227 3300045049 Bacteria 884
619 Ga0466958_0159600 3300045836 Bacteria 1424
620 Ga0466967_0140209 3300045976 Bacteria 2251
621 Ga0466967_0458301 3300045976 Bacteria 1247
622 Ga0495617_026835 3300046452 Bacteria 1939
623 Ga0495592_0012321 3300046454 Bacteria 6494
624 Ga0495592_0050196 3300046454 Bacteria 3100
625 Ga0495592_0061168 3300046454 Bacteria 2768
626 Ga0495592_0143345 3300046454 Bacteria 1659
627 Ga0495603_0000468 3300046455 Bacteria 22214
628 Ga0495603_0033212 3300046455 Bacteria 3105
629 Ga0495603_0130525 3300046455 Bacteria 1463
630 Ga0495603_0177669 3300046455 Bacteria 1232
631 Ga0495603_0235706 3300046455 Bacteria 1055
632 Ga0495590_0051207 3300046457 Bacteria 1442
633 Ga0495590_0053608 3300046457 Bacteria 1408
634 Ga0495591_090943 3300046458 Bacteria 766
635 Ga0495629_0000244 3300046459 Bacteria 47424
636 Ga0495629_0002029 3300046459 Bacteria 15740
637 Ga0495629_0256266 3300046459 Bacteria 1203
638 Ga0495629_0395399 3300046459 Bacteria 940
639 Ga0495638_0006759 3300046460 Bacteria 8304
640 Ga0495638_0023696 3300046460 Bacteria 4010
641 Ga0495638_0099406 3300046460 Bacteria 1741
642 Ga0495638_0114000 3300046460 Bacteria 1603
643 Ga0495638_0620069 3300046460 Bacteria 529
644 Ga0495641_0005414 3300046461 Bacteria 8632
645 Ga0495641_0080026 3300046461 Bacteria 1464
646 Ga0495651_0339234 3300046462 Bacteria 996
647 Ga0495653_0048844 3300046463 Bacteria 3263
648 Ga0495653_0062538 3300046463 Bacteria 2812
649 Ga0495580_0002784 3300046472 Bacteria 15056
650 Ga0495580_0022608 3300046472 Bacteria 4625
651 Ga0495582_0000986 3300046473 Bacteria 15936
652 Ga0495582_0283876 3300046473 Bacteria 951
653 Ga0495605_0069318 3300046474 Bacteria 1670
654 Ga0495639_0000015 3300046475 Bacteria 80742
655 Ga0495639_0046128 3300046475 Bacteria 1972
656 Ga0495639_0203940 3300046475 Bacteria 969
657 Ga0495639_0424590 3300046475 Bacteria 673
658 Ga0495662_0004296 3300046476 Bacteria 7158
659 Ga0495664_0006408 3300046477 Bacteria 6500
660 Ga0495664_0014560 3300046477 Bacteria 4461
661 Ga0495664_0016114 3300046477 Bacteria 4257
662 Ga0495664_0018042 3300046477 Bacteria 4036
663 Ga0495664_0443451 3300046477 Bacteria 778
664 Ga0495664_0543215 3300046477 Bacteria 693
665 Ga0495584_0288698 3300046491 Bacteria 833
666 Ga0495584_0319164 3300046491 Bacteria 789
667 Ga0495585_0037608 3300046492 Bacteria 2725
668 Ga0495594_0000052 3300046499 Bacteria 51787
669 Ga0495594_0166812 3300046499 Bacteria 1252
670 Ga0495594_0169486 3300046499 Bacteria 1242
671 Ga0495594_0306414 3300046499 Bacteria 905
672 Ga0495596_0045661 3300046500 Bacteria 1722
673 Ga0495583_0081116 3300046506 Bacteria 1409
674 Ga0495583_0109194 3300046506 Bacteria 1174
675 Ga0495583_0135597 3300046506 Bacteria 1028
676 Ga0495606_0071103 3300046507 Bacteria 2192
677 Ga0495606_0147760 3300046507 Bacteria 1382
678 Ga0495606_0187395 3300046507 Bacteria 1188
679 Ga0495606_0354754 3300046507 Bacteria 777
680 Ga0495608_0025236 3300046511 Bacteria 4056
681 Ga0495608_0093626 3300046511 Bacteria 1941
682 Ga0495608_0408649 3300046511 Bacteria 829
683 Ga0495616_0102274 3300046513 Bacteria 1342
684 Ga0495616_0156388 3300046513 Bacteria 1028
685 Ga0495616_0236608 3300046513 Bacteria 789
686 Ga0495618_0008774 3300046514 Bacteria 6105
687 Ga0495618_0297998 3300046514 Bacteria 1002
688 Ga0495620_0009664 3300046515 Bacteria 5120
689 Ga0495620_0055613 3300046515 Bacteria 1667
690 Ga0495620_0070892 3300046515 Bacteria 1427
691 Ga0495628_0051224 3300046516 Bacteria 3264
692 Ga0495628_0139249 3300046516 Bacteria 1852
693 Ga0495628_0366569 3300046516 Bacteria 1057
694 Ga0495628_0426945 3300046516 Bacteria 965
695 Ga0495630_0001642 3300046517 Bacteria 15530
696 Ga0495630_0736561 3300046517 Bacteria 754
697 Ga0495631_0018925 3300046518 Bacteria 3236
698 Ga0495631_0024875 3300046518 Bacteria 2761
699 Ga0495632_0055899 3300046519 Bacteria 1931
700 Ga0495632_0089356 3300046519 Bacteria 1462
701 Ga0495632_0166745 3300046519 Bacteria 1013
702 Ga0495637_0061832 3300046520 Bacteria 1534
703 Ga0495643_0121160 3300046522 Bacteria 1321
704 Ga0495648_0171844 3300046524 Bacteria 1110
705 Ga0495666_0019119 3300046526 Bacteria 3403
706 Ga0495666_0177575 3300046526 Bacteria 984
707 Ga0495666_0198516 3300046526 Bacteria 923
708 Ga0495652_0048733 3300046529 Bacteria 3628
709 Ga0495652_0076403 3300046529 Bacteria 2778
710 Ga0495652_0172587 3300046529 Bacteria 1667
711 Ga0495652_0220869 3300046529 Bacteria 1424
712 Ga0495654_0032434 3300046530 Bacteria 2648
713 Ga0495665_0002408 3300046531 Bacteria 10110
714 Ga0495665_0048031 3300046531 Bacteria 2264
715 Ga0495640_0009558 3300046533 Bacteria 7543
716 Ga0495640_0011080 3300046533 Bacteria 6941
717 Ga0495640_0136148 3300046533 Bacteria 1586
718 Ga0495640_0204182 3300046533 Bacteria 1251
719 Ga0495640_0390579 3300046533 Bacteria 855
720 Ga0495587_0009543 3300046536 Bacteria 6213
721 Ga0495598_0011017 3300046537 Bacteria 2181
722 Ga0495609_0069068 3300046538 Bacteria 1554
723 Ga0495621_0020483 3300046539 Bacteria 2171
724 Ga0495597_0145358 3300046542 Bacteria 976
725 Ga0495645_0013656 3300046543 Bacteria 5753
726 Ga0495645_0116310 3300046543 Bacteria 1887
727 Ga0495645_0182747 3300046543 Bacteria 1435
728 Ga0495645_0205321 3300046543 Bacteria 1334
729 Ga0495645_0245613 3300046543 Bacteria 1192
730 Ga0495622_0043031 3300046557 Bacteria 2100
731 Ga0495622_0092790 3300046557 Bacteria 1386
732 Ga0495622_0095860 3300046557 Bacteria 1361
733 Ga0495633_0223714 3300046558 Bacteria 861
734 Ga0495667_0040707 3300046559 Bacteria 3084
735 Ga0495667_0122017 3300046559 Bacteria 1682
736 Ga0495667_0124825 3300046559 Bacteria 1661
737 Ga0495667_0263494 3300046559 Bacteria 1096
738 Ga0495667_0313959 3300046559 Bacteria 992
739 Ga0495656_0009134 3300046615 Bacteria 3560
740 Ga0495656_0074587 3300046615 Bacteria 1515
741 Ga0495656_0122454 3300046615 Bacteria 1229
742 Ga0495668_0032051 3300046616 Bacteria 2959
743 Ga0495668_0086409 3300046616 Bacteria 1720
744 Ga0495668_0285397 3300046616 Bacteria 904
745 Ga0495668_0382603 3300046616 Bacteria 773
746 Ga0495634_0003714 3300046642 Bacteria 12163
747 Ga0495634_0016562 3300046642 Bacteria 5270
748 Ga0495634_0076327 3300046642 Bacteria 2200
749 Ga0495634_0245470 3300046642 Bacteria 1097
750 Ga0495634_0293367 3300046642 Bacteria 985
751 Ga0495611_0043449 3300046648 Bacteria 2009
752 Ga0495611_0151438 3300046648 Bacteria 1083
753 Ga0495611_0187645 3300046648 Bacteria 965
754 Ga0495625_0087742 3300046660 Bacteria 2156
755 Ga0495625_0129626 3300046660 Bacteria 1709
756 Ga0495625_0184281 3300046660 Bacteria 1386
757 Ga0495625_0332132 3300046660 Bacteria 965
758 Ga0495625_0489730 3300046660 Bacteria 753
759 Ga0495625_0597809 3300046660 Bacteria 663
760 Ga0495625_0696616 3300046660 Bacteria 600
761 Ga0495635_0001648 3300046663 Bacteria 15060
762 Ga0495635_0005493 3300046663 Bacteria 8814
763 Ga0495635_0147910 3300046663 Bacteria 1599
764 Ga0495659_0085540 3300046664 Bacteria 1203
765 Ga0495659_0101804 3300046664 Bacteria 1113
766 Ga0495661_0009212 3300046665 Bacteria 6784
767 Ga0495588_0042507 3300046674 Bacteria 2323
768 Ga0495657_0035266 3300046675 Bacteria 3468
769 Ga0495657_0058559 3300046675 Bacteria 2558
770 Ga0495657_0238792 3300046675 Bacteria 1097
771 Ga0495599_0051596 3300046678 Bacteria 2577
772 Ga0495599_0164886 3300046678 Bacteria 1369
773 Ga0495599_0256173 3300046678 Bacteria 1064
774 Ga0495599_0497993 3300046678 Bacteria 717
775 Ga0495599_0565641 3300046678 Bacteria 665
776 Ga0495599_0640760 3300046678 Bacteria 616
777 Ga0495623_0028703 3300046679 Bacteria 3579
778 Ga0495623_0114202 3300046679 Bacteria 1633
779 Ga0495623_0161650 3300046679 Bacteria 1316
780 Ga0495646_0005606 3300046680 Bacteria 7943
781 Ga0495646_0016089 3300046680 Bacteria 4747
782 Ga0495646_0341797 3300046680 Bacteria 785
783 Ga0495647_0008590 3300046681 Bacteria 3436
784 Ga0495647_0014709 3300046681 Bacteria 2730
785 Ga0495658_0002378 3300046683 Bacteria 9493
786 Ga0495658_0104092 3300046683 Bacteria 1698
787 Ga0495658_0111179 3300046683 Bacteria 1648
788 Ga0495669_0061526 3300046684 Bacteria 1699
789 Ga0495669_0121917 3300046684 Bacteria 1222
790 Ga0495669_0317477 3300046684 Bacteria 752
791 Ga0495613_0019214 3300046689 Bacteria 5094
792 Ga0495613_0236572 3300046689 Bacteria 1278
793 Ga0495624_0001637 3300046690 Bacteria 17178
794 Ga0495624_0144728 3300046690 Bacteria 1455
795 Ga0495670_0055014 3300046691 Bacteria 1995
796 Ga0495670_0176288 3300046691 Bacteria 1127
797 Ga0495670_0315804 3300046691 Bacteria 838
798 Ga0495671_0022803 3300046692 Bacteria 3276
799 Ga0495671_0054884 3300046692 Bacteria 1974
800 Ga0495671_0448922 3300046692 Bacteria 616
801 Ga0495649_0091380 3300046694 Bacteria 1622
802 Ga0495649_0158538 3300046694 Bacteria 1187
803 Ga0495649_0291367 3300046694 Bacteria 832
804 Ga0495589_0248476 3300046794 Bacteria 831
805 Ga0495600_0026219 3300046809 Bacteria 3760
806 Ga0495600_0031634 3300046809 Bacteria 3429
807 Ga0495600_0104906 3300046809 Bacteria 1842
808 Ga0495660_0062347 3300046810 Bacteria 1999
809 Ga0495660_0227078 3300046810 Bacteria 877
810 Ga0495581_0000123 3300047315 Bacteria 33251
811 Ga0495581_0073370 3300047315 Bacteria 1980
812 Ga0495581_0189155 3300047315 Bacteria 1204
813 Ga0495581_0273439 3300047315 Bacteria 988
814 Ga0495604_0006563 3300047317 Bacteria 9223
815 Ga0495604_0419321 3300047317 Bacteria 879
816 Ga0495604_0615045 3300047317 Bacteria 695
817 Ga0495674_0001682 3300047319 Bacteria 21755
818 Ga0495674_0007867 3300047319 Bacteria 10179
819 Ga0495674_0226925 3300047319 Bacteria 1542
820 Ga0495674_0389363 3300047319 Bacteria 1127
821 Ga0495672_0013335 3300047320 Bacteria 5675
822 Ga0495672_0166329 3300047320 Bacteria 1129
823 Ga0495672_0249953 3300047320 Bacteria 861
824 Ga0495676_0050628 3300047321 Bacteria 3330
825 Ga0495676_0097442 3300047321 Bacteria 2184
826 Ga0495676_0214456 3300047321 Bacteria 1330
827 Ga0495676_0261283 3300047321 Bacteria 1178
828 Ga0495676_0696254 3300047321 Bacteria 658
829 Ga0495680_0004838 3300047322 Bacteria 12776
830 Ga0495680_0347905 3300047322 Bacteria 1032
831 Ga0495680_0430445 3300047322 Bacteria 906
832 Ga0495683_0196897 3300047323 Bacteria 911
833 Ga0495675_0063385 3300047444 Bacteria 2339
834 Ga0495675_0238461 3300047444 Bacteria 1095
835 Ga0495677_0087812 3300047445 Bacteria 1170
836 Ga0495673_0144799 3300047469 Bacteria 923
837 Ga0495673_0236043 3300047469 Bacteria 672
838 Ga0495684_0061433 3300047471 Bacteria 2859
839 Ga0495684_0106456 3300047471 Bacteria 2119
840 Ga0495686_0030975 3300047472 Bacteria 3471
841 Ga0495686_0120640 3300047472 Bacteria 1563
842 Ga0495686_0160239 3300047472 Bacteria 1315
843 Ga0495686_0393509 3300047472 Bacteria 745
844 Ga0495593_0000332 3300047673 Bacteria 26189
845 Ga0495593_0004032 3300047673 Bacteria 8749
846 Ga0495593_0143388 3300047673 Bacteria 1210
847 Ga0495593_0361226 3300047673 Bacteria 726
848 Ga0495593_0396947 3300047673 Bacteria 690
849 Ga0495602_0039574 3300048088 Bacteria 4339
850 Ga0495614_0005250 3300048089 Bacteria 5843
851 Ga0495626_0017083 3300048091 Bacteria 3671
852 Ga0495626_0290535 3300048091 Bacteria 648
853 Ga0496100_0053851 3300048903 Bacteria 2622
854 Ga0496100_0300827 3300048903 Bacteria 1201
855 Ga0496101_0007148 3300048904 Bacteria 7220
856 Ga0496101_0122158 3300048904 Bacteria 1970
857 Ga0496101_0164028 3300048904 Bacteria 1705
858 Ga0496101_0628455 3300048904 Bacteria 849
859 Ga0496102_0061742 3300048905 Bacteria 3431
860 Ga0496102_0189841 3300048905 Bacteria 1936
861 Ga0496102_0363650 3300048905 Bacteria 1362
862 Ga0496102_1294243 3300048905 Bacteria 648
863 Ga0496103_0109799 3300048906 Bacteria 1751
864 Ga0496103_0209280 3300048906 Bacteria 1254
865 Ga0496103_0253800 3300048906 Bacteria 1132
866 Ga0496104_0015940 3300048907 Bacteria 6820
867 Ga0496104_0131599 3300048907 Bacteria 2403
868 Ga0496104_0877881 3300048907 Bacteria 802
869 Ga0496105_0457279 3300048908 Bacteria 1007
870 Ga0496106_0102769 3300048909 Bacteria 2217
871 Ga0496106_0418132 3300048909 Bacteria 1077
872 Ga0496106_0676501 3300048909 Bacteria 823
873 Ga0496107_0011954 3300048910 Bacteria 6060
874 Ga0496107_0392271 3300048910 Bacteria 1032
875 Ga0496107_0583688 3300048910 Bacteria 827
876 Ga0496107_1208412 3300048910 Bacteria 543
877 Ga0496108_0093932 3300048911 Bacteria 2552
878 Ga0496108_0361424 3300048911 Bacteria 1267
879 Ga0496108_0762974 3300048911 Bacteria 836
880 Ga0496109_0008198 3300048912 Bacteria 8864
881 Ga0496109_0048842 3300048912 Bacteria 3850
882 Ga0496110_0015882 3300048913 Bacteria 6277
883 Ga0496110_0137548 3300048913 Bacteria 2208
884 Ga0496110_0256467 3300048913 Bacteria 1592
885 Ga0496111_0023733 3300048914 Bacteria 4308
886 Ga0496111_0932821 3300048914 Bacteria 624
887 Ga0496111_0937970 3300048914 Bacteria 622
888 Ga0496112_0083173 3300048915 Bacteria 3165
889 Ga0496112_0268321 3300048915 Bacteria 1655
890 Ga0496112_0380219 3300048915 Bacteria 1353
891 Ga0496112_0860676 3300048915 Bacteria 829
892 Ga0496113_0126700 3300048916 Bacteria 2000
893 Ga0496114_0015772 3300048917 Bacteria 6080
894 Ga0496114_0152086 3300048917 Bacteria 2008
895 Ga0496114_0221776 3300048917 Bacteria 1660
896 Ga0496114_1556996 3300048917 Bacteria 549
897 Ga0496115_0005432 3300048918 Bacteria 9269
898 Ga0496115_0085919 3300048918 Bacteria 2566
899 Ga0496115_0154497 3300048918 Bacteria 1895
900 Ga0496115_0285670 3300048918 Bacteria 1354
901 Ga0496115_0503369 3300048918 Bacteria 973
902 Ga0496116_0001099 3300048919 Bacteria 32485
903 Ga0496116_0307019 3300048919 Bacteria 751
904 Ga0496117_0027253 3300048920 Bacteria 4455
905 Ga0496117_0061631 3300048920 Bacteria 2577
906 Ga0496117_0255294 3300048920 Bacteria 953
907 Ga0496118_0011793 3300048921 Bacteria 8487
908 Ga0496118_0022593 3300048921 Bacteria 5492
909 Ga0496118_0067738 3300048921 Bacteria 2597
910 Ga0496118_0081043 3300048921 Bacteria 2281
911 Ga0496118_0115655 3300048921 Bacteria 1765
912 Ga0496118_0143239 3300048921 Bacteria 1510
913 Ga0496118_0407435 3300048921 Bacteria 704
914 Ga0496119_0031900 3300048922 Bacteria 3521
915 Ga0496119_0155124 3300048922 Bacteria 1223
916 Ga0496120_0011170 3300048923 Bacteria 6198
917 Ga0496120_0043295 3300048923 Bacteria 2624
918 Ga0496120_0329598 3300048923 Bacteria 691
919 Ga0496121_0001566 3300048924 Bacteria 38176
920 Ga0496121_0002300 3300048924 Bacteria 29639
921 Ga0496121_0002583 3300048924 Bacteria 27387
922 Ga0496121_0002985 3300048924 Bacteria 24586
923 Ga0496121_0028431 3300048924 Bacteria 5203
924 Ga0496121_0031009 3300048924 Bacteria 4897
925 Ga0496121_0057009 3300048924 Bacteria 3240
926 Ga0496121_0073592 3300048924 Bacteria 2737
927 Ga0496121_0085514 3300048924 Bacteria 2482
928 Ga0496121_0087473 3300048924 Bacteria 2446
929 Ga0496121_0105524 3300048924 Bacteria 2162
930 Ga0496121_0141628 3300048924 Bacteria 1783
931 Ga0496121_0168114 3300048924 Bacteria 1596
932 Ga0496121_0207701 3300048924 Bacteria 1390
933 Ga0496121_0221476 3300048924 Bacteria 1332
934 Ga0496121_0252471 3300048924 Bacteria 1222
935 Ga0496122_0097166 3300048925 Bacteria 1983
936 Ga0496122_0430000 3300048925 Bacteria 661
937 Ga0496123_0044358 3300048926 Bacteria 3041
938 Ga0496123_0334315 3300048926 Bacteria 710
939 Ga0496124_0003294 3300048927 Bacteria 19907
940 Ga0496124_0212774 3300048927 Bacteria 1461
941 Ga0496124_0491859 3300048927 Bacteria 825
942 Ga0496124_0571790 3300048927 Bacteria 741
943 Ga0496124_0847641 3300048927 Bacteria 560
944 Ga0496125_0000801 3300048928 Bacteria 51346
945 Ga0496125_0009137 3300048928 Bacteria 10253
946 Ga0496125_0013838 3300048928 Bacteria 7900
947 Ga0496125_0124993 3300048928 Bacteria 1825
948 Ga0496125_0132854 3300048928 Bacteria 1748
949 Ga0496125_0190934 3300048928 Bacteria 1352
950 Ga0496125_0350237 3300048928 Bacteria 882
951 Ga0496126_0003285 3300048929 Bacteria 20614
952 Ga0496126_0034214 3300048929 Bacteria 4774
953 Ga0496126_0037297 3300048929 Bacteria 4537
954 Ga0496126_0101489 3300048929 Bacteria 2516
955 Ga0496126_0117979 3300048929 Bacteria 2304
956 Ga0496126_0145070 3300048929 Bacteria 2040
957 Ga0496126_0162562 3300048929 Bacteria 1907
958 Ga0496126_0175131 3300048929 Bacteria 1825
959 Ga0496126_0213222 3300048929 Bacteria 1625
960 Ga0496126_0304727 3300048929 Bacteria 1313
961 Ga0496126_0308180 3300048929 Bacteria 1304
962 Ga0496126_0749752 3300048929 Bacteria 754
963 Ga0495682_0189736 3300049460 Bacteria 730
964 Ga0501032_0000001 3300049569 Bacteria 422097
965 Ga0501033_0000092 3300049570 Bacteria 85398
966 Ga0501034_0000036 3300049571 Bacteria 239274
967 Ga0501034_0222843 3300049571 Bacteria 1838
968 Ga0501036_0000078 3300049572 Bacteria 60614
969 Ga0501037_0000017 3300049573 Bacteria 157276
970 Ga0501038_0000153 3300049574 Bacteria 59196
971 Ga0501038_0843970 3300049574 Bacteria 679
972 Ga0501039_0000011 3300049575 Bacteria 245124
973 Ga0501041_0097660 3300049577 Bacteria 1816
974 Ga0501043_0000016 3300049579 Bacteria 170869
975 Ga0501046_0011771 3300049580 Bacteria 7470
976 Ga0501046_0268808 3300049580 Bacteria 1251
977 Ga0501047_0013118 3300049581 Bacteria 7848
978 Ga0501047_0076378 3300049581 Bacteria 3224
979 Ga0501047_0095469 3300049581 Bacteria 2852
980 Ga0501047_0495828 3300049581 Bacteria 1048
981 Ga0501067_0066576 3300049583 Bacteria 1994
982 Ga0501067_0099675 3300049583 Bacteria 1613
983 Ga0501067_0641627 3300049583 Bacteria 596
984 Ga0501068_0854246 3300049584 Bacteria 598
985 Ga0501069_0636277 3300049585 Bacteria 641
986 Ga0501070_0142293 3300049586 Bacteria 1980
987 Ga0501070_0377926 3300049586 Bacteria 1148
988 Ga0501070_0485763 3300049586 Bacteria 993
989 Ga0501071_0931043 3300049587 Bacteria 671
990 Ga0501072_0005754 3300049588 Bacteria 9436
991 Ga0501072_0654134 3300049588 Bacteria 827
992 Ga0501073_0233467 3300049589 Bacteria 1270
993 Ga0501074_0074417 3300049590 Bacteria 2439
994 Ga0501080_0069368 3300049742 Bacteria 3278
995 Ga0501083_0033737 3300049744 Bacteria 3503
996 Ga0501083_0053385 3300049744 Bacteria 2714
997 Ga0501083_0067461 3300049744 Bacteria 2381
998 Ga0501035_0000028 3300049822 Bacteria 179195
999 Ga0501035_0062272 3300049822 Bacteria 3320
1000 Ga0501044_0090388 3300049823 Bacteria 3089
1001 Ga0501044_0116053 3300049823 Bacteria 2683
1002 Ga0501044_0291295 3300049823 Bacteria 1564
1003 nmdc:mga03n38_212664_c1 3300050490 Bacteria 1006
1004 nmdc:mga03n38_492154_c1 3300050490 Bacteria 687
1005 nmdc:mga03n38_49430_c1 3300050490 Bacteria 1870
1006 nmdc:mga0yw44_359092_c1 3300050492 Bacteria 982
1007 nmdc:mga0yw44_40732_c1 3300050492 Bacteria 2762
1008 nmdc:mga0yw44_627679_c1 3300050492 Bacteria 730
1009 nmdc:mga0k408_110097_c1 3300050493 Bacteria 1628
1010 nmdc:mga0k408_113608_c1 3300050493 Bacteria 1602
1011 nmdc:mga06z11_131121_c1 3300050494 Bacteria 1408
1012 nmdc:mga06z11_175728_c1 3300050494 Bacteria 1232
1013 nmdc:mga04h51_102777_c1 3300050495 Bacteria 1044
1014 nmdc:mga07m45_177276_c1 3300050496 Bacteria 1239
1015 nmdc:mga07m45_261130_c1 3300050496 Bacteria 1008
1016 nmdc:mga07m45_34810_c1 3300050496 Bacteria 2800
1017 nmdc:mga07m45_372558_c1 3300050496 Bacteria 829
1018 nmdc:mga05p37_1292349_c1 3300050507 Bacteria 744
1019 nmdc:mga05p37_2013400_c1 3300050507 Bacteria 546
1020 nmdc:mga08y16_908491_c1 3300050511 Bacteria 866
1021 nmdc:mga0n895_298481_c1 3300050512 Bacteria 1633
1022 nmdc:mga0n895_929483_c1 3300050512 Bacteria 854
1023 nmdc:mga0rr50_322499_c1 3300050513 Bacteria 1295
1024 nmdc:mga08x19_135787_c1 3300050514 Bacteria 1658
1025 nmdc:mga0sz30_10924_c1 3300050516 Bacteria 2579
1026 nmdc:mga0sz30_154132_c1 3300050516 Bacteria 1017
1027 nmdc:mga0sz30_166150_c1 3300050516 Bacteria 978
1028 nmdc:mga0sz30_182347_c1 3300050516 Bacteria 932
1029 nmdc:mga0sz30_2979_c1 3300050516 Bacteria 6074
1030 Ga0495601_0001435 3300053077 Bacteria 13125
1031 Ga0495601_0026159 3300053077 Bacteria 3601
1032 Ga0495601_0103604 3300053077 Bacteria 1839
1033 Ga0495601_0121092 3300053077 Bacteria 1699
1034 Ga0495601_0222865 3300053077 Bacteria 1232
1035 Ga0495601_0246368 3300053077 Bacteria 1167
1036 Ga0495612_0010450 3300053078 Bacteria 3754
1037 Ga0495612_0012482 3300053078 Bacteria 3425
1038 Ga0495612_0144867 3300053078 Bacteria 1032
1039 Ga0495612_0197262 3300053078 Bacteria 887
1040 Ga0495612_0225392 3300053078 Bacteria 830
1041 Ga0500635_0000999 3300053080 Bacteria 6783
1042 Ga0500635_0004951 3300053080 Bacteria 3464
1043 Ga0500635_0114234 3300053080 Bacteria 1005
1044 Ga0495655_0051464 3300053083 Bacteria 1092
1045 Ga0495595_0005338 3300053084 Bacteria 5198
1046 Ga0495595_0433326 3300053084 Bacteria 667
1047 Ga0495619_0063475 3300053085 Bacteria 2460
1048 Ga0500643_061712 3300053087 Bacteria 1051
1049 Ga0500644_0009244 3300053088 Bacteria 2630
1050 Ga0500581_167750 3300053089 Bacteria 1011
1051 Ga0500646_0027414 3300053090 Bacteria 1550
1052 Ga0500646_0323353 3300053090 Bacteria 557
1053 Ga0500651_0006315 3300053093 Bacteria 6816
1054 Ga0500651_0052289 3300053093 Bacteria 2561
1055 Ga0500651_0219708 3300053093 Bacteria 1115
1056 Ga0500651_0413321 3300053093 Bacteria 756
1057 Ga0500651_0451444 3300053093 Bacteria 715
1058 Ga0500566_0001430 3300053094 Bacteria 13975
1059 Ga0500566_0001776 3300053094 Bacteria 12676
1060 Ga0500566_0002071 3300053094 Bacteria 11849
1061 Ga0500566_0137960 3300053094 Bacteria 1297
1062 Ga0500566_0202509 3300053094 Bacteria 1001
1063 Ga0500640_000418 3300053095 Bacteria 10279
1064 Ga0500641_0011747 3300053096 Bacteria 3184
1065 Ga0500641_0036209 3300053096 Bacteria 1973
1066 Ga0500641_0083130 3300053096 Bacteria 1361
1067 Ga0500641_0109539 3300053096 Bacteria 1188
1068 Ga0500650_0319367 3300053098 Bacteria 684
1069 Ga0500554_014823 3300053102 Bacteria 2021
1070 Ga0500554_115745 3300053102 Bacteria 902
1071 Ga0500554_257664 3300053102 Bacteria 573
1072 Ga0500555_035874 3300053103 Bacteria 1392
1073 Ga0500555_080356 3300053103 Bacteria 849
1074 Ga0500556_0000019 3300053104 Bacteria 186017
1075 Ga0500557_097610 3300053105 Bacteria 975
1076 Ga0500558_110192 3300053106 Bacteria 1081
1077 Ga0500569_006961 3300053109 Bacteria 2512
1078 Ga0500572_000151 3300053111 Bacteria 24045
1079 Ga0500572_001227 3300053111 Bacteria 7233
1080 Ga0500592_000834 3300053116 Bacteria 5051
1081 Ga0500592_010602 3300053116 Bacteria 1470
1082 Ga0500594_0041491 3300053118 Bacteria 1260
1083 Ga0500594_0188770 3300053118 Bacteria 674
1084 Ga0500594_0252819 3300053118 Bacteria 587
1085 Ga0500595_000203 3300053119 Bacteria 40552
1086 Ga0500595_002743 3300053119 Bacteria 8512
1087 Ga0500595_004186 3300053119 Bacteria 6530
1088 Ga0500595_005804 3300053119 Bacteria 5327
1089 Ga0500607_246858 3300053121 Bacteria 714
1090 Ga0500608_022879 3300053122 Bacteria 2901
1091 Ga0500608_066974 3300053122 Bacteria 1712
1092 Ga0500608_312958 3300053122 Bacteria 576
1093 Ga0500614_003865 3300053123 Bacteria 3201
1094 Ga0500618_005679 3300053125 Bacteria 3763
1095 Ga0500642_0000048 3300053130 Bacteria 81787
1096 Ga0500642_0227371 3300053130 Bacteria 863
1097 Ga0500652_000394 3300053131 Bacteria 15616
1098 Ga0500658_0013741 3300053134 Bacteria 2993
1099 Ga0500559_0000099 3300053136 Bacteria 67311
1100 Ga0500559_0008202 3300053136 Bacteria 4593
1101 Ga0500559_0063941 3300053136 Bacteria 1645
1102 Ga0500559_0207725 3300053136 Bacteria 923
1103 Ga0500568_0000242 3300053139 Bacteria 46479
1104 Ga0500568_0019541 3300053139 Bacteria 2943
1105 Ga0500577_0001076 3300053142 Bacteria 7042
1106 Ga0500577_0020943 3300053142 Bacteria 2148
1107 Ga0500577_0092420 3300053142 Bacteria 1225
1108 Ga0500586_001420 3300053145 Bacteria 5047
1109 Ga0500588_0048325 3300053146 Bacteria 1316
1110 Ga0500590_052736 3300053148 Bacteria 2063
1111 Ga0500590_266850 3300053148 Bacteria 668
1112 Ga0500603_002319 3300053150 Bacteria 4178
1113 Ga0500603_002324 3300053150 Bacteria 4175
1114 Ga0500603_030985 3300053150 Bacteria 1380
1115 Ga0500604_0078827 3300053151 Bacteria 1061
1116 Ga0500604_0224167 3300053151 Bacteria 648
1117 Ga0500616_0000059 3300053153 Bacteria 259741
1118 Ga0500616_0025080 3300053153 Bacteria 3308
1119 Ga0500616_0027563 3300053153 Bacteria 3135
1120 Ga0500619_065580 3300053154 Bacteria 1201
1121 Ga0500622_0164303 3300053156 Bacteria 1038
1122 Ga0500622_0329401 3300053156 Bacteria 640
1123 Ga0500624_016526 3300053157 Bacteria 1140
1124 Ga0500627_0094878 3300053158 Bacteria 1337
1125 Ga0500630_002843 3300053159 Bacteria 8346
1126 Ga0500638_063152 3300053162 Bacteria 1777
1127 Ga0500638_066962 3300053162 Bacteria 1721
1128 Ga0500638_154662 3300053162 Bacteria 1016
1129 Ga0500639_000579 3300053163 Bacteria 18423
1130 Ga0500639_111748 3300053163 Bacteria 1328
1131 Ga0500639_132437 3300053163 Bacteria 1179
1132 Ga0500636_0001221 3300053177 Bacteria 13884
1133 Ga0500636_0016866 3300053177 Bacteria 4306
1134 Ga0500636_0065263 3300053177 Bacteria 2119
1135 Ga0500636_0165751 3300053177 Bacteria 1200
1136 Ga0500636_0249174 3300053177 Bacteria 907
1137 Ga0500636_0261355 3300053177 Bacteria 876
1138 Ga0500637_0000130 3300053178 Bacteria 27292
1139 Ga0500637_0000328 3300053178 Bacteria 17873
1140 Ga0500637_0025623 3300053178 Bacteria 3242
1141 Ga0500637_0087119 3300053178 Bacteria 1806
1142 Ga0500570_085592 3300053724 Bacteria 1398
1143 Ga0500576_050827 3300053725 Bacteria 1839
1144 Ga0500645_006912 3300053730 Bacteria 4004
1145 Ga0500645_170239 3300053730 Bacteria 595
1146 Ga0500609_031491 3300053731 Bacteria 729
1147 Ga0500656_018743 3300053732 Bacteria 840
1148 Ga0500552_005540 3300053733 Bacteria 1380
1149 Ga0500596_000351 3300053735 Bacteria 8299
1150 Ga0500596_004935 3300053735 Bacteria 2398
1151 Ga0500596_006577 3300053735 Bacteria 1956
1152 Ga0500599_001092 3300053736 Bacteria 3063
1153 Ga0501084_0200552 3300054114 Bacteria 1683
1154 Ga0500661_004065 3300055283 Bacteria 2735
1155 Ga0501082_0064019 3300060353 Bacteria 3166
1156 Ga0501082_0179683 3300060353 Bacteria 1840
1157 Ga0501082_0900478 3300060353 Bacteria 774
1158 Ga0501082_1061155 3300060353 Bacteria 708
1159 Ga0466962_0130558 3300061719 Bacteria 1214

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006175 Ga0070712_101374804 Ga0070712_1013748041 152
2 3300035118 Ga0373954_0004607 Ga0373954_0004607_16_492 152
3 3300035172 Ga0373955_0003145 Ga0373955_0003145_5927_6403 152
4 3300035724 Ga0373933_0038486 Ga0373933_0038486_912_1388 152
5 3300035725 Ga0373947_0060569 Ga0373947_0060569_1724_2200 152
6 3300046454 Ga0495592_0012321 Ga0495592_0012321_2657_3133 152
7 3300046459 Ga0495629_0002029 Ga0495629_0002029_8591_9067 152
8 3300046463 Ga0495653_0048844 Ga0495653_0048844_92_568 152
9 3300046477 Ga0495664_0016114 Ga0495664_0016114_40_516 152
10 3300046511 Ga0495608_0025236 Ga0495608_0025236_521_997 152
11 3300046514 Ga0495618_0008774 Ga0495618_0008774_2762_3238 152
12 3300046529 Ga0495652_0076403 Ga0495652_0076403_1059_1535 152
13 3300046533 Ga0495640_0011080 Ga0495640_0011080_4795_5271 152
14 3300046536 Ga0495587_0009543 Ga0495587_0009543_884_1360 152
15 3300046543 Ga0495645_0182747 Ga0495645_0182747_343_819 152
16 3300046559 Ga0495667_0124825 Ga0495667_0124825_40_516 152
17 3300046642 Ga0495634_0076327 Ga0495634_0076327_610_1086 152
18 3300046663 Ga0495635_0005493 Ga0495635_0005493_468_944 152
19 3300046675 Ga0495657_0035266 Ga0495657_0035266_2159_2635 152
20 3300046679 Ga0495623_0114202 Ga0495623_0114202_1098_1574 152
21 3300046680 Ga0495646_0005606 Ga0495646_0005606_305_781 152
22 3300046809 Ga0495600_0026219 Ga0495600_0026219_2505_2981 152
23 3300047315 Ga0495581_0073370 Ga0495581_0073370_977_1453 152
24 3300047317 Ga0495604_0006563 Ga0495604_0006563_2944_3420 152
25 3300047321 Ga0495676_0261283 Ga0495676_0261283_303_779 152
26 3300047322 Ga0495680_0004838 Ga0495680_0004838_966_1442 152
27 3300047444 Ga0495675_0063385 Ga0495675_0063385_152_628 152
28 3300047471 Ga0495684_0106456 Ga0495684_0106456_1357_1833 152
29 3300047673 Ga0495593_0143388 Ga0495593_0143388_685_1161 152
30 3300048088 Ga0495602_0039574 Ga0495602_0039574_2765_3241 152
31 3300053077 Ga0495601_0001435 Ga0495601_0001435_5352_5828 152
32 3300053078 Ga0495612_0010450 Ga0495612_0010450_417_893 152
33 3300053084 Ga0495595_0005338 Ga0495595_0005338_2093_2569 152
34 3300005338 Ga0068868_101118823 Ga0068868_1011188231 153
35 3300005539 Ga0068853_100323117 Ga0068853_1003231172 153
36 3300005564 Ga0070664_100435586 Ga0070664_1004355861 153
37 3300010375 Ga0105239_11092929 Ga0105239_110929291 153
38 3300013105 Ga0157369_10188588 Ga0157369_101885882 153
39 3300025924 Ga0207694_10039513 Ga0207694_100395132 153
40 3300037466 Ga0395898_0037505 Ga0395898_0037505_1816_2289 153
41 3300038443 Ga0395901_1523453 Ga0395901_1523453_14_487 153
42 3300048924 Ga0496121_0028431 Ga0496121_0028431_505_981 153
43 3300048925 Ga0496122_0097166 Ga0496122_0097166_468_944 153
44 3300048928 Ga0496125_0000801 Ga0496125_0000801_23077_23553 153
45 3300048928 Ga0496125_0013838 Ga0496125_0013838_3884_4360 153
46 3300050514 nmdc:mga08x19_135787_c1 nmdc:mga08x19_135787_c1_31_504 153
47 3300053142 Ga0500577_0001076 Ga0500577_0001076_4264_4740 153
48 iso_pu_bacteria 2602042107 2603861722 153
49 iso_pu_bacteria 2857524615 2857525911 153
50 iso_pu_bacteria 2893066018 2893067808 153
51 iso_pu_bacteria 2919073203 2919074228 153
52 3300009093 Ga0105240_10896524 Ga0105240_108965242 154
53 3300031238 Ga0265332_10001463 Ga0265332_100014636 155
54 3300031247 Ga0265340_10001613 Ga0265340_100016134 155
55 3300031249 Ga0265339_10101408 Ga0265339_101014081 155
56 3300031344 Ga0265316_10438173 Ga0265316_104381732 155
57 3300031595 Ga0265313_10206662 Ga0265313_102066622 155
58 3300031712 Ga0265342_10000039 Ga0265342_1000003935 155
59 3300039453 Ga0436362_0190408 Ga0436362_0190408_25_495 155
60 3300044656 Ga0466969_0178772 Ga0466969_0178772_28_504 155
61 3300044765 Ga0466970_0069207 Ga0466970_0069207_853_1329 155
62 3300045049 Ga0466959_0093872 Ga0466959_0093872_1169_1645 155
63 3300049569 Ga0501032_0000001 Ga0501032_0000001_312268_312744 155
64 3300049570 Ga0501033_0000092 Ga0501033_0000092_72017_72493 155
65 3300049571 Ga0501034_0000036 Ga0501034_0000036_108365_108841 155
66 3300049572 Ga0501036_0000078 Ga0501036_0000078_52049_52525 155
67 3300049573 Ga0501037_0000017 Ga0501037_0000017_56459_56935 155
68 3300049574 Ga0501038_0000153 Ga0501038_0000153_6890_7366 155
69 3300049575 Ga0501039_0000011 Ga0501039_0000011_110814_111290 155
70 3300049577 Ga0501041_0097660 Ga0501041_0097660_1269_1745 155
71 3300049579 Ga0501043_0000016 Ga0501043_0000016_31435_31911 155
72 3300049580 Ga0501046_0011771 Ga0501046_0011771_6925_7401 155
73 3300049581 Ga0501047_0495828 Ga0501047_0495828_464_940 155
74 3300049822 Ga0501035_0000028 Ga0501035_0000028_108491_108967 155
75 3300049823 Ga0501044_0090388 Ga0501044_0090388_1114_1590 155
76 3300003203 JGI25406J46586_10023761 JGI25406J46586_100237613 156
77 3300003322 rootL2_10123755 rootL2_101237553 156
78 3300005338 Ga0068868_100701434 Ga0068868_1007014342 156
79 3300005340 Ga0070689_100011394 Ga0070689_1000113947 156
80 3300005354 Ga0070675_100128047 Ga0070675_1001280473 156
81 3300005355 Ga0070671_100105888 Ga0070671_1001058881 156
82 3300005366 Ga0070659_100176151 Ga0070659_1001761512 156
83 3300005367 Ga0070667_100145691 Ga0070667_1001456912 156
84 3300005367 Ga0070667_100541244 Ga0070667_1005412442 156
85 3300005435 Ga0070714_100098675 Ga0070714_1000986752 156
86 3300005436 Ga0070713_101071863 Ga0070713_1010718631 156
87 3300005445 Ga0070708_100809812 Ga0070708_1008098121 156
88 3300005445 Ga0070708_100998391 Ga0070708_1009983911 156
89 3300005455 Ga0070663_101330521 Ga0070663_1013305211 156
90 3300005456 Ga0070678_100600858 Ga0070678_1006008582 156
91 3300005467 Ga0070706_100220654 Ga0070706_1002206542 156
92 3300005468 Ga0070707_100268855 Ga0070707_1002688552 156
93 3300005471 Ga0070698_100403203 Ga0070698_1004032032 156
94 3300005518 Ga0070699_100872038 Ga0070699_1008720381 156
95 3300005536 Ga0070697_100165297 Ga0070697_1001652972 156
96 3300005543 Ga0070672_101161600 Ga0070672_1011616001 156
97 3300005548 Ga0070665_100821489 Ga0070665_1008214892 156
98 3300005548 Ga0070665_101373324 Ga0070665_1013733241 156
99 3300005563 Ga0068855_100507450 Ga0068855_1005074502 156
100 3300005577 Ga0068857_100362513 Ga0068857_1003625132 156
101 3300005615 Ga0070702_101042054 Ga0070702_1010420541 156
102 3300005616 Ga0068852_101566997 Ga0068852_1015669972 156
103 3300005618 Ga0068864_100321378 Ga0068864_1003213782 156
104 3300005842 Ga0068858_100277566 Ga0068858_1002775662 156
105 3300005842 Ga0068858_101847543 Ga0068858_1018475431 156
106 3300005983 Ga0081540_1035810 Ga0081540_10358102 156
107 3300005983 Ga0081540_1087351 Ga0081540_10873512 156
108 3300005985 Ga0081539_10001826 Ga0081539_1000182629 156
109 3300006028 Ga0070717_10952087 Ga0070717_109520871 156
110 3300006051 Ga0075364_10190859 Ga0075364_101908592 156
111 3300006163 Ga0070715_10047572 Ga0070715_100475722 156
112 3300006175 Ga0070712_100087639 Ga0070712_1000876392 156
113 3300006178 Ga0075367_10188156 Ga0075367_101881562 156
114 3300006353 Ga0075370_10424404 Ga0075370_104244041 156
115 3300006881 Ga0068865_101288458 Ga0068865_1012884581 156
116 3300007076 Ga0075435_100343491 Ga0075435_1003434912 156
117 3300007788 Ga0099795_10133883 Ga0099795_101338832 156
118 3300009092 Ga0105250_10066410 Ga0105250_100664102 156
119 3300009098 Ga0105245_10094969 Ga0105245_100949693 156
120 3300009098 Ga0105245_10366907 Ga0105245_103669073 156
121 3300009174 Ga0105241_10706151 Ga0105241_107061512 156
122 3300009177 Ga0105248_10251511 Ga0105248_102515112 156
123 3300010375 Ga0105239_10908722 Ga0105239_109087222 156
124 3300013296 Ga0157374_10226810 Ga0157374_102268102 156
125 3300014325 Ga0163163_10116559 Ga0163163_101165593 156
126 3300014969 Ga0157376_10449305 Ga0157376_104493051 156
127 3300021361 Ga0213872_10107938 Ga0213872_101079382 156
128 3300022467 Ga0224712_10181980 Ga0224712_101819801 156
129 3300024123 Ga0228600_1013447 Ga0228600_10134471 156
130 3300024227 Ga0228598_1004809 Ga0228598_10048093 156
131 3300025711 Ga0207696_1036714 Ga0207696_10367142 156
132 3300025906 Ga0207699_10281422 Ga0207699_102814222 156
133 3300025910 Ga0207684_10058728 Ga0207684_100587283 156
134 3300025911 Ga0207654_10574180 Ga0207654_105741802 156
135 3300025915 Ga0207693_10154979 Ga0207693_101549792 156
136 3300025925 Ga0207650_10054101 Ga0207650_100541011 156
137 3300025926 Ga0207659_10280081 Ga0207659_102800812 156
138 3300025927 Ga0207687_10354794 Ga0207687_103547942 156
139 3300025927 Ga0207687_10905155 Ga0207687_109051552 156
140 3300025928 Ga0207700_10850060 Ga0207700_108500601 156
141 3300025929 Ga0207664_10159219 Ga0207664_101592192 156
142 3300025931 Ga0207644_10006424 Ga0207644_100064242 156
143 3300025932 Ga0207690_10062525 Ga0207690_100625252 156
144 3300025932 Ga0207690_10663833 Ga0207690_106638332 156
145 3300025933 Ga0207706_10136274 Ga0207706_101362742 156
146 3300025936 Ga0207670_10037132 Ga0207670_100371323 156
147 3300025945 Ga0207679_10054988 Ga0207679_100549883 156
148 3300025986 Ga0207658_10129014 Ga0207658_101290142 156
149 3300026035 Ga0207703_10206516 Ga0207703_102065161 156
150 3300026078 Ga0207702_10271195 Ga0207702_102711952 156
151 3300026095 Ga0207676_10410117 Ga0207676_104101172 156
152 3300026118 Ga0207675_100062997 Ga0207675_1000629972 156
153 3300026142 Ga0207698_12381597 Ga0207698_123815971 156
154 3300028379 Ga0268266_10053456 Ga0268266_100534562 156
155 3300028379 Ga0268266_10174815 Ga0268266_101748151 156
156 3300028379 Ga0268266_10293753 Ga0268266_102937532 156
157 3300031238 Ga0265332_10104590 Ga0265332_101045902 156
158 3300031239 Ga0265328_10000257 Ga0265328_1000025712 156
159 3300031251 Ga0265327_10057949 Ga0265327_100579492 156
160 3300031456 Ga0307513_10257000 Ga0307513_102570002 156
161 3300031691 Ga0316579_10330007 Ga0316579_103300071 156
162 3300031711 Ga0265314_10003438 Ga0265314_100034389 156
163 3300031712 Ga0265342_10007997 Ga0265342_100079973 156
164 3300031995 Ga0307409_100633657 Ga0307409_1006336572 156
165 3300033180 Ga0307510_10140057 Ga0307510_101400572 156
166 3300035083 Ga0373926_0392280 Ga0373926_0392280_24_515 156
167 3300035086 Ga0373934_0059481 Ga0373934_0059481_425_898 156
168 3300035089 Ga0373944_0124754 Ga0373944_0124754_40_513 156
169 3300035111 Ga0373923_0052257 Ga0373923_0052257_351_824 156
170 3300035113 Ga0373936_0020001 Ga0373936_0020001_346_819 156
171 3300035116 Ga0373945_0023360 Ga0373945_0023360_182_655 156
172 3300035117 Ga0373953_0002986 Ga0373953_0002986_1691_2182 156
173 3300035117 Ga0373953_0192179 Ga0373953_0192179_328_801 156
174 3300035118 Ga0373954_0037670 Ga0373954_0037670_1244_1717 156
175 3300035118 Ga0373954_0142179 Ga0373954_0142179_301_792 156
176 3300035119 Ga0373956_0107716 Ga0373956_0107716_244_735 156
177 3300035170 Ga0373943_0002891 Ga0373943_0002891_5119_5592 156
178 3300035171 Ga0373946_0011102 Ga0373946_0011102_693_1166 156
179 3300035172 Ga0373955_0018293 Ga0373955_0018293_1105_1596 156
180 3300035172 Ga0373955_0019988 Ga0373955_0019988_111_584 156
181 3300035692 Ga0373935_0001059 Ga0373935_0001059_8143_8616 156
182 3300035692 Ga0373935_0103761 Ga0373935_0103761_414_905 156
183 3300035695 Ga0373927_0000456 Ga0373927_0000456_22151_22624 156
184 3300035724 Ga0373933_0015188 Ga0373933_0015188_2712_3185 156
185 3300035724 Ga0373933_0128241 Ga0373933_0128241_471_962 156
186 3300035725 Ga0373947_0002829 Ga0373947_0002829_3522_3995 156
187 3300036401 Ga0373937_0311338 Ga0373937_0311338_451_924 156
188 3300036401 Ga0373937_0321385 Ga0373937_0321385_459_932 156
189 3300036401 Ga0373937_0608242 Ga0373937_0608242_343_834 156
190 3300036458 Ga0310112_048466 Ga0310112_048466_71_544 156
191 3300036459 Ga0372808_007737 Ga0372808_007737_134_607 156
192 3300037068 Ga0373925_0044802 Ga0373925_0044802_2174_2647 156
193 3300039447 Ga0436361_1008940 Ga0436361_1008940_1300_1782 156
194 3300042004 Ga0439445_0157835 Ga0439445_0157835_100_573 156
195 3300044656 Ga0466969_0057497 Ga0466969_0057497_110_583 156
196 3300046454 Ga0495592_0050196 Ga0495592_0050196_1870_2361 156
197 3300046454 Ga0495592_0143345 Ga0495592_0143345_642_1115 156
198 3300046455 Ga0495603_0000468 Ga0495603_0000468_20137_20610 156
199 3300046455 Ga0495603_0235706 Ga0495603_0235706_502_993 156
200 3300046459 Ga0495629_0000244 Ga0495629_0000244_21374_21847 156
201 3300046460 Ga0495638_0006759 Ga0495638_0006759_3335_3808 156
202 3300046461 Ga0495641_0005414 Ga0495641_0005414_724_1197 156
203 3300046463 Ga0495653_0062538 Ga0495653_0062538_1888_2361 156
204 3300046472 Ga0495580_0002784 Ga0495580_0002784_1221_1694 156
205 3300046473 Ga0495582_0000986 Ga0495582_0000986_7309_7782 156
206 3300046475 Ga0495639_0000015 Ga0495639_0000015_29050_29523 156
207 3300046475 Ga0495639_0424590 Ga0495639_0424590_156_647 156
208 3300046476 Ga0495662_0004296 Ga0495662_0004296_4592_5065 156
209 3300046477 Ga0495664_0006408 Ga0495664_0006408_3400_3873 156
210 3300046477 Ga0495664_0543215 Ga0495664_0543215_88_579 156
211 3300046499 Ga0495594_0000052 Ga0495594_0000052_15034_15507 156
212 3300046511 Ga0495608_0093626 Ga0495608_0093626_945_1418 156
213 3300046511 Ga0495608_0408649 Ga0495608_0408649_292_783 156
214 3300046514 Ga0495618_0297998 Ga0495618_0297998_342_833 156
215 3300046516 Ga0495628_0051224 Ga0495628_0051224_2634_3107 156
216 3300046516 Ga0495628_0139249 Ga0495628_0139249_581_1072 156
217 3300046517 Ga0495630_0001642 Ga0495630_0001642_819_1292 156
218 3300046517 Ga0495630_0736561 Ga0495630_0736561_161_652 156
219 3300046526 Ga0495666_0019119 Ga0495666_0019119_2892_3365 156
220 3300046526 Ga0495666_0198516 Ga0495666_0198516_222_713 156
221 3300046529 Ga0495652_0048733 Ga0495652_0048733_2426_2899 156
222 3300046529 Ga0495652_0172587 Ga0495652_0172587_766_1257 156
223 3300046531 Ga0495665_0002408 Ga0495665_0002408_7480_7953 156
224 3300046531 Ga0495665_0048031 Ga0495665_0048031_246_737 156
225 3300046533 Ga0495640_0009558 Ga0495640_0009558_6310_6783 156
226 3300046533 Ga0495640_0136148 Ga0495640_0136148_782_1273 156
227 3300046543 Ga0495645_0116310 Ga0495645_0116310_58_549 156
228 3300046543 Ga0495645_0245613 Ga0495645_0245613_108_599 156
229 3300046557 Ga0495622_0095860 Ga0495622_0095860_725_1198 156
230 3300046559 Ga0495667_0040707 Ga0495667_0040707_1205_1678 156
231 3300046559 Ga0495667_0122017 Ga0495667_0122017_352_843 156
232 3300046642 Ga0495634_0003714 Ga0495634_0003714_1900_2373 156
233 3300046642 Ga0495634_0245470 Ga0495634_0245470_261_752 156
234 3300046663 Ga0495635_0001648 Ga0495635_0001648_3132_3605 156
235 3300046674 Ga0495588_0042507 Ga0495588_0042507_1091_1564 156
236 3300046675 Ga0495657_0058559 Ga0495657_0058559_149_640 156
237 3300046675 Ga0495657_0238792 Ga0495657_0238792_273_746 156
238 3300046678 Ga0495599_0051596 Ga0495599_0051596_686_1159 156
239 3300046678 Ga0495599_0256173 Ga0495599_0256173_470_961 156
240 3300046679 Ga0495623_0028703 Ga0495623_0028703_34_525 156
241 3300046679 Ga0495623_0161650 Ga0495623_0161650_77_550 156
242 3300046680 Ga0495646_0016089 Ga0495646_0016089_2730_3203 156
243 3300046681 Ga0495647_0014709 Ga0495647_0014709_662_1135 156
244 3300046683 Ga0495658_0002378 Ga0495658_0002378_3416_3889 156
245 3300046683 Ga0495658_0111179 Ga0495658_0111179_870_1361 156
246 3300046689 Ga0495613_0019214 Ga0495613_0019214_4331_4804 156
247 3300046690 Ga0495624_0001637 Ga0495624_0001637_11408_11881 156
248 3300046809 Ga0495600_0031634 Ga0495600_0031634_1561_2034 156
249 3300046809 Ga0495600_0104906 Ga0495600_0104906_549_1040 156
250 3300047315 Ga0495581_0000123 Ga0495581_0000123_9501_9974 156
251 3300047315 Ga0495581_0273439 Ga0495581_0273439_439_930 156
252 3300047317 Ga0495604_0419321 Ga0495604_0419321_40_513 156
253 3300047317 Ga0495604_0615045 Ga0495604_0615045_25_516 156
254 3300047319 Ga0495674_0007867 Ga0495674_0007867_2229_2702 156
255 3300047319 Ga0495674_0226925 Ga0495674_0226925_287_778 156
256 3300047321 Ga0495676_0097442 Ga0495676_0097442_130_603 156
257 3300047322 Ga0495680_0347905 Ga0495680_0347905_36_527 156
258 3300047322 Ga0495680_0430445 Ga0495680_0430445_317_790 156
259 3300047444 Ga0495675_0238461 Ga0495675_0238461_56_547 156
260 3300047673 Ga0495593_0000332 Ga0495593_0000332_8578_9051 156
261 3300048089 Ga0495614_0005250 Ga0495614_0005250_3483_3956 156
262 3300048904 Ga0496101_0164028 Ga0496101_0164028_585_1076 156
263 3300048905 Ga0496102_0189841 Ga0496102_0189841_167_658 156
264 3300048907 Ga0496104_0131599 Ga0496104_0131599_817_1308 156
265 3300048909 Ga0496106_0418132 Ga0496106_0418132_429_920 156
266 3300048910 Ga0496107_0583688 Ga0496107_0583688_160_633 156
267 3300048911 Ga0496108_0361424 Ga0496108_0361424_198_689 156
268 3300048914 Ga0496111_0932821 Ga0496111_0932821_121_594 156
269 3300048915 Ga0496112_0083173 Ga0496112_0083173_2516_3007 156
270 3300048915 Ga0496112_0380219 Ga0496112_0380219_572_1063 156
271 3300048918 Ga0496115_0085919 Ga0496115_0085919_1243_1716 156
272 3300048918 Ga0496115_0154497 Ga0496115_0154497_175_666 156
273 3300048924 Ga0496121_0141628 Ga0496121_0141628_89_565 156
274 3300048925 Ga0496122_0430000 Ga0496122_0430000_26_502 156
275 3300048926 Ga0496123_0334315 Ga0496123_0334315_183_659 156
276 3300048927 Ga0496124_0491859 Ga0496124_0491859_126_602 156
277 3300048929 Ga0496126_0145070 Ga0496126_0145070_999_1472 156
278 3300048929 Ga0496126_0749752 Ga0496126_0749752_165_662 156
279 3300049571 Ga0501034_0222843 Ga0501034_0222843_286_762 156
280 3300049574 Ga0501038_0843970 Ga0501038_0843970_186_659 156
281 3300049581 Ga0501047_0013118 Ga0501047_0013118_1887_2360 156
282 3300049583 Ga0501067_0066576 Ga0501067_0066576_1316_1819 156
283 3300049583 Ga0501067_0641627 Ga0501067_0641627_74_547 156
284 3300049588 Ga0501072_0005754 Ga0501072_0005754_8143_8616 156
285 3300049744 Ga0501083_0033737 Ga0501083_0033737_2878_3351 156
286 3300049744 Ga0501083_0053385 Ga0501083_0053385_1234_1707 156
287 3300049744 Ga0501083_0067461 Ga0501083_0067461_332_805 156
288 3300050513 nmdc:mga0rr50_322499_c1 nmdc:mga0rr50_322499_c1_183_674 156
289 3300050516 nmdc:mga0sz30_182347_c1 nmdc:mga0sz30_182347_c1_240_713 156
290 3300053077 Ga0495601_0103604 Ga0495601_0103604_1313_1804 156
291 3300053077 Ga0495601_0121092 Ga0495601_0121092_888_1379 156
292 3300053078 Ga0495612_0225392 Ga0495612_0225392_25_516 156
293 3300053084 Ga0495595_0433326 Ga0495595_0433326_151_642 156
294 3300053085 Ga0495619_0063475 Ga0495619_0063475_1247_1738 156
295 3300053090 Ga0500646_0323353 Ga0500646_0323353_67_540 156
296 3300053093 Ga0500651_0219708 Ga0500651_0219708_324_800 156
297 3300053150 Ga0500603_030985 Ga0500603_030985_324_797 156
298 3300053153 Ga0500616_0025080 Ga0500616_0025080_716_1189 156
299 3300053153 Ga0500616_0027563 Ga0500616_0027563_2378_2851 156
300 3300054114 Ga0501084_0200552 Ga0501084_0200552_165_638 156
301 3300060353 Ga0501082_0064019 Ga0501082_0064019_1877_2350 156
302 3300060353 Ga0501082_0179683 Ga0501082_0179683_508_1011 156
303 3300060353 Ga0501082_1061155 Ga0501082_1061155_86_559 156
304 2010549000 RicEn_FSXC7958_b1 RicEn_222710 157
305 3300001991 JGI24743J22301_10011029 JGI24743J22301_100110292 157
306 3300003203 JGI25406J46586_10002869 JGI25406J46586_100028693 157
307 3300003215 JGI25153J46596_10005767 JGI25153J46596_100057675 157
308 3300003215 JGI25153J46596_10006684 JGI25153J46596_100066843 157
309 3300003215 JGI25153J46596_10039667 JGI25153J46596_100396672 157
310 3300003323 rootH1_10291242 rootH1_102912421 157
311 3300003659 JGI25404J52841_10040049 JGI25404J52841_100400492 157
312 3300003659 JGI25404J52841_10049835 JGI25404J52841_100498351 157
313 3300003659 JGI25404J52841_10053153 JGI25404J52841_100531532 157
314 3300003659 JGI25404J52841_10054410 JGI25404J52841_100544102 157
315 3300003771 Ga0055526_1053332 Ga0055526_10533322 157
316 3300003775 Ga0055524_1037314 Ga0055524_10373142 157
317 3300003794 Ga0055531_10009335 Ga0055531_100093354 157
318 3300005327 Ga0070658_10087205 Ga0070658_100872052 157
319 3300005329 Ga0070683_100517205 Ga0070683_1005172052 157
320 3300005330 Ga0070690_100456427 Ga0070690_1004564272 157
321 3300005331 Ga0070670_100185219 Ga0070670_1001852192 157
322 3300005334 Ga0068869_100007229 Ga0068869_1000072297 157
323 3300005334 Ga0068869_100096279 Ga0068869_1000962793 157
324 3300005334 Ga0068869_100172023 Ga0068869_1001720231 157
325 3300005334 Ga0068869_100432435 Ga0068869_1004324351 157
326 3300005335 Ga0070666_10397492 Ga0070666_103974921 157
327 3300005337 Ga0070682_100043669 Ga0070682_1000436693 157
328 3300005338 Ga0068868_100041351 Ga0068868_1000413513 157
329 3300005339 Ga0070660_100165420 Ga0070660_1001654202 157
330 3300005340 Ga0070689_100387082 Ga0070689_1003870821 157
331 3300005344 Ga0070661_100373491 Ga0070661_1003734912 157
332 3300005347 Ga0070668_100058386 Ga0070668_1000583862 157
333 3300005347 Ga0070668_100132950 Ga0070668_1001329502 157
334 3300005347 Ga0070668_100161292 Ga0070668_1001612922 157
335 3300005347 Ga0070668_100211531 Ga0070668_1002115313 157
336 3300005347 Ga0070668_100236330 Ga0070668_1002363301 157
337 3300005347 Ga0070668_101189192 Ga0070668_1011891921 157
338 3300005353 Ga0070669_100287154 Ga0070669_1002871542 157
339 3300005356 Ga0070674_100293469 Ga0070674_1002934691 157
340 3300005365 Ga0070688_100121147 Ga0070688_1001211472 157
341 3300005366 Ga0070659_100192084 Ga0070659_1001920842 157
342 3300005366 Ga0070659_100228988 Ga0070659_1002289882 157
343 3300005366 Ga0070659_101313265 Ga0070659_1013132651 157
344 3300005435 Ga0070714_100044316 Ga0070714_1000443163 157
345 3300005435 Ga0070714_100271872 Ga0070714_1002718722 157
346 3300005435 Ga0070714_100529735 Ga0070714_1005297352 157
347 3300005436 Ga0070713_100003607 Ga0070713_1000036072 157
348 3300005436 Ga0070713_100360934 Ga0070713_1003609342 157
349 3300005437 Ga0070710_10106555 Ga0070710_101065552 157
350 3300005438 Ga0070701_10145770 Ga0070701_101457703 157
351 3300005439 Ga0070711_100147899 Ga0070711_1001478992 157
352 3300005439 Ga0070711_100855728 Ga0070711_1008557281 157
353 3300005440 Ga0070705_100096685 Ga0070705_1000966852 157
354 3300005444 Ga0070694_100242697 Ga0070694_1002426971 157
355 3300005455 Ga0070663_100034961 Ga0070663_1000349612 157
356 3300005455 Ga0070663_100102625 Ga0070663_1001026252 157
357 3300005455 Ga0070663_100117649 Ga0070663_1001176492 157
358 3300005455 Ga0070663_100159673 Ga0070663_1001596732 157
359 3300005455 Ga0070663_100193574 Ga0070663_1001935742 157
360 3300005455 Ga0070663_100218136 Ga0070663_1002181362 157
361 3300005455 Ga0070663_100450437 Ga0070663_1004504372 157
362 3300005455 Ga0070663_101337446 Ga0070663_1013374461 157
363 3300005456 Ga0070678_100024023 Ga0070678_1000240233 157
364 3300005456 Ga0070678_100120571 Ga0070678_1001205713 157
365 3300005456 Ga0070678_100121766 Ga0070678_1001217662 157
366 3300005456 Ga0070678_100228043 Ga0070678_1002280431 157
367 3300005456 Ga0070678_101192585 Ga0070678_1011925851 157
368 3300005457 Ga0070662_100179164 Ga0070662_1001791642 157
369 3300005457 Ga0070662_100292099 Ga0070662_1002920992 157
370 3300005457 Ga0070662_100469560 Ga0070662_1004695601 157
371 3300005457 Ga0070662_100710338 Ga0070662_1007103382 157
372 3300005458 Ga0070681_10009165 Ga0070681_100091653 157
373 3300005459 Ga0068867_100812716 Ga0068867_1008127161 157
374 3300005467 Ga0070706_100236911 Ga0070706_1002369112 157
375 3300005471 Ga0070698_100269806 Ga0070698_1002698062 157
376 3300005530 Ga0070679_100026502 Ga0070679_1000265025 157
377 3300005530 Ga0070679_100810466 Ga0070679_1008104662 157
378 3300005539 Ga0068853_100064892 Ga0068853_1000648922 157
379 3300005543 Ga0070672_100350867 Ga0070672_1003508672 157
380 3300005544 Ga0070686_101198616 Ga0070686_1011986161 157
381 3300005545 Ga0070695_100226048 Ga0070695_1002260482 157
382 3300005546 Ga0070696_100341225 Ga0070696_1003412251 157
383 3300005547 Ga0070693_100041420 Ga0070693_1000414203 157
384 3300005547 Ga0070693_100262788 Ga0070693_1002627882 157
385 3300005548 Ga0070665_100040083 Ga0070665_1000400832 157
386 3300005548 Ga0070665_100329230 Ga0070665_1003292302 157
387 3300005548 Ga0070665_100356056 Ga0070665_1003560562 157
388 3300005548 Ga0070665_100774426 Ga0070665_1007744262 157
389 3300005548 Ga0070665_100971484 Ga0070665_1009714841 157
390 3300005549 Ga0070704_100579738 Ga0070704_1005797382 157
391 3300005563 Ga0068855_100228274 Ga0068855_1002282742 157
392 3300005563 Ga0068855_100240424 Ga0068855_1002404242 157
393 3300005563 Ga0068855_100288298 Ga0068855_1002882982 157
394 3300005563 Ga0068855_102144244 Ga0068855_1021442441 157
395 3300005564 Ga0070664_100030458 Ga0070664_1000304583 157
396 3300005564 Ga0070664_100857130 Ga0070664_1008571302 157
397 3300005578 Ga0068854_100176039 Ga0068854_1001760392 157
398 3300005614 Ga0068856_100100329 Ga0068856_1001003292 157
399 3300005614 Ga0068856_100180346 Ga0068856_1001803462 157
400 3300005615 Ga0070702_100142800 Ga0070702_1001428002 157
401 3300005615 Ga0070702_100243258 Ga0070702_1002432581 157
402 3300005616 Ga0068852_100100189 Ga0068852_1001001892 157
403 3300005616 Ga0068852_100113120 Ga0068852_1001131202 157
404 3300005616 Ga0068852_100291117 Ga0068852_1002911172 157
405 3300005616 Ga0068852_101141851 Ga0068852_1011418511 157
406 3300005617 Ga0068859_100083940 Ga0068859_1000839402 157
407 3300005617 Ga0068859_100246441 Ga0068859_1002464412 157
408 3300005617 Ga0068859_100310837 Ga0068859_1003108372 157
409 3300005617 Ga0068859_100531733 Ga0068859_1005317332 157
410 3300005618 Ga0068864_100082585 Ga0068864_1000825852 157
411 3300005618 Ga0068864_100097823 Ga0068864_1000978233 157
412 3300005719 Ga0068861_100057639 Ga0068861_1000576392 157
413 3300005719 Ga0068861_100130371 Ga0068861_1001303712 157
414 3300005719 Ga0068861_100131553 Ga0068861_1001315532 157
415 3300005719 Ga0068861_100191087 Ga0068861_1001910873 157
416 3300005719 Ga0068861_101020815 Ga0068861_1010208151 157
417 3300005719 Ga0068861_101220952 Ga0068861_1012209522 157
418 3300005834 Ga0068851_10098844 Ga0068851_100988442 157
419 3300005840 Ga0068870_10112336 Ga0068870_101123362 157
420 3300005842 Ga0068858_100347878 Ga0068858_1003478782 157
421 3300005842 Ga0068858_100453711 Ga0068858_1004537112 157
422 3300005842 Ga0068858_100512520 Ga0068858_1005125201 157
423 3300005843 Ga0068860_100000429 Ga0068860_10000042940 157
424 3300005843 Ga0068860_100249964 Ga0068860_1002499642 157
425 3300005843 Ga0068860_100289155 Ga0068860_1002891552 157
426 3300005844 Ga0068862_100066839 Ga0068862_1000668392 157
427 3300005844 Ga0068862_100196256 Ga0068862_1001962562 157
428 3300005844 Ga0068862_100326643 Ga0068862_1003266432 157
429 3300005844 Ga0068862_100772072 Ga0068862_1007720721 157
430 3300005844 Ga0068862_100934006 Ga0068862_1009340062 157
431 3300005844 Ga0068862_101153400 Ga0068862_1011534002 157
432 3300005937 Ga0081455_10003715 Ga0081455_1000371511 157
433 3300005937 Ga0081455_10017606 Ga0081455_100176063 157
434 3300005937 Ga0081455_10027966 Ga0081455_100279661 157
435 3300005937 Ga0081455_10041857 Ga0081455_100418574 157
436 3300005937 Ga0081455_10072038 Ga0081455_100720382 157
437 3300005937 Ga0081455_10217963 Ga0081455_102179631 157
438 3300005937 Ga0081455_10403567 Ga0081455_104035671 157
439 3300005981 Ga0081538_10178129 Ga0081538_101781292 157
440 3300005983 Ga0081540_1003319 Ga0081540_100331914 157
441 3300005983 Ga0081540_1006968 Ga0081540_10069682 157
442 3300005983 Ga0081540_1009221 Ga0081540_10092216 157
443 3300005983 Ga0081540_1009314 Ga0081540_10093143 157
444 3300005983 Ga0081540_1012667 Ga0081540_10126672 157
445 3300005983 Ga0081540_1013667 Ga0081540_10136674 157
446 3300005983 Ga0081540_1017966 Ga0081540_10179661 157
447 3300005983 Ga0081540_1081455 Ga0081540_10814552 157
448 3300005983 Ga0081540_1105461 Ga0081540_11054612 157
449 3300005983 Ga0081540_1217779 Ga0081540_12177792 157
450 3300005985 Ga0081539_10000824 Ga0081539_1000082450 157
451 3300005985 Ga0081539_10056696 Ga0081539_100566963 157
452 3300006028 Ga0070717_10000402 Ga0070717_100004029 157
453 3300006038 Ga0075365_10043534 Ga0075365_100435342 157
454 3300006038 Ga0075365_11028005 Ga0075365_110280052 157
455 3300006042 Ga0075368_10143274 Ga0075368_101432741 157
456 3300006048 Ga0075363_100088101 Ga0075363_1000881012 157
457 3300006051 Ga0075364_10084087 Ga0075364_100840872 157
458 3300006051 Ga0075364_10251323 Ga0075364_102513232 157
459 3300006173 Ga0070716_100144483 Ga0070716_1001444832 157
460 3300006177 Ga0075362_10065841 Ga0075362_100658412 157
461 3300006177 Ga0075362_10190338 Ga0075362_101903382 157
462 3300006178 Ga0075367_10089795 Ga0075367_100897952 157
463 3300006178 Ga0075367_10140923 Ga0075367_101409232 157
464 3300006178 Ga0075367_10231044 Ga0075367_102310442 157
465 3300006178 Ga0075367_10491269 Ga0075367_104912691 157
466 3300006186 Ga0075369_10026014 Ga0075369_100260144 157
467 3300006186 Ga0075369_10119017 Ga0075369_101190172 157
468 3300006195 Ga0075366_10076670 Ga0075366_100766701 157
469 3300006195 Ga0075366_10397838 Ga0075366_103978381 157
470 3300006195 Ga0075366_10457933 Ga0075366_104579331 157
471 3300006237 Ga0097621_100509737 Ga0097621_1005097373 157
472 3300006353 Ga0075370_10029377 Ga0075370_100293772 157
473 3300006353 Ga0075370_10114890 Ga0075370_101148901 157
474 3300006353 Ga0075370_10135641 Ga0075370_101356412 157
475 3300006358 Ga0068871_100048459 Ga0068871_1000484592 157
476 3300006358 Ga0068871_100508668 Ga0068871_1005086682 157
477 3300006844 Ga0075428_100105629 Ga0075428_1001056292 157
478 3300006846 Ga0075430_100882865 Ga0075430_1008828652 157
479 3300006852 Ga0075433_10432025 Ga0075433_104320252 157
480 3300006871 Ga0075434_100187512 Ga0075434_1001875122 157
481 3300006871 Ga0075434_100296278 Ga0075434_1002962782 157
482 3300006871 Ga0075434_100409718 Ga0075434_1004097182 157
483 3300006880 Ga0075429_100736317 Ga0075429_1007363172 157
484 3300006914 Ga0075436_100942288 Ga0075436_1009422882 157
485 3300006931 Ga0097620_100083940 Ga0097620_1000839404 157
486 3300006931 Ga0097620_100246428 Ga0097620_1002464283 157
487 3300006931 Ga0097620_100310853 Ga0097620_1003108532 157
488 3300006931 Ga0097620_100531750 Ga0097620_1005317502 157
489 3300006941 Ga0099825_1037135 Ga0099825_10371352 157
490 3300006942 Ga0099824_1010736 Ga0099824_10107363 157
491 3300006943 Ga0099822_1001873 Ga0099822_10018736 157
492 3300009093 Ga0105240_10071970 Ga0105240_100719705 157
493 3300009093 Ga0105240_10642011 Ga0105240_106420112 157
494 3300009094 Ga0111539_10589218 Ga0111539_105892182 157
495 3300009098 Ga0105245_10023512 Ga0105245_100235122 157
496 3300009098 Ga0105245_10025286 Ga0105245_100252863 157
497 3300009101 Ga0105247_10027726 Ga0105247_100277265 157
498 3300009101 Ga0105247_10108918 Ga0105247_101089182 157
499 3300009147 Ga0114129_11383353 Ga0114129_113833532 157
500 3300009174 Ga0105241_10032187 Ga0105241_100321872 157
501 3300009174 Ga0105241_10184354 Ga0105241_101843542 157
502 3300009176 Ga0105242_10424705 Ga0105242_104247052 157
503 3300009176 Ga0105242_10543040 Ga0105242_105430402 157
504 3300009545 Ga0105237_10027608 Ga0105237_100276085 157
505 3300009545 Ga0105237_10130645 Ga0105237_101306451 157
506 3300009545 Ga0105237_10465608 Ga0105237_104656081 157
507 3300009545 Ga0105237_11212590 Ga0105237_112125901 157
508 3300009551 Ga0105238_10247715 Ga0105238_102477151 157
509 3300009551 Ga0105238_10286808 Ga0105238_102868082 157
510 3300009551 Ga0105238_10548911 Ga0105238_105489112 157
511 3300009553 Ga0105249_10759582 Ga0105249_107595822 157
512 3300010159 Ga0099796_10366968 Ga0099796_103669682 157
513 3300010375 Ga0105239_10123545 Ga0105239_101235452 157
514 3300010375 Ga0105239_10124134 Ga0105239_101241342 157
515 3300010375 Ga0105239_10211103 Ga0105239_102111032 157
516 3300010375 Ga0105239_10580837 Ga0105239_105808372 157
517 3300010375 Ga0105239_10811210 Ga0105239_108112102 157
518 3300010375 Ga0105239_10929289 Ga0105239_109292892 157
519 3300011119 Ga0105246_10139869 Ga0105246_101398692 157
520 3300011119 Ga0105246_10194118 Ga0105246_101941182 157
521 3300011119 Ga0105246_11380111 Ga0105246_113801111 157
522 3300013100 Ga0157373_10183735 Ga0157373_101837352 157
523 3300013102 Ga0157371_10063398 Ga0157371_100633982 157
524 3300013104 Ga0157370_10077272 Ga0157370_100772723 157
525 3300013105 Ga0157369_10783463 Ga0157369_107834631 157
526 3300013296 Ga0157374_10012040 Ga0157374_100120403 157
527 3300013297 Ga0157378_10306046 Ga0157378_103060462 157
528 3300013297 Ga0157378_10562693 Ga0157378_105626932 157
529 3300013297 Ga0157378_10681486 Ga0157378_106814863 157
530 3300013306 Ga0163162_10060464 Ga0163162_100604642 157
531 3300013306 Ga0163162_10302734 Ga0163162_103027342 157
532 3300013307 Ga0157372_10289691 Ga0157372_102896912 157
533 3300013307 Ga0157372_10599113 Ga0157372_105991132 157
534 3300013307 Ga0157372_10630473 Ga0157372_106304732 157
535 3300013307 Ga0157372_13102837 Ga0157372_131028371 157
536 3300013308 Ga0157375_10026110 Ga0157375_100261103 157
537 3300013308 Ga0157375_10206529 Ga0157375_102065292 157
538 3300013308 Ga0157375_10320089 Ga0157375_103200892 157
539 3300013308 Ga0157375_10464493 Ga0157375_104644932 157
540 3300014325 Ga0163163_11333883 Ga0163163_113338831 157
541 3300014326 Ga0157380_10229183 Ga0157380_102291832 157
542 3300014326 Ga0157380_10593340 Ga0157380_105933402 157
543 3300014745 Ga0157377_10041917 Ga0157377_100419172 157
544 3300014968 Ga0157379_11236216 Ga0157379_112362161 157
545 3300014969 Ga0157376_10113354 Ga0157376_101133542 157
546 3300014969 Ga0157376_10659751 Ga0157376_106597511 157
547 3300017792 Ga0163161_10125502 Ga0163161_101255022 157
548 3300017792 Ga0163161_10260454 Ga0163161_102604542 157
549 3300017792 Ga0163161_10811286 Ga0163161_108112862 157
550 3300021384 Ga0213876_10110668 Ga0213876_101106682 157
551 3300021384 Ga0213876_10460959 Ga0213876_104609592 157
552 3300021441 Ga0213871_10037190 Ga0213871_100371903 157
553 3300025245 Ga0207425_1035486 Ga0207425_10354862 157
554 3300025253 Ga0209677_106670 Ga0209677_1066702 157
555 3300025254 Ga0209148_1005310 Ga0209148_10053103 157
556 3300025261 Ga0209233_1004579 Ga0209233_10045792 157
557 3300025272 Ga0209455_1002894 Ga0209455_10028944 157
558 3300025272 Ga0209455_1008301 Ga0209455_10083012 157
559 3300025273 Ga0209673_1054401 Ga0209673_10544012 157
560 3300025295 Ga0209564_1000401 Ga0209564_100040180 157
561 3300025295 Ga0209564_1022120 Ga0209564_10221202 157
562 3300025297 Ga0209758_1000011 Ga0209758_1000011106 157
563 3300025297 Ga0209758_1001959 Ga0209758_100195913 157
564 3300025297 Ga0209758_1002046 Ga0209758_10020462 157
565 3300025297 Ga0209758_1050262 Ga0209758_10502622 157
566 3300025299 Ga0209256_1005722 Ga0209256_10057224 157
567 3300025304 Ga0209257_1000620 Ga0209257_100062025 157
568 3300025304 Ga0209257_1000729 Ga0209257_100072916 157
569 3300025304 Ga0209257_1001767 Ga0209257_10017674 157
570 3300025898 Ga0207692_10111818 Ga0207692_101118182 157
571 3300025899 Ga0207642_10111716 Ga0207642_101117163 157
572 3300025900 Ga0207710_10200352 Ga0207710_102003522 157
573 3300025901 Ga0207688_10039440 Ga0207688_100394402 157
574 3300025904 Ga0207647_10177088 Ga0207647_101770881 157
575 3300025906 Ga0207699_10009649 Ga0207699_100096493 157
576 3300025906 Ga0207699_10268459 Ga0207699_102684592 157
577 3300025906 Ga0207699_10853197 Ga0207699_108531972 157
578 3300025907 Ga0207645_10119589 Ga0207645_101195892 157
579 3300025908 Ga0207643_10082378 Ga0207643_100823782 157
580 3300025909 Ga0207705_10525374 Ga0207705_105253742 157
581 3300025910 Ga0207684_10458146 Ga0207684_104581462 157
582 3300025911 Ga0207654_10077674 Ga0207654_100776742 157
583 3300025912 Ga0207707_10000404 Ga0207707_100004045 157
584 3300025913 Ga0207695_10325908 Ga0207695_103259082 157
585 3300025914 Ga0207671_10126577 Ga0207671_101265772 157
586 3300025915 Ga0207693_10131046 Ga0207693_101310462 157
587 3300025916 Ga0207663_10085506 Ga0207663_100855062 157
588 3300025916 Ga0207663_10745323 Ga0207663_107453231 157
589 3300025917 Ga0207660_10136755 Ga0207660_101367552 157
590 3300025919 Ga0207657_10116195 Ga0207657_101161952 157
591 3300025920 Ga0207649_10489154 Ga0207649_104891541 157
592 3300025921 Ga0207652_10493807 Ga0207652_104938072 157
593 3300025922 Ga0207646_11313267 Ga0207646_113132672 157
594 3300025924 Ga0207694_10251664 Ga0207694_102516642 157
595 3300025924 Ga0207694_10985498 Ga0207694_109854981 157
596 3300025925 Ga0207650_10191098 Ga0207650_101910982 157
597 3300025927 Ga0207687_10012593 Ga0207687_100125933 157
598 3300025927 Ga0207687_10013063 Ga0207687_100130633 157
599 3300025927 Ga0207687_10185994 Ga0207687_101859942 157
600 3300025928 Ga0207700_10090898 Ga0207700_100908983 157
601 3300025928 Ga0207700_10387267 Ga0207700_103872672 157
602 3300025928 Ga0207700_10635373 Ga0207700_106353732 157
603 3300025929 Ga0207664_10027721 Ga0207664_100277213 157
604 3300025929 Ga0207664_10325808 Ga0207664_103258082 157
605 3300025929 Ga0207664_10525304 Ga0207664_105253042 157
606 3300025929 Ga0207664_10688085 Ga0207664_106880852 157
607 3300025931 Ga0207644_10421888 Ga0207644_104218882 157
608 3300025932 Ga0207690_10192603 Ga0207690_101926032 157
609 3300025932 Ga0207690_10220162 Ga0207690_102201621 157
610 3300025933 Ga0207706_10080875 Ga0207706_100808752 157
611 3300025933 Ga0207706_10125365 Ga0207706_101253652 157
612 3300025933 Ga0207706_10376636 Ga0207706_103766362 157
613 3300025933 Ga0207706_10676698 Ga0207706_106766982 157
614 3300025933 Ga0207706_11030939 Ga0207706_110309392 157
615 3300025935 Ga0207709_10511112 Ga0207709_105111122 157
616 3300025936 Ga0207670_10934202 Ga0207670_109342021 157
617 3300025939 Ga0207665_10132626 Ga0207665_101326262 157
618 3300025939 Ga0207665_11032809 Ga0207665_110328091 157
619 3300025940 Ga0207691_11333352 Ga0207691_113333522 157
620 3300025942 Ga0207689_10072170 Ga0207689_100721703 157
621 3300025942 Ga0207689_10136519 Ga0207689_101365193 157
622 3300025945 Ga0207679_10245220 Ga0207679_102452202 157
623 3300025945 Ga0207679_10425123 Ga0207679_104251232 157
624 3300025949 Ga0207667_10526987 Ga0207667_105269872 157
625 3300025972 Ga0207668_10021291 Ga0207668_100212912 157
626 3300025972 Ga0207668_10388625 Ga0207668_103886251 157
627 3300025972 Ga0207668_11124563 Ga0207668_111245632 157
628 3300025981 Ga0207640_10142912 Ga0207640_101429122 157
629 3300025981 Ga0207640_10317412 Ga0207640_103174122 157
630 3300025981 Ga0207640_10777567 Ga0207640_107775672 157
631 3300025981 Ga0207640_10815082 Ga0207640_108150822 157
632 3300025986 Ga0207658_10237544 Ga0207658_102375441 157
633 3300026035 Ga0207703_10060810 Ga0207703_100608102 157
634 3300026035 Ga0207703_10232504 Ga0207703_102325042 157
635 3300026035 Ga0207703_10370247 Ga0207703_103702472 157
636 3300026067 Ga0207678_10007944 Ga0207678_100079447 157
637 3300026067 Ga0207678_10032510 Ga0207678_100325102 157
638 3300026067 Ga0207678_10100203 Ga0207678_101002031 157
639 3300026067 Ga0207678_10238907 Ga0207678_102389072 157
640 3300026067 Ga0207678_10249150 Ga0207678_102491502 157
641 3300026067 Ga0207678_10424251 Ga0207678_104242512 157
642 3300026067 Ga0207678_10534297 Ga0207678_105342972 157
643 3300026067 Ga0207678_10593999 Ga0207678_105939992 157
644 3300026067 Ga0207678_11054754 Ga0207678_110547541 157
645 3300026075 Ga0207708_10127239 Ga0207708_101272392 157
646 3300026078 Ga0207702_10112696 Ga0207702_101126962 157
647 3300026088 Ga0207641_10063006 Ga0207641_100630063 157
648 3300026088 Ga0207641_11279738 Ga0207641_112797382 157
649 3300026089 Ga0207648_10019660 Ga0207648_100196604 157
650 3300026089 Ga0207648_10215453 Ga0207648_102154532 157
651 3300026095 Ga0207676_10112890 Ga0207676_101128902 157
652 3300026095 Ga0207676_10361949 Ga0207676_103619492 157
653 3300026095 Ga0207676_10527987 Ga0207676_105279872 157
654 3300026116 Ga0207674_10111629 Ga0207674_101116293 157
655 3300026116 Ga0207674_10265186 Ga0207674_102651862 157
656 3300026116 Ga0207674_10942005 Ga0207674_109420051 157
657 3300026118 Ga0207675_100057494 Ga0207675_1000574944 157
658 3300026118 Ga0207675_100069301 Ga0207675_1000693014 157
659 3300026118 Ga0207675_100105190 Ga0207675_1001051903 157
660 3300026118 Ga0207675_100200406 Ga0207675_1002004062 157
661 3300026118 Ga0207675_100318308 Ga0207675_1003183082 157
662 3300026121 Ga0207683_10049361 Ga0207683_100493613 157
663 3300026121 Ga0207683_11006598 Ga0207683_110065982 157
664 3300026142 Ga0207698_10295555 Ga0207698_102955552 157
665 3300027357 Ga0209589_1000001 Ga0209589_1000001711 157
666 3300027361 Ga0209489_100001 Ga0209489_100001711 157
667 3300027363 Ga0209700_100001 Ga0209700_100001711 157
668 3300027866 Ga0209813_10041706 Ga0209813_100417062 157
669 3300027907 Ga0207428_10235629 Ga0207428_102356292 157
670 3300028379 Ga0268266_10348365 Ga0268266_103483652 157
671 3300028379 Ga0268266_10403373 Ga0268266_104033732 157
672 3300028379 Ga0268266_10522194 Ga0268266_105221942 157
673 3300028379 Ga0268266_11135391 Ga0268266_111353912 157
674 3300028379 Ga0268266_11339074 Ga0268266_113390741 157
675 3300028380 Ga0268265_10065954 Ga0268265_100659542 157
676 3300028380 Ga0268265_10466837 Ga0268265_104668372 157
677 3300028380 Ga0268265_10840534 Ga0268265_108405341 157
678 3300028380 Ga0268265_10967213 Ga0268265_109672132 157
679 3300028381 Ga0268264_10000048 Ga0268264_10000048239 157
680 3300028381 Ga0268264_10105922 Ga0268264_101059222 157
681 3300028381 Ga0268264_10228119 Ga0268264_102281192 157
682 3300028381 Ga0268264_10758289 Ga0268264_107582892 157
683 3300028556 Ga0265337_1014325 Ga0265337_10143251 157
684 3300028577 Ga0265318_10055792 Ga0265318_100557922 157
685 3300028666 Ga0265336_10002023 Ga0265336_100020232 157
686 3300028786 Ga0307517_10401190 Ga0307517_104011902 157
687 3300028786 Ga0307517_10516633 Ga0307517_105166331 157
688 3300028794 Ga0307515_10055742 Ga0307515_100557424 157
689 3300028794 Ga0307515_10251366 Ga0307515_102513662 157
690 3300028800 Ga0265338_10000034 Ga0265338_1000003425 157
691 3300029957 Ga0265324_10008520 Ga0265324_100085202 157
692 3300030521 Ga0307511_10259389 Ga0307511_102593892 157
693 3300031238 Ga0265332_10020911 Ga0265332_100209113 157
694 3300031238 Ga0265332_10026357 Ga0265332_100263573 157
695 3300031239 Ga0265328_10107591 Ga0265328_101075912 157
696 3300031241 Ga0265325_10055816 Ga0265325_100558162 157
697 3300031247 Ga0265340_10486088 Ga0265340_104860881 157
698 3300031249 Ga0265339_10094694 Ga0265339_100946941 157
699 3300031250 Ga0265331_10125071 Ga0265331_101250712 157
700 3300031344 Ga0265316_10202469 Ga0265316_102024692 157
701 3300031344 Ga0265316_10847007 Ga0265316_108470072 157
702 3300031456 Ga0307513_10124063 Ga0307513_101240632 157
703 3300031507 Ga0307509_10004515 Ga0307509_100045157 157
704 3300031507 Ga0307509_10083761 Ga0307509_100837611 157
705 3300031507 Ga0307509_10242489 Ga0307509_102424892 157
706 3300031507 Ga0307509_10468063 Ga0307509_104680632 157
707 3300031548 Ga0307408_100468626 Ga0307408_1004686261 157
708 3300031595 Ga0265313_10215668 Ga0265313_102156681 157
709 3300031616 Ga0307508_10124432 Ga0307508_101244322 157
710 3300031616 Ga0307508_10350129 Ga0307508_103501292 157
711 3300031711 Ga0265314_10055608 Ga0265314_100556082 157
712 3300031711 Ga0265314_10142572 Ga0265314_101425721 157
713 3300031712 Ga0265342_10201252 Ga0265342_102012522 157
714 3300031730 Ga0307516_10010023 Ga0307516_100100236 157
715 3300031730 Ga0307516_10183347 Ga0307516_101833472 157
716 3300031730 Ga0307516_10382672 Ga0307516_103826722 157
717 3300031911 Ga0307412_10169904 Ga0307412_101699042 157
718 3300031911 Ga0307412_10235461 Ga0307412_102354612 157
719 3300031995 Ga0307409_100056209 Ga0307409_1000562093 157
720 3300032002 Ga0307416_100350332 Ga0307416_1003503322 157
721 3300032002 Ga0307416_100377813 Ga0307416_1003778131 157
722 3300033179 Ga0307507_10043168 Ga0307507_100431681 157
723 3300033180 Ga0307510_10006198 Ga0307510_100061982 157
724 3300033180 Ga0307510_10230653 Ga0307510_102306532 157
725 3300033442 Ga0315911_1000002 Ga0315911_1000002374 157
726 3300035089 Ga0373944_0012406 Ga0373944_0012406_1401_1877 157
727 3300035111 Ga0373923_0005649 Ga0373923_0005649_1397_1873 157
728 3300035112 Ga0373932_0256459 Ga0373932_0256459_39_551 157
729 3300035113 Ga0373936_0003425 Ga0373936_0003425_3710_4186 157
730 3300035113 Ga0373936_0079192 Ga0373936_0079192_43_519 157
731 3300035114 Ga0373939_0093342 Ga0373939_0093342_390_866 157
732 3300035115 Ga0373941_0074741 Ga0373941_0074741_307_789 157
733 3300035116 Ga0373945_0050258 Ga0373945_0050258_162_638 157
734 3300035117 Ga0373953_0046725 Ga0373953_0046725_264_740 157
735 3300035119 Ga0373956_0004560 Ga0373956_0004560_501_977 157
736 3300035120 Ga0373957_0034710 Ga0373957_0034710_1068_1544 157
737 3300035170 Ga0373943_0153100 Ga0373943_0153100_688_1164 157
738 3300035170 Ga0373943_0306457 Ga0373943_0306457_137_613 157
739 3300035171 Ga0373946_0022449 Ga0373946_0022449_1061_1537 157
740 3300035410 Ga0373924_0057151 Ga0373924_0057151_1046_1522 157
741 3300035692 Ga0373935_0101957 Ga0373935_0101957_1404_1880 157
742 3300035692 Ga0373935_0712163 Ga0373935_0712163_213_689 157
743 3300035695 Ga0373927_0089176 Ga0373927_0089176_1186_1662 157
744 3300035695 Ga0373927_0264690 Ga0373927_0264690_246_722 157
745 3300035724 Ga0373933_0262592 Ga0373933_0262592_220_696 157
746 3300035724 Ga0373933_0685728 Ga0373933_0685728_108_584 157
747 3300035725 Ga0373947_0051973 Ga0373947_0051973_29_505 157
748 3300035725 Ga0373947_0887615 Ga0373947_0887615_89_565 157
749 3300036459 Ga0372808_012541 Ga0372808_012541_78_575 157
750 3300037068 Ga0373925_0095058 Ga0373925_0095058_409_885 157
751 3300037068 Ga0373925_0112212 Ga0373925_0112212_575_1051 157
752 3300037068 Ga0373925_0693607 Ga0373925_0693607_266_742 157
753 3300037312 Ga0395899_0441481 Ga0395899_0441481_240_716 157
754 3300037418 Ga0395900_0062919 Ga0395900_0062919_2058_2534 157
755 3300037466 Ga0395898_0209258 Ga0395898_0209258_666_1142 157
756 3300037853 Ga0436364_0169791 Ga0436364_0169791_89_565 157
757 3300037853 Ga0436364_1233393 Ga0436364_1233393_758_1234 157
758 3300037853 Ga0436364_1554191 Ga0436364_1554191_20_496 157
759 3300039437 Ga0436365_0191780 Ga0436365_0191780_2590_3066 157
760 3300039437 Ga0436365_0251377 Ga0436365_0251377_822_1298 157
761 3300039437 Ga0436365_0393739 Ga0436365_0393739_276_755 157
762 3300039437 Ga0436365_1908037 Ga0436365_1908037_1621_2097 157
763 3300039447 Ga0436361_1005768 Ga0436361_1005768_276_764 157
764 3300039450 Ga0436363_1267832 Ga0436363_1267832_214_690 157
765 3300041460 Ga0451802_0888262 Ga0451802_0888262_505_987 157
766 3300041496 Ga0451839_1007315 Ga0451839_1007315_214_696 157
767 3300041507 Ga0451851_0273039 Ga0451851_0273039_54_530 157
768 3300041512 Ga0451853_2445747 Ga0451853_2445747_227_703 157
769 3300044658 Ga0466972_0030619 Ga0466972_0030619_1427_1903 157
770 3300044683 Ga0466965_0403188 Ga0466965_0403188_106_582 157
771 3300044683 Ga0466965_0684660 Ga0466965_0684660_91_567 157
772 3300044694 Ga0466963_0247985 Ga0466963_0247985_296_772 157
773 3300044735 Ga0466968_0016849 Ga0466968_0016849_1278_1754 157
774 3300044842 Ga0466957_0143835 Ga0466957_0143835_183_659 157
775 3300044842 Ga0466957_0187965 Ga0466957_0187965_82_558 157
776 3300044901 Ga0466960_0009101 Ga0466960_0009101_1384_1860 157
777 3300045049 Ga0466959_0440227 Ga0466959_0440227_254_730 157
778 3300045836 Ga0466958_0159600 Ga0466958_0159600_505_996 157
779 3300045976 Ga0466967_0140209 Ga0466967_0140209_1243_1719 157
780 3300045976 Ga0466967_0458301 Ga0466967_0458301_313_789 157
781 3300046452 Ga0495617_026835 Ga0495617_026835_363_839 157
782 3300046454 Ga0495592_0061168 Ga0495592_0061168_1906_2382 157
783 3300046455 Ga0495603_0033212 Ga0495603_0033212_828_1304 157
784 3300046455 Ga0495603_0130525 Ga0495603_0130525_223_699 157
785 3300046455 Ga0495603_0177669 Ga0495603_0177669_126_602 157
786 3300046457 Ga0495590_0051207 Ga0495590_0051207_865_1356 157
787 3300046457 Ga0495590_0053608 Ga0495590_0053608_799_1275 157
788 3300046458 Ga0495591_090943 Ga0495591_090943_131_607 157
789 3300046459 Ga0495629_0256266 Ga0495629_0256266_566_1042 157
790 3300046459 Ga0495629_0395399 Ga0495629_0395399_77_553 157
791 3300046460 Ga0495638_0023696 Ga0495638_0023696_2728_3204 157
792 3300046460 Ga0495638_0099406 Ga0495638_0099406_517_1008 157
793 3300046460 Ga0495638_0114000 Ga0495638_0114000_221_709 157
794 3300046460 Ga0495638_0620069 Ga0495638_0620069_14_496 157
795 3300046461 Ga0495641_0080026 Ga0495641_0080026_808_1284 157
796 3300046462 Ga0495651_0339234 Ga0495651_0339234_404_880 157
797 3300046472 Ga0495580_0022608 Ga0495580_0022608_1577_2053 157
798 3300046473 Ga0495582_0283876 Ga0495582_0283876_427_903 157
799 3300046474 Ga0495605_0069318 Ga0495605_0069318_935_1411 157
800 3300046475 Ga0495639_0046128 Ga0495639_0046128_485_961 157
801 3300046475 Ga0495639_0203940 Ga0495639_0203940_462_938 157
802 3300046477 Ga0495664_0014560 Ga0495664_0014560_2582_3058 157
803 3300046477 Ga0495664_0018042 Ga0495664_0018042_1243_1731 157
804 3300046477 Ga0495664_0443451 Ga0495664_0443451_43_519 157
805 3300046491 Ga0495584_0288698 Ga0495584_0288698_342_818 157
806 3300046491 Ga0495584_0319164 Ga0495584_0319164_41_517 157
807 3300046492 Ga0495585_0037608 Ga0495585_0037608_13_489 157
808 3300046499 Ga0495594_0166812 Ga0495594_0166812_89_565 157
809 3300046499 Ga0495594_0169486 Ga0495594_0169486_150_626 157
810 3300046499 Ga0495594_0306414 Ga0495594_0306414_22_504 157
811 3300046500 Ga0495596_0045661 Ga0495596_0045661_906_1382 157
812 3300046506 Ga0495583_0081116 Ga0495583_0081116_705_1196 157
813 3300046506 Ga0495583_0109194 Ga0495583_0109194_347_847 157
814 3300046506 Ga0495583_0135597 Ga0495583_0135597_220_696 157
815 3300046507 Ga0495606_0071103 Ga0495606_0071103_1429_1905 157
816 3300046507 Ga0495606_0147760 Ga0495606_0147760_870_1361 157
817 3300046507 Ga0495606_0187395 Ga0495606_0187395_179_679 157
818 3300046507 Ga0495606_0354754 Ga0495606_0354754_15_491 157
819 3300046513 Ga0495616_0102274 Ga0495616_0102274_432_923 157
820 3300046513 Ga0495616_0156388 Ga0495616_0156388_95_595 157
821 3300046513 Ga0495616_0236608 Ga0495616_0236608_278_754 157
822 3300046515 Ga0495620_0009664 Ga0495620_0009664_3935_4426 157
823 3300046515 Ga0495620_0055613 Ga0495620_0055613_486_962 157
824 3300046515 Ga0495620_0070892 Ga0495620_0070892_157_657 157
825 3300046516 Ga0495628_0366569 Ga0495628_0366569_198_674 157
826 3300046516 Ga0495628_0426945 Ga0495628_0426945_344_820 157
827 3300046518 Ga0495631_0018925 Ga0495631_0018925_2178_2654 157
828 3300046518 Ga0495631_0024875 Ga0495631_0024875_1736_2227 157
829 3300046519 Ga0495632_0055899 Ga0495632_0055899_690_1181 157
830 3300046519 Ga0495632_0089356 Ga0495632_0089356_576_1052 157
831 3300046519 Ga0495632_0166745 Ga0495632_0166745_307_783 157
832 3300046520 Ga0495637_0061832 Ga0495637_0061832_174_665 157
833 3300046522 Ga0495643_0121160 Ga0495643_0121160_603_1094 157
834 3300046524 Ga0495648_0171844 Ga0495648_0171844_548_1024 157
835 3300046526 Ga0495666_0177575 Ga0495666_0177575_20_496 157
836 3300046529 Ga0495652_0220869 Ga0495652_0220869_151_627 157
837 3300046530 Ga0495654_0032434 Ga0495654_0032434_1021_1512 157
838 3300046533 Ga0495640_0204182 Ga0495640_0204182_674_1150 157
839 3300046533 Ga0495640_0390579 Ga0495640_0390579_322_798 157
840 3300046537 Ga0495598_0011017 Ga0495598_0011017_774_1256 157
841 3300046538 Ga0495609_0069068 Ga0495609_0069068_610_1086 157
842 3300046539 Ga0495621_0020483 Ga0495621_0020483_216_692 157
843 3300046542 Ga0495597_0145358 Ga0495597_0145358_427_903 157
844 3300046543 Ga0495645_0013656 Ga0495645_0013656_1489_1977 157
845 3300046543 Ga0495645_0205321 Ga0495645_0205321_714_1190 157
846 3300046557 Ga0495622_0043031 Ga0495622_0043031_573_1049 157
847 3300046557 Ga0495622_0092790 Ga0495622_0092790_153_629 157
848 3300046558 Ga0495633_0223714 Ga0495633_0223714_96_572 157
849 3300046559 Ga0495667_0263494 Ga0495667_0263494_355_837 157
850 3300046559 Ga0495667_0313959 Ga0495667_0313959_403_879 157
851 3300046615 Ga0495656_0009134 Ga0495656_0009134_2980_3456 157
852 3300046615 Ga0495656_0074587 Ga0495656_0074587_431_913 157
853 3300046615 Ga0495656_0122454 Ga0495656_0122454_686_1162 157
854 3300046616 Ga0495668_0032051 Ga0495668_0032051_1143_1634 157
855 3300046616 Ga0495668_0086409 Ga0495668_0086409_540_1016 157
856 3300046616 Ga0495668_0285397 Ga0495668_0285397_352_828 157
857 3300046616 Ga0495668_0382603 Ga0495668_0382603_44_544 157
858 3300046642 Ga0495634_0016562 Ga0495634_0016562_4385_4861 157
859 3300046642 Ga0495634_0293367 Ga0495634_0293367_104_580 157
860 3300046648 Ga0495611_0043449 Ga0495611_0043449_1432_1908 157
861 3300046648 Ga0495611_0151438 Ga0495611_0151438_184_675 157
862 3300046648 Ga0495611_0187645 Ga0495611_0187645_159_635 157
863 3300046660 Ga0495625_0087742 Ga0495625_0087742_584_1060 157
864 3300046660 Ga0495625_0129626 Ga0495625_0129626_714_1205 157
865 3300046660 Ga0495625_0184281 Ga0495625_0184281_626_1102 157
866 3300046660 Ga0495625_0332132 Ga0495625_0332132_239_739 157
867 3300046660 Ga0495625_0489730 Ga0495625_0489730_211_687 157
868 3300046660 Ga0495625_0597809 Ga0495625_0597809_146_628 157
869 3300046660 Ga0495625_0696616 Ga0495625_0696616_101_583 157
870 3300046663 Ga0495635_0147910 Ga0495635_0147910_10_486 157
871 3300046664 Ga0495659_0085540 Ga0495659_0085540_159_635 157
872 3300046664 Ga0495659_0101804 Ga0495659_0101804_529_1011 157
873 3300046665 Ga0495661_0009212 Ga0495661_0009212_191_682 157
874 3300046678 Ga0495599_0164886 Ga0495599_0164886_109_585 157
875 3300046678 Ga0495599_0497993 Ga0495599_0497993_123_611 157
876 3300046678 Ga0495599_0565641 Ga0495599_0565641_128_604 157
877 3300046678 Ga0495599_0640760 Ga0495599_0640760_10_486 157
878 3300046680 Ga0495646_0341797 Ga0495646_0341797_50_526 157
879 3300046681 Ga0495647_0008590 Ga0495647_0008590_2886_3362 157
880 3300046683 Ga0495658_0104092 Ga0495658_0104092_506_982 157
881 3300046684 Ga0495669_0061526 Ga0495669_0061526_774_1250 157
882 3300046684 Ga0495669_0121917 Ga0495669_0121917_403_885 157
883 3300046684 Ga0495669_0317477 Ga0495669_0317477_134_616 157
884 3300046689 Ga0495613_0236572 Ga0495613_0236572_721_1197 157
885 3300046690 Ga0495624_0144728 Ga0495624_0144728_944_1420 157
886 3300046691 Ga0495670_0055014 Ga0495670_0055014_890_1372 157
887 3300046691 Ga0495670_0176288 Ga0495670_0176288_474_950 157
888 3300046691 Ga0495670_0315804 Ga0495670_0315804_189_680 157
889 3300046692 Ga0495671_0022803 Ga0495671_0022803_384_860 157
890 3300046692 Ga0495671_0054884 Ga0495671_0054884_558_1049 157
891 3300046692 Ga0495671_0448922 Ga0495671_0448922_68_544 157
892 3300046694 Ga0495649_0091380 Ga0495649_0091380_791_1291 157
893 3300046694 Ga0495649_0158538 Ga0495649_0158538_527_1015 157
894 3300046694 Ga0495649_0291367 Ga0495649_0291367_337_813 157
895 3300046794 Ga0495589_0248476 Ga0495589_0248476_91_567 157
896 3300046810 Ga0495660_0062347 Ga0495660_0062347_870_1361 157
897 3300046810 Ga0495660_0227078 Ga0495660_0227078_324_800 157
898 3300047315 Ga0495581_0189155 Ga0495581_0189155_240_722 157
899 3300047319 Ga0495674_0001682 Ga0495674_0001682_16090_16566 157
900 3300047319 Ga0495674_0389363 Ga0495674_0389363_76_552 157
901 3300047320 Ga0495672_0013335 Ga0495672_0013335_5122_5598 157
902 3300047320 Ga0495672_0166329 Ga0495672_0166329_120_596 157
903 3300047320 Ga0495672_0249953 Ga0495672_0249953_183_674 157
904 3300047321 Ga0495676_0050628 Ga0495676_0050628_816_1292 157
905 3300047321 Ga0495676_0214456 Ga0495676_0214456_778_1254 157
906 3300047321 Ga0495676_0696254 Ga0495676_0696254_131_613 157
907 3300047323 Ga0495683_0196897 Ga0495683_0196897_43_543 157
908 3300047445 Ga0495677_0087812 Ga0495677_0087812_496_972 157
909 3300047469 Ga0495673_0144799 Ga0495673_0144799_246_722 157
910 3300047469 Ga0495673_0236043 Ga0495673_0236043_137_628 157
911 3300047471 Ga0495684_0061433 Ga0495684_0061433_1320_1796 157
912 3300047472 Ga0495686_0030975 Ga0495686_0030975_107_598 157
913 3300047472 Ga0495686_0120640 Ga0495686_0120640_439_915 157
914 3300047472 Ga0495686_0160239 Ga0495686_0160239_516_992 157
915 3300047472 Ga0495686_0393509 Ga0495686_0393509_255_731 157
916 3300047673 Ga0495593_0004032 Ga0495593_0004032_1572_2048 157
917 3300047673 Ga0495593_0361226 Ga0495593_0361226_168_644 157
918 3300047673 Ga0495593_0396947 Ga0495593_0396947_178_660 157
919 3300048091 Ga0495626_0017083 Ga0495626_0017083_2930_3421 157
920 3300048091 Ga0495626_0290535 Ga0495626_0290535_145_621 157
921 3300048903 Ga0496100_0053851 Ga0496100_0053851_1145_1621 157
922 3300048903 Ga0496100_0300827 Ga0496100_0300827_590_1072 157
923 3300048904 Ga0496101_0007148 Ga0496101_0007148_3025_3501 157
924 3300048904 Ga0496101_0122158 Ga0496101_0122158_1358_1834 157
925 3300048904 Ga0496101_0628455 Ga0496101_0628455_185_661 157
926 3300048905 Ga0496102_0061742 Ga0496102_0061742_1145_1621 157
927 3300048905 Ga0496102_0363650 Ga0496102_0363650_793_1269 157
928 3300048905 Ga0496102_1294243 Ga0496102_1294243_119_601 157
929 3300048906 Ga0496103_0109799 Ga0496103_0109799_456_932 157
930 3300048906 Ga0496103_0209280 Ga0496103_0209280_504_980 157
931 3300048906 Ga0496103_0253800 Ga0496103_0253800_188_664 157
932 3300048907 Ga0496104_0015940 Ga0496104_0015940_6327_6803 157
933 3300048907 Ga0496104_0877881 Ga0496104_0877881_186_662 157
934 3300048908 Ga0496105_0457279 Ga0496105_0457279_285_761 157
935 3300048909 Ga0496106_0102769 Ga0496106_0102769_1374_1850 157
936 3300048909 Ga0496106_0676501 Ga0496106_0676501_269_745 157
937 3300048910 Ga0496107_0011954 Ga0496107_0011954_440_916 157
938 3300048910 Ga0496107_0392271 Ga0496107_0392271_86_562 157
939 3300048910 Ga0496107_1208412 Ga0496107_1208412_52_528 157
940 3300048911 Ga0496108_0093932 Ga0496108_0093932_651_1127 157
941 3300048911 Ga0496108_0762974 Ga0496108_0762974_240_815 157
942 3300048912 Ga0496109_0008198 Ga0496109_0008198_1145_1621 157
943 3300048912 Ga0496109_0048842 Ga0496109_0048842_1111_1587 157
944 3300048913 Ga0496110_0015882 Ga0496110_0015882_4060_4536 157
945 3300048913 Ga0496110_0137548 Ga0496110_0137548_1470_1946 157
946 3300048913 Ga0496110_0256467 Ga0496110_0256467_355_867 157
947 3300048914 Ga0496111_0023733 Ga0496111_0023733_3305_3781 157
948 3300048914 Ga0496111_0937970 Ga0496111_0937970_81_557 157
949 3300048915 Ga0496112_0268321 Ga0496112_0268321_622_1098 157
950 3300048915 Ga0496112_0860676 Ga0496112_0860676_262_738 157
951 3300048916 Ga0496113_0126700 Ga0496113_0126700_478_954 157
952 3300048917 Ga0496114_0015772 Ga0496114_0015772_456_932 157
953 3300048917 Ga0496114_0152086 Ga0496114_0152086_785_1261 157
954 3300048917 Ga0496114_0221776 Ga0496114_0221776_1003_1479 157
955 3300048917 Ga0496114_1556996 Ga0496114_1556996_17_493 157
956 3300048918 Ga0496115_0005432 Ga0496115_0005432_2251_2727 157
957 3300048918 Ga0496115_0285670 Ga0496115_0285670_477_953 157
958 3300048918 Ga0496115_0503369 Ga0496115_0503369_77_553 157
959 3300048919 Ga0496116_0001099 Ga0496116_0001099_5144_5635 157
960 3300048919 Ga0496116_0307019 Ga0496116_0307019_126_617 157
961 3300048920 Ga0496117_0027253 Ga0496117_0027253_2648_3124 157
962 3300048920 Ga0496117_0061631 Ga0496117_0061631_325_807 157
963 3300048920 Ga0496117_0255294 Ga0496117_0255294_158_649 157
964 3300048921 Ga0496118_0011793 Ga0496118_0011793_7231_7707 157
965 3300048921 Ga0496118_0022593 Ga0496118_0022593_4657_5133 157
966 3300048921 Ga0496118_0067738 Ga0496118_0067738_1020_1496 157
967 3300048921 Ga0496118_0081043 Ga0496118_0081043_1128_1610 157
968 3300048921 Ga0496118_0115655 Ga0496118_0115655_408_899 157
969 3300048921 Ga0496118_0143239 Ga0496118_0143239_200_691 157
970 3300048921 Ga0496118_0407435 Ga0496118_0407435_67_543 157
971 3300048922 Ga0496119_0031900 Ga0496119_0031900_214_690 157
972 3300048922 Ga0496119_0155124 Ga0496119_0155124_348_824 157
973 3300048923 Ga0496120_0011170 Ga0496120_0011170_3274_3765 157
974 3300048923 Ga0496120_0043295 Ga0496120_0043295_330_821 157
975 3300048923 Ga0496120_0329598 Ga0496120_0329598_45_521 157
976 3300048924 Ga0496121_0001566 Ga0496121_0001566_530_1006 157
977 3300048924 Ga0496121_0002300 Ga0496121_0002300_25903_26379 157
978 3300048924 Ga0496121_0002583 Ga0496121_0002583_885_1376 157
979 3300048924 Ga0496121_0002985 Ga0496121_0002985_3691_4173 157
980 3300048924 Ga0496121_0031009 Ga0496121_0031009_2002_2478 157
981 3300048924 Ga0496121_0057009 Ga0496121_0057009_498_974 157
982 3300048924 Ga0496121_0073592 Ga0496121_0073592_1807_2283 157
983 3300048924 Ga0496121_0085514 Ga0496121_0085514_838_1314 157
984 3300048924 Ga0496121_0087473 Ga0496121_0087473_797_1273 157
985 3300048924 Ga0496121_0105524 Ga0496121_0105524_1264_1746 157
986 3300048924 Ga0496121_0168114 Ga0496121_0168114_884_1360 157
987 3300048924 Ga0496121_0207701 Ga0496121_0207701_162_644 157
988 3300048924 Ga0496121_0221476 Ga0496121_0221476_77_553 157
989 3300048924 Ga0496121_0252471 Ga0496121_0252471_186_662 157
990 3300048926 Ga0496123_0044358 Ga0496123_0044358_1041_1532 157
991 3300048927 Ga0496124_0003294 Ga0496124_0003294_413_889 157
992 3300048927 Ga0496124_0212774 Ga0496124_0212774_835_1311 157
993 3300048927 Ga0496124_0571790 Ga0496124_0571790_228_719 157
994 3300048927 Ga0496124_0847641 Ga0496124_0847641_45_521 157
995 3300048928 Ga0496125_0009137 Ga0496125_0009137_6111_6602 157
996 3300048928 Ga0496125_0124993 Ga0496125_0124993_18_494 157
997 3300048928 Ga0496125_0132854 Ga0496125_0132854_976_1452 157
998 3300048928 Ga0496125_0190934 Ga0496125_0190934_450_1025 157
999 3300048928 Ga0496125_0350237 Ga0496125_0350237_57_533 157
1000 3300048929 Ga0496126_0003285 Ga0496126_0003285_11223_11699 157
1001 3300048929 Ga0496126_0034214 Ga0496126_0034214_1538_2014 157
1002 3300048929 Ga0496126_0037297 Ga0496126_0037297_2318_2794 157
1003 3300048929 Ga0496126_0101489 Ga0496126_0101489_1042_1518 157
1004 3300048929 Ga0496126_0117979 Ga0496126_0117979_627_1109 157
1005 3300048929 Ga0496126_0162562 Ga0496126_0162562_396_872 157
1006 3300048929 Ga0496126_0175131 Ga0496126_0175131_148_624 157
1007 3300048929 Ga0496126_0213222 Ga0496126_0213222_554_1030 157
1008 3300048929 Ga0496126_0304727 Ga0496126_0304727_64_546 157
1009 3300048929 Ga0496126_0308180 Ga0496126_0308180_453_929 157
1010 3300049460 Ga0495682_0189736 Ga0495682_0189736_140_616 157
1011 3300049580 Ga0501046_0268808 Ga0501046_0268808_102_578 157
1012 3300049581 Ga0501047_0076378 Ga0501047_0076378_1130_1606 157
1013 3300049581 Ga0501047_0095469 Ga0501047_0095469_707_1183 157
1014 3300049583 Ga0501067_0099675 Ga0501067_0099675_52_528 157
1015 3300049584 Ga0501068_0854246 Ga0501068_0854246_84_572 157
1016 3300049585 Ga0501069_0636277 Ga0501069_0636277_71_559 157
1017 3300049586 Ga0501070_0142293 Ga0501070_0142293_738_1214 157
1018 3300049586 Ga0501070_0377926 Ga0501070_0377926_155_631 157
1019 3300049586 Ga0501070_0485763 Ga0501070_0485763_47_523 157
1020 3300049587 Ga0501071_0931043 Ga0501071_0931043_142_618 157
1021 3300049588 Ga0501072_0654134 Ga0501072_0654134_313_789 157
1022 3300049589 Ga0501073_0233467 Ga0501073_0233467_562_1038 157
1023 3300049590 Ga0501074_0074417 Ga0501074_0074417_1377_1853 157
1024 3300049742 Ga0501080_0069368 Ga0501080_0069368_972_1448 157
1025 3300049822 Ga0501035_0062272 Ga0501035_0062272_281_757 157
1026 3300049823 Ga0501044_0116053 Ga0501044_0116053_1405_1881 157
1027 3300049823 Ga0501044_0291295 Ga0501044_0291295_255_731 157
1028 3300050490 nmdc:mga03n38_212664_c1 nmdc:mga03n38_212664_c1_282_758 157
1029 3300050490 nmdc:mga03n38_492154_c1 nmdc:mga03n38_492154_c1_170_646 157
1030 3300050490 nmdc:mga03n38_49430_c1 nmdc:mga03n38_49430_c1_213_689 157
1031 3300050492 nmdc:mga0yw44_359092_c1 nmdc:mga0yw44_359092_c1_488_964 157
1032 3300050492 nmdc:mga0yw44_40732_c1 nmdc:mga0yw44_40732_c1_880_1371 157
1033 3300050492 nmdc:mga0yw44_627679_c1 nmdc:mga0yw44_627679_c1_13_489 157
1034 3300050493 nmdc:mga0k408_110097_c1 nmdc:mga0k408_110097_c1_826_1302 157
1035 3300050493 nmdc:mga0k408_113608_c1 nmdc:mga0k408_113608_c1_142_618 157
1036 3300050494 nmdc:mga06z11_131121_c1 nmdc:mga06z11_131121_c1_117_593 157
1037 3300050494 nmdc:mga06z11_175728_c1 nmdc:mga06z11_175728_c1_31_522 157
1038 3300050495 nmdc:mga04h51_102777_c1 nmdc:mga04h51_102777_c1_354_830 157
1039 3300050496 nmdc:mga07m45_177276_c1 nmdc:mga07m45_177276_c1_598_1080 157
1040 3300050496 nmdc:mga07m45_261130_c1 nmdc:mga07m45_261130_c1_509_985 157
1041 3300050496 nmdc:mga07m45_34810_c1 nmdc:mga07m45_34810_c1_2172_2663 157
1042 3300050496 nmdc:mga07m45_372558_c1 nmdc:mga07m45_372558_c1_254_730 157
1043 3300050507 nmdc:mga05p37_1292349_c1 nmdc:mga05p37_1292349_c1_122_598 157
1044 3300050507 nmdc:mga05p37_2013400_c1 nmdc:mga05p37_2013400_c1_52_528 157
1045 3300050511 nmdc:mga08y16_908491_c1 nmdc:mga08y16_908491_c1_257_739 157
1046 3300050512 nmdc:mga0n895_298481_c1 nmdc:mga0n895_298481_c1_323_835 157
1047 3300050512 nmdc:mga0n895_929483_c1 nmdc:mga0n895_929483_c1_354_830 157
1048 3300050516 nmdc:mga0sz30_10924_c1 nmdc:mga0sz30_10924_c1_18_509 157
1049 3300050516 nmdc:mga0sz30_154132_c1 nmdc:mga0sz30_154132_c1_138_614 157
1050 3300050516 nmdc:mga0sz30_166150_c1 nmdc:mga0sz30_166150_c1_122_640 157
1051 3300050516 nmdc:mga0sz30_2979_c1 nmdc:mga0sz30_2979_c1_265_756 157
1052 3300053077 Ga0495601_0026159 Ga0495601_0026159_568_1056 157
1053 3300053077 Ga0495601_0222865 Ga0495601_0222865_651_1127 157
1054 3300053077 Ga0495601_0246368 Ga0495601_0246368_59_535 157
1055 3300053078 Ga0495612_0012482 Ga0495612_0012482_1149_1637 157
1056 3300053078 Ga0495612_0144867 Ga0495612_0144867_501_977 157
1057 3300053078 Ga0495612_0197262 Ga0495612_0197262_153_629 157
1058 3300053080 Ga0500635_0000999 Ga0500635_0000999_4383_4859 157
1059 3300053080 Ga0500635_0004951 Ga0500635_0004951_2496_2972 157
1060 3300053080 Ga0500635_0114234 Ga0500635_0114234_284_760 157
1061 3300053083 Ga0495655_0051464 Ga0495655_0051464_154_654 157
1062 3300053087 Ga0500643_061712 Ga0500643_061712_442_918 157
1063 3300053088 Ga0500644_0009244 Ga0500644_0009244_996_1487 157
1064 3300053089 Ga0500581_167750 Ga0500581_167750_510_1001 157
1065 3300053090 Ga0500646_0027414 Ga0500646_0027414_505_996 157
1066 3300053093 Ga0500651_0006315 Ga0500651_0006315_4802_5290 157
1067 3300053093 Ga0500651_0052289 Ga0500651_0052289_1963_2454 157
1068 3300053093 Ga0500651_0413321 Ga0500651_0413321_142_618 157
1069 3300053093 Ga0500651_0451444 Ga0500651_0451444_157_633 157
1070 3300053094 Ga0500566_0001430 Ga0500566_0001430_1906_2397 157
1071 3300053094 Ga0500566_0001776 Ga0500566_0001776_9497_9973 157
1072 3300053094 Ga0500566_0002071 Ga0500566_0002071_9486_9962 157
1073 3300053094 Ga0500566_0137960 Ga0500566_0137960_141_617 157
1074 3300053094 Ga0500566_0202509 Ga0500566_0202509_462_938 157
1075 3300053095 Ga0500640_000418 Ga0500640_000418_1330_1806 157
1076 3300053096 Ga0500641_0011747 Ga0500641_0011747_861_1343 157
1077 3300053096 Ga0500641_0036209 Ga0500641_0036209_1315_1797 157
1078 3300053096 Ga0500641_0083130 Ga0500641_0083130_512_1000 157
1079 3300053096 Ga0500641_0109539 Ga0500641_0109539_420_911 157
1080 3300053098 Ga0500650_0319367 Ga0500650_0319367_175_657 157
1081 3300053102 Ga0500554_014823 Ga0500554_014823_994_1470 157
1082 3300053102 Ga0500554_115745 Ga0500554_115745_74_565 157
1083 3300053102 Ga0500554_257664 Ga0500554_257664_70_546 157
1084 3300053103 Ga0500555_035874 Ga0500555_035874_676_1167 157
1085 3300053103 Ga0500555_080356 Ga0500555_080356_239_715 157
1086 3300053104 Ga0500556_0000019 Ga0500556_0000019_127328_127819 157
1087 3300053105 Ga0500557_097610 Ga0500557_097610_318_809 157
1088 3300053106 Ga0500558_110192 Ga0500558_110192_480_956 157
1089 3300053109 Ga0500569_006961 Ga0500569_006961_1300_1791 157
1090 3300053111 Ga0500572_000151 Ga0500572_000151_2403_2879 157
1091 3300053111 Ga0500572_001227 Ga0500572_001227_3476_3952 157
1092 3300053116 Ga0500592_000834 Ga0500592_000834_2184_2675 157
1093 3300053116 Ga0500592_010602 Ga0500592_010602_799_1275 157
1094 3300053118 Ga0500594_0041491 Ga0500594_0041491_613_1104 157
1095 3300053118 Ga0500594_0188770 Ga0500594_0188770_50_532 157
1096 3300053118 Ga0500594_0252819 Ga0500594_0252819_58_540 157
1097 3300053119 Ga0500595_000203 Ga0500595_000203_21865_22341 157
1098 3300053119 Ga0500595_002743 Ga0500595_002743_2399_2881 157
1099 3300053119 Ga0500595_004186 Ga0500595_004186_139_621 157
1100 3300053119 Ga0500595_005804 Ga0500595_005804_3571_4053 157
1101 3300053121 Ga0500607_246858 Ga0500607_246858_117_608 157
1102 3300053122 Ga0500608_022879 Ga0500608_022879_152_643 157
1103 3300053122 Ga0500608_066974 Ga0500608_066974_754_1230 157
1104 3300053122 Ga0500608_312958 Ga0500608_312958_50_526 157
1105 3300053123 Ga0500614_003865 Ga0500614_003865_1340_1816 157
1106 3300053125 Ga0500618_005679 Ga0500618_005679_2517_3008 157
1107 3300053130 Ga0500642_0000048 Ga0500642_0000048_47948_48439 157
1108 3300053130 Ga0500642_0227371 Ga0500642_0227371_328_810 157
1109 3300053131 Ga0500652_000394 Ga0500652_000394_1146_1637 157
1110 3300053134 Ga0500658_0013741 Ga0500658_0013741_703_1194 157
1111 3300053136 Ga0500559_0000099 Ga0500559_0000099_47521_47997 157
1112 3300053136 Ga0500559_0008202 Ga0500559_0008202_1369_1860 157
1113 3300053136 Ga0500559_0063941 Ga0500559_0063941_584_1060 157
1114 3300053136 Ga0500559_0207725 Ga0500559_0207725_414_890 157
1115 3300053139 Ga0500568_0000242 Ga0500568_0000242_42612_43103 157
1116 3300053139 Ga0500568_0019541 Ga0500568_0019541_1903_2379 157
1117 3300053142 Ga0500577_0020943 Ga0500577_0020943_871_1362 157
1118 3300053142 Ga0500577_0092420 Ga0500577_0092420_214_690 157
1119 3300053145 Ga0500586_001420 Ga0500586_001420_2693_3184 157
1120 3300053146 Ga0500588_0048325 Ga0500588_0048325_510_998 157
1121 3300053148 Ga0500590_052736 Ga0500590_052736_1098_1574 157
1122 3300053148 Ga0500590_266850 Ga0500590_266850_107_598 157
1123 3300053150 Ga0500603_002319 Ga0500603_002319_1293_1769 157
1124 3300053150 Ga0500603_002324 Ga0500603_002324_2380_2856 157
1125 3300053151 Ga0500604_0078827 Ga0500604_0078827_144_620 157
1126 3300053151 Ga0500604_0224167 Ga0500604_0224167_25_516 157
1127 3300053153 Ga0500616_0000059 Ga0500616_0000059_134473_134964 157
1128 3300053154 Ga0500619_065580 Ga0500619_065580_161_652 157
1129 3300053156 Ga0500622_0164303 Ga0500622_0164303_184_672 157
1130 3300053156 Ga0500622_0329401 Ga0500622_0329401_139_630 157
1131 3300053157 Ga0500624_016526 Ga0500624_016526_256_747 157
1132 3300053158 Ga0500627_0094878 Ga0500627_0094878_286_774 157
1133 3300053159 Ga0500630_002843 Ga0500630_002843_2393_2869 157
1134 3300053162 Ga0500638_063152 Ga0500638_063152_756_1232 157
1135 3300053162 Ga0500638_066962 Ga0500638_066962_1010_1486 157
1136 3300053162 Ga0500638_154662 Ga0500638_154662_380_862 157
1137 3300053163 Ga0500639_000579 Ga0500639_000579_13771_14247 157
1138 3300053163 Ga0500639_111748 Ga0500639_111748_443_919 157
1139 3300053163 Ga0500639_132437 Ga0500639_132437_342_818 157
1140 3300053177 Ga0500636_0001221 Ga0500636_0001221_13311_13802 157
1141 3300053177 Ga0500636_0016866 Ga0500636_0016866_2426_2902 157
1142 3300053177 Ga0500636_0065263 Ga0500636_0065263_362_844 157
1143 3300053177 Ga0500636_0165751 Ga0500636_0165751_703_1185 157
1144 3300053177 Ga0500636_0249174 Ga0500636_0249174_181_657 157
1145 3300053177 Ga0500636_0261355 Ga0500636_0261355_160_636 157
1146 3300053178 Ga0500637_0000130 Ga0500637_0000130_4332_4808 157
1147 3300053178 Ga0500637_0000328 Ga0500637_0000328_2876_3352 157
1148 3300053178 Ga0500637_0025623 Ga0500637_0025623_2712_3188 157
1149 3300053178 Ga0500637_0087119 Ga0500637_0087119_1296_1787 157
1150 3300053724 Ga0500570_085592 Ga0500570_085592_78_569 157
1151 3300053725 Ga0500576_050827 Ga0500576_050827_271_747 157
1152 3300053730 Ga0500645_006912 Ga0500645_006912_1970_2461 157
1153 3300053730 Ga0500645_170239 Ga0500645_170239_101_577 157
1154 3300053731 Ga0500609_031491 Ga0500609_031491_207_695 157
1155 3300053732 Ga0500656_018743 Ga0500656_018743_124_600 157
1156 3300053733 Ga0500552_005540 Ga0500552_005540_449_925 157
1157 3300053735 Ga0500596_000351 Ga0500596_000351_509_985 157
1158 3300053735 Ga0500596_004935 Ga0500596_004935_1839_2315 157
1159 3300053735 Ga0500596_006577 Ga0500596_006577_654_1130 157
1160 3300053736 Ga0500599_001092 Ga0500599_001092_831_1319 157
1161 3300055283 Ga0500661_004065 Ga0500661_004065_507_983 157
1162 3300060353 Ga0501082_0900478 Ga0501082_0900478_271_747 157
1163 3300061719 Ga0466962_0130558 Ga0466962_0130558_347_823 157
1164 iso_pu_bacteria 2508501128 2509147658 157
1165 iso_pu_bacteria 2511231028 2511396273 157
1166 iso_pu_bacteria 2513237094 2513639301 157
1167 iso_pu_bacteria 2513237095 2513647324 157
1168 iso_pu_bacteria 2517093001 2517103944 157
1169 iso_pu_bacteria 2824653114 2824659327 157
1170 iso_pu_bacteria 2841957949 2841959897 157
1171 iso_pu_bacteria 2842694124 2842695047 157
1172 iso_pu_bacteria 2844315083 2844319839 157
1173 iso_pu_bacteria 2874620515 2874622288 157
1174 iso_pu_bacteria 2885409591 2885409827 157
1175 iso_pu_bacteria 2888378607 2888385258 157
1176 iso_pu_bacteria 2888419890 2888425406 157
1177 iso_pu_bacteria 2903727486 2903730490 157
1178 iso_pu_bacteria 2904666416 2904667899 157
1179 iso_pu_bacteria 2906602504 2906609711 157
1180 iso_pu_bacteria 2932794094 2932795340 157
1181 iso_pu_bacteria 2935959822 2935961238 157
1182 iso_pu_bacteria 2941531003 2941536857 157
1183 iso_pu_bacteria 3005710791 3005715637 157
1184 iso_pu_bacteria 3005718088 3005722968 157

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01257

2Fe-2S_thioredx

Thioredoxin-like [2Fe-2S] ferredoxin

49

193

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2o2k-assembly1.cif.gz_B crystal structure of the activation domain of human methionine synthase isoform/mutant d963e/k1071n 0.8819 39 64
7t30-assembly1.cif.gz_H structure of electron bifurcating ni-fe hydrogenase complex hydabcsl in fmn/nad(h) bound state 0.8789 10 75
6vw7-assembly1.cif.gz_A formate dehydrogenase fdsabg subcomplex fdsbg from c. necator - nadh bound 0.8269 7 155
7p8n-assembly1.cif.gz_b tmhydabc- t. maritima hydrogenase with bridge closed 0.8222 77 154
6vw7-assembly1.cif.gz_A formate dehydrogenase fdsabg subcomplex fdsbg from c. necator - nadh bound 0.8174 7 155
ID Description Score Start End Superfamily
af_Q9D6J6_126_223_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9582 74 154 3.40.30.10
af_P0AFD1_83_165_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9494 73 154 3.40.30.10
af_P0AFD1_83_165_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9278 73 154 3.40.30.10
2fug202 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.905 74 153 3.40.30.10
af_A4HX94_128_234_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9011 74 156 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A7W7Z118-F1-model_v4 Formate dehydrogenase subunit gamma 0.8745 3 157 GO:0016491
GO:0046872
GO:0051537
AF-A0A2P8KF63-F1-model_v4 Formate dehydrogenase subunit gamma 0.8738 10 156 GO:0016491
GO:0046872
GO:0051537
AF-A0A7W7Z118-F1-model_v4 Formate dehydrogenase subunit gamma 0.8645 3 157 GO:0016491
GO:0046872
GO:0051537
AF-A0A6A7Y881-F1-model_v4 Formate dehydrogenase subunit gamma 0.8602 3 155 GO:0016491
GO:0046872
GO:0051537
AF-A0A561QIW4-F1-model_v4 Formate dehydrogenase gamma subunit 0.8591 9 157 GO:0016491
GO:0046872
GO:0051537

Feature Viewer

pLDDT pTM Quality
93.68 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map