F491361
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1184 | 527 | 1159 | 159 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2508501128|2509147658 |
| Length | 194 |
| Sequence | HFPINRFALSQHGTALLIFPTNSVSVGEAQFVIESPIMAVYEPWDETRGAEIITEHANREGATLLILHALQEAFGYVPEPAIPMVAAALNLSRAEVYGVFTFYHDFRKEPAGRHVLKLCRAEACQAAGGDALAARAEAKLGIACGNTTADNRVTLEPIYCLGLCATAPSAMLDGRLVGRLDQTRLDALIAEAQQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2010549000 | Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes | Metagenome | Endosphere |
| 2 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 3 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 4 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 5 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 6 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 7 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 8 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 9 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 10 | 2842694124 | Methylopila sp. R-72369 | Isolate | Unclassified |
| 11 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 12 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 13 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 14 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 15 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 16 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 17 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 18 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 19 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 20 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 21 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 22 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 23 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 24 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 25 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 26 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 27 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 28 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 29 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 30 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 31 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 32 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 33 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 34 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 35 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 36 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 39 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 41 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 44 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 46 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 53 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 67 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 68 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 71 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 73 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 74 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 75 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 77 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 78 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 82 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 83 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 85 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 86 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 87 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 89 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 90 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 91 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 92 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 93 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 94 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 95 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 96 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 97 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 98 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 99 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 100 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 101 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 102 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 103 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 104 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 105 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 106 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 107 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 108 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 109 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 110 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 111 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 112 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 113 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 115 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 116 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 117 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 118 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 119 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 120 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 121 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 122 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 123 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 125 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 126 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 127 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 128 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 129 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 142 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 144 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 160 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 161 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 162 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 163 | 3300024123 | Spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU5 | Metagenome | Unclassified |
| 164 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 165 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 166 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 167 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 168 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 169 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 170 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 171 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 172 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 173 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 174 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 175 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 228 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 229 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 230 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 231 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 232 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 236 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 237 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 238 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 239 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 240 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 241 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 242 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 243 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 244 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 245 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 246 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 247 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 248 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 249 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 250 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 251 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 252 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 253 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 254 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 255 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 256 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 257 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 258 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 259 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 260 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 261 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 262 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 263 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 264 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 265 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 266 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 267 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 268 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 269 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 270 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 271 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 272 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 273 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 274 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 275 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 276 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 277 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 278 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 279 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 280 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 281 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 282 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 283 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 284 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 285 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 286 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 287 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 288 | 3300036458 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 289 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 290 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 291 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 292 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 293 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 294 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 295 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 296 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 297 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 298 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 299 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 300 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 301 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 302 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 303 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 304 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 305 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 306 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 307 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 308 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 309 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 310 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 311 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 312 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 313 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 314 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 315 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 316 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 404 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 405 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 406 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 407 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 408 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 409 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 410 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 411 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 412 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 413 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 414 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 415 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 416 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 417 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 418 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 419 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 420 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 421 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 422 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 423 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 424 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 425 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 426 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 427 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 428 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 429 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 430 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 432 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 433 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 434 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 435 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 436 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 437 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 438 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 439 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 440 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 441 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 442 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 443 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 444 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 445 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 446 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 447 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 448 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 449 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 450 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 451 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 452 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 453 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 454 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 455 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 456 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 457 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 458 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 459 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 460 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 461 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 462 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 463 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 464 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 465 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 466 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 467 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 468 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 469 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 470 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 471 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 472 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 473 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 474 | 3300053089 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere | Metagenome | Endosphere |
| 475 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 476 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 477 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 478 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 479 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 480 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 481 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 482 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 483 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 484 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 485 | 3300053106 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere | Metagenome | Endosphere |
| 486 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 487 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 488 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 489 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 490 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 491 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 492 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 493 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 494 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 495 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 496 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 497 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 498 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 499 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 500 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 501 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 502 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 503 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 504 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 505 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 506 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 507 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 508 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 509 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 510 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 511 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 512 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 513 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 514 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 515 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 516 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 517 | 3300053725 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere | Metagenome | Endosphere |
| 518 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 519 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 520 | 3300053732 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere | Metagenome | Endosphere |
| 521 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 522 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 523 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 524 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 525 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 526 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 527 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.55 |
| Metatranscriptomes | 0.34 |
| Isolates | 2.11 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 14.95 |
| Nodule | 1.35 |
| Rhizoplane | 4.31 |
| Rhizosphere | 69.76 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.63 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | RicEn_FSXC7958_b1 | 2010549000 | Bacteria | 813 |
| 2 | JGI24743J22301_10011029 | 3300001991 | Bacteria | 1621 |
| 3 | JGI25406J46586_10002869 | 3300003203 | Bacteria | 8121 |
| 4 | JGI25406J46586_10023761 | 3300003203 | Bacteria | 2417 |
| 5 | JGI25153J46596_10005767 | 3300003215 | Bacteria | 6450 |
| 6 | JGI25153J46596_10006684 | 3300003215 | Bacteria | 5797 |
| 7 | JGI25153J46596_10039667 | 3300003215 | Bacteria | 1469 |
| 8 | rootL2_10123755 | 3300003322 | Bacteria | 1852 |
| 9 | rootH1_10291242 | 3300003323 | Bacteria | 1286 |
| 10 | JGI25404J52841_10040049 | 3300003659 | Bacteria | 992 |
| 11 | JGI25404J52841_10049835 | 3300003659 | Bacteria | 881 |
| 12 | JGI25404J52841_10053153 | 3300003659 | Bacteria | 850 |
| 13 | JGI25404J52841_10054410 | 3300003659 | Bacteria | 840 |
| 14 | Ga0055526_1053332 | 3300003771 | Bacteria | 906 |
| 15 | Ga0055524_1037314 | 3300003775 | Bacteria | 1291 |
| 16 | Ga0055531_10009335 | 3300003794 | Bacteria | 5026 |
| 17 | Ga0070658_10087205 | 3300005327 | Bacteria | 2568 |
| 18 | Ga0070683_100517205 | 3300005329 | Bacteria | 1140 |
| 19 | Ga0070690_100456427 | 3300005330 | Bacteria | 948 |
| 20 | Ga0070670_100185219 | 3300005331 | Bacteria | 1808 |
| 21 | Ga0068869_100007229 | 3300005334 | Bacteria | 7077 |
| 22 | Ga0068869_100096279 | 3300005334 | Bacteria | 2234 |
| 23 | Ga0068869_100172023 | 3300005334 | Bacteria | 1692 |
| 24 | Ga0068869_100432435 | 3300005334 | Bacteria | 1088 |
| 25 | Ga0070666_10397492 | 3300005335 | Bacteria | 990 |
| 26 | Ga0070682_100043669 | 3300005337 | Bacteria | 2773 |
| 27 | Ga0068868_100041351 | 3300005338 | Bacteria | 3591 |
| 28 | Ga0068868_100701434 | 3300005338 | Bacteria | 905 |
| 29 | Ga0068868_101118823 | 3300005338 | Bacteria | 725 |
| 30 | Ga0070660_100165420 | 3300005339 | Bacteria | 1784 |
| 31 | Ga0070689_100011394 | 3300005340 | Bacteria | 6368 |
| 32 | Ga0070689_100387082 | 3300005340 | Bacteria | 1180 |
| 33 | Ga0070661_100373491 | 3300005344 | Bacteria | 1123 |
| 34 | Ga0070668_100058386 | 3300005347 | Bacteria | 2984 |
| 35 | Ga0070668_100132950 | 3300005347 | Bacteria | 1998 |
| 36 | Ga0070668_100161292 | 3300005347 | Bacteria | 1819 |
| 37 | Ga0070668_100211531 | 3300005347 | Bacteria | 1595 |
| 38 | Ga0070668_100236330 | 3300005347 | Bacteria | 1512 |
| 39 | Ga0070668_101189192 | 3300005347 | Bacteria | 690 |
| 40 | Ga0070669_100287154 | 3300005353 | Bacteria | 1320 |
| 41 | Ga0070675_100128047 | 3300005354 | Bacteria | 2161 |
| 42 | Ga0070671_100105888 | 3300005355 | Bacteria | 2360 |
| 43 | Ga0070674_100293469 | 3300005356 | Bacteria | 1293 |
| 44 | Ga0070688_100121147 | 3300005365 | Bacteria | 1753 |
| 45 | Ga0070659_100176151 | 3300005366 | Bacteria | 1754 |
| 46 | Ga0070659_100192084 | 3300005366 | Bacteria | 1678 |
| 47 | Ga0070659_100228988 | 3300005366 | Bacteria | 1536 |
| 48 | Ga0070659_101313265 | 3300005366 | Bacteria | 642 |
| 49 | Ga0070667_100145691 | 3300005367 | Bacteria | 2077 |
| 50 | Ga0070667_100541244 | 3300005367 | Bacteria | 1070 |
| 51 | Ga0070714_100044316 | 3300005435 | Bacteria | 3766 |
| 52 | Ga0070714_100098675 | 3300005435 | Bacteria | 2570 |
| 53 | Ga0070714_100271872 | 3300005435 | Bacteria | 1572 |
| 54 | Ga0070714_100529735 | 3300005435 | Bacteria | 1126 |
| 55 | Ga0070713_100003607 | 3300005436 | Bacteria | 10231 |
| 56 | Ga0070713_100360934 | 3300005436 | Bacteria | 1350 |
| 57 | Ga0070713_101071863 | 3300005436 | Bacteria | 778 |
| 58 | Ga0070710_10106555 | 3300005437 | Bacteria | 1677 |
| 59 | Ga0070701_10145770 | 3300005438 | Bacteria | 1359 |
| 60 | Ga0070711_100147899 | 3300005439 | Bacteria | 1768 |
| 61 | Ga0070711_100855728 | 3300005439 | Bacteria | 774 |
| 62 | Ga0070705_100096685 | 3300005440 | Bacteria | 1854 |
| 63 | Ga0070694_100242697 | 3300005444 | Bacteria | 1359 |
| 64 | Ga0070708_100809812 | 3300005445 | Bacteria | 880 |
| 65 | Ga0070708_100998391 | 3300005445 | Bacteria | 785 |
| 66 | Ga0070663_100034961 | 3300005455 | Bacteria | 3483 |
| 67 | Ga0070663_100102625 | 3300005455 | Bacteria | 2137 |
| 68 | Ga0070663_100117649 | 3300005455 | Bacteria | 2004 |
| 69 | Ga0070663_100159673 | 3300005455 | Bacteria | 1734 |
| 70 | Ga0070663_100193574 | 3300005455 | Bacteria | 1584 |
| 71 | Ga0070663_100218136 | 3300005455 | Bacteria | 1496 |
| 72 | Ga0070663_100450437 | 3300005455 | Bacteria | 1061 |
| 73 | Ga0070663_101330521 | 3300005455 | Bacteria | 634 |
| 74 | Ga0070663_101337446 | 3300005455 | Bacteria | 633 |
| 75 | Ga0070678_100024023 | 3300005456 | Bacteria | 4073 |
| 76 | Ga0070678_100120571 | 3300005456 | Bacteria | 2067 |
| 77 | Ga0070678_100121766 | 3300005456 | Bacteria | 2058 |
| 78 | Ga0070678_100228043 | 3300005456 | Bacteria | 1551 |
| 79 | Ga0070678_100600858 | 3300005456 | Bacteria | 982 |
| 80 | Ga0070678_101192585 | 3300005456 | Bacteria | 706 |
| 81 | Ga0070662_100179164 | 3300005457 | Bacteria | 1670 |
| 82 | Ga0070662_100292099 | 3300005457 | Bacteria | 1322 |
| 83 | Ga0070662_100469560 | 3300005457 | Bacteria | 1046 |
| 84 | Ga0070662_100710338 | 3300005457 | Bacteria | 851 |
| 85 | Ga0070681_10009165 | 3300005458 | Bacteria | 9724 |
| 86 | Ga0068867_100812716 | 3300005459 | Bacteria | 835 |
| 87 | Ga0070706_100220654 | 3300005467 | Bacteria | 1770 |
| 88 | Ga0070706_100236911 | 3300005467 | Bacteria | 1704 |
| 89 | Ga0070707_100268855 | 3300005468 | Bacteria | 1658 |
| 90 | Ga0070698_100269806 | 3300005471 | Bacteria | 1633 |
| 91 | Ga0070698_100403203 | 3300005471 | Bacteria | 1301 |
| 92 | Ga0070699_100872038 | 3300005518 | Bacteria | 824 |
| 93 | Ga0070679_100026502 | 3300005530 | Bacteria | 5695 |
| 94 | Ga0070679_100810466 | 3300005530 | Bacteria | 879 |
| 95 | Ga0070697_100165297 | 3300005536 | Bacteria | 1871 |
| 96 | Ga0068853_100064892 | 3300005539 | Bacteria | 3168 |
| 97 | Ga0068853_100323117 | 3300005539 | Bacteria | 1431 |
| 98 | Ga0070672_100350867 | 3300005543 | Bacteria | 1258 |
| 99 | Ga0070672_101161600 | 3300005543 | Bacteria | 687 |
| 100 | Ga0070686_101198616 | 3300005544 | Bacteria | 631 |
| 101 | Ga0070695_100226048 | 3300005545 | Bacteria | 1351 |
| 102 | Ga0070696_100341225 | 3300005546 | Bacteria | 1158 |
| 103 | Ga0070693_100041420 | 3300005547 | Bacteria | 2591 |
| 104 | Ga0070693_100262788 | 3300005547 | Bacteria | 1149 |
| 105 | Ga0070665_100040083 | 3300005548 | Bacteria | 4708 |
| 106 | Ga0070665_100329230 | 3300005548 | Bacteria | 1532 |
| 107 | Ga0070665_100356056 | 3300005548 | Bacteria | 1469 |
| 108 | Ga0070665_100774426 | 3300005548 | Bacteria | 972 |
| 109 | Ga0070665_100821489 | 3300005548 | Bacteria | 942 |
| 110 | Ga0070665_100971484 | 3300005548 | Bacteria | 862 |
| 111 | Ga0070665_101373324 | 3300005548 | Bacteria | 716 |
| 112 | Ga0070704_100579738 | 3300005549 | Bacteria | 983 |
| 113 | Ga0068855_100228274 | 3300005563 | Bacteria | 2086 |
| 114 | Ga0068855_100240424 | 3300005563 | Bacteria | 2024 |
| 115 | Ga0068855_100288298 | 3300005563 | Bacteria | 1821 |
| 116 | Ga0068855_100507450 | 3300005563 | Bacteria | 1310 |
| 117 | Ga0068855_102144244 | 3300005563 | Bacteria | 562 |
| 118 | Ga0070664_100030458 | 3300005564 | Bacteria | 4502 |
| 119 | Ga0070664_100435586 | 3300005564 | Bacteria | 1202 |
| 120 | Ga0070664_100857130 | 3300005564 | Bacteria | 851 |
| 121 | Ga0068857_100362513 | 3300005577 | Bacteria | 1344 |
| 122 | Ga0068854_100176039 | 3300005578 | Bacteria | 1668 |
| 123 | Ga0068856_100100329 | 3300005614 | Bacteria | 2887 |
| 124 | Ga0068856_100180346 | 3300005614 | Bacteria | 2125 |
| 125 | Ga0070702_100142800 | 3300005615 | Bacteria | 1527 |
| 126 | Ga0070702_100243258 | 3300005615 | Bacteria | 1215 |
| 127 | Ga0070702_101042054 | 3300005615 | Bacteria | 650 |
| 128 | Ga0068852_100100189 | 3300005616 | Bacteria | 2613 |
| 129 | Ga0068852_100113120 | 3300005616 | Bacteria | 2471 |
| 130 | Ga0068852_100291117 | 3300005616 | Bacteria | 1578 |
| 131 | Ga0068852_101141851 | 3300005616 | Bacteria | 800 |
| 132 | Ga0068852_101566997 | 3300005616 | Bacteria | 681 |
| 133 | Ga0068859_100083940 | 3300005617 | Bacteria | 3229 |
| 134 | Ga0068859_100246441 | 3300005617 | Bacteria | 1876 |
| 135 | Ga0068859_100310837 | 3300005617 | Bacteria | 1669 |
| 136 | Ga0068859_100531733 | 3300005617 | Bacteria | 1270 |
| 137 | Ga0068864_100082585 | 3300005618 | Bacteria | 2820 |
| 138 | Ga0068864_100097823 | 3300005618 | Bacteria | 2598 |
| 139 | Ga0068864_100321378 | 3300005618 | Bacteria | 1454 |
| 140 | Ga0068861_100057639 | 3300005719 | Bacteria | 2967 |
| 141 | Ga0068861_100130371 | 3300005719 | Bacteria | 2040 |
| 142 | Ga0068861_100131553 | 3300005719 | Bacteria | 2031 |
| 143 | Ga0068861_100191087 | 3300005719 | Bacteria | 1711 |
| 144 | Ga0068861_101020815 | 3300005719 | Bacteria | 791 |
| 145 | Ga0068861_101220952 | 3300005719 | Bacteria | 728 |
| 146 | Ga0068851_10098844 | 3300005834 | Bacteria | 1546 |
| 147 | Ga0068870_10112336 | 3300005840 | Bacteria | 1558 |
| 148 | Ga0068858_100277566 | 3300005842 | Bacteria | 1595 |
| 149 | Ga0068858_100347878 | 3300005842 | Bacteria | 1419 |
| 150 | Ga0068858_100453711 | 3300005842 | Bacteria | 1236 |
| 151 | Ga0068858_100512520 | 3300005842 | Bacteria | 1159 |
| 152 | Ga0068858_101847543 | 3300005842 | Bacteria | 597 |
| 153 | Ga0068860_100000429 | 3300005843 | Bacteria | 53378 |
| 154 | Ga0068860_100249964 | 3300005843 | Bacteria | 1726 |
| 155 | Ga0068860_100289155 | 3300005843 | Bacteria | 1603 |
| 156 | Ga0068862_100066839 | 3300005844 | Bacteria | 3098 |
| 157 | Ga0068862_100196256 | 3300005844 | Bacteria | 1818 |
| 158 | Ga0068862_100326643 | 3300005844 | Bacteria | 1417 |
| 159 | Ga0068862_100772072 | 3300005844 | Bacteria | 936 |
| 160 | Ga0068862_100934006 | 3300005844 | Bacteria | 854 |
| 161 | Ga0068862_101153400 | 3300005844 | Bacteria | 772 |
| 162 | Ga0081455_10003715 | 3300005937 | Bacteria | 17461 |
| 163 | Ga0081455_10017606 | 3300005937 | Bacteria | 6841 |
| 164 | Ga0081455_10027966 | 3300005937 | Bacteria | 5158 |
| 165 | Ga0081455_10041857 | 3300005937 | Bacteria | 4024 |
| 166 | Ga0081455_10072038 | 3300005937 | Bacteria | 2863 |
| 167 | Ga0081455_10217963 | 3300005937 | Bacteria | 1417 |
| 168 | Ga0081455_10403567 | 3300005937 | Bacteria | 948 |
| 169 | Ga0081538_10178129 | 3300005981 | Bacteria | 914 |
| 170 | Ga0081540_1003319 | 3300005983 | Bacteria | 12755 |
| 171 | Ga0081540_1006968 | 3300005983 | Bacteria | 8140 |
| 172 | Ga0081540_1009221 | 3300005983 | Bacteria | 6805 |
| 173 | Ga0081540_1009314 | 3300005983 | Bacteria | 6773 |
| 174 | Ga0081540_1012667 | 3300005983 | Bacteria | 5532 |
| 175 | Ga0081540_1013667 | 3300005983 | Bacteria | 5264 |
| 176 | Ga0081540_1017966 | 3300005983 | Bacteria | 4358 |
| 177 | Ga0081540_1035810 | 3300005983 | Bacteria | 2656 |
| 178 | Ga0081540_1081455 | 3300005983 | Bacteria | 1456 |
| 179 | Ga0081540_1087351 | 3300005983 | Bacteria | 1382 |
| 180 | Ga0081540_1105461 | 3300005983 | Bacteria | 1204 |
| 181 | Ga0081540_1217779 | 3300005983 | Bacteria | 682 |
| 182 | Ga0081539_10000824 | 3300005985 | Bacteria | 59921 |
| 183 | Ga0081539_10001826 | 3300005985 | Bacteria | 33599 |
| 184 | Ga0081539_10056696 | 3300005985 | Bacteria | 2173 |
| 185 | Ga0070717_10000402 | 3300006028 | Bacteria | 27731 |
| 186 | Ga0070717_10952087 | 3300006028 | Bacteria | 782 |
| 187 | Ga0075365_10043534 | 3300006038 | Bacteria | 2939 |
| 188 | Ga0075365_11028005 | 3300006038 | Bacteria | 580 |
| 189 | Ga0075368_10143274 | 3300006042 | Bacteria | 996 |
| 190 | Ga0075363_100088101 | 3300006048 | Bacteria | 1706 |
| 191 | Ga0075364_10084087 | 3300006051 | Bacteria | 2107 |
| 192 | Ga0075364_10190859 | 3300006051 | Bacteria | 1388 |
| 193 | Ga0075364_10251323 | 3300006051 | Bacteria | 1201 |
| 194 | Ga0070715_10047572 | 3300006163 | Bacteria | 1829 |
| 195 | Ga0070716_100144483 | 3300006173 | Bacteria | 1522 |
| 196 | Ga0070712_100087639 | 3300006175 | Bacteria | 2272 |
| 197 | Ga0070712_101374804 | 3300006175 | Bacteria | 616 |
| 198 | Ga0075362_10065841 | 3300006177 | Bacteria | 1646 |
| 199 | Ga0075362_10190338 | 3300006177 | Bacteria | 996 |
| 200 | Ga0075367_10089795 | 3300006178 | Bacteria | 1868 |
| 201 | Ga0075367_10140923 | 3300006178 | Bacteria | 1493 |
| 202 | Ga0075367_10188156 | 3300006178 | Bacteria | 1288 |
| 203 | Ga0075367_10231044 | 3300006178 | Bacteria | 1158 |
| 204 | Ga0075367_10491269 | 3300006178 | Bacteria | 778 |
| 205 | Ga0075369_10026014 | 3300006186 | Bacteria | 2437 |
| 206 | Ga0075369_10119017 | 3300006186 | Bacteria | 1194 |
| 207 | Ga0075366_10076670 | 3300006195 | Bacteria | 1995 |
| 208 | Ga0075366_10397838 | 3300006195 | Bacteria | 848 |
| 209 | Ga0075366_10457933 | 3300006195 | Bacteria | 787 |
| 210 | Ga0097621_100509737 | 3300006237 | Bacteria | 1091 |
| 211 | Ga0075370_10029377 | 3300006353 | Bacteria | 3062 |
| 212 | Ga0075370_10114890 | 3300006353 | Bacteria | 1564 |
| 213 | Ga0075370_10135641 | 3300006353 | Bacteria | 1438 |
| 214 | Ga0075370_10424404 | 3300006353 | Bacteria | 799 |
| 215 | Ga0068871_100048459 | 3300006358 | Bacteria | 3430 |
| 216 | Ga0068871_100508668 | 3300006358 | Bacteria | 1086 |
| 217 | Ga0075428_100105629 | 3300006844 | Bacteria | 3070 |
| 218 | Ga0075430_100882865 | 3300006846 | Bacteria | 737 |
| 219 | Ga0075433_10432025 | 3300006852 | Bacteria | 1161 |
| 220 | Ga0075434_100187512 | 3300006871 | Bacteria | 2089 |
| 221 | Ga0075434_100296278 | 3300006871 | Bacteria | 1637 |
| 222 | Ga0075434_100409718 | 3300006871 | Bacteria | 1377 |
| 223 | Ga0075429_100736317 | 3300006880 | Bacteria | 864 |
| 224 | Ga0068865_101288458 | 3300006881 | Bacteria | 649 |
| 225 | Ga0075436_100942288 | 3300006914 | Bacteria | 647 |
| 226 | Ga0097620_100083940 | 3300006931 | Bacteria | 3229 |
| 227 | Ga0097620_100246428 | 3300006931 | Bacteria | 1876 |
| 228 | Ga0097620_100310853 | 3300006931 | Bacteria | 1669 |
| 229 | Ga0097620_100531750 | 3300006931 | Bacteria | 1270 |
| 230 | Ga0099825_1037135 | 3300006941 | Bacteria | 1632 |
| 231 | Ga0099824_1010736 | 3300006942 | Bacteria | 10647 |
| 232 | Ga0099822_1001873 | 3300006943 | Bacteria | 25386 |
| 233 | Ga0075435_100343491 | 3300007076 | Bacteria | 1279 |
| 234 | Ga0099795_10133883 | 3300007788 | Bacteria | 1002 |
| 235 | Ga0105250_10066410 | 3300009092 | Bacteria | 1455 |
| 236 | Ga0105240_10071970 | 3300009093 | Bacteria | 4274 |
| 237 | Ga0105240_10642011 | 3300009093 | Bacteria | 1164 |
| 238 | Ga0105240_10896524 | 3300009093 | Unclassified | 954 |
| 239 | Ga0111539_10589218 | 3300009094 | Bacteria | 1295 |
| 240 | Ga0105245_10023512 | 3300009098 | Bacteria | 5410 |
| 241 | Ga0105245_10025286 | 3300009098 | Bacteria | 5220 |
| 242 | Ga0105245_10094969 | 3300009098 | Bacteria | 2750 |
| 243 | Ga0105245_10366907 | 3300009098 | Bacteria | 1430 |
| 244 | Ga0105247_10027726 | 3300009101 | Bacteria | 3425 |
| 245 | Ga0105247_10108918 | 3300009101 | Bacteria | 1780 |
| 246 | Ga0114129_11383353 | 3300009147 | Bacteria | 869 |
| 247 | Ga0105241_10032187 | 3300009174 | Bacteria | 3930 |
| 248 | Ga0105241_10184354 | 3300009174 | Bacteria | 1733 |
| 249 | Ga0105241_10706151 | 3300009174 | Bacteria | 921 |
| 250 | Ga0105242_10424705 | 3300009176 | Bacteria | 1246 |
| 251 | Ga0105242_10543040 | 3300009176 | Bacteria | 1113 |
| 252 | Ga0105248_10251511 | 3300009177 | Bacteria | 1989 |
| 253 | Ga0105237_10027608 | 3300009545 | Bacteria | 5792 |
| 254 | Ga0105237_10130645 | 3300009545 | Bacteria | 2506 |
| 255 | Ga0105237_10465608 | 3300009545 | Bacteria | 1270 |
| 256 | Ga0105237_11212590 | 3300009545 | Bacteria | 761 |
| 257 | Ga0105238_10247715 | 3300009551 | Bacteria | 1760 |
| 258 | Ga0105238_10286808 | 3300009551 | Bacteria | 1628 |
| 259 | Ga0105238_10548911 | 3300009551 | Bacteria | 1160 |
| 260 | Ga0105249_10759582 | 3300009553 | Bacteria | 1032 |
| 261 | Ga0099796_10366968 | 3300010159 | Bacteria | 624 |
| 262 | Ga0105239_10123545 | 3300010375 | Bacteria | 2876 |
| 263 | Ga0105239_10124134 | 3300010375 | Bacteria | 2869 |
| 264 | Ga0105239_10211103 | 3300010375 | Bacteria | 2176 |
| 265 | Ga0105239_10580837 | 3300010375 | Bacteria | 1277 |
| 266 | Ga0105239_10811210 | 3300010375 | Bacteria | 1072 |
| 267 | Ga0105239_10908722 | 3300010375 | Bacteria | 1011 |
| 268 | Ga0105239_10929289 | 3300010375 | Bacteria | 999 |
| 269 | Ga0105239_11092929 | 3300010375 | Bacteria | 918 |
| 270 | Ga0105246_10139869 | 3300011119 | Bacteria | 1819 |
| 271 | Ga0105246_10194118 | 3300011119 | Bacteria | 1574 |
| 272 | Ga0105246_11380111 | 3300011119 | Bacteria | 656 |
| 273 | Ga0157373_10183735 | 3300013100 | Bacteria | 1473 |
| 274 | Ga0157371_10063398 | 3300013102 | Bacteria | 2620 |
| 275 | Ga0157370_10077272 | 3300013104 | Bacteria | 3136 |
| 276 | Ga0157369_10188588 | 3300013105 | Bacteria | 2167 |
| 277 | Ga0157369_10783463 | 3300013105 | Bacteria | 980 |
| 278 | Ga0157374_10012040 | 3300013296 | Bacteria | 7511 |
| 279 | Ga0157374_10226810 | 3300013296 | Bacteria | 1835 |
| 280 | Ga0157378_10306046 | 3300013297 | Bacteria | 1540 |
| 281 | Ga0157378_10562693 | 3300013297 | Bacteria | 1147 |
| 282 | Ga0157378_10681486 | 3300013297 | Bacteria | 1046 |
| 283 | Ga0163162_10060464 | 3300013306 | Bacteria | 3824 |
| 284 | Ga0163162_10302734 | 3300013306 | Bacteria | 1731 |
| 285 | Ga0157372_10289691 | 3300013307 | Bacteria | 1904 |
| 286 | Ga0157372_10599113 | 3300013307 | Bacteria | 1284 |
| 287 | Ga0157372_10630473 | 3300013307 | Bacteria | 1249 |
| 288 | Ga0157372_13102837 | 3300013307 | Bacteria | 530 |
| 289 | Ga0157375_10026110 | 3300013308 | Bacteria | 5439 |
| 290 | Ga0157375_10206529 | 3300013308 | Bacteria | 2121 |
| 291 | Ga0157375_10320089 | 3300013308 | Bacteria | 1716 |
| 292 | Ga0157375_10464493 | 3300013308 | Bacteria | 1431 |
| 293 | Ga0163163_10116559 | 3300014325 | Bacteria | 2702 |
| 294 | Ga0163163_11333883 | 3300014325 | Bacteria | 779 |
| 295 | Ga0157380_10229183 | 3300014326 | Bacteria | 1667 |
| 296 | Ga0157380_10593340 | 3300014326 | Bacteria | 1094 |
| 297 | Ga0157377_10041917 | 3300014745 | Bacteria | 2541 |
| 298 | Ga0157379_11236216 | 3300014968 | Bacteria | 719 |
| 299 | Ga0157376_10113354 | 3300014969 | Bacteria | 2391 |
| 300 | Ga0157376_10449305 | 3300014969 | Bacteria | 1257 |
| 301 | Ga0157376_10659751 | 3300014969 | Bacteria | 1047 |
| 302 | Ga0163161_10125502 | 3300017792 | Bacteria | 1932 |
| 303 | Ga0163161_10260454 | 3300017792 | Bacteria | 1354 |
| 304 | Ga0163161_10811286 | 3300017792 | Bacteria | 787 |
| 305 | Ga0213872_10107938 | 3300021361 | Bacteria | 1237 |
| 306 | Ga0213876_10110668 | 3300021384 | Bacteria | 1458 |
| 307 | Ga0213876_10460959 | 3300021384 | Bacteria | 676 |
| 308 | Ga0213871_10037190 | 3300021441 | Bacteria | 1294 |
| 309 | Ga0224712_10181980 | 3300022467 | Bacteria | 947 |
| 310 | Ga0228600_1013447 | 3300024123 | Bacteria | 651 |
| 311 | Ga0228598_1004809 | 3300024227 | Bacteria | 2853 |
| 312 | Ga0207425_1035486 | 3300025245 | Bacteria | 973 |
| 313 | Ga0209677_106670 | 3300025253 | Bacteria | 2671 |
| 314 | Ga0209148_1005310 | 3300025254 | Bacteria | 2980 |
| 315 | Ga0209233_1004579 | 3300025261 | Bacteria | 4684 |
| 316 | Ga0209455_1002894 | 3300025272 | Bacteria | 6337 |
| 317 | Ga0209455_1008301 | 3300025272 | Bacteria | 2834 |
| 318 | Ga0209673_1054401 | 3300025273 | Bacteria | 1037 |
| 319 | Ga0209564_1000401 | 3300025295 | Bacteria | 76992 |
| 320 | Ga0209564_1022120 | 3300025295 | Bacteria | 2258 |
| 321 | Ga0209758_1000011 | 3300025297 | Bacteria | 1049685 |
| 322 | Ga0209758_1001959 | 3300025297 | Bacteria | 22262 |
| 323 | Ga0209758_1002046 | 3300025297 | Bacteria | 21630 |
| 324 | Ga0209758_1050262 | 3300025297 | Bacteria | 1463 |
| 325 | Ga0209256_1005722 | 3300025299 | Bacteria | 6972 |
| 326 | Ga0209257_1000620 | 3300025304 | Bacteria | 57327 |
| 327 | Ga0209257_1000729 | 3300025304 | Bacteria | 49815 |
| 328 | Ga0209257_1001767 | 3300025304 | Bacteria | 23946 |
| 329 | Ga0207696_1036714 | 3300025711 | Bacteria | 1454 |
| 330 | Ga0207692_10111818 | 3300025898 | Bacteria | 1516 |
| 331 | Ga0207642_10111716 | 3300025899 | Bacteria | 1393 |
| 332 | Ga0207710_10200352 | 3300025900 | Bacteria | 986 |
| 333 | Ga0207688_10039440 | 3300025901 | Bacteria | 2623 |
| 334 | Ga0207647_10177088 | 3300025904 | Bacteria | 1240 |
| 335 | Ga0207699_10009649 | 3300025906 | Bacteria | 4816 |
| 336 | Ga0207699_10268459 | 3300025906 | Bacteria | 1182 |
| 337 | Ga0207699_10281422 | 3300025906 | Bacteria | 1156 |
| 338 | Ga0207699_10853197 | 3300025906 | Bacteria | 671 |
| 339 | Ga0207645_10119589 | 3300025907 | Bacteria | 1709 |
| 340 | Ga0207643_10082378 | 3300025908 | Bacteria | 1865 |
| 341 | Ga0207705_10525374 | 3300025909 | Bacteria | 920 |
| 342 | Ga0207684_10058728 | 3300025910 | Bacteria | 3265 |
| 343 | Ga0207684_10458146 | 3300025910 | Bacteria | 1095 |
| 344 | Ga0207654_10077674 | 3300025911 | Bacteria | 1991 |
| 345 | Ga0207654_10574180 | 3300025911 | Bacteria | 803 |
| 346 | Ga0207707_10000404 | 3300025912 | Bacteria | 45123 |
| 347 | Ga0207695_10325908 | 3300025913 | Bacteria | 1425 |
| 348 | Ga0207671_10126577 | 3300025914 | Bacteria | 1958 |
| 349 | Ga0207693_10131046 | 3300025915 | Bacteria | 1971 |
| 350 | Ga0207693_10154979 | 3300025915 | Bacteria | 1802 |
| 351 | Ga0207663_10085506 | 3300025916 | Bacteria | 2077 |
| 352 | Ga0207663_10745323 | 3300025916 | Bacteria | 778 |
| 353 | Ga0207660_10136755 | 3300025917 | Bacteria | 1870 |
| 354 | Ga0207657_10116195 | 3300025919 | Bacteria | 2205 |
| 355 | Ga0207649_10489154 | 3300025920 | Bacteria | 934 |
| 356 | Ga0207652_10493807 | 3300025921 | Bacteria | 1102 |
| 357 | Ga0207646_11313267 | 3300025922 | Bacteria | 631 |
| 358 | Ga0207694_10039513 | 3300025924 | Bacteria | 3631 |
| 359 | Ga0207694_10251664 | 3300025924 | Bacteria | 1446 |
| 360 | Ga0207694_10985498 | 3300025924 | Bacteria | 713 |
| 361 | Ga0207650_10054101 | 3300025925 | Bacteria | 2976 |
| 362 | Ga0207650_10191098 | 3300025925 | Bacteria | 1636 |
| 363 | Ga0207659_10280081 | 3300025926 | Bacteria | 1363 |
| 364 | Ga0207687_10012593 | 3300025927 | Bacteria | 5525 |
| 365 | Ga0207687_10013063 | 3300025927 | Bacteria | 5426 |
| 366 | Ga0207687_10185994 | 3300025927 | Bacteria | 1613 |
| 367 | Ga0207687_10354794 | 3300025927 | Bacteria | 1195 |
| 368 | Ga0207687_10905155 | 3300025927 | Bacteria | 755 |
| 369 | Ga0207700_10090898 | 3300025928 | Bacteria | 2410 |
| 370 | Ga0207700_10387267 | 3300025928 | Bacteria | 1223 |
| 371 | Ga0207700_10635373 | 3300025928 | Bacteria | 951 |
| 372 | Ga0207700_10850060 | 3300025928 | Bacteria | 816 |
| 373 | Ga0207664_10027721 | 3300025929 | Bacteria | 4299 |
| 374 | Ga0207664_10159219 | 3300025929 | Bacteria | 1924 |
| 375 | Ga0207664_10325808 | 3300025929 | Bacteria | 1356 |
| 376 | Ga0207664_10525304 | 3300025929 | Bacteria | 1061 |
| 377 | Ga0207664_10688085 | 3300025929 | Bacteria | 920 |
| 378 | Ga0207644_10006424 | 3300025931 | Bacteria | 7661 |
| 379 | Ga0207644_10421888 | 3300025931 | Bacteria | 1093 |
| 380 | Ga0207690_10062525 | 3300025932 | Bacteria | 2535 |
| 381 | Ga0207690_10192603 | 3300025932 | Bacteria | 1543 |
| 382 | Ga0207690_10220162 | 3300025932 | Bacteria | 1452 |
| 383 | Ga0207690_10663833 | 3300025932 | Bacteria | 855 |
| 384 | Ga0207706_10080875 | 3300025933 | Bacteria | 2856 |
| 385 | Ga0207706_10125365 | 3300025933 | Bacteria | 2259 |
| 386 | Ga0207706_10136274 | 3300025933 | Bacteria | 2160 |
| 387 | Ga0207706_10376636 | 3300025933 | Bacteria | 1232 |
| 388 | Ga0207706_10676698 | 3300025933 | Bacteria | 883 |
| 389 | Ga0207706_11030939 | 3300025933 | Bacteria | 690 |
| 390 | Ga0207709_10511112 | 3300025935 | Bacteria | 939 |
| 391 | Ga0207670_10037132 | 3300025936 | Bacteria | 3173 |
| 392 | Ga0207670_10934202 | 3300025936 | Bacteria | 728 |
| 393 | Ga0207665_10132626 | 3300025939 | Bacteria | 1770 |
| 394 | Ga0207665_11032809 | 3300025939 | Bacteria | 654 |
| 395 | Ga0207691_11333352 | 3300025940 | Bacteria | 592 |
| 396 | Ga0207689_10072170 | 3300025942 | Bacteria | 2836 |
| 397 | Ga0207689_10136519 | 3300025942 | Bacteria | 2020 |
| 398 | Ga0207679_10054988 | 3300025945 | Bacteria | 2933 |
| 399 | Ga0207679_10245220 | 3300025945 | Bacteria | 1520 |
| 400 | Ga0207679_10425123 | 3300025945 | Bacteria | 1173 |
| 401 | Ga0207667_10526987 | 3300025949 | Bacteria | 1196 |
| 402 | Ga0207668_10021291 | 3300025972 | Bacteria | 4133 |
| 403 | Ga0207668_10388625 | 3300025972 | Bacteria | 1176 |
| 404 | Ga0207668_11124563 | 3300025972 | Bacteria | 704 |
| 405 | Ga0207640_10142912 | 3300025981 | Bacteria | 1747 |
| 406 | Ga0207640_10317412 | 3300025981 | Bacteria | 1239 |
| 407 | Ga0207640_10777567 | 3300025981 | Bacteria | 827 |
| 408 | Ga0207640_10815082 | 3300025981 | Bacteria | 810 |
| 409 | Ga0207658_10129014 | 3300025986 | Bacteria | 2029 |
| 410 | Ga0207658_10237544 | 3300025986 | Bacteria | 1542 |
| 411 | Ga0207703_10060810 | 3300026035 | Bacteria | 3090 |
| 412 | Ga0207703_10206516 | 3300026035 | Bacteria | 1748 |
| 413 | Ga0207703_10232504 | 3300026035 | Bacteria | 1653 |
| 414 | Ga0207703_10370247 | 3300026035 | Bacteria | 1323 |
| 415 | Ga0207678_10007944 | 3300026067 | Bacteria | 9359 |
| 416 | Ga0207678_10032510 | 3300026067 | Bacteria | 4546 |
| 417 | Ga0207678_10100203 | 3300026067 | Bacteria | 2475 |
| 418 | Ga0207678_10238907 | 3300026067 | Bacteria | 1556 |
| 419 | Ga0207678_10249150 | 3300026067 | Bacteria | 1521 |
| 420 | Ga0207678_10424251 | 3300026067 | Bacteria | 1153 |
| 421 | Ga0207678_10534297 | 3300026067 | Bacteria | 1024 |
| 422 | Ga0207678_10593999 | 3300026067 | Bacteria | 970 |
| 423 | Ga0207678_11054754 | 3300026067 | Bacteria | 720 |
| 424 | Ga0207708_10127239 | 3300026075 | Bacteria | 1989 |
| 425 | Ga0207702_10112696 | 3300026078 | Bacteria | 2421 |
| 426 | Ga0207702_10271195 | 3300026078 | Bacteria | 1601 |
| 427 | Ga0207641_10063006 | 3300026088 | Bacteria | 3166 |
| 428 | Ga0207641_11279738 | 3300026088 | Bacteria | 734 |
| 429 | Ga0207648_10019660 | 3300026089 | Bacteria | 6095 |
| 430 | Ga0207648_10215453 | 3300026089 | Bacteria | 1705 |
| 431 | Ga0207676_10112890 | 3300026095 | Bacteria | 2277 |
| 432 | Ga0207676_10361949 | 3300026095 | Bacteria | 1345 |
| 433 | Ga0207676_10410117 | 3300026095 | Bacteria | 1268 |
| 434 | Ga0207676_10527987 | 3300026095 | Bacteria | 1124 |
| 435 | Ga0207674_10111629 | 3300026116 | Bacteria | 2708 |
| 436 | Ga0207674_10265186 | 3300026116 | Bacteria | 1665 |
| 437 | Ga0207674_10942005 | 3300026116 | Bacteria | 832 |
| 438 | Ga0207675_100057494 | 3300026118 | Bacteria | 3629 |
| 439 | Ga0207675_100062997 | 3300026118 | Bacteria | 3465 |
| 440 | Ga0207675_100069301 | 3300026118 | Bacteria | 3296 |
| 441 | Ga0207675_100105190 | 3300026118 | Bacteria | 2660 |
| 442 | Ga0207675_100200406 | 3300026118 | Bacteria | 1917 |
| 443 | Ga0207675_100318308 | 3300026118 | Bacteria | 1518 |
| 444 | Ga0207683_10049361 | 3300026121 | Bacteria | 3684 |
| 445 | Ga0207683_11006598 | 3300026121 | Bacteria | 773 |
| 446 | Ga0207698_10295555 | 3300026142 | Bacteria | 1505 |
| 447 | Ga0207698_12381597 | 3300026142 | Bacteria | 541 |
| 448 | Ga0209589_1000001 | 3300027357 | Bacteria | 794224 |
| 449 | Ga0209489_100001 | 3300027361 | Bacteria | 794224 |
| 450 | Ga0209700_100001 | 3300027363 | Bacteria | 794224 |
| 451 | Ga0209813_10041706 | 3300027866 | Bacteria | 1400 |
| 452 | Ga0207428_10235629 | 3300027907 | Bacteria | 1369 |
| 453 | Ga0268266_10053456 | 3300028379 | Bacteria | 3470 |
| 454 | Ga0268266_10174815 | 3300028379 | Bacteria | 1951 |
| 455 | Ga0268266_10293753 | 3300028379 | Bacteria | 1514 |
| 456 | Ga0268266_10348365 | 3300028379 | Bacteria | 1391 |
| 457 | Ga0268266_10403373 | 3300028379 | Bacteria | 1293 |
| 458 | Ga0268266_10522194 | 3300028379 | Bacteria | 1135 |
| 459 | Ga0268266_11135391 | 3300028379 | Bacteria | 756 |
| 460 | Ga0268266_11339074 | 3300028379 | Bacteria | 691 |
| 461 | Ga0268265_10065954 | 3300028380 | Bacteria | 2796 |
| 462 | Ga0268265_10466837 | 3300028380 | Bacteria | 1182 |
| 463 | Ga0268265_10840534 | 3300028380 | Bacteria | 897 |
| 464 | Ga0268265_10967213 | 3300028380 | Bacteria | 839 |
| 465 | Ga0268264_10000048 | 3300028381 | Bacteria | 334457 |
| 466 | Ga0268264_10105922 | 3300028381 | Bacteria | 2454 |
| 467 | Ga0268264_10228119 | 3300028381 | Bacteria | 1718 |
| 468 | Ga0268264_10758289 | 3300028381 | Bacteria | 967 |
| 469 | Ga0265337_1014325 | 3300028556 | Bacteria | 2631 |
| 470 | Ga0265318_10055792 | 3300028577 | Bacteria | 1478 |
| 471 | Ga0265336_10002023 | 3300028666 | Bacteria | 8653 |
| 472 | Ga0307517_10401190 | 3300028786 | Bacteria | 726 |
| 473 | Ga0307517_10516633 | 3300028786 | Bacteria | 604 |
| 474 | Ga0307515_10055742 | 3300028794 | Bacteria | 5765 |
| 475 | Ga0307515_10251366 | 3300028794 | Bacteria | 1520 |
| 476 | Ga0265338_10000034 | 3300028800 | Bacteria | 244623 |
| 477 | Ga0265324_10008520 | 3300029957 | Bacteria | 4070 |
| 478 | Ga0307511_10259389 | 3300030521 | Bacteria | 826 |
| 479 | Ga0265332_10001463 | 3300031238 | Bacteria | 13211 |
| 480 | Ga0265332_10020911 | 3300031238 | Bacteria | 2890 |
| 481 | Ga0265332_10026357 | 3300031238 | Bacteria | 2550 |
| 482 | Ga0265332_10104590 | 3300031238 | Bacteria | 1194 |
| 483 | Ga0265328_10000257 | 3300031239 | Bacteria | 24470 |
| 484 | Ga0265328_10107591 | 3300031239 | Bacteria | 1035 |
| 485 | Ga0265325_10055816 | 3300031241 | Bacteria | 2018 |
| 486 | Ga0265340_10001613 | 3300031247 | Bacteria | 12952 |
| 487 | Ga0265340_10486088 | 3300031247 | Bacteria | 543 |
| 488 | Ga0265339_10094694 | 3300031249 | Bacteria | 1561 |
| 489 | Ga0265339_10101408 | 3300031249 | Bacteria | 1497 |
| 490 | Ga0265331_10125071 | 3300031250 | Bacteria | 1175 |
| 491 | Ga0265327_10057949 | 3300031251 | Bacteria | 1990 |
| 492 | Ga0265316_10202469 | 3300031344 | Bacteria | 1471 |
| 493 | Ga0265316_10438173 | 3300031344 | Bacteria | 938 |
| 494 | Ga0265316_10847007 | 3300031344 | Bacteria | 640 |
| 495 | Ga0307513_10124063 | 3300031456 | Bacteria | 2543 |
| 496 | Ga0307513_10257000 | 3300031456 | Bacteria | 1539 |
| 497 | Ga0307509_10004515 | 3300031507 | Bacteria | 20009 |
| 498 | Ga0307509_10083761 | 3300031507 | Bacteria | 3286 |
| 499 | Ga0307509_10242489 | 3300031507 | Bacteria | 1593 |
| 500 | Ga0307509_10468063 | 3300031507 | Bacteria | 951 |
| 501 | Ga0307408_100468626 | 3300031548 | Bacteria | 1096 |
| 502 | Ga0265313_10206662 | 3300031595 | Bacteria | 815 |
| 503 | Ga0265313_10215668 | 3300031595 | Bacteria | 793 |
| 504 | Ga0307508_10124432 | 3300031616 | Bacteria | 2181 |
| 505 | Ga0307508_10350129 | 3300031616 | Bacteria | 1068 |
| 506 | Ga0316579_10330007 | 3300031691 | Bacteria | 738 |
| 507 | Ga0265314_10003438 | 3300031711 | Bacteria | 15304 |
| 508 | Ga0265314_10055608 | 3300031711 | Bacteria | 2730 |
| 509 | Ga0265314_10142572 | 3300031711 | Bacteria | 1479 |
| 510 | Ga0265342_10000039 | 3300031712 | Bacteria | 140091 |
| 511 | Ga0265342_10007997 | 3300031712 | Bacteria | 7657 |
| 512 | Ga0265342_10201252 | 3300031712 | Bacteria | 1082 |
| 513 | Ga0307516_10010023 | 3300031730 | Bacteria | 10487 |
| 514 | Ga0307516_10183347 | 3300031730 | Bacteria | 1825 |
| 515 | Ga0307516_10382672 | 3300031730 | Bacteria | 1068 |
| 516 | Ga0307412_10169904 | 3300031911 | Bacteria | 1629 |
| 517 | Ga0307412_10235461 | 3300031911 | Bacteria | 1413 |
| 518 | Ga0307409_100056209 | 3300031995 | Bacteria | 3042 |
| 519 | Ga0307409_100633657 | 3300031995 | Bacteria | 1061 |
| 520 | Ga0307416_100350332 | 3300032002 | Bacteria | 1494 |
| 521 | Ga0307416_100377813 | 3300032002 | Bacteria | 1446 |
| 522 | Ga0307507_10043168 | 3300033179 | Bacteria | 4479 |
| 523 | Ga0307510_10006198 | 3300033180 | Bacteria | 14263 |
| 524 | Ga0307510_10140057 | 3300033180 | Bacteria | 2065 |
| 525 | Ga0307510_10230653 | 3300033180 | Bacteria | 1354 |
| 526 | Ga0315911_1000002 | 3300033442 | Bacteria | 926833 |
| 527 | Ga0373926_0392280 | 3300035083 | Bacteria | 548 |
| 528 | Ga0373934_0059481 | 3300035086 | Bacteria | 1521 |
| 529 | Ga0373944_0012406 | 3300035089 | Bacteria | 2348 |
| 530 | Ga0373944_0124754 | 3300035089 | Bacteria | 890 |
| 531 | Ga0373923_0005649 | 3300035111 | Bacteria | 4261 |
| 532 | Ga0373923_0052257 | 3300035111 | Bacteria | 1716 |
| 533 | Ga0373932_0256459 | 3300035112 | Bacteria | 640 |
| 534 | Ga0373936_0003425 | 3300035113 | Bacteria | 5946 |
| 535 | Ga0373936_0020001 | 3300035113 | Bacteria | 2597 |
| 536 | Ga0373936_0079192 | 3300035113 | Bacteria | 1365 |
| 537 | Ga0373939_0093342 | 3300035114 | Bacteria | 1021 |
| 538 | Ga0373941_0074741 | 3300035115 | Bacteria | 1133 |
| 539 | Ga0373945_0023360 | 3300035116 | Bacteria | 2135 |
| 540 | Ga0373945_0050258 | 3300035116 | Bacteria | 1532 |
| 541 | Ga0373953_0002986 | 3300035117 | Bacteria | 5176 |
| 542 | Ga0373953_0046725 | 3300035117 | Bacteria | 1739 |
| 543 | Ga0373953_0192179 | 3300035117 | Bacteria | 882 |
| 544 | Ga0373954_0004607 | 3300035118 | Bacteria | 5942 |
| 545 | Ga0373954_0037670 | 3300035118 | Bacteria | 2248 |
| 546 | Ga0373954_0142179 | 3300035118 | Bacteria | 1171 |
| 547 | Ga0373956_0004560 | 3300035119 | Bacteria | 5530 |
| 548 | Ga0373956_0107716 | 3300035119 | Bacteria | 1296 |
| 549 | Ga0373957_0034710 | 3300035120 | Bacteria | 1870 |
| 550 | Ga0373943_0002891 | 3300035170 | Bacteria | 7796 |
| 551 | Ga0373943_0153100 | 3300035170 | Bacteria | 1250 |
| 552 | Ga0373943_0306457 | 3300035170 | Bacteria | 903 |
| 553 | Ga0373946_0011102 | 3300035171 | Bacteria | 3351 |
| 554 | Ga0373946_0022449 | 3300035171 | Bacteria | 2456 |
| 555 | Ga0373955_0003145 | 3300035172 | Bacteria | 7221 |
| 556 | Ga0373955_0018293 | 3300035172 | Bacteria | 3483 |
| 557 | Ga0373955_0019988 | 3300035172 | Bacteria | 3358 |
| 558 | Ga0373924_0057151 | 3300035410 | Bacteria | 1626 |
| 559 | Ga0373935_0001059 | 3300035692 | Bacteria | 14992 |
| 560 | Ga0373935_0101957 | 3300035692 | Bacteria | 1893 |
| 561 | Ga0373935_0103761 | 3300035692 | Bacteria | 1878 |
| 562 | Ga0373935_0712163 | 3300035692 | Bacteria | 738 |
| 563 | Ga0373927_0000456 | 3300035695 | Bacteria | 31301 |
| 564 | Ga0373927_0089176 | 3300035695 | Bacteria | 2002 |
| 565 | Ga0373927_0264690 | 3300035695 | Bacteria | 1131 |
| 566 | Ga0373933_0015188 | 3300035724 | Bacteria | 4292 |
| 567 | Ga0373933_0038486 | 3300035724 | Bacteria | 2810 |
| 568 | Ga0373933_0128241 | 3300035724 | Bacteria | 1593 |
| 569 | Ga0373933_0262592 | 3300035724 | Bacteria | 1113 |
| 570 | Ga0373933_0685728 | 3300035724 | Bacteria | 674 |
| 571 | Ga0373947_0002829 | 3300035725 | Bacteria | 10356 |
| 572 | Ga0373947_0051973 | 3300035725 | Bacteria | 2467 |
| 573 | Ga0373947_0060569 | 3300035725 | Bacteria | 2299 |
| 574 | Ga0373947_0887615 | 3300035725 | Bacteria | 609 |
| 575 | Ga0373937_0311338 | 3300036401 | Bacteria | 1489 |
| 576 | Ga0373937_0321385 | 3300036401 | Bacteria | 1464 |
| 577 | Ga0373937_0608242 | 3300036401 | Bacteria | 1037 |
| 578 | Ga0310112_048466 | 3300036458 | Bacteria | 576 |
| 579 | Ga0372808_007737 | 3300036459 | Bacteria | 1475 |
| 580 | Ga0372808_012541 | 3300036459 | Bacteria | 1203 |
| 581 | Ga0373925_0044802 | 3300037068 | Bacteria | 3285 |
| 582 | Ga0373925_0095058 | 3300037068 | Bacteria | 2282 |
| 583 | Ga0373925_0112212 | 3300037068 | Bacteria | 2107 |
| 584 | Ga0373925_0693607 | 3300037068 | Bacteria | 839 |
| 585 | Ga0395899_0441481 | 3300037312 | Bacteria | 854 |
| 586 | Ga0395900_0062919 | 3300037418 | Bacteria | 3814 |
| 587 | Ga0395898_0037505 | 3300037466 | Bacteria | 4807 |
| 588 | Ga0395898_0209258 | 3300037466 | Bacteria | 1861 |
| 589 | Ga0436364_0169791 | 3300037853 | Bacteria | 1599 |
| 590 | Ga0436364_1233393 | 3300037853 | Bacteria | 1490 |
| 591 | Ga0436364_1554191 | 3300037853 | Bacteria | 594 |
| 592 | Ga0395901_1523453 | 3300038443 | Bacteria | 624 |
| 593 | Ga0436365_0191780 | 3300039437 | Bacteria | 3907 |
| 594 | Ga0436365_0251377 | 3300039437 | Bacteria | 2455 |
| 595 | Ga0436365_0393739 | 3300039437 | Bacteria | 765 |
| 596 | Ga0436365_1908037 | 3300039437 | Bacteria | 2107 |
| 597 | Ga0436361_1005768 | 3300039447 | Bacteria | 1128 |
| 598 | Ga0436361_1008940 | 3300039447 | Bacteria | 2288 |
| 599 | Ga0436363_1267832 | 3300039450 | Bacteria | 725 |
| 600 | Ga0436362_0190408 | 3300039453 | Bacteria | 505 |
| 601 | Ga0451802_0888262 | 3300041460 | Bacteria | 1335 |
| 602 | Ga0451839_1007315 | 3300041496 | Bacteria | 994 |
| 603 | Ga0451851_0273039 | 3300041507 | Bacteria | 582 |
| 604 | Ga0451853_2445747 | 3300041512 | Bacteria | 1196 |
| 605 | Ga0439445_0157835 | 3300042004 | Bacteria | 662 |
| 606 | Ga0466969_0057497 | 3300044656 | Bacteria | 1896 |
| 607 | Ga0466969_0178772 | 3300044656 | Bacteria | 971 |
| 608 | Ga0466972_0030619 | 3300044658 | Bacteria | 2648 |
| 609 | Ga0466965_0403188 | 3300044683 | Bacteria | 756 |
| 610 | Ga0466965_0684660 | 3300044683 | Bacteria | 587 |
| 611 | Ga0466963_0247985 | 3300044694 | Bacteria | 1249 |
| 612 | Ga0466968_0016849 | 3300044735 | Bacteria | 2913 |
| 613 | Ga0466970_0069207 | 3300044765 | Bacteria | 1897 |
| 614 | Ga0466957_0143835 | 3300044842 | Bacteria | 1538 |
| 615 | Ga0466957_0187965 | 3300044842 | Bacteria | 1352 |
| 616 | Ga0466960_0009101 | 3300044901 | Bacteria | 4085 |
| 617 | Ga0466959_0093872 | 3300045049 | Bacteria | 2153 |
| 618 | Ga0466959_0440227 | 3300045049 | Bacteria | 884 |
| 619 | Ga0466958_0159600 | 3300045836 | Bacteria | 1424 |
| 620 | Ga0466967_0140209 | 3300045976 | Bacteria | 2251 |
| 621 | Ga0466967_0458301 | 3300045976 | Bacteria | 1247 |
| 622 | Ga0495617_026835 | 3300046452 | Bacteria | 1939 |
| 623 | Ga0495592_0012321 | 3300046454 | Bacteria | 6494 |
| 624 | Ga0495592_0050196 | 3300046454 | Bacteria | 3100 |
| 625 | Ga0495592_0061168 | 3300046454 | Bacteria | 2768 |
| 626 | Ga0495592_0143345 | 3300046454 | Bacteria | 1659 |
| 627 | Ga0495603_0000468 | 3300046455 | Bacteria | 22214 |
| 628 | Ga0495603_0033212 | 3300046455 | Bacteria | 3105 |
| 629 | Ga0495603_0130525 | 3300046455 | Bacteria | 1463 |
| 630 | Ga0495603_0177669 | 3300046455 | Bacteria | 1232 |
| 631 | Ga0495603_0235706 | 3300046455 | Bacteria | 1055 |
| 632 | Ga0495590_0051207 | 3300046457 | Bacteria | 1442 |
| 633 | Ga0495590_0053608 | 3300046457 | Bacteria | 1408 |
| 634 | Ga0495591_090943 | 3300046458 | Bacteria | 766 |
| 635 | Ga0495629_0000244 | 3300046459 | Bacteria | 47424 |
| 636 | Ga0495629_0002029 | 3300046459 | Bacteria | 15740 |
| 637 | Ga0495629_0256266 | 3300046459 | Bacteria | 1203 |
| 638 | Ga0495629_0395399 | 3300046459 | Bacteria | 940 |
| 639 | Ga0495638_0006759 | 3300046460 | Bacteria | 8304 |
| 640 | Ga0495638_0023696 | 3300046460 | Bacteria | 4010 |
| 641 | Ga0495638_0099406 | 3300046460 | Bacteria | 1741 |
| 642 | Ga0495638_0114000 | 3300046460 | Bacteria | 1603 |
| 643 | Ga0495638_0620069 | 3300046460 | Bacteria | 529 |
| 644 | Ga0495641_0005414 | 3300046461 | Bacteria | 8632 |
| 645 | Ga0495641_0080026 | 3300046461 | Bacteria | 1464 |
| 646 | Ga0495651_0339234 | 3300046462 | Bacteria | 996 |
| 647 | Ga0495653_0048844 | 3300046463 | Bacteria | 3263 |
| 648 | Ga0495653_0062538 | 3300046463 | Bacteria | 2812 |
| 649 | Ga0495580_0002784 | 3300046472 | Bacteria | 15056 |
| 650 | Ga0495580_0022608 | 3300046472 | Bacteria | 4625 |
| 651 | Ga0495582_0000986 | 3300046473 | Bacteria | 15936 |
| 652 | Ga0495582_0283876 | 3300046473 | Bacteria | 951 |
| 653 | Ga0495605_0069318 | 3300046474 | Bacteria | 1670 |
| 654 | Ga0495639_0000015 | 3300046475 | Bacteria | 80742 |
| 655 | Ga0495639_0046128 | 3300046475 | Bacteria | 1972 |
| 656 | Ga0495639_0203940 | 3300046475 | Bacteria | 969 |
| 657 | Ga0495639_0424590 | 3300046475 | Bacteria | 673 |
| 658 | Ga0495662_0004296 | 3300046476 | Bacteria | 7158 |
| 659 | Ga0495664_0006408 | 3300046477 | Bacteria | 6500 |
| 660 | Ga0495664_0014560 | 3300046477 | Bacteria | 4461 |
| 661 | Ga0495664_0016114 | 3300046477 | Bacteria | 4257 |
| 662 | Ga0495664_0018042 | 3300046477 | Bacteria | 4036 |
| 663 | Ga0495664_0443451 | 3300046477 | Bacteria | 778 |
| 664 | Ga0495664_0543215 | 3300046477 | Bacteria | 693 |
| 665 | Ga0495584_0288698 | 3300046491 | Bacteria | 833 |
| 666 | Ga0495584_0319164 | 3300046491 | Bacteria | 789 |
| 667 | Ga0495585_0037608 | 3300046492 | Bacteria | 2725 |
| 668 | Ga0495594_0000052 | 3300046499 | Bacteria | 51787 |
| 669 | Ga0495594_0166812 | 3300046499 | Bacteria | 1252 |
| 670 | Ga0495594_0169486 | 3300046499 | Bacteria | 1242 |
| 671 | Ga0495594_0306414 | 3300046499 | Bacteria | 905 |
| 672 | Ga0495596_0045661 | 3300046500 | Bacteria | 1722 |
| 673 | Ga0495583_0081116 | 3300046506 | Bacteria | 1409 |
| 674 | Ga0495583_0109194 | 3300046506 | Bacteria | 1174 |
| 675 | Ga0495583_0135597 | 3300046506 | Bacteria | 1028 |
| 676 | Ga0495606_0071103 | 3300046507 | Bacteria | 2192 |
| 677 | Ga0495606_0147760 | 3300046507 | Bacteria | 1382 |
| 678 | Ga0495606_0187395 | 3300046507 | Bacteria | 1188 |
| 679 | Ga0495606_0354754 | 3300046507 | Bacteria | 777 |
| 680 | Ga0495608_0025236 | 3300046511 | Bacteria | 4056 |
| 681 | Ga0495608_0093626 | 3300046511 | Bacteria | 1941 |
| 682 | Ga0495608_0408649 | 3300046511 | Bacteria | 829 |
| 683 | Ga0495616_0102274 | 3300046513 | Bacteria | 1342 |
| 684 | Ga0495616_0156388 | 3300046513 | Bacteria | 1028 |
| 685 | Ga0495616_0236608 | 3300046513 | Bacteria | 789 |
| 686 | Ga0495618_0008774 | 3300046514 | Bacteria | 6105 |
| 687 | Ga0495618_0297998 | 3300046514 | Bacteria | 1002 |
| 688 | Ga0495620_0009664 | 3300046515 | Bacteria | 5120 |
| 689 | Ga0495620_0055613 | 3300046515 | Bacteria | 1667 |
| 690 | Ga0495620_0070892 | 3300046515 | Bacteria | 1427 |
| 691 | Ga0495628_0051224 | 3300046516 | Bacteria | 3264 |
| 692 | Ga0495628_0139249 | 3300046516 | Bacteria | 1852 |
| 693 | Ga0495628_0366569 | 3300046516 | Bacteria | 1057 |
| 694 | Ga0495628_0426945 | 3300046516 | Bacteria | 965 |
| 695 | Ga0495630_0001642 | 3300046517 | Bacteria | 15530 |
| 696 | Ga0495630_0736561 | 3300046517 | Bacteria | 754 |
| 697 | Ga0495631_0018925 | 3300046518 | Bacteria | 3236 |
| 698 | Ga0495631_0024875 | 3300046518 | Bacteria | 2761 |
| 699 | Ga0495632_0055899 | 3300046519 | Bacteria | 1931 |
| 700 | Ga0495632_0089356 | 3300046519 | Bacteria | 1462 |
| 701 | Ga0495632_0166745 | 3300046519 | Bacteria | 1013 |
| 702 | Ga0495637_0061832 | 3300046520 | Bacteria | 1534 |
| 703 | Ga0495643_0121160 | 3300046522 | Bacteria | 1321 |
| 704 | Ga0495648_0171844 | 3300046524 | Bacteria | 1110 |
| 705 | Ga0495666_0019119 | 3300046526 | Bacteria | 3403 |
| 706 | Ga0495666_0177575 | 3300046526 | Bacteria | 984 |
| 707 | Ga0495666_0198516 | 3300046526 | Bacteria | 923 |
| 708 | Ga0495652_0048733 | 3300046529 | Bacteria | 3628 |
| 709 | Ga0495652_0076403 | 3300046529 | Bacteria | 2778 |
| 710 | Ga0495652_0172587 | 3300046529 | Bacteria | 1667 |
| 711 | Ga0495652_0220869 | 3300046529 | Bacteria | 1424 |
| 712 | Ga0495654_0032434 | 3300046530 | Bacteria | 2648 |
| 713 | Ga0495665_0002408 | 3300046531 | Bacteria | 10110 |
| 714 | Ga0495665_0048031 | 3300046531 | Bacteria | 2264 |
| 715 | Ga0495640_0009558 | 3300046533 | Bacteria | 7543 |
| 716 | Ga0495640_0011080 | 3300046533 | Bacteria | 6941 |
| 717 | Ga0495640_0136148 | 3300046533 | Bacteria | 1586 |
| 718 | Ga0495640_0204182 | 3300046533 | Bacteria | 1251 |
| 719 | Ga0495640_0390579 | 3300046533 | Bacteria | 855 |
| 720 | Ga0495587_0009543 | 3300046536 | Bacteria | 6213 |
| 721 | Ga0495598_0011017 | 3300046537 | Bacteria | 2181 |
| 722 | Ga0495609_0069068 | 3300046538 | Bacteria | 1554 |
| 723 | Ga0495621_0020483 | 3300046539 | Bacteria | 2171 |
| 724 | Ga0495597_0145358 | 3300046542 | Bacteria | 976 |
| 725 | Ga0495645_0013656 | 3300046543 | Bacteria | 5753 |
| 726 | Ga0495645_0116310 | 3300046543 | Bacteria | 1887 |
| 727 | Ga0495645_0182747 | 3300046543 | Bacteria | 1435 |
| 728 | Ga0495645_0205321 | 3300046543 | Bacteria | 1334 |
| 729 | Ga0495645_0245613 | 3300046543 | Bacteria | 1192 |
| 730 | Ga0495622_0043031 | 3300046557 | Bacteria | 2100 |
| 731 | Ga0495622_0092790 | 3300046557 | Bacteria | 1386 |
| 732 | Ga0495622_0095860 | 3300046557 | Bacteria | 1361 |
| 733 | Ga0495633_0223714 | 3300046558 | Bacteria | 861 |
| 734 | Ga0495667_0040707 | 3300046559 | Bacteria | 3084 |
| 735 | Ga0495667_0122017 | 3300046559 | Bacteria | 1682 |
| 736 | Ga0495667_0124825 | 3300046559 | Bacteria | 1661 |
| 737 | Ga0495667_0263494 | 3300046559 | Bacteria | 1096 |
| 738 | Ga0495667_0313959 | 3300046559 | Bacteria | 992 |
| 739 | Ga0495656_0009134 | 3300046615 | Bacteria | 3560 |
| 740 | Ga0495656_0074587 | 3300046615 | Bacteria | 1515 |
| 741 | Ga0495656_0122454 | 3300046615 | Bacteria | 1229 |
| 742 | Ga0495668_0032051 | 3300046616 | Bacteria | 2959 |
| 743 | Ga0495668_0086409 | 3300046616 | Bacteria | 1720 |
| 744 | Ga0495668_0285397 | 3300046616 | Bacteria | 904 |
| 745 | Ga0495668_0382603 | 3300046616 | Bacteria | 773 |
| 746 | Ga0495634_0003714 | 3300046642 | Bacteria | 12163 |
| 747 | Ga0495634_0016562 | 3300046642 | Bacteria | 5270 |
| 748 | Ga0495634_0076327 | 3300046642 | Bacteria | 2200 |
| 749 | Ga0495634_0245470 | 3300046642 | Bacteria | 1097 |
| 750 | Ga0495634_0293367 | 3300046642 | Bacteria | 985 |
| 751 | Ga0495611_0043449 | 3300046648 | Bacteria | 2009 |
| 752 | Ga0495611_0151438 | 3300046648 | Bacteria | 1083 |
| 753 | Ga0495611_0187645 | 3300046648 | Bacteria | 965 |
| 754 | Ga0495625_0087742 | 3300046660 | Bacteria | 2156 |
| 755 | Ga0495625_0129626 | 3300046660 | Bacteria | 1709 |
| 756 | Ga0495625_0184281 | 3300046660 | Bacteria | 1386 |
| 757 | Ga0495625_0332132 | 3300046660 | Bacteria | 965 |
| 758 | Ga0495625_0489730 | 3300046660 | Bacteria | 753 |
| 759 | Ga0495625_0597809 | 3300046660 | Bacteria | 663 |
| 760 | Ga0495625_0696616 | 3300046660 | Bacteria | 600 |
| 761 | Ga0495635_0001648 | 3300046663 | Bacteria | 15060 |
| 762 | Ga0495635_0005493 | 3300046663 | Bacteria | 8814 |
| 763 | Ga0495635_0147910 | 3300046663 | Bacteria | 1599 |
| 764 | Ga0495659_0085540 | 3300046664 | Bacteria | 1203 |
| 765 | Ga0495659_0101804 | 3300046664 | Bacteria | 1113 |
| 766 | Ga0495661_0009212 | 3300046665 | Bacteria | 6784 |
| 767 | Ga0495588_0042507 | 3300046674 | Bacteria | 2323 |
| 768 | Ga0495657_0035266 | 3300046675 | Bacteria | 3468 |
| 769 | Ga0495657_0058559 | 3300046675 | Bacteria | 2558 |
| 770 | Ga0495657_0238792 | 3300046675 | Bacteria | 1097 |
| 771 | Ga0495599_0051596 | 3300046678 | Bacteria | 2577 |
| 772 | Ga0495599_0164886 | 3300046678 | Bacteria | 1369 |
| 773 | Ga0495599_0256173 | 3300046678 | Bacteria | 1064 |
| 774 | Ga0495599_0497993 | 3300046678 | Bacteria | 717 |
| 775 | Ga0495599_0565641 | 3300046678 | Bacteria | 665 |
| 776 | Ga0495599_0640760 | 3300046678 | Bacteria | 616 |
| 777 | Ga0495623_0028703 | 3300046679 | Bacteria | 3579 |
| 778 | Ga0495623_0114202 | 3300046679 | Bacteria | 1633 |
| 779 | Ga0495623_0161650 | 3300046679 | Bacteria | 1316 |
| 780 | Ga0495646_0005606 | 3300046680 | Bacteria | 7943 |
| 781 | Ga0495646_0016089 | 3300046680 | Bacteria | 4747 |
| 782 | Ga0495646_0341797 | 3300046680 | Bacteria | 785 |
| 783 | Ga0495647_0008590 | 3300046681 | Bacteria | 3436 |
| 784 | Ga0495647_0014709 | 3300046681 | Bacteria | 2730 |
| 785 | Ga0495658_0002378 | 3300046683 | Bacteria | 9493 |
| 786 | Ga0495658_0104092 | 3300046683 | Bacteria | 1698 |
| 787 | Ga0495658_0111179 | 3300046683 | Bacteria | 1648 |
| 788 | Ga0495669_0061526 | 3300046684 | Bacteria | 1699 |
| 789 | Ga0495669_0121917 | 3300046684 | Bacteria | 1222 |
| 790 | Ga0495669_0317477 | 3300046684 | Bacteria | 752 |
| 791 | Ga0495613_0019214 | 3300046689 | Bacteria | 5094 |
| 792 | Ga0495613_0236572 | 3300046689 | Bacteria | 1278 |
| 793 | Ga0495624_0001637 | 3300046690 | Bacteria | 17178 |
| 794 | Ga0495624_0144728 | 3300046690 | Bacteria | 1455 |
| 795 | Ga0495670_0055014 | 3300046691 | Bacteria | 1995 |
| 796 | Ga0495670_0176288 | 3300046691 | Bacteria | 1127 |
| 797 | Ga0495670_0315804 | 3300046691 | Bacteria | 838 |
| 798 | Ga0495671_0022803 | 3300046692 | Bacteria | 3276 |
| 799 | Ga0495671_0054884 | 3300046692 | Bacteria | 1974 |
| 800 | Ga0495671_0448922 | 3300046692 | Bacteria | 616 |
| 801 | Ga0495649_0091380 | 3300046694 | Bacteria | 1622 |
| 802 | Ga0495649_0158538 | 3300046694 | Bacteria | 1187 |
| 803 | Ga0495649_0291367 | 3300046694 | Bacteria | 832 |
| 804 | Ga0495589_0248476 | 3300046794 | Bacteria | 831 |
| 805 | Ga0495600_0026219 | 3300046809 | Bacteria | 3760 |
| 806 | Ga0495600_0031634 | 3300046809 | Bacteria | 3429 |
| 807 | Ga0495600_0104906 | 3300046809 | Bacteria | 1842 |
| 808 | Ga0495660_0062347 | 3300046810 | Bacteria | 1999 |
| 809 | Ga0495660_0227078 | 3300046810 | Bacteria | 877 |
| 810 | Ga0495581_0000123 | 3300047315 | Bacteria | 33251 |
| 811 | Ga0495581_0073370 | 3300047315 | Bacteria | 1980 |
| 812 | Ga0495581_0189155 | 3300047315 | Bacteria | 1204 |
| 813 | Ga0495581_0273439 | 3300047315 | Bacteria | 988 |
| 814 | Ga0495604_0006563 | 3300047317 | Bacteria | 9223 |
| 815 | Ga0495604_0419321 | 3300047317 | Bacteria | 879 |
| 816 | Ga0495604_0615045 | 3300047317 | Bacteria | 695 |
| 817 | Ga0495674_0001682 | 3300047319 | Bacteria | 21755 |
| 818 | Ga0495674_0007867 | 3300047319 | Bacteria | 10179 |
| 819 | Ga0495674_0226925 | 3300047319 | Bacteria | 1542 |
| 820 | Ga0495674_0389363 | 3300047319 | Bacteria | 1127 |
| 821 | Ga0495672_0013335 | 3300047320 | Bacteria | 5675 |
| 822 | Ga0495672_0166329 | 3300047320 | Bacteria | 1129 |
| 823 | Ga0495672_0249953 | 3300047320 | Bacteria | 861 |
| 824 | Ga0495676_0050628 | 3300047321 | Bacteria | 3330 |
| 825 | Ga0495676_0097442 | 3300047321 | Bacteria | 2184 |
| 826 | Ga0495676_0214456 | 3300047321 | Bacteria | 1330 |
| 827 | Ga0495676_0261283 | 3300047321 | Bacteria | 1178 |
| 828 | Ga0495676_0696254 | 3300047321 | Bacteria | 658 |
| 829 | Ga0495680_0004838 | 3300047322 | Bacteria | 12776 |
| 830 | Ga0495680_0347905 | 3300047322 | Bacteria | 1032 |
| 831 | Ga0495680_0430445 | 3300047322 | Bacteria | 906 |
| 832 | Ga0495683_0196897 | 3300047323 | Bacteria | 911 |
| 833 | Ga0495675_0063385 | 3300047444 | Bacteria | 2339 |
| 834 | Ga0495675_0238461 | 3300047444 | Bacteria | 1095 |
| 835 | Ga0495677_0087812 | 3300047445 | Bacteria | 1170 |
| 836 | Ga0495673_0144799 | 3300047469 | Bacteria | 923 |
| 837 | Ga0495673_0236043 | 3300047469 | Bacteria | 672 |
| 838 | Ga0495684_0061433 | 3300047471 | Bacteria | 2859 |
| 839 | Ga0495684_0106456 | 3300047471 | Bacteria | 2119 |
| 840 | Ga0495686_0030975 | 3300047472 | Bacteria | 3471 |
| 841 | Ga0495686_0120640 | 3300047472 | Bacteria | 1563 |
| 842 | Ga0495686_0160239 | 3300047472 | Bacteria | 1315 |
| 843 | Ga0495686_0393509 | 3300047472 | Bacteria | 745 |
| 844 | Ga0495593_0000332 | 3300047673 | Bacteria | 26189 |
| 845 | Ga0495593_0004032 | 3300047673 | Bacteria | 8749 |
| 846 | Ga0495593_0143388 | 3300047673 | Bacteria | 1210 |
| 847 | Ga0495593_0361226 | 3300047673 | Bacteria | 726 |
| 848 | Ga0495593_0396947 | 3300047673 | Bacteria | 690 |
| 849 | Ga0495602_0039574 | 3300048088 | Bacteria | 4339 |
| 850 | Ga0495614_0005250 | 3300048089 | Bacteria | 5843 |
| 851 | Ga0495626_0017083 | 3300048091 | Bacteria | 3671 |
| 852 | Ga0495626_0290535 | 3300048091 | Bacteria | 648 |
| 853 | Ga0496100_0053851 | 3300048903 | Bacteria | 2622 |
| 854 | Ga0496100_0300827 | 3300048903 | Bacteria | 1201 |
| 855 | Ga0496101_0007148 | 3300048904 | Bacteria | 7220 |
| 856 | Ga0496101_0122158 | 3300048904 | Bacteria | 1970 |
| 857 | Ga0496101_0164028 | 3300048904 | Bacteria | 1705 |
| 858 | Ga0496101_0628455 | 3300048904 | Bacteria | 849 |
| 859 | Ga0496102_0061742 | 3300048905 | Bacteria | 3431 |
| 860 | Ga0496102_0189841 | 3300048905 | Bacteria | 1936 |
| 861 | Ga0496102_0363650 | 3300048905 | Bacteria | 1362 |
| 862 | Ga0496102_1294243 | 3300048905 | Bacteria | 648 |
| 863 | Ga0496103_0109799 | 3300048906 | Bacteria | 1751 |
| 864 | Ga0496103_0209280 | 3300048906 | Bacteria | 1254 |
| 865 | Ga0496103_0253800 | 3300048906 | Bacteria | 1132 |
| 866 | Ga0496104_0015940 | 3300048907 | Bacteria | 6820 |
| 867 | Ga0496104_0131599 | 3300048907 | Bacteria | 2403 |
| 868 | Ga0496104_0877881 | 3300048907 | Bacteria | 802 |
| 869 | Ga0496105_0457279 | 3300048908 | Bacteria | 1007 |
| 870 | Ga0496106_0102769 | 3300048909 | Bacteria | 2217 |
| 871 | Ga0496106_0418132 | 3300048909 | Bacteria | 1077 |
| 872 | Ga0496106_0676501 | 3300048909 | Bacteria | 823 |
| 873 | Ga0496107_0011954 | 3300048910 | Bacteria | 6060 |
| 874 | Ga0496107_0392271 | 3300048910 | Bacteria | 1032 |
| 875 | Ga0496107_0583688 | 3300048910 | Bacteria | 827 |
| 876 | Ga0496107_1208412 | 3300048910 | Bacteria | 543 |
| 877 | Ga0496108_0093932 | 3300048911 | Bacteria | 2552 |
| 878 | Ga0496108_0361424 | 3300048911 | Bacteria | 1267 |
| 879 | Ga0496108_0762974 | 3300048911 | Bacteria | 836 |
| 880 | Ga0496109_0008198 | 3300048912 | Bacteria | 8864 |
| 881 | Ga0496109_0048842 | 3300048912 | Bacteria | 3850 |
| 882 | Ga0496110_0015882 | 3300048913 | Bacteria | 6277 |
| 883 | Ga0496110_0137548 | 3300048913 | Bacteria | 2208 |
| 884 | Ga0496110_0256467 | 3300048913 | Bacteria | 1592 |
| 885 | Ga0496111_0023733 | 3300048914 | Bacteria | 4308 |
| 886 | Ga0496111_0932821 | 3300048914 | Bacteria | 624 |
| 887 | Ga0496111_0937970 | 3300048914 | Bacteria | 622 |
| 888 | Ga0496112_0083173 | 3300048915 | Bacteria | 3165 |
| 889 | Ga0496112_0268321 | 3300048915 | Bacteria | 1655 |
| 890 | Ga0496112_0380219 | 3300048915 | Bacteria | 1353 |
| 891 | Ga0496112_0860676 | 3300048915 | Bacteria | 829 |
| 892 | Ga0496113_0126700 | 3300048916 | Bacteria | 2000 |
| 893 | Ga0496114_0015772 | 3300048917 | Bacteria | 6080 |
| 894 | Ga0496114_0152086 | 3300048917 | Bacteria | 2008 |
| 895 | Ga0496114_0221776 | 3300048917 | Bacteria | 1660 |
| 896 | Ga0496114_1556996 | 3300048917 | Bacteria | 549 |
| 897 | Ga0496115_0005432 | 3300048918 | Bacteria | 9269 |
| 898 | Ga0496115_0085919 | 3300048918 | Bacteria | 2566 |
| 899 | Ga0496115_0154497 | 3300048918 | Bacteria | 1895 |
| 900 | Ga0496115_0285670 | 3300048918 | Bacteria | 1354 |
| 901 | Ga0496115_0503369 | 3300048918 | Bacteria | 973 |
| 902 | Ga0496116_0001099 | 3300048919 | Bacteria | 32485 |
| 903 | Ga0496116_0307019 | 3300048919 | Bacteria | 751 |
| 904 | Ga0496117_0027253 | 3300048920 | Bacteria | 4455 |
| 905 | Ga0496117_0061631 | 3300048920 | Bacteria | 2577 |
| 906 | Ga0496117_0255294 | 3300048920 | Bacteria | 953 |
| 907 | Ga0496118_0011793 | 3300048921 | Bacteria | 8487 |
| 908 | Ga0496118_0022593 | 3300048921 | Bacteria | 5492 |
| 909 | Ga0496118_0067738 | 3300048921 | Bacteria | 2597 |
| 910 | Ga0496118_0081043 | 3300048921 | Bacteria | 2281 |
| 911 | Ga0496118_0115655 | 3300048921 | Bacteria | 1765 |
| 912 | Ga0496118_0143239 | 3300048921 | Bacteria | 1510 |
| 913 | Ga0496118_0407435 | 3300048921 | Bacteria | 704 |
| 914 | Ga0496119_0031900 | 3300048922 | Bacteria | 3521 |
| 915 | Ga0496119_0155124 | 3300048922 | Bacteria | 1223 |
| 916 | Ga0496120_0011170 | 3300048923 | Bacteria | 6198 |
| 917 | Ga0496120_0043295 | 3300048923 | Bacteria | 2624 |
| 918 | Ga0496120_0329598 | 3300048923 | Bacteria | 691 |
| 919 | Ga0496121_0001566 | 3300048924 | Bacteria | 38176 |
| 920 | Ga0496121_0002300 | 3300048924 | Bacteria | 29639 |
| 921 | Ga0496121_0002583 | 3300048924 | Bacteria | 27387 |
| 922 | Ga0496121_0002985 | 3300048924 | Bacteria | 24586 |
| 923 | Ga0496121_0028431 | 3300048924 | Bacteria | 5203 |
| 924 | Ga0496121_0031009 | 3300048924 | Bacteria | 4897 |
| 925 | Ga0496121_0057009 | 3300048924 | Bacteria | 3240 |
| 926 | Ga0496121_0073592 | 3300048924 | Bacteria | 2737 |
| 927 | Ga0496121_0085514 | 3300048924 | Bacteria | 2482 |
| 928 | Ga0496121_0087473 | 3300048924 | Bacteria | 2446 |
| 929 | Ga0496121_0105524 | 3300048924 | Bacteria | 2162 |
| 930 | Ga0496121_0141628 | 3300048924 | Bacteria | 1783 |
| 931 | Ga0496121_0168114 | 3300048924 | Bacteria | 1596 |
| 932 | Ga0496121_0207701 | 3300048924 | Bacteria | 1390 |
| 933 | Ga0496121_0221476 | 3300048924 | Bacteria | 1332 |
| 934 | Ga0496121_0252471 | 3300048924 | Bacteria | 1222 |
| 935 | Ga0496122_0097166 | 3300048925 | Bacteria | 1983 |
| 936 | Ga0496122_0430000 | 3300048925 | Bacteria | 661 |
| 937 | Ga0496123_0044358 | 3300048926 | Bacteria | 3041 |
| 938 | Ga0496123_0334315 | 3300048926 | Bacteria | 710 |
| 939 | Ga0496124_0003294 | 3300048927 | Bacteria | 19907 |
| 940 | Ga0496124_0212774 | 3300048927 | Bacteria | 1461 |
| 941 | Ga0496124_0491859 | 3300048927 | Bacteria | 825 |
| 942 | Ga0496124_0571790 | 3300048927 | Bacteria | 741 |
| 943 | Ga0496124_0847641 | 3300048927 | Bacteria | 560 |
| 944 | Ga0496125_0000801 | 3300048928 | Bacteria | 51346 |
| 945 | Ga0496125_0009137 | 3300048928 | Bacteria | 10253 |
| 946 | Ga0496125_0013838 | 3300048928 | Bacteria | 7900 |
| 947 | Ga0496125_0124993 | 3300048928 | Bacteria | 1825 |
| 948 | Ga0496125_0132854 | 3300048928 | Bacteria | 1748 |
| 949 | Ga0496125_0190934 | 3300048928 | Bacteria | 1352 |
| 950 | Ga0496125_0350237 | 3300048928 | Bacteria | 882 |
| 951 | Ga0496126_0003285 | 3300048929 | Bacteria | 20614 |
| 952 | Ga0496126_0034214 | 3300048929 | Bacteria | 4774 |
| 953 | Ga0496126_0037297 | 3300048929 | Bacteria | 4537 |
| 954 | Ga0496126_0101489 | 3300048929 | Bacteria | 2516 |
| 955 | Ga0496126_0117979 | 3300048929 | Bacteria | 2304 |
| 956 | Ga0496126_0145070 | 3300048929 | Bacteria | 2040 |
| 957 | Ga0496126_0162562 | 3300048929 | Bacteria | 1907 |
| 958 | Ga0496126_0175131 | 3300048929 | Bacteria | 1825 |
| 959 | Ga0496126_0213222 | 3300048929 | Bacteria | 1625 |
| 960 | Ga0496126_0304727 | 3300048929 | Bacteria | 1313 |
| 961 | Ga0496126_0308180 | 3300048929 | Bacteria | 1304 |
| 962 | Ga0496126_0749752 | 3300048929 | Bacteria | 754 |
| 963 | Ga0495682_0189736 | 3300049460 | Bacteria | 730 |
| 964 | Ga0501032_0000001 | 3300049569 | Bacteria | 422097 |
| 965 | Ga0501033_0000092 | 3300049570 | Bacteria | 85398 |
| 966 | Ga0501034_0000036 | 3300049571 | Bacteria | 239274 |
| 967 | Ga0501034_0222843 | 3300049571 | Bacteria | 1838 |
| 968 | Ga0501036_0000078 | 3300049572 | Bacteria | 60614 |
| 969 | Ga0501037_0000017 | 3300049573 | Bacteria | 157276 |
| 970 | Ga0501038_0000153 | 3300049574 | Bacteria | 59196 |
| 971 | Ga0501038_0843970 | 3300049574 | Bacteria | 679 |
| 972 | Ga0501039_0000011 | 3300049575 | Bacteria | 245124 |
| 973 | Ga0501041_0097660 | 3300049577 | Bacteria | 1816 |
| 974 | Ga0501043_0000016 | 3300049579 | Bacteria | 170869 |
| 975 | Ga0501046_0011771 | 3300049580 | Bacteria | 7470 |
| 976 | Ga0501046_0268808 | 3300049580 | Bacteria | 1251 |
| 977 | Ga0501047_0013118 | 3300049581 | Bacteria | 7848 |
| 978 | Ga0501047_0076378 | 3300049581 | Bacteria | 3224 |
| 979 | Ga0501047_0095469 | 3300049581 | Bacteria | 2852 |
| 980 | Ga0501047_0495828 | 3300049581 | Bacteria | 1048 |
| 981 | Ga0501067_0066576 | 3300049583 | Bacteria | 1994 |
| 982 | Ga0501067_0099675 | 3300049583 | Bacteria | 1613 |
| 983 | Ga0501067_0641627 | 3300049583 | Bacteria | 596 |
| 984 | Ga0501068_0854246 | 3300049584 | Bacteria | 598 |
| 985 | Ga0501069_0636277 | 3300049585 | Bacteria | 641 |
| 986 | Ga0501070_0142293 | 3300049586 | Bacteria | 1980 |
| 987 | Ga0501070_0377926 | 3300049586 | Bacteria | 1148 |
| 988 | Ga0501070_0485763 | 3300049586 | Bacteria | 993 |
| 989 | Ga0501071_0931043 | 3300049587 | Bacteria | 671 |
| 990 | Ga0501072_0005754 | 3300049588 | Bacteria | 9436 |
| 991 | Ga0501072_0654134 | 3300049588 | Bacteria | 827 |
| 992 | Ga0501073_0233467 | 3300049589 | Bacteria | 1270 |
| 993 | Ga0501074_0074417 | 3300049590 | Bacteria | 2439 |
| 994 | Ga0501080_0069368 | 3300049742 | Bacteria | 3278 |
| 995 | Ga0501083_0033737 | 3300049744 | Bacteria | 3503 |
| 996 | Ga0501083_0053385 | 3300049744 | Bacteria | 2714 |
| 997 | Ga0501083_0067461 | 3300049744 | Bacteria | 2381 |
| 998 | Ga0501035_0000028 | 3300049822 | Bacteria | 179195 |
| 999 | Ga0501035_0062272 | 3300049822 | Bacteria | 3320 |
| 1000 | Ga0501044_0090388 | 3300049823 | Bacteria | 3089 |
| 1001 | Ga0501044_0116053 | 3300049823 | Bacteria | 2683 |
| 1002 | Ga0501044_0291295 | 3300049823 | Bacteria | 1564 |
| 1003 | nmdc:mga03n38_212664_c1 | 3300050490 | Bacteria | 1006 |
| 1004 | nmdc:mga03n38_492154_c1 | 3300050490 | Bacteria | 687 |
| 1005 | nmdc:mga03n38_49430_c1 | 3300050490 | Bacteria | 1870 |
| 1006 | nmdc:mga0yw44_359092_c1 | 3300050492 | Bacteria | 982 |
| 1007 | nmdc:mga0yw44_40732_c1 | 3300050492 | Bacteria | 2762 |
| 1008 | nmdc:mga0yw44_627679_c1 | 3300050492 | Bacteria | 730 |
| 1009 | nmdc:mga0k408_110097_c1 | 3300050493 | Bacteria | 1628 |
| 1010 | nmdc:mga0k408_113608_c1 | 3300050493 | Bacteria | 1602 |
| 1011 | nmdc:mga06z11_131121_c1 | 3300050494 | Bacteria | 1408 |
| 1012 | nmdc:mga06z11_175728_c1 | 3300050494 | Bacteria | 1232 |
| 1013 | nmdc:mga04h51_102777_c1 | 3300050495 | Bacteria | 1044 |
| 1014 | nmdc:mga07m45_177276_c1 | 3300050496 | Bacteria | 1239 |
| 1015 | nmdc:mga07m45_261130_c1 | 3300050496 | Bacteria | 1008 |
| 1016 | nmdc:mga07m45_34810_c1 | 3300050496 | Bacteria | 2800 |
| 1017 | nmdc:mga07m45_372558_c1 | 3300050496 | Bacteria | 829 |
| 1018 | nmdc:mga05p37_1292349_c1 | 3300050507 | Bacteria | 744 |
| 1019 | nmdc:mga05p37_2013400_c1 | 3300050507 | Bacteria | 546 |
| 1020 | nmdc:mga08y16_908491_c1 | 3300050511 | Bacteria | 866 |
| 1021 | nmdc:mga0n895_298481_c1 | 3300050512 | Bacteria | 1633 |
| 1022 | nmdc:mga0n895_929483_c1 | 3300050512 | Bacteria | 854 |
| 1023 | nmdc:mga0rr50_322499_c1 | 3300050513 | Bacteria | 1295 |
| 1024 | nmdc:mga08x19_135787_c1 | 3300050514 | Bacteria | 1658 |
| 1025 | nmdc:mga0sz30_10924_c1 | 3300050516 | Bacteria | 2579 |
| 1026 | nmdc:mga0sz30_154132_c1 | 3300050516 | Bacteria | 1017 |
| 1027 | nmdc:mga0sz30_166150_c1 | 3300050516 | Bacteria | 978 |
| 1028 | nmdc:mga0sz30_182347_c1 | 3300050516 | Bacteria | 932 |
| 1029 | nmdc:mga0sz30_2979_c1 | 3300050516 | Bacteria | 6074 |
| 1030 | Ga0495601_0001435 | 3300053077 | Bacteria | 13125 |
| 1031 | Ga0495601_0026159 | 3300053077 | Bacteria | 3601 |
| 1032 | Ga0495601_0103604 | 3300053077 | Bacteria | 1839 |
| 1033 | Ga0495601_0121092 | 3300053077 | Bacteria | 1699 |
| 1034 | Ga0495601_0222865 | 3300053077 | Bacteria | 1232 |
| 1035 | Ga0495601_0246368 | 3300053077 | Bacteria | 1167 |
| 1036 | Ga0495612_0010450 | 3300053078 | Bacteria | 3754 |
| 1037 | Ga0495612_0012482 | 3300053078 | Bacteria | 3425 |
| 1038 | Ga0495612_0144867 | 3300053078 | Bacteria | 1032 |
| 1039 | Ga0495612_0197262 | 3300053078 | Bacteria | 887 |
| 1040 | Ga0495612_0225392 | 3300053078 | Bacteria | 830 |
| 1041 | Ga0500635_0000999 | 3300053080 | Bacteria | 6783 |
| 1042 | Ga0500635_0004951 | 3300053080 | Bacteria | 3464 |
| 1043 | Ga0500635_0114234 | 3300053080 | Bacteria | 1005 |
| 1044 | Ga0495655_0051464 | 3300053083 | Bacteria | 1092 |
| 1045 | Ga0495595_0005338 | 3300053084 | Bacteria | 5198 |
| 1046 | Ga0495595_0433326 | 3300053084 | Bacteria | 667 |
| 1047 | Ga0495619_0063475 | 3300053085 | Bacteria | 2460 |
| 1048 | Ga0500643_061712 | 3300053087 | Bacteria | 1051 |
| 1049 | Ga0500644_0009244 | 3300053088 | Bacteria | 2630 |
| 1050 | Ga0500581_167750 | 3300053089 | Bacteria | 1011 |
| 1051 | Ga0500646_0027414 | 3300053090 | Bacteria | 1550 |
| 1052 | Ga0500646_0323353 | 3300053090 | Bacteria | 557 |
| 1053 | Ga0500651_0006315 | 3300053093 | Bacteria | 6816 |
| 1054 | Ga0500651_0052289 | 3300053093 | Bacteria | 2561 |
| 1055 | Ga0500651_0219708 | 3300053093 | Bacteria | 1115 |
| 1056 | Ga0500651_0413321 | 3300053093 | Bacteria | 756 |
| 1057 | Ga0500651_0451444 | 3300053093 | Bacteria | 715 |
| 1058 | Ga0500566_0001430 | 3300053094 | Bacteria | 13975 |
| 1059 | Ga0500566_0001776 | 3300053094 | Bacteria | 12676 |
| 1060 | Ga0500566_0002071 | 3300053094 | Bacteria | 11849 |
| 1061 | Ga0500566_0137960 | 3300053094 | Bacteria | 1297 |
| 1062 | Ga0500566_0202509 | 3300053094 | Bacteria | 1001 |
| 1063 | Ga0500640_000418 | 3300053095 | Bacteria | 10279 |
| 1064 | Ga0500641_0011747 | 3300053096 | Bacteria | 3184 |
| 1065 | Ga0500641_0036209 | 3300053096 | Bacteria | 1973 |
| 1066 | Ga0500641_0083130 | 3300053096 | Bacteria | 1361 |
| 1067 | Ga0500641_0109539 | 3300053096 | Bacteria | 1188 |
| 1068 | Ga0500650_0319367 | 3300053098 | Bacteria | 684 |
| 1069 | Ga0500554_014823 | 3300053102 | Bacteria | 2021 |
| 1070 | Ga0500554_115745 | 3300053102 | Bacteria | 902 |
| 1071 | Ga0500554_257664 | 3300053102 | Bacteria | 573 |
| 1072 | Ga0500555_035874 | 3300053103 | Bacteria | 1392 |
| 1073 | Ga0500555_080356 | 3300053103 | Bacteria | 849 |
| 1074 | Ga0500556_0000019 | 3300053104 | Bacteria | 186017 |
| 1075 | Ga0500557_097610 | 3300053105 | Bacteria | 975 |
| 1076 | Ga0500558_110192 | 3300053106 | Bacteria | 1081 |
| 1077 | Ga0500569_006961 | 3300053109 | Bacteria | 2512 |
| 1078 | Ga0500572_000151 | 3300053111 | Bacteria | 24045 |
| 1079 | Ga0500572_001227 | 3300053111 | Bacteria | 7233 |
| 1080 | Ga0500592_000834 | 3300053116 | Bacteria | 5051 |
| 1081 | Ga0500592_010602 | 3300053116 | Bacteria | 1470 |
| 1082 | Ga0500594_0041491 | 3300053118 | Bacteria | 1260 |
| 1083 | Ga0500594_0188770 | 3300053118 | Bacteria | 674 |
| 1084 | Ga0500594_0252819 | 3300053118 | Bacteria | 587 |
| 1085 | Ga0500595_000203 | 3300053119 | Bacteria | 40552 |
| 1086 | Ga0500595_002743 | 3300053119 | Bacteria | 8512 |
| 1087 | Ga0500595_004186 | 3300053119 | Bacteria | 6530 |
| 1088 | Ga0500595_005804 | 3300053119 | Bacteria | 5327 |
| 1089 | Ga0500607_246858 | 3300053121 | Bacteria | 714 |
| 1090 | Ga0500608_022879 | 3300053122 | Bacteria | 2901 |
| 1091 | Ga0500608_066974 | 3300053122 | Bacteria | 1712 |
| 1092 | Ga0500608_312958 | 3300053122 | Bacteria | 576 |
| 1093 | Ga0500614_003865 | 3300053123 | Bacteria | 3201 |
| 1094 | Ga0500618_005679 | 3300053125 | Bacteria | 3763 |
| 1095 | Ga0500642_0000048 | 3300053130 | Bacteria | 81787 |
| 1096 | Ga0500642_0227371 | 3300053130 | Bacteria | 863 |
| 1097 | Ga0500652_000394 | 3300053131 | Bacteria | 15616 |
| 1098 | Ga0500658_0013741 | 3300053134 | Bacteria | 2993 |
| 1099 | Ga0500559_0000099 | 3300053136 | Bacteria | 67311 |
| 1100 | Ga0500559_0008202 | 3300053136 | Bacteria | 4593 |
| 1101 | Ga0500559_0063941 | 3300053136 | Bacteria | 1645 |
| 1102 | Ga0500559_0207725 | 3300053136 | Bacteria | 923 |
| 1103 | Ga0500568_0000242 | 3300053139 | Bacteria | 46479 |
| 1104 | Ga0500568_0019541 | 3300053139 | Bacteria | 2943 |
| 1105 | Ga0500577_0001076 | 3300053142 | Bacteria | 7042 |
| 1106 | Ga0500577_0020943 | 3300053142 | Bacteria | 2148 |
| 1107 | Ga0500577_0092420 | 3300053142 | Bacteria | 1225 |
| 1108 | Ga0500586_001420 | 3300053145 | Bacteria | 5047 |
| 1109 | Ga0500588_0048325 | 3300053146 | Bacteria | 1316 |
| 1110 | Ga0500590_052736 | 3300053148 | Bacteria | 2063 |
| 1111 | Ga0500590_266850 | 3300053148 | Bacteria | 668 |
| 1112 | Ga0500603_002319 | 3300053150 | Bacteria | 4178 |
| 1113 | Ga0500603_002324 | 3300053150 | Bacteria | 4175 |
| 1114 | Ga0500603_030985 | 3300053150 | Bacteria | 1380 |
| 1115 | Ga0500604_0078827 | 3300053151 | Bacteria | 1061 |
| 1116 | Ga0500604_0224167 | 3300053151 | Bacteria | 648 |
| 1117 | Ga0500616_0000059 | 3300053153 | Bacteria | 259741 |
| 1118 | Ga0500616_0025080 | 3300053153 | Bacteria | 3308 |
| 1119 | Ga0500616_0027563 | 3300053153 | Bacteria | 3135 |
| 1120 | Ga0500619_065580 | 3300053154 | Bacteria | 1201 |
| 1121 | Ga0500622_0164303 | 3300053156 | Bacteria | 1038 |
| 1122 | Ga0500622_0329401 | 3300053156 | Bacteria | 640 |
| 1123 | Ga0500624_016526 | 3300053157 | Bacteria | 1140 |
| 1124 | Ga0500627_0094878 | 3300053158 | Bacteria | 1337 |
| 1125 | Ga0500630_002843 | 3300053159 | Bacteria | 8346 |
| 1126 | Ga0500638_063152 | 3300053162 | Bacteria | 1777 |
| 1127 | Ga0500638_066962 | 3300053162 | Bacteria | 1721 |
| 1128 | Ga0500638_154662 | 3300053162 | Bacteria | 1016 |
| 1129 | Ga0500639_000579 | 3300053163 | Bacteria | 18423 |
| 1130 | Ga0500639_111748 | 3300053163 | Bacteria | 1328 |
| 1131 | Ga0500639_132437 | 3300053163 | Bacteria | 1179 |
| 1132 | Ga0500636_0001221 | 3300053177 | Bacteria | 13884 |
| 1133 | Ga0500636_0016866 | 3300053177 | Bacteria | 4306 |
| 1134 | Ga0500636_0065263 | 3300053177 | Bacteria | 2119 |
| 1135 | Ga0500636_0165751 | 3300053177 | Bacteria | 1200 |
| 1136 | Ga0500636_0249174 | 3300053177 | Bacteria | 907 |
| 1137 | Ga0500636_0261355 | 3300053177 | Bacteria | 876 |
| 1138 | Ga0500637_0000130 | 3300053178 | Bacteria | 27292 |
| 1139 | Ga0500637_0000328 | 3300053178 | Bacteria | 17873 |
| 1140 | Ga0500637_0025623 | 3300053178 | Bacteria | 3242 |
| 1141 | Ga0500637_0087119 | 3300053178 | Bacteria | 1806 |
| 1142 | Ga0500570_085592 | 3300053724 | Bacteria | 1398 |
| 1143 | Ga0500576_050827 | 3300053725 | Bacteria | 1839 |
| 1144 | Ga0500645_006912 | 3300053730 | Bacteria | 4004 |
| 1145 | Ga0500645_170239 | 3300053730 | Bacteria | 595 |
| 1146 | Ga0500609_031491 | 3300053731 | Bacteria | 729 |
| 1147 | Ga0500656_018743 | 3300053732 | Bacteria | 840 |
| 1148 | Ga0500552_005540 | 3300053733 | Bacteria | 1380 |
| 1149 | Ga0500596_000351 | 3300053735 | Bacteria | 8299 |
| 1150 | Ga0500596_004935 | 3300053735 | Bacteria | 2398 |
| 1151 | Ga0500596_006577 | 3300053735 | Bacteria | 1956 |
| 1152 | Ga0500599_001092 | 3300053736 | Bacteria | 3063 |
| 1153 | Ga0501084_0200552 | 3300054114 | Bacteria | 1683 |
| 1154 | Ga0500661_004065 | 3300055283 | Bacteria | 2735 |
| 1155 | Ga0501082_0064019 | 3300060353 | Bacteria | 3166 |
| 1156 | Ga0501082_0179683 | 3300060353 | Bacteria | 1840 |
| 1157 | Ga0501082_0900478 | 3300060353 | Bacteria | 774 |
| 1158 | Ga0501082_1061155 | 3300060353 | Bacteria | 708 |
| 1159 | Ga0466962_0130558 | 3300061719 | Bacteria | 1214 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300006175 | Ga0070712_101374804 | Ga0070712_1013748041 | 152 |
| 2 | 3300035118 | Ga0373954_0004607 | Ga0373954_0004607_16_492 | 152 |
| 3 | 3300035172 | Ga0373955_0003145 | Ga0373955_0003145_5927_6403 | 152 |
| 4 | 3300035724 | Ga0373933_0038486 | Ga0373933_0038486_912_1388 | 152 |
| 5 | 3300035725 | Ga0373947_0060569 | Ga0373947_0060569_1724_2200 | 152 |
| 6 | 3300046454 | Ga0495592_0012321 | Ga0495592_0012321_2657_3133 | 152 |
| 7 | 3300046459 | Ga0495629_0002029 | Ga0495629_0002029_8591_9067 | 152 |
| 8 | 3300046463 | Ga0495653_0048844 | Ga0495653_0048844_92_568 | 152 |
| 9 | 3300046477 | Ga0495664_0016114 | Ga0495664_0016114_40_516 | 152 |
| 10 | 3300046511 | Ga0495608_0025236 | Ga0495608_0025236_521_997 | 152 |
| 11 | 3300046514 | Ga0495618_0008774 | Ga0495618_0008774_2762_3238 | 152 |
| 12 | 3300046529 | Ga0495652_0076403 | Ga0495652_0076403_1059_1535 | 152 |
| 13 | 3300046533 | Ga0495640_0011080 | Ga0495640_0011080_4795_5271 | 152 |
| 14 | 3300046536 | Ga0495587_0009543 | Ga0495587_0009543_884_1360 | 152 |
| 15 | 3300046543 | Ga0495645_0182747 | Ga0495645_0182747_343_819 | 152 |
| 16 | 3300046559 | Ga0495667_0124825 | Ga0495667_0124825_40_516 | 152 |
| 17 | 3300046642 | Ga0495634_0076327 | Ga0495634_0076327_610_1086 | 152 |
| 18 | 3300046663 | Ga0495635_0005493 | Ga0495635_0005493_468_944 | 152 |
| 19 | 3300046675 | Ga0495657_0035266 | Ga0495657_0035266_2159_2635 | 152 |
| 20 | 3300046679 | Ga0495623_0114202 | Ga0495623_0114202_1098_1574 | 152 |
| 21 | 3300046680 | Ga0495646_0005606 | Ga0495646_0005606_305_781 | 152 |
| 22 | 3300046809 | Ga0495600_0026219 | Ga0495600_0026219_2505_2981 | 152 |
| 23 | 3300047315 | Ga0495581_0073370 | Ga0495581_0073370_977_1453 | 152 |
| 24 | 3300047317 | Ga0495604_0006563 | Ga0495604_0006563_2944_3420 | 152 |
| 25 | 3300047321 | Ga0495676_0261283 | Ga0495676_0261283_303_779 | 152 |
| 26 | 3300047322 | Ga0495680_0004838 | Ga0495680_0004838_966_1442 | 152 |
| 27 | 3300047444 | Ga0495675_0063385 | Ga0495675_0063385_152_628 | 152 |
| 28 | 3300047471 | Ga0495684_0106456 | Ga0495684_0106456_1357_1833 | 152 |
| 29 | 3300047673 | Ga0495593_0143388 | Ga0495593_0143388_685_1161 | 152 |
| 30 | 3300048088 | Ga0495602_0039574 | Ga0495602_0039574_2765_3241 | 152 |
| 31 | 3300053077 | Ga0495601_0001435 | Ga0495601_0001435_5352_5828 | 152 |
| 32 | 3300053078 | Ga0495612_0010450 | Ga0495612_0010450_417_893 | 152 |
| 33 | 3300053084 | Ga0495595_0005338 | Ga0495595_0005338_2093_2569 | 152 |
| 34 | 3300005338 | Ga0068868_101118823 | Ga0068868_1011188231 | 153 |
| 35 | 3300005539 | Ga0068853_100323117 | Ga0068853_1003231172 | 153 |
| 36 | 3300005564 | Ga0070664_100435586 | Ga0070664_1004355861 | 153 |
| 37 | 3300010375 | Ga0105239_11092929 | Ga0105239_110929291 | 153 |
| 38 | 3300013105 | Ga0157369_10188588 | Ga0157369_101885882 | 153 |
| 39 | 3300025924 | Ga0207694_10039513 | Ga0207694_100395132 | 153 |
| 40 | 3300037466 | Ga0395898_0037505 | Ga0395898_0037505_1816_2289 | 153 |
| 41 | 3300038443 | Ga0395901_1523453 | Ga0395901_1523453_14_487 | 153 |
| 42 | 3300048924 | Ga0496121_0028431 | Ga0496121_0028431_505_981 | 153 |
| 43 | 3300048925 | Ga0496122_0097166 | Ga0496122_0097166_468_944 | 153 |
| 44 | 3300048928 | Ga0496125_0000801 | Ga0496125_0000801_23077_23553 | 153 |
| 45 | 3300048928 | Ga0496125_0013838 | Ga0496125_0013838_3884_4360 | 153 |
| 46 | 3300050514 | nmdc:mga08x19_135787_c1 | nmdc:mga08x19_135787_c1_31_504 | 153 |
| 47 | 3300053142 | Ga0500577_0001076 | Ga0500577_0001076_4264_4740 | 153 |
| 48 | iso_pu_bacteria | 2602042107 | 2603861722 | 153 |
| 49 | iso_pu_bacteria | 2857524615 | 2857525911 | 153 |
| 50 | iso_pu_bacteria | 2893066018 | 2893067808 | 153 |
| 51 | iso_pu_bacteria | 2919073203 | 2919074228 | 153 |
| 52 | 3300009093 | Ga0105240_10896524 | Ga0105240_108965242 | 154 |
| 53 | 3300031238 | Ga0265332_10001463 | Ga0265332_100014636 | 155 |
| 54 | 3300031247 | Ga0265340_10001613 | Ga0265340_100016134 | 155 |
| 55 | 3300031249 | Ga0265339_10101408 | Ga0265339_101014081 | 155 |
| 56 | 3300031344 | Ga0265316_10438173 | Ga0265316_104381732 | 155 |
| 57 | 3300031595 | Ga0265313_10206662 | Ga0265313_102066622 | 155 |
| 58 | 3300031712 | Ga0265342_10000039 | Ga0265342_1000003935 | 155 |
| 59 | 3300039453 | Ga0436362_0190408 | Ga0436362_0190408_25_495 | 155 |
| 60 | 3300044656 | Ga0466969_0178772 | Ga0466969_0178772_28_504 | 155 |
| 61 | 3300044765 | Ga0466970_0069207 | Ga0466970_0069207_853_1329 | 155 |
| 62 | 3300045049 | Ga0466959_0093872 | Ga0466959_0093872_1169_1645 | 155 |
| 63 | 3300049569 | Ga0501032_0000001 | Ga0501032_0000001_312268_312744 | 155 |
| 64 | 3300049570 | Ga0501033_0000092 | Ga0501033_0000092_72017_72493 | 155 |
| 65 | 3300049571 | Ga0501034_0000036 | Ga0501034_0000036_108365_108841 | 155 |
| 66 | 3300049572 | Ga0501036_0000078 | Ga0501036_0000078_52049_52525 | 155 |
| 67 | 3300049573 | Ga0501037_0000017 | Ga0501037_0000017_56459_56935 | 155 |
| 68 | 3300049574 | Ga0501038_0000153 | Ga0501038_0000153_6890_7366 | 155 |
| 69 | 3300049575 | Ga0501039_0000011 | Ga0501039_0000011_110814_111290 | 155 |
| 70 | 3300049577 | Ga0501041_0097660 | Ga0501041_0097660_1269_1745 | 155 |
| 71 | 3300049579 | Ga0501043_0000016 | Ga0501043_0000016_31435_31911 | 155 |
| 72 | 3300049580 | Ga0501046_0011771 | Ga0501046_0011771_6925_7401 | 155 |
| 73 | 3300049581 | Ga0501047_0495828 | Ga0501047_0495828_464_940 | 155 |
| 74 | 3300049822 | Ga0501035_0000028 | Ga0501035_0000028_108491_108967 | 155 |
| 75 | 3300049823 | Ga0501044_0090388 | Ga0501044_0090388_1114_1590 | 155 |
| 76 | 3300003203 | JGI25406J46586_10023761 | JGI25406J46586_100237613 | 156 |
| 77 | 3300003322 | rootL2_10123755 | rootL2_101237553 | 156 |
| 78 | 3300005338 | Ga0068868_100701434 | Ga0068868_1007014342 | 156 |
| 79 | 3300005340 | Ga0070689_100011394 | Ga0070689_1000113947 | 156 |
| 80 | 3300005354 | Ga0070675_100128047 | Ga0070675_1001280473 | 156 |
| 81 | 3300005355 | Ga0070671_100105888 | Ga0070671_1001058881 | 156 |
| 82 | 3300005366 | Ga0070659_100176151 | Ga0070659_1001761512 | 156 |
| 83 | 3300005367 | Ga0070667_100145691 | Ga0070667_1001456912 | 156 |
| 84 | 3300005367 | Ga0070667_100541244 | Ga0070667_1005412442 | 156 |
| 85 | 3300005435 | Ga0070714_100098675 | Ga0070714_1000986752 | 156 |
| 86 | 3300005436 | Ga0070713_101071863 | Ga0070713_1010718631 | 156 |
| 87 | 3300005445 | Ga0070708_100809812 | Ga0070708_1008098121 | 156 |
| 88 | 3300005445 | Ga0070708_100998391 | Ga0070708_1009983911 | 156 |
| 89 | 3300005455 | Ga0070663_101330521 | Ga0070663_1013305211 | 156 |
| 90 | 3300005456 | Ga0070678_100600858 | Ga0070678_1006008582 | 156 |
| 91 | 3300005467 | Ga0070706_100220654 | Ga0070706_1002206542 | 156 |
| 92 | 3300005468 | Ga0070707_100268855 | Ga0070707_1002688552 | 156 |
| 93 | 3300005471 | Ga0070698_100403203 | Ga0070698_1004032032 | 156 |
| 94 | 3300005518 | Ga0070699_100872038 | Ga0070699_1008720381 | 156 |
| 95 | 3300005536 | Ga0070697_100165297 | Ga0070697_1001652972 | 156 |
| 96 | 3300005543 | Ga0070672_101161600 | Ga0070672_1011616001 | 156 |
| 97 | 3300005548 | Ga0070665_100821489 | Ga0070665_1008214892 | 156 |
| 98 | 3300005548 | Ga0070665_101373324 | Ga0070665_1013733241 | 156 |
| 99 | 3300005563 | Ga0068855_100507450 | Ga0068855_1005074502 | 156 |
| 100 | 3300005577 | Ga0068857_100362513 | Ga0068857_1003625132 | 156 |
| 101 | 3300005615 | Ga0070702_101042054 | Ga0070702_1010420541 | 156 |
| 102 | 3300005616 | Ga0068852_101566997 | Ga0068852_1015669972 | 156 |
| 103 | 3300005618 | Ga0068864_100321378 | Ga0068864_1003213782 | 156 |
| 104 | 3300005842 | Ga0068858_100277566 | Ga0068858_1002775662 | 156 |
| 105 | 3300005842 | Ga0068858_101847543 | Ga0068858_1018475431 | 156 |
| 106 | 3300005983 | Ga0081540_1035810 | Ga0081540_10358102 | 156 |
| 107 | 3300005983 | Ga0081540_1087351 | Ga0081540_10873512 | 156 |
| 108 | 3300005985 | Ga0081539_10001826 | Ga0081539_1000182629 | 156 |
| 109 | 3300006028 | Ga0070717_10952087 | Ga0070717_109520871 | 156 |
| 110 | 3300006051 | Ga0075364_10190859 | Ga0075364_101908592 | 156 |
| 111 | 3300006163 | Ga0070715_10047572 | Ga0070715_100475722 | 156 |
| 112 | 3300006175 | Ga0070712_100087639 | Ga0070712_1000876392 | 156 |
| 113 | 3300006178 | Ga0075367_10188156 | Ga0075367_101881562 | 156 |
| 114 | 3300006353 | Ga0075370_10424404 | Ga0075370_104244041 | 156 |
| 115 | 3300006881 | Ga0068865_101288458 | Ga0068865_1012884581 | 156 |
| 116 | 3300007076 | Ga0075435_100343491 | Ga0075435_1003434912 | 156 |
| 117 | 3300007788 | Ga0099795_10133883 | Ga0099795_101338832 | 156 |
| 118 | 3300009092 | Ga0105250_10066410 | Ga0105250_100664102 | 156 |
| 119 | 3300009098 | Ga0105245_10094969 | Ga0105245_100949693 | 156 |
| 120 | 3300009098 | Ga0105245_10366907 | Ga0105245_103669073 | 156 |
| 121 | 3300009174 | Ga0105241_10706151 | Ga0105241_107061512 | 156 |
| 122 | 3300009177 | Ga0105248_10251511 | Ga0105248_102515112 | 156 |
| 123 | 3300010375 | Ga0105239_10908722 | Ga0105239_109087222 | 156 |
| 124 | 3300013296 | Ga0157374_10226810 | Ga0157374_102268102 | 156 |
| 125 | 3300014325 | Ga0163163_10116559 | Ga0163163_101165593 | 156 |
| 126 | 3300014969 | Ga0157376_10449305 | Ga0157376_104493051 | 156 |
| 127 | 3300021361 | Ga0213872_10107938 | Ga0213872_101079382 | 156 |
| 128 | 3300022467 | Ga0224712_10181980 | Ga0224712_101819801 | 156 |
| 129 | 3300024123 | Ga0228600_1013447 | Ga0228600_10134471 | 156 |
| 130 | 3300024227 | Ga0228598_1004809 | Ga0228598_10048093 | 156 |
| 131 | 3300025711 | Ga0207696_1036714 | Ga0207696_10367142 | 156 |
| 132 | 3300025906 | Ga0207699_10281422 | Ga0207699_102814222 | 156 |
| 133 | 3300025910 | Ga0207684_10058728 | Ga0207684_100587283 | 156 |
| 134 | 3300025911 | Ga0207654_10574180 | Ga0207654_105741802 | 156 |
| 135 | 3300025915 | Ga0207693_10154979 | Ga0207693_101549792 | 156 |
| 136 | 3300025925 | Ga0207650_10054101 | Ga0207650_100541011 | 156 |
| 137 | 3300025926 | Ga0207659_10280081 | Ga0207659_102800812 | 156 |
| 138 | 3300025927 | Ga0207687_10354794 | Ga0207687_103547942 | 156 |
| 139 | 3300025927 | Ga0207687_10905155 | Ga0207687_109051552 | 156 |
| 140 | 3300025928 | Ga0207700_10850060 | Ga0207700_108500601 | 156 |
| 141 | 3300025929 | Ga0207664_10159219 | Ga0207664_101592192 | 156 |
| 142 | 3300025931 | Ga0207644_10006424 | Ga0207644_100064242 | 156 |
| 143 | 3300025932 | Ga0207690_10062525 | Ga0207690_100625252 | 156 |
| 144 | 3300025932 | Ga0207690_10663833 | Ga0207690_106638332 | 156 |
| 145 | 3300025933 | Ga0207706_10136274 | Ga0207706_101362742 | 156 |
| 146 | 3300025936 | Ga0207670_10037132 | Ga0207670_100371323 | 156 |
| 147 | 3300025945 | Ga0207679_10054988 | Ga0207679_100549883 | 156 |
| 148 | 3300025986 | Ga0207658_10129014 | Ga0207658_101290142 | 156 |
| 149 | 3300026035 | Ga0207703_10206516 | Ga0207703_102065161 | 156 |
| 150 | 3300026078 | Ga0207702_10271195 | Ga0207702_102711952 | 156 |
| 151 | 3300026095 | Ga0207676_10410117 | Ga0207676_104101172 | 156 |
| 152 | 3300026118 | Ga0207675_100062997 | Ga0207675_1000629972 | 156 |
| 153 | 3300026142 | Ga0207698_12381597 | Ga0207698_123815971 | 156 |
| 154 | 3300028379 | Ga0268266_10053456 | Ga0268266_100534562 | 156 |
| 155 | 3300028379 | Ga0268266_10174815 | Ga0268266_101748151 | 156 |
| 156 | 3300028379 | Ga0268266_10293753 | Ga0268266_102937532 | 156 |
| 157 | 3300031238 | Ga0265332_10104590 | Ga0265332_101045902 | 156 |
| 158 | 3300031239 | Ga0265328_10000257 | Ga0265328_1000025712 | 156 |
| 159 | 3300031251 | Ga0265327_10057949 | Ga0265327_100579492 | 156 |
| 160 | 3300031456 | Ga0307513_10257000 | Ga0307513_102570002 | 156 |
| 161 | 3300031691 | Ga0316579_10330007 | Ga0316579_103300071 | 156 |
| 162 | 3300031711 | Ga0265314_10003438 | Ga0265314_100034389 | 156 |
| 163 | 3300031712 | Ga0265342_10007997 | Ga0265342_100079973 | 156 |
| 164 | 3300031995 | Ga0307409_100633657 | Ga0307409_1006336572 | 156 |
| 165 | 3300033180 | Ga0307510_10140057 | Ga0307510_101400572 | 156 |
| 166 | 3300035083 | Ga0373926_0392280 | Ga0373926_0392280_24_515 | 156 |
| 167 | 3300035086 | Ga0373934_0059481 | Ga0373934_0059481_425_898 | 156 |
| 168 | 3300035089 | Ga0373944_0124754 | Ga0373944_0124754_40_513 | 156 |
| 169 | 3300035111 | Ga0373923_0052257 | Ga0373923_0052257_351_824 | 156 |
| 170 | 3300035113 | Ga0373936_0020001 | Ga0373936_0020001_346_819 | 156 |
| 171 | 3300035116 | Ga0373945_0023360 | Ga0373945_0023360_182_655 | 156 |
| 172 | 3300035117 | Ga0373953_0002986 | Ga0373953_0002986_1691_2182 | 156 |
| 173 | 3300035117 | Ga0373953_0192179 | Ga0373953_0192179_328_801 | 156 |
| 174 | 3300035118 | Ga0373954_0037670 | Ga0373954_0037670_1244_1717 | 156 |
| 175 | 3300035118 | Ga0373954_0142179 | Ga0373954_0142179_301_792 | 156 |
| 176 | 3300035119 | Ga0373956_0107716 | Ga0373956_0107716_244_735 | 156 |
| 177 | 3300035170 | Ga0373943_0002891 | Ga0373943_0002891_5119_5592 | 156 |
| 178 | 3300035171 | Ga0373946_0011102 | Ga0373946_0011102_693_1166 | 156 |
| 179 | 3300035172 | Ga0373955_0018293 | Ga0373955_0018293_1105_1596 | 156 |
| 180 | 3300035172 | Ga0373955_0019988 | Ga0373955_0019988_111_584 | 156 |
| 181 | 3300035692 | Ga0373935_0001059 | Ga0373935_0001059_8143_8616 | 156 |
| 182 | 3300035692 | Ga0373935_0103761 | Ga0373935_0103761_414_905 | 156 |
| 183 | 3300035695 | Ga0373927_0000456 | Ga0373927_0000456_22151_22624 | 156 |
| 184 | 3300035724 | Ga0373933_0015188 | Ga0373933_0015188_2712_3185 | 156 |
| 185 | 3300035724 | Ga0373933_0128241 | Ga0373933_0128241_471_962 | 156 |
| 186 | 3300035725 | Ga0373947_0002829 | Ga0373947_0002829_3522_3995 | 156 |
| 187 | 3300036401 | Ga0373937_0311338 | Ga0373937_0311338_451_924 | 156 |
| 188 | 3300036401 | Ga0373937_0321385 | Ga0373937_0321385_459_932 | 156 |
| 189 | 3300036401 | Ga0373937_0608242 | Ga0373937_0608242_343_834 | 156 |
| 190 | 3300036458 | Ga0310112_048466 | Ga0310112_048466_71_544 | 156 |
| 191 | 3300036459 | Ga0372808_007737 | Ga0372808_007737_134_607 | 156 |
| 192 | 3300037068 | Ga0373925_0044802 | Ga0373925_0044802_2174_2647 | 156 |
| 193 | 3300039447 | Ga0436361_1008940 | Ga0436361_1008940_1300_1782 | 156 |
| 194 | 3300042004 | Ga0439445_0157835 | Ga0439445_0157835_100_573 | 156 |
| 195 | 3300044656 | Ga0466969_0057497 | Ga0466969_0057497_110_583 | 156 |
| 196 | 3300046454 | Ga0495592_0050196 | Ga0495592_0050196_1870_2361 | 156 |
| 197 | 3300046454 | Ga0495592_0143345 | Ga0495592_0143345_642_1115 | 156 |
| 198 | 3300046455 | Ga0495603_0000468 | Ga0495603_0000468_20137_20610 | 156 |
| 199 | 3300046455 | Ga0495603_0235706 | Ga0495603_0235706_502_993 | 156 |
| 200 | 3300046459 | Ga0495629_0000244 | Ga0495629_0000244_21374_21847 | 156 |
| 201 | 3300046460 | Ga0495638_0006759 | Ga0495638_0006759_3335_3808 | 156 |
| 202 | 3300046461 | Ga0495641_0005414 | Ga0495641_0005414_724_1197 | 156 |
| 203 | 3300046463 | Ga0495653_0062538 | Ga0495653_0062538_1888_2361 | 156 |
| 204 | 3300046472 | Ga0495580_0002784 | Ga0495580_0002784_1221_1694 | 156 |
| 205 | 3300046473 | Ga0495582_0000986 | Ga0495582_0000986_7309_7782 | 156 |
| 206 | 3300046475 | Ga0495639_0000015 | Ga0495639_0000015_29050_29523 | 156 |
| 207 | 3300046475 | Ga0495639_0424590 | Ga0495639_0424590_156_647 | 156 |
| 208 | 3300046476 | Ga0495662_0004296 | Ga0495662_0004296_4592_5065 | 156 |
| 209 | 3300046477 | Ga0495664_0006408 | Ga0495664_0006408_3400_3873 | 156 |
| 210 | 3300046477 | Ga0495664_0543215 | Ga0495664_0543215_88_579 | 156 |
| 211 | 3300046499 | Ga0495594_0000052 | Ga0495594_0000052_15034_15507 | 156 |
| 212 | 3300046511 | Ga0495608_0093626 | Ga0495608_0093626_945_1418 | 156 |
| 213 | 3300046511 | Ga0495608_0408649 | Ga0495608_0408649_292_783 | 156 |
| 214 | 3300046514 | Ga0495618_0297998 | Ga0495618_0297998_342_833 | 156 |
| 215 | 3300046516 | Ga0495628_0051224 | Ga0495628_0051224_2634_3107 | 156 |
| 216 | 3300046516 | Ga0495628_0139249 | Ga0495628_0139249_581_1072 | 156 |
| 217 | 3300046517 | Ga0495630_0001642 | Ga0495630_0001642_819_1292 | 156 |
| 218 | 3300046517 | Ga0495630_0736561 | Ga0495630_0736561_161_652 | 156 |
| 219 | 3300046526 | Ga0495666_0019119 | Ga0495666_0019119_2892_3365 | 156 |
| 220 | 3300046526 | Ga0495666_0198516 | Ga0495666_0198516_222_713 | 156 |
| 221 | 3300046529 | Ga0495652_0048733 | Ga0495652_0048733_2426_2899 | 156 |
| 222 | 3300046529 | Ga0495652_0172587 | Ga0495652_0172587_766_1257 | 156 |
| 223 | 3300046531 | Ga0495665_0002408 | Ga0495665_0002408_7480_7953 | 156 |
| 224 | 3300046531 | Ga0495665_0048031 | Ga0495665_0048031_246_737 | 156 |
| 225 | 3300046533 | Ga0495640_0009558 | Ga0495640_0009558_6310_6783 | 156 |
| 226 | 3300046533 | Ga0495640_0136148 | Ga0495640_0136148_782_1273 | 156 |
| 227 | 3300046543 | Ga0495645_0116310 | Ga0495645_0116310_58_549 | 156 |
| 228 | 3300046543 | Ga0495645_0245613 | Ga0495645_0245613_108_599 | 156 |
| 229 | 3300046557 | Ga0495622_0095860 | Ga0495622_0095860_725_1198 | 156 |
| 230 | 3300046559 | Ga0495667_0040707 | Ga0495667_0040707_1205_1678 | 156 |
| 231 | 3300046559 | Ga0495667_0122017 | Ga0495667_0122017_352_843 | 156 |
| 232 | 3300046642 | Ga0495634_0003714 | Ga0495634_0003714_1900_2373 | 156 |
| 233 | 3300046642 | Ga0495634_0245470 | Ga0495634_0245470_261_752 | 156 |
| 234 | 3300046663 | Ga0495635_0001648 | Ga0495635_0001648_3132_3605 | 156 |
| 235 | 3300046674 | Ga0495588_0042507 | Ga0495588_0042507_1091_1564 | 156 |
| 236 | 3300046675 | Ga0495657_0058559 | Ga0495657_0058559_149_640 | 156 |
| 237 | 3300046675 | Ga0495657_0238792 | Ga0495657_0238792_273_746 | 156 |
| 238 | 3300046678 | Ga0495599_0051596 | Ga0495599_0051596_686_1159 | 156 |
| 239 | 3300046678 | Ga0495599_0256173 | Ga0495599_0256173_470_961 | 156 |
| 240 | 3300046679 | Ga0495623_0028703 | Ga0495623_0028703_34_525 | 156 |
| 241 | 3300046679 | Ga0495623_0161650 | Ga0495623_0161650_77_550 | 156 |
| 242 | 3300046680 | Ga0495646_0016089 | Ga0495646_0016089_2730_3203 | 156 |
| 243 | 3300046681 | Ga0495647_0014709 | Ga0495647_0014709_662_1135 | 156 |
| 244 | 3300046683 | Ga0495658_0002378 | Ga0495658_0002378_3416_3889 | 156 |
| 245 | 3300046683 | Ga0495658_0111179 | Ga0495658_0111179_870_1361 | 156 |
| 246 | 3300046689 | Ga0495613_0019214 | Ga0495613_0019214_4331_4804 | 156 |
| 247 | 3300046690 | Ga0495624_0001637 | Ga0495624_0001637_11408_11881 | 156 |
| 248 | 3300046809 | Ga0495600_0031634 | Ga0495600_0031634_1561_2034 | 156 |
| 249 | 3300046809 | Ga0495600_0104906 | Ga0495600_0104906_549_1040 | 156 |
| 250 | 3300047315 | Ga0495581_0000123 | Ga0495581_0000123_9501_9974 | 156 |
| 251 | 3300047315 | Ga0495581_0273439 | Ga0495581_0273439_439_930 | 156 |
| 252 | 3300047317 | Ga0495604_0419321 | Ga0495604_0419321_40_513 | 156 |
| 253 | 3300047317 | Ga0495604_0615045 | Ga0495604_0615045_25_516 | 156 |
| 254 | 3300047319 | Ga0495674_0007867 | Ga0495674_0007867_2229_2702 | 156 |
| 255 | 3300047319 | Ga0495674_0226925 | Ga0495674_0226925_287_778 | 156 |
| 256 | 3300047321 | Ga0495676_0097442 | Ga0495676_0097442_130_603 | 156 |
| 257 | 3300047322 | Ga0495680_0347905 | Ga0495680_0347905_36_527 | 156 |
| 258 | 3300047322 | Ga0495680_0430445 | Ga0495680_0430445_317_790 | 156 |
| 259 | 3300047444 | Ga0495675_0238461 | Ga0495675_0238461_56_547 | 156 |
| 260 | 3300047673 | Ga0495593_0000332 | Ga0495593_0000332_8578_9051 | 156 |
| 261 | 3300048089 | Ga0495614_0005250 | Ga0495614_0005250_3483_3956 | 156 |
| 262 | 3300048904 | Ga0496101_0164028 | Ga0496101_0164028_585_1076 | 156 |
| 263 | 3300048905 | Ga0496102_0189841 | Ga0496102_0189841_167_658 | 156 |
| 264 | 3300048907 | Ga0496104_0131599 | Ga0496104_0131599_817_1308 | 156 |
| 265 | 3300048909 | Ga0496106_0418132 | Ga0496106_0418132_429_920 | 156 |
| 266 | 3300048910 | Ga0496107_0583688 | Ga0496107_0583688_160_633 | 156 |
| 267 | 3300048911 | Ga0496108_0361424 | Ga0496108_0361424_198_689 | 156 |
| 268 | 3300048914 | Ga0496111_0932821 | Ga0496111_0932821_121_594 | 156 |
| 269 | 3300048915 | Ga0496112_0083173 | Ga0496112_0083173_2516_3007 | 156 |
| 270 | 3300048915 | Ga0496112_0380219 | Ga0496112_0380219_572_1063 | 156 |
| 271 | 3300048918 | Ga0496115_0085919 | Ga0496115_0085919_1243_1716 | 156 |
| 272 | 3300048918 | Ga0496115_0154497 | Ga0496115_0154497_175_666 | 156 |
| 273 | 3300048924 | Ga0496121_0141628 | Ga0496121_0141628_89_565 | 156 |
| 274 | 3300048925 | Ga0496122_0430000 | Ga0496122_0430000_26_502 | 156 |
| 275 | 3300048926 | Ga0496123_0334315 | Ga0496123_0334315_183_659 | 156 |
| 276 | 3300048927 | Ga0496124_0491859 | Ga0496124_0491859_126_602 | 156 |
| 277 | 3300048929 | Ga0496126_0145070 | Ga0496126_0145070_999_1472 | 156 |
| 278 | 3300048929 | Ga0496126_0749752 | Ga0496126_0749752_165_662 | 156 |
| 279 | 3300049571 | Ga0501034_0222843 | Ga0501034_0222843_286_762 | 156 |
| 280 | 3300049574 | Ga0501038_0843970 | Ga0501038_0843970_186_659 | 156 |
| 281 | 3300049581 | Ga0501047_0013118 | Ga0501047_0013118_1887_2360 | 156 |
| 282 | 3300049583 | Ga0501067_0066576 | Ga0501067_0066576_1316_1819 | 156 |
| 283 | 3300049583 | Ga0501067_0641627 | Ga0501067_0641627_74_547 | 156 |
| 284 | 3300049588 | Ga0501072_0005754 | Ga0501072_0005754_8143_8616 | 156 |
| 285 | 3300049744 | Ga0501083_0033737 | Ga0501083_0033737_2878_3351 | 156 |
| 286 | 3300049744 | Ga0501083_0053385 | Ga0501083_0053385_1234_1707 | 156 |
| 287 | 3300049744 | Ga0501083_0067461 | Ga0501083_0067461_332_805 | 156 |
| 288 | 3300050513 | nmdc:mga0rr50_322499_c1 | nmdc:mga0rr50_322499_c1_183_674 | 156 |
| 289 | 3300050516 | nmdc:mga0sz30_182347_c1 | nmdc:mga0sz30_182347_c1_240_713 | 156 |
| 290 | 3300053077 | Ga0495601_0103604 | Ga0495601_0103604_1313_1804 | 156 |
| 291 | 3300053077 | Ga0495601_0121092 | Ga0495601_0121092_888_1379 | 156 |
| 292 | 3300053078 | Ga0495612_0225392 | Ga0495612_0225392_25_516 | 156 |
| 293 | 3300053084 | Ga0495595_0433326 | Ga0495595_0433326_151_642 | 156 |
| 294 | 3300053085 | Ga0495619_0063475 | Ga0495619_0063475_1247_1738 | 156 |
| 295 | 3300053090 | Ga0500646_0323353 | Ga0500646_0323353_67_540 | 156 |
| 296 | 3300053093 | Ga0500651_0219708 | Ga0500651_0219708_324_800 | 156 |
| 297 | 3300053150 | Ga0500603_030985 | Ga0500603_030985_324_797 | 156 |
| 298 | 3300053153 | Ga0500616_0025080 | Ga0500616_0025080_716_1189 | 156 |
| 299 | 3300053153 | Ga0500616_0027563 | Ga0500616_0027563_2378_2851 | 156 |
| 300 | 3300054114 | Ga0501084_0200552 | Ga0501084_0200552_165_638 | 156 |
| 301 | 3300060353 | Ga0501082_0064019 | Ga0501082_0064019_1877_2350 | 156 |
| 302 | 3300060353 | Ga0501082_0179683 | Ga0501082_0179683_508_1011 | 156 |
| 303 | 3300060353 | Ga0501082_1061155 | Ga0501082_1061155_86_559 | 156 |
| 304 | 2010549000 | RicEn_FSXC7958_b1 | RicEn_222710 | 157 |
| 305 | 3300001991 | JGI24743J22301_10011029 | JGI24743J22301_100110292 | 157 |
| 306 | 3300003203 | JGI25406J46586_10002869 | JGI25406J46586_100028693 | 157 |
| 307 | 3300003215 | JGI25153J46596_10005767 | JGI25153J46596_100057675 | 157 |
| 308 | 3300003215 | JGI25153J46596_10006684 | JGI25153J46596_100066843 | 157 |
| 309 | 3300003215 | JGI25153J46596_10039667 | JGI25153J46596_100396672 | 157 |
| 310 | 3300003323 | rootH1_10291242 | rootH1_102912421 | 157 |
| 311 | 3300003659 | JGI25404J52841_10040049 | JGI25404J52841_100400492 | 157 |
| 312 | 3300003659 | JGI25404J52841_10049835 | JGI25404J52841_100498351 | 157 |
| 313 | 3300003659 | JGI25404J52841_10053153 | JGI25404J52841_100531532 | 157 |
| 314 | 3300003659 | JGI25404J52841_10054410 | JGI25404J52841_100544102 | 157 |
| 315 | 3300003771 | Ga0055526_1053332 | Ga0055526_10533322 | 157 |
| 316 | 3300003775 | Ga0055524_1037314 | Ga0055524_10373142 | 157 |
| 317 | 3300003794 | Ga0055531_10009335 | Ga0055531_100093354 | 157 |
| 318 | 3300005327 | Ga0070658_10087205 | Ga0070658_100872052 | 157 |
| 319 | 3300005329 | Ga0070683_100517205 | Ga0070683_1005172052 | 157 |
| 320 | 3300005330 | Ga0070690_100456427 | Ga0070690_1004564272 | 157 |
| 321 | 3300005331 | Ga0070670_100185219 | Ga0070670_1001852192 | 157 |
| 322 | 3300005334 | Ga0068869_100007229 | Ga0068869_1000072297 | 157 |
| 323 | 3300005334 | Ga0068869_100096279 | Ga0068869_1000962793 | 157 |
| 324 | 3300005334 | Ga0068869_100172023 | Ga0068869_1001720231 | 157 |
| 325 | 3300005334 | Ga0068869_100432435 | Ga0068869_1004324351 | 157 |
| 326 | 3300005335 | Ga0070666_10397492 | Ga0070666_103974921 | 157 |
| 327 | 3300005337 | Ga0070682_100043669 | Ga0070682_1000436693 | 157 |
| 328 | 3300005338 | Ga0068868_100041351 | Ga0068868_1000413513 | 157 |
| 329 | 3300005339 | Ga0070660_100165420 | Ga0070660_1001654202 | 157 |
| 330 | 3300005340 | Ga0070689_100387082 | Ga0070689_1003870821 | 157 |
| 331 | 3300005344 | Ga0070661_100373491 | Ga0070661_1003734912 | 157 |
| 332 | 3300005347 | Ga0070668_100058386 | Ga0070668_1000583862 | 157 |
| 333 | 3300005347 | Ga0070668_100132950 | Ga0070668_1001329502 | 157 |
| 334 | 3300005347 | Ga0070668_100161292 | Ga0070668_1001612922 | 157 |
| 335 | 3300005347 | Ga0070668_100211531 | Ga0070668_1002115313 | 157 |
| 336 | 3300005347 | Ga0070668_100236330 | Ga0070668_1002363301 | 157 |
| 337 | 3300005347 | Ga0070668_101189192 | Ga0070668_1011891921 | 157 |
| 338 | 3300005353 | Ga0070669_100287154 | Ga0070669_1002871542 | 157 |
| 339 | 3300005356 | Ga0070674_100293469 | Ga0070674_1002934691 | 157 |
| 340 | 3300005365 | Ga0070688_100121147 | Ga0070688_1001211472 | 157 |
| 341 | 3300005366 | Ga0070659_100192084 | Ga0070659_1001920842 | 157 |
| 342 | 3300005366 | Ga0070659_100228988 | Ga0070659_1002289882 | 157 |
| 343 | 3300005366 | Ga0070659_101313265 | Ga0070659_1013132651 | 157 |
| 344 | 3300005435 | Ga0070714_100044316 | Ga0070714_1000443163 | 157 |
| 345 | 3300005435 | Ga0070714_100271872 | Ga0070714_1002718722 | 157 |
| 346 | 3300005435 | Ga0070714_100529735 | Ga0070714_1005297352 | 157 |
| 347 | 3300005436 | Ga0070713_100003607 | Ga0070713_1000036072 | 157 |
| 348 | 3300005436 | Ga0070713_100360934 | Ga0070713_1003609342 | 157 |
| 349 | 3300005437 | Ga0070710_10106555 | Ga0070710_101065552 | 157 |
| 350 | 3300005438 | Ga0070701_10145770 | Ga0070701_101457703 | 157 |
| 351 | 3300005439 | Ga0070711_100147899 | Ga0070711_1001478992 | 157 |
| 352 | 3300005439 | Ga0070711_100855728 | Ga0070711_1008557281 | 157 |
| 353 | 3300005440 | Ga0070705_100096685 | Ga0070705_1000966852 | 157 |
| 354 | 3300005444 | Ga0070694_100242697 | Ga0070694_1002426971 | 157 |
| 355 | 3300005455 | Ga0070663_100034961 | Ga0070663_1000349612 | 157 |
| 356 | 3300005455 | Ga0070663_100102625 | Ga0070663_1001026252 | 157 |
| 357 | 3300005455 | Ga0070663_100117649 | Ga0070663_1001176492 | 157 |
| 358 | 3300005455 | Ga0070663_100159673 | Ga0070663_1001596732 | 157 |
| 359 | 3300005455 | Ga0070663_100193574 | Ga0070663_1001935742 | 157 |
| 360 | 3300005455 | Ga0070663_100218136 | Ga0070663_1002181362 | 157 |
| 361 | 3300005455 | Ga0070663_100450437 | Ga0070663_1004504372 | 157 |
| 362 | 3300005455 | Ga0070663_101337446 | Ga0070663_1013374461 | 157 |
| 363 | 3300005456 | Ga0070678_100024023 | Ga0070678_1000240233 | 157 |
| 364 | 3300005456 | Ga0070678_100120571 | Ga0070678_1001205713 | 157 |
| 365 | 3300005456 | Ga0070678_100121766 | Ga0070678_1001217662 | 157 |
| 366 | 3300005456 | Ga0070678_100228043 | Ga0070678_1002280431 | 157 |
| 367 | 3300005456 | Ga0070678_101192585 | Ga0070678_1011925851 | 157 |
| 368 | 3300005457 | Ga0070662_100179164 | Ga0070662_1001791642 | 157 |
| 369 | 3300005457 | Ga0070662_100292099 | Ga0070662_1002920992 | 157 |
| 370 | 3300005457 | Ga0070662_100469560 | Ga0070662_1004695601 | 157 |
| 371 | 3300005457 | Ga0070662_100710338 | Ga0070662_1007103382 | 157 |
| 372 | 3300005458 | Ga0070681_10009165 | Ga0070681_100091653 | 157 |
| 373 | 3300005459 | Ga0068867_100812716 | Ga0068867_1008127161 | 157 |
| 374 | 3300005467 | Ga0070706_100236911 | Ga0070706_1002369112 | 157 |
| 375 | 3300005471 | Ga0070698_100269806 | Ga0070698_1002698062 | 157 |
| 376 | 3300005530 | Ga0070679_100026502 | Ga0070679_1000265025 | 157 |
| 377 | 3300005530 | Ga0070679_100810466 | Ga0070679_1008104662 | 157 |
| 378 | 3300005539 | Ga0068853_100064892 | Ga0068853_1000648922 | 157 |
| 379 | 3300005543 | Ga0070672_100350867 | Ga0070672_1003508672 | 157 |
| 380 | 3300005544 | Ga0070686_101198616 | Ga0070686_1011986161 | 157 |
| 381 | 3300005545 | Ga0070695_100226048 | Ga0070695_1002260482 | 157 |
| 382 | 3300005546 | Ga0070696_100341225 | Ga0070696_1003412251 | 157 |
| 383 | 3300005547 | Ga0070693_100041420 | Ga0070693_1000414203 | 157 |
| 384 | 3300005547 | Ga0070693_100262788 | Ga0070693_1002627882 | 157 |
| 385 | 3300005548 | Ga0070665_100040083 | Ga0070665_1000400832 | 157 |
| 386 | 3300005548 | Ga0070665_100329230 | Ga0070665_1003292302 | 157 |
| 387 | 3300005548 | Ga0070665_100356056 | Ga0070665_1003560562 | 157 |
| 388 | 3300005548 | Ga0070665_100774426 | Ga0070665_1007744262 | 157 |
| 389 | 3300005548 | Ga0070665_100971484 | Ga0070665_1009714841 | 157 |
| 390 | 3300005549 | Ga0070704_100579738 | Ga0070704_1005797382 | 157 |
| 391 | 3300005563 | Ga0068855_100228274 | Ga0068855_1002282742 | 157 |
| 392 | 3300005563 | Ga0068855_100240424 | Ga0068855_1002404242 | 157 |
| 393 | 3300005563 | Ga0068855_100288298 | Ga0068855_1002882982 | 157 |
| 394 | 3300005563 | Ga0068855_102144244 | Ga0068855_1021442441 | 157 |
| 395 | 3300005564 | Ga0070664_100030458 | Ga0070664_1000304583 | 157 |
| 396 | 3300005564 | Ga0070664_100857130 | Ga0070664_1008571302 | 157 |
| 397 | 3300005578 | Ga0068854_100176039 | Ga0068854_1001760392 | 157 |
| 398 | 3300005614 | Ga0068856_100100329 | Ga0068856_1001003292 | 157 |
| 399 | 3300005614 | Ga0068856_100180346 | Ga0068856_1001803462 | 157 |
| 400 | 3300005615 | Ga0070702_100142800 | Ga0070702_1001428002 | 157 |
| 401 | 3300005615 | Ga0070702_100243258 | Ga0070702_1002432581 | 157 |
| 402 | 3300005616 | Ga0068852_100100189 | Ga0068852_1001001892 | 157 |
| 403 | 3300005616 | Ga0068852_100113120 | Ga0068852_1001131202 | 157 |
| 404 | 3300005616 | Ga0068852_100291117 | Ga0068852_1002911172 | 157 |
| 405 | 3300005616 | Ga0068852_101141851 | Ga0068852_1011418511 | 157 |
| 406 | 3300005617 | Ga0068859_100083940 | Ga0068859_1000839402 | 157 |
| 407 | 3300005617 | Ga0068859_100246441 | Ga0068859_1002464412 | 157 |
| 408 | 3300005617 | Ga0068859_100310837 | Ga0068859_1003108372 | 157 |
| 409 | 3300005617 | Ga0068859_100531733 | Ga0068859_1005317332 | 157 |
| 410 | 3300005618 | Ga0068864_100082585 | Ga0068864_1000825852 | 157 |
| 411 | 3300005618 | Ga0068864_100097823 | Ga0068864_1000978233 | 157 |
| 412 | 3300005719 | Ga0068861_100057639 | Ga0068861_1000576392 | 157 |
| 413 | 3300005719 | Ga0068861_100130371 | Ga0068861_1001303712 | 157 |
| 414 | 3300005719 | Ga0068861_100131553 | Ga0068861_1001315532 | 157 |
| 415 | 3300005719 | Ga0068861_100191087 | Ga0068861_1001910873 | 157 |
| 416 | 3300005719 | Ga0068861_101020815 | Ga0068861_1010208151 | 157 |
| 417 | 3300005719 | Ga0068861_101220952 | Ga0068861_1012209522 | 157 |
| 418 | 3300005834 | Ga0068851_10098844 | Ga0068851_100988442 | 157 |
| 419 | 3300005840 | Ga0068870_10112336 | Ga0068870_101123362 | 157 |
| 420 | 3300005842 | Ga0068858_100347878 | Ga0068858_1003478782 | 157 |
| 421 | 3300005842 | Ga0068858_100453711 | Ga0068858_1004537112 | 157 |
| 422 | 3300005842 | Ga0068858_100512520 | Ga0068858_1005125201 | 157 |
| 423 | 3300005843 | Ga0068860_100000429 | Ga0068860_10000042940 | 157 |
| 424 | 3300005843 | Ga0068860_100249964 | Ga0068860_1002499642 | 157 |
| 425 | 3300005843 | Ga0068860_100289155 | Ga0068860_1002891552 | 157 |
| 426 | 3300005844 | Ga0068862_100066839 | Ga0068862_1000668392 | 157 |
| 427 | 3300005844 | Ga0068862_100196256 | Ga0068862_1001962562 | 157 |
| 428 | 3300005844 | Ga0068862_100326643 | Ga0068862_1003266432 | 157 |
| 429 | 3300005844 | Ga0068862_100772072 | Ga0068862_1007720721 | 157 |
| 430 | 3300005844 | Ga0068862_100934006 | Ga0068862_1009340062 | 157 |
| 431 | 3300005844 | Ga0068862_101153400 | Ga0068862_1011534002 | 157 |
| 432 | 3300005937 | Ga0081455_10003715 | Ga0081455_1000371511 | 157 |
| 433 | 3300005937 | Ga0081455_10017606 | Ga0081455_100176063 | 157 |
| 434 | 3300005937 | Ga0081455_10027966 | Ga0081455_100279661 | 157 |
| 435 | 3300005937 | Ga0081455_10041857 | Ga0081455_100418574 | 157 |
| 436 | 3300005937 | Ga0081455_10072038 | Ga0081455_100720382 | 157 |
| 437 | 3300005937 | Ga0081455_10217963 | Ga0081455_102179631 | 157 |
| 438 | 3300005937 | Ga0081455_10403567 | Ga0081455_104035671 | 157 |
| 439 | 3300005981 | Ga0081538_10178129 | Ga0081538_101781292 | 157 |
| 440 | 3300005983 | Ga0081540_1003319 | Ga0081540_100331914 | 157 |
| 441 | 3300005983 | Ga0081540_1006968 | Ga0081540_10069682 | 157 |
| 442 | 3300005983 | Ga0081540_1009221 | Ga0081540_10092216 | 157 |
| 443 | 3300005983 | Ga0081540_1009314 | Ga0081540_10093143 | 157 |
| 444 | 3300005983 | Ga0081540_1012667 | Ga0081540_10126672 | 157 |
| 445 | 3300005983 | Ga0081540_1013667 | Ga0081540_10136674 | 157 |
| 446 | 3300005983 | Ga0081540_1017966 | Ga0081540_10179661 | 157 |
| 447 | 3300005983 | Ga0081540_1081455 | Ga0081540_10814552 | 157 |
| 448 | 3300005983 | Ga0081540_1105461 | Ga0081540_11054612 | 157 |
| 449 | 3300005983 | Ga0081540_1217779 | Ga0081540_12177792 | 157 |
| 450 | 3300005985 | Ga0081539_10000824 | Ga0081539_1000082450 | 157 |
| 451 | 3300005985 | Ga0081539_10056696 | Ga0081539_100566963 | 157 |
| 452 | 3300006028 | Ga0070717_10000402 | Ga0070717_100004029 | 157 |
| 453 | 3300006038 | Ga0075365_10043534 | Ga0075365_100435342 | 157 |
| 454 | 3300006038 | Ga0075365_11028005 | Ga0075365_110280052 | 157 |
| 455 | 3300006042 | Ga0075368_10143274 | Ga0075368_101432741 | 157 |
| 456 | 3300006048 | Ga0075363_100088101 | Ga0075363_1000881012 | 157 |
| 457 | 3300006051 | Ga0075364_10084087 | Ga0075364_100840872 | 157 |
| 458 | 3300006051 | Ga0075364_10251323 | Ga0075364_102513232 | 157 |
| 459 | 3300006173 | Ga0070716_100144483 | Ga0070716_1001444832 | 157 |
| 460 | 3300006177 | Ga0075362_10065841 | Ga0075362_100658412 | 157 |
| 461 | 3300006177 | Ga0075362_10190338 | Ga0075362_101903382 | 157 |
| 462 | 3300006178 | Ga0075367_10089795 | Ga0075367_100897952 | 157 |
| 463 | 3300006178 | Ga0075367_10140923 | Ga0075367_101409232 | 157 |
| 464 | 3300006178 | Ga0075367_10231044 | Ga0075367_102310442 | 157 |
| 465 | 3300006178 | Ga0075367_10491269 | Ga0075367_104912691 | 157 |
| 466 | 3300006186 | Ga0075369_10026014 | Ga0075369_100260144 | 157 |
| 467 | 3300006186 | Ga0075369_10119017 | Ga0075369_101190172 | 157 |
| 468 | 3300006195 | Ga0075366_10076670 | Ga0075366_100766701 | 157 |
| 469 | 3300006195 | Ga0075366_10397838 | Ga0075366_103978381 | 157 |
| 470 | 3300006195 | Ga0075366_10457933 | Ga0075366_104579331 | 157 |
| 471 | 3300006237 | Ga0097621_100509737 | Ga0097621_1005097373 | 157 |
| 472 | 3300006353 | Ga0075370_10029377 | Ga0075370_100293772 | 157 |
| 473 | 3300006353 | Ga0075370_10114890 | Ga0075370_101148901 | 157 |
| 474 | 3300006353 | Ga0075370_10135641 | Ga0075370_101356412 | 157 |
| 475 | 3300006358 | Ga0068871_100048459 | Ga0068871_1000484592 | 157 |
| 476 | 3300006358 | Ga0068871_100508668 | Ga0068871_1005086682 | 157 |
| 477 | 3300006844 | Ga0075428_100105629 | Ga0075428_1001056292 | 157 |
| 478 | 3300006846 | Ga0075430_100882865 | Ga0075430_1008828652 | 157 |
| 479 | 3300006852 | Ga0075433_10432025 | Ga0075433_104320252 | 157 |
| 480 | 3300006871 | Ga0075434_100187512 | Ga0075434_1001875122 | 157 |
| 481 | 3300006871 | Ga0075434_100296278 | Ga0075434_1002962782 | 157 |
| 482 | 3300006871 | Ga0075434_100409718 | Ga0075434_1004097182 | 157 |
| 483 | 3300006880 | Ga0075429_100736317 | Ga0075429_1007363172 | 157 |
| 484 | 3300006914 | Ga0075436_100942288 | Ga0075436_1009422882 | 157 |
| 485 | 3300006931 | Ga0097620_100083940 | Ga0097620_1000839404 | 157 |
| 486 | 3300006931 | Ga0097620_100246428 | Ga0097620_1002464283 | 157 |
| 487 | 3300006931 | Ga0097620_100310853 | Ga0097620_1003108532 | 157 |
| 488 | 3300006931 | Ga0097620_100531750 | Ga0097620_1005317502 | 157 |
| 489 | 3300006941 | Ga0099825_1037135 | Ga0099825_10371352 | 157 |
| 490 | 3300006942 | Ga0099824_1010736 | Ga0099824_10107363 | 157 |
| 491 | 3300006943 | Ga0099822_1001873 | Ga0099822_10018736 | 157 |
| 492 | 3300009093 | Ga0105240_10071970 | Ga0105240_100719705 | 157 |
| 493 | 3300009093 | Ga0105240_10642011 | Ga0105240_106420112 | 157 |
| 494 | 3300009094 | Ga0111539_10589218 | Ga0111539_105892182 | 157 |
| 495 | 3300009098 | Ga0105245_10023512 | Ga0105245_100235122 | 157 |
| 496 | 3300009098 | Ga0105245_10025286 | Ga0105245_100252863 | 157 |
| 497 | 3300009101 | Ga0105247_10027726 | Ga0105247_100277265 | 157 |
| 498 | 3300009101 | Ga0105247_10108918 | Ga0105247_101089182 | 157 |
| 499 | 3300009147 | Ga0114129_11383353 | Ga0114129_113833532 | 157 |
| 500 | 3300009174 | Ga0105241_10032187 | Ga0105241_100321872 | 157 |
| 501 | 3300009174 | Ga0105241_10184354 | Ga0105241_101843542 | 157 |
| 502 | 3300009176 | Ga0105242_10424705 | Ga0105242_104247052 | 157 |
| 503 | 3300009176 | Ga0105242_10543040 | Ga0105242_105430402 | 157 |
| 504 | 3300009545 | Ga0105237_10027608 | Ga0105237_100276085 | 157 |
| 505 | 3300009545 | Ga0105237_10130645 | Ga0105237_101306451 | 157 |
| 506 | 3300009545 | Ga0105237_10465608 | Ga0105237_104656081 | 157 |
| 507 | 3300009545 | Ga0105237_11212590 | Ga0105237_112125901 | 157 |
| 508 | 3300009551 | Ga0105238_10247715 | Ga0105238_102477151 | 157 |
| 509 | 3300009551 | Ga0105238_10286808 | Ga0105238_102868082 | 157 |
| 510 | 3300009551 | Ga0105238_10548911 | Ga0105238_105489112 | 157 |
| 511 | 3300009553 | Ga0105249_10759582 | Ga0105249_107595822 | 157 |
| 512 | 3300010159 | Ga0099796_10366968 | Ga0099796_103669682 | 157 |
| 513 | 3300010375 | Ga0105239_10123545 | Ga0105239_101235452 | 157 |
| 514 | 3300010375 | Ga0105239_10124134 | Ga0105239_101241342 | 157 |
| 515 | 3300010375 | Ga0105239_10211103 | Ga0105239_102111032 | 157 |
| 516 | 3300010375 | Ga0105239_10580837 | Ga0105239_105808372 | 157 |
| 517 | 3300010375 | Ga0105239_10811210 | Ga0105239_108112102 | 157 |
| 518 | 3300010375 | Ga0105239_10929289 | Ga0105239_109292892 | 157 |
| 519 | 3300011119 | Ga0105246_10139869 | Ga0105246_101398692 | 157 |
| 520 | 3300011119 | Ga0105246_10194118 | Ga0105246_101941182 | 157 |
| 521 | 3300011119 | Ga0105246_11380111 | Ga0105246_113801111 | 157 |
| 522 | 3300013100 | Ga0157373_10183735 | Ga0157373_101837352 | 157 |
| 523 | 3300013102 | Ga0157371_10063398 | Ga0157371_100633982 | 157 |
| 524 | 3300013104 | Ga0157370_10077272 | Ga0157370_100772723 | 157 |
| 525 | 3300013105 | Ga0157369_10783463 | Ga0157369_107834631 | 157 |
| 526 | 3300013296 | Ga0157374_10012040 | Ga0157374_100120403 | 157 |
| 527 | 3300013297 | Ga0157378_10306046 | Ga0157378_103060462 | 157 |
| 528 | 3300013297 | Ga0157378_10562693 | Ga0157378_105626932 | 157 |
| 529 | 3300013297 | Ga0157378_10681486 | Ga0157378_106814863 | 157 |
| 530 | 3300013306 | Ga0163162_10060464 | Ga0163162_100604642 | 157 |
| 531 | 3300013306 | Ga0163162_10302734 | Ga0163162_103027342 | 157 |
| 532 | 3300013307 | Ga0157372_10289691 | Ga0157372_102896912 | 157 |
| 533 | 3300013307 | Ga0157372_10599113 | Ga0157372_105991132 | 157 |
| 534 | 3300013307 | Ga0157372_10630473 | Ga0157372_106304732 | 157 |
| 535 | 3300013307 | Ga0157372_13102837 | Ga0157372_131028371 | 157 |
| 536 | 3300013308 | Ga0157375_10026110 | Ga0157375_100261103 | 157 |
| 537 | 3300013308 | Ga0157375_10206529 | Ga0157375_102065292 | 157 |
| 538 | 3300013308 | Ga0157375_10320089 | Ga0157375_103200892 | 157 |
| 539 | 3300013308 | Ga0157375_10464493 | Ga0157375_104644932 | 157 |
| 540 | 3300014325 | Ga0163163_11333883 | Ga0163163_113338831 | 157 |
| 541 | 3300014326 | Ga0157380_10229183 | Ga0157380_102291832 | 157 |
| 542 | 3300014326 | Ga0157380_10593340 | Ga0157380_105933402 | 157 |
| 543 | 3300014745 | Ga0157377_10041917 | Ga0157377_100419172 | 157 |
| 544 | 3300014968 | Ga0157379_11236216 | Ga0157379_112362161 | 157 |
| 545 | 3300014969 | Ga0157376_10113354 | Ga0157376_101133542 | 157 |
| 546 | 3300014969 | Ga0157376_10659751 | Ga0157376_106597511 | 157 |
| 547 | 3300017792 | Ga0163161_10125502 | Ga0163161_101255022 | 157 |
| 548 | 3300017792 | Ga0163161_10260454 | Ga0163161_102604542 | 157 |
| 549 | 3300017792 | Ga0163161_10811286 | Ga0163161_108112862 | 157 |
| 550 | 3300021384 | Ga0213876_10110668 | Ga0213876_101106682 | 157 |
| 551 | 3300021384 | Ga0213876_10460959 | Ga0213876_104609592 | 157 |
| 552 | 3300021441 | Ga0213871_10037190 | Ga0213871_100371903 | 157 |
| 553 | 3300025245 | Ga0207425_1035486 | Ga0207425_10354862 | 157 |
| 554 | 3300025253 | Ga0209677_106670 | Ga0209677_1066702 | 157 |
| 555 | 3300025254 | Ga0209148_1005310 | Ga0209148_10053103 | 157 |
| 556 | 3300025261 | Ga0209233_1004579 | Ga0209233_10045792 | 157 |
| 557 | 3300025272 | Ga0209455_1002894 | Ga0209455_10028944 | 157 |
| 558 | 3300025272 | Ga0209455_1008301 | Ga0209455_10083012 | 157 |
| 559 | 3300025273 | Ga0209673_1054401 | Ga0209673_10544012 | 157 |
| 560 | 3300025295 | Ga0209564_1000401 | Ga0209564_100040180 | 157 |
| 561 | 3300025295 | Ga0209564_1022120 | Ga0209564_10221202 | 157 |
| 562 | 3300025297 | Ga0209758_1000011 | Ga0209758_1000011106 | 157 |
| 563 | 3300025297 | Ga0209758_1001959 | Ga0209758_100195913 | 157 |
| 564 | 3300025297 | Ga0209758_1002046 | Ga0209758_10020462 | 157 |
| 565 | 3300025297 | Ga0209758_1050262 | Ga0209758_10502622 | 157 |
| 566 | 3300025299 | Ga0209256_1005722 | Ga0209256_10057224 | 157 |
| 567 | 3300025304 | Ga0209257_1000620 | Ga0209257_100062025 | 157 |
| 568 | 3300025304 | Ga0209257_1000729 | Ga0209257_100072916 | 157 |
| 569 | 3300025304 | Ga0209257_1001767 | Ga0209257_10017674 | 157 |
| 570 | 3300025898 | Ga0207692_10111818 | Ga0207692_101118182 | 157 |
| 571 | 3300025899 | Ga0207642_10111716 | Ga0207642_101117163 | 157 |
| 572 | 3300025900 | Ga0207710_10200352 | Ga0207710_102003522 | 157 |
| 573 | 3300025901 | Ga0207688_10039440 | Ga0207688_100394402 | 157 |
| 574 | 3300025904 | Ga0207647_10177088 | Ga0207647_101770881 | 157 |
| 575 | 3300025906 | Ga0207699_10009649 | Ga0207699_100096493 | 157 |
| 576 | 3300025906 | Ga0207699_10268459 | Ga0207699_102684592 | 157 |
| 577 | 3300025906 | Ga0207699_10853197 | Ga0207699_108531972 | 157 |
| 578 | 3300025907 | Ga0207645_10119589 | Ga0207645_101195892 | 157 |
| 579 | 3300025908 | Ga0207643_10082378 | Ga0207643_100823782 | 157 |
| 580 | 3300025909 | Ga0207705_10525374 | Ga0207705_105253742 | 157 |
| 581 | 3300025910 | Ga0207684_10458146 | Ga0207684_104581462 | 157 |
| 582 | 3300025911 | Ga0207654_10077674 | Ga0207654_100776742 | 157 |
| 583 | 3300025912 | Ga0207707_10000404 | Ga0207707_100004045 | 157 |
| 584 | 3300025913 | Ga0207695_10325908 | Ga0207695_103259082 | 157 |
| 585 | 3300025914 | Ga0207671_10126577 | Ga0207671_101265772 | 157 |
| 586 | 3300025915 | Ga0207693_10131046 | Ga0207693_101310462 | 157 |
| 587 | 3300025916 | Ga0207663_10085506 | Ga0207663_100855062 | 157 |
| 588 | 3300025916 | Ga0207663_10745323 | Ga0207663_107453231 | 157 |
| 589 | 3300025917 | Ga0207660_10136755 | Ga0207660_101367552 | 157 |
| 590 | 3300025919 | Ga0207657_10116195 | Ga0207657_101161952 | 157 |
| 591 | 3300025920 | Ga0207649_10489154 | Ga0207649_104891541 | 157 |
| 592 | 3300025921 | Ga0207652_10493807 | Ga0207652_104938072 | 157 |
| 593 | 3300025922 | Ga0207646_11313267 | Ga0207646_113132672 | 157 |
| 594 | 3300025924 | Ga0207694_10251664 | Ga0207694_102516642 | 157 |
| 595 | 3300025924 | Ga0207694_10985498 | Ga0207694_109854981 | 157 |
| 596 | 3300025925 | Ga0207650_10191098 | Ga0207650_101910982 | 157 |
| 597 | 3300025927 | Ga0207687_10012593 | Ga0207687_100125933 | 157 |
| 598 | 3300025927 | Ga0207687_10013063 | Ga0207687_100130633 | 157 |
| 599 | 3300025927 | Ga0207687_10185994 | Ga0207687_101859942 | 157 |
| 600 | 3300025928 | Ga0207700_10090898 | Ga0207700_100908983 | 157 |
| 601 | 3300025928 | Ga0207700_10387267 | Ga0207700_103872672 | 157 |
| 602 | 3300025928 | Ga0207700_10635373 | Ga0207700_106353732 | 157 |
| 603 | 3300025929 | Ga0207664_10027721 | Ga0207664_100277213 | 157 |
| 604 | 3300025929 | Ga0207664_10325808 | Ga0207664_103258082 | 157 |
| 605 | 3300025929 | Ga0207664_10525304 | Ga0207664_105253042 | 157 |
| 606 | 3300025929 | Ga0207664_10688085 | Ga0207664_106880852 | 157 |
| 607 | 3300025931 | Ga0207644_10421888 | Ga0207644_104218882 | 157 |
| 608 | 3300025932 | Ga0207690_10192603 | Ga0207690_101926032 | 157 |
| 609 | 3300025932 | Ga0207690_10220162 | Ga0207690_102201621 | 157 |
| 610 | 3300025933 | Ga0207706_10080875 | Ga0207706_100808752 | 157 |
| 611 | 3300025933 | Ga0207706_10125365 | Ga0207706_101253652 | 157 |
| 612 | 3300025933 | Ga0207706_10376636 | Ga0207706_103766362 | 157 |
| 613 | 3300025933 | Ga0207706_10676698 | Ga0207706_106766982 | 157 |
| 614 | 3300025933 | Ga0207706_11030939 | Ga0207706_110309392 | 157 |
| 615 | 3300025935 | Ga0207709_10511112 | Ga0207709_105111122 | 157 |
| 616 | 3300025936 | Ga0207670_10934202 | Ga0207670_109342021 | 157 |
| 617 | 3300025939 | Ga0207665_10132626 | Ga0207665_101326262 | 157 |
| 618 | 3300025939 | Ga0207665_11032809 | Ga0207665_110328091 | 157 |
| 619 | 3300025940 | Ga0207691_11333352 | Ga0207691_113333522 | 157 |
| 620 | 3300025942 | Ga0207689_10072170 | Ga0207689_100721703 | 157 |
| 621 | 3300025942 | Ga0207689_10136519 | Ga0207689_101365193 | 157 |
| 622 | 3300025945 | Ga0207679_10245220 | Ga0207679_102452202 | 157 |
| 623 | 3300025945 | Ga0207679_10425123 | Ga0207679_104251232 | 157 |
| 624 | 3300025949 | Ga0207667_10526987 | Ga0207667_105269872 | 157 |
| 625 | 3300025972 | Ga0207668_10021291 | Ga0207668_100212912 | 157 |
| 626 | 3300025972 | Ga0207668_10388625 | Ga0207668_103886251 | 157 |
| 627 | 3300025972 | Ga0207668_11124563 | Ga0207668_111245632 | 157 |
| 628 | 3300025981 | Ga0207640_10142912 | Ga0207640_101429122 | 157 |
| 629 | 3300025981 | Ga0207640_10317412 | Ga0207640_103174122 | 157 |
| 630 | 3300025981 | Ga0207640_10777567 | Ga0207640_107775672 | 157 |
| 631 | 3300025981 | Ga0207640_10815082 | Ga0207640_108150822 | 157 |
| 632 | 3300025986 | Ga0207658_10237544 | Ga0207658_102375441 | 157 |
| 633 | 3300026035 | Ga0207703_10060810 | Ga0207703_100608102 | 157 |
| 634 | 3300026035 | Ga0207703_10232504 | Ga0207703_102325042 | 157 |
| 635 | 3300026035 | Ga0207703_10370247 | Ga0207703_103702472 | 157 |
| 636 | 3300026067 | Ga0207678_10007944 | Ga0207678_100079447 | 157 |
| 637 | 3300026067 | Ga0207678_10032510 | Ga0207678_100325102 | 157 |
| 638 | 3300026067 | Ga0207678_10100203 | Ga0207678_101002031 | 157 |
| 639 | 3300026067 | Ga0207678_10238907 | Ga0207678_102389072 | 157 |
| 640 | 3300026067 | Ga0207678_10249150 | Ga0207678_102491502 | 157 |
| 641 | 3300026067 | Ga0207678_10424251 | Ga0207678_104242512 | 157 |
| 642 | 3300026067 | Ga0207678_10534297 | Ga0207678_105342972 | 157 |
| 643 | 3300026067 | Ga0207678_10593999 | Ga0207678_105939992 | 157 |
| 644 | 3300026067 | Ga0207678_11054754 | Ga0207678_110547541 | 157 |
| 645 | 3300026075 | Ga0207708_10127239 | Ga0207708_101272392 | 157 |
| 646 | 3300026078 | Ga0207702_10112696 | Ga0207702_101126962 | 157 |
| 647 | 3300026088 | Ga0207641_10063006 | Ga0207641_100630063 | 157 |
| 648 | 3300026088 | Ga0207641_11279738 | Ga0207641_112797382 | 157 |
| 649 | 3300026089 | Ga0207648_10019660 | Ga0207648_100196604 | 157 |
| 650 | 3300026089 | Ga0207648_10215453 | Ga0207648_102154532 | 157 |
| 651 | 3300026095 | Ga0207676_10112890 | Ga0207676_101128902 | 157 |
| 652 | 3300026095 | Ga0207676_10361949 | Ga0207676_103619492 | 157 |
| 653 | 3300026095 | Ga0207676_10527987 | Ga0207676_105279872 | 157 |
| 654 | 3300026116 | Ga0207674_10111629 | Ga0207674_101116293 | 157 |
| 655 | 3300026116 | Ga0207674_10265186 | Ga0207674_102651862 | 157 |
| 656 | 3300026116 | Ga0207674_10942005 | Ga0207674_109420051 | 157 |
| 657 | 3300026118 | Ga0207675_100057494 | Ga0207675_1000574944 | 157 |
| 658 | 3300026118 | Ga0207675_100069301 | Ga0207675_1000693014 | 157 |
| 659 | 3300026118 | Ga0207675_100105190 | Ga0207675_1001051903 | 157 |
| 660 | 3300026118 | Ga0207675_100200406 | Ga0207675_1002004062 | 157 |
| 661 | 3300026118 | Ga0207675_100318308 | Ga0207675_1003183082 | 157 |
| 662 | 3300026121 | Ga0207683_10049361 | Ga0207683_100493613 | 157 |
| 663 | 3300026121 | Ga0207683_11006598 | Ga0207683_110065982 | 157 |
| 664 | 3300026142 | Ga0207698_10295555 | Ga0207698_102955552 | 157 |
| 665 | 3300027357 | Ga0209589_1000001 | Ga0209589_1000001711 | 157 |
| 666 | 3300027361 | Ga0209489_100001 | Ga0209489_100001711 | 157 |
| 667 | 3300027363 | Ga0209700_100001 | Ga0209700_100001711 | 157 |
| 668 | 3300027866 | Ga0209813_10041706 | Ga0209813_100417062 | 157 |
| 669 | 3300027907 | Ga0207428_10235629 | Ga0207428_102356292 | 157 |
| 670 | 3300028379 | Ga0268266_10348365 | Ga0268266_103483652 | 157 |
| 671 | 3300028379 | Ga0268266_10403373 | Ga0268266_104033732 | 157 |
| 672 | 3300028379 | Ga0268266_10522194 | Ga0268266_105221942 | 157 |
| 673 | 3300028379 | Ga0268266_11135391 | Ga0268266_111353912 | 157 |
| 674 | 3300028379 | Ga0268266_11339074 | Ga0268266_113390741 | 157 |
| 675 | 3300028380 | Ga0268265_10065954 | Ga0268265_100659542 | 157 |
| 676 | 3300028380 | Ga0268265_10466837 | Ga0268265_104668372 | 157 |
| 677 | 3300028380 | Ga0268265_10840534 | Ga0268265_108405341 | 157 |
| 678 | 3300028380 | Ga0268265_10967213 | Ga0268265_109672132 | 157 |
| 679 | 3300028381 | Ga0268264_10000048 | Ga0268264_10000048239 | 157 |
| 680 | 3300028381 | Ga0268264_10105922 | Ga0268264_101059222 | 157 |
| 681 | 3300028381 | Ga0268264_10228119 | Ga0268264_102281192 | 157 |
| 682 | 3300028381 | Ga0268264_10758289 | Ga0268264_107582892 | 157 |
| 683 | 3300028556 | Ga0265337_1014325 | Ga0265337_10143251 | 157 |
| 684 | 3300028577 | Ga0265318_10055792 | Ga0265318_100557922 | 157 |
| 685 | 3300028666 | Ga0265336_10002023 | Ga0265336_100020232 | 157 |
| 686 | 3300028786 | Ga0307517_10401190 | Ga0307517_104011902 | 157 |
| 687 | 3300028786 | Ga0307517_10516633 | Ga0307517_105166331 | 157 |
| 688 | 3300028794 | Ga0307515_10055742 | Ga0307515_100557424 | 157 |
| 689 | 3300028794 | Ga0307515_10251366 | Ga0307515_102513662 | 157 |
| 690 | 3300028800 | Ga0265338_10000034 | Ga0265338_1000003425 | 157 |
| 691 | 3300029957 | Ga0265324_10008520 | Ga0265324_100085202 | 157 |
| 692 | 3300030521 | Ga0307511_10259389 | Ga0307511_102593892 | 157 |
| 693 | 3300031238 | Ga0265332_10020911 | Ga0265332_100209113 | 157 |
| 694 | 3300031238 | Ga0265332_10026357 | Ga0265332_100263573 | 157 |
| 695 | 3300031239 | Ga0265328_10107591 | Ga0265328_101075912 | 157 |
| 696 | 3300031241 | Ga0265325_10055816 | Ga0265325_100558162 | 157 |
| 697 | 3300031247 | Ga0265340_10486088 | Ga0265340_104860881 | 157 |
| 698 | 3300031249 | Ga0265339_10094694 | Ga0265339_100946941 | 157 |
| 699 | 3300031250 | Ga0265331_10125071 | Ga0265331_101250712 | 157 |
| 700 | 3300031344 | Ga0265316_10202469 | Ga0265316_102024692 | 157 |
| 701 | 3300031344 | Ga0265316_10847007 | Ga0265316_108470072 | 157 |
| 702 | 3300031456 | Ga0307513_10124063 | Ga0307513_101240632 | 157 |
| 703 | 3300031507 | Ga0307509_10004515 | Ga0307509_100045157 | 157 |
| 704 | 3300031507 | Ga0307509_10083761 | Ga0307509_100837611 | 157 |
| 705 | 3300031507 | Ga0307509_10242489 | Ga0307509_102424892 | 157 |
| 706 | 3300031507 | Ga0307509_10468063 | Ga0307509_104680632 | 157 |
| 707 | 3300031548 | Ga0307408_100468626 | Ga0307408_1004686261 | 157 |
| 708 | 3300031595 | Ga0265313_10215668 | Ga0265313_102156681 | 157 |
| 709 | 3300031616 | Ga0307508_10124432 | Ga0307508_101244322 | 157 |
| 710 | 3300031616 | Ga0307508_10350129 | Ga0307508_103501292 | 157 |
| 711 | 3300031711 | Ga0265314_10055608 | Ga0265314_100556082 | 157 |
| 712 | 3300031711 | Ga0265314_10142572 | Ga0265314_101425721 | 157 |
| 713 | 3300031712 | Ga0265342_10201252 | Ga0265342_102012522 | 157 |
| 714 | 3300031730 | Ga0307516_10010023 | Ga0307516_100100236 | 157 |
| 715 | 3300031730 | Ga0307516_10183347 | Ga0307516_101833472 | 157 |
| 716 | 3300031730 | Ga0307516_10382672 | Ga0307516_103826722 | 157 |
| 717 | 3300031911 | Ga0307412_10169904 | Ga0307412_101699042 | 157 |
| 718 | 3300031911 | Ga0307412_10235461 | Ga0307412_102354612 | 157 |
| 719 | 3300031995 | Ga0307409_100056209 | Ga0307409_1000562093 | 157 |
| 720 | 3300032002 | Ga0307416_100350332 | Ga0307416_1003503322 | 157 |
| 721 | 3300032002 | Ga0307416_100377813 | Ga0307416_1003778131 | 157 |
| 722 | 3300033179 | Ga0307507_10043168 | Ga0307507_100431681 | 157 |
| 723 | 3300033180 | Ga0307510_10006198 | Ga0307510_100061982 | 157 |
| 724 | 3300033180 | Ga0307510_10230653 | Ga0307510_102306532 | 157 |
| 725 | 3300033442 | Ga0315911_1000002 | Ga0315911_1000002374 | 157 |
| 726 | 3300035089 | Ga0373944_0012406 | Ga0373944_0012406_1401_1877 | 157 |
| 727 | 3300035111 | Ga0373923_0005649 | Ga0373923_0005649_1397_1873 | 157 |
| 728 | 3300035112 | Ga0373932_0256459 | Ga0373932_0256459_39_551 | 157 |
| 729 | 3300035113 | Ga0373936_0003425 | Ga0373936_0003425_3710_4186 | 157 |
| 730 | 3300035113 | Ga0373936_0079192 | Ga0373936_0079192_43_519 | 157 |
| 731 | 3300035114 | Ga0373939_0093342 | Ga0373939_0093342_390_866 | 157 |
| 732 | 3300035115 | Ga0373941_0074741 | Ga0373941_0074741_307_789 | 157 |
| 733 | 3300035116 | Ga0373945_0050258 | Ga0373945_0050258_162_638 | 157 |
| 734 | 3300035117 | Ga0373953_0046725 | Ga0373953_0046725_264_740 | 157 |
| 735 | 3300035119 | Ga0373956_0004560 | Ga0373956_0004560_501_977 | 157 |
| 736 | 3300035120 | Ga0373957_0034710 | Ga0373957_0034710_1068_1544 | 157 |
| 737 | 3300035170 | Ga0373943_0153100 | Ga0373943_0153100_688_1164 | 157 |
| 738 | 3300035170 | Ga0373943_0306457 | Ga0373943_0306457_137_613 | 157 |
| 739 | 3300035171 | Ga0373946_0022449 | Ga0373946_0022449_1061_1537 | 157 |
| 740 | 3300035410 | Ga0373924_0057151 | Ga0373924_0057151_1046_1522 | 157 |
| 741 | 3300035692 | Ga0373935_0101957 | Ga0373935_0101957_1404_1880 | 157 |
| 742 | 3300035692 | Ga0373935_0712163 | Ga0373935_0712163_213_689 | 157 |
| 743 | 3300035695 | Ga0373927_0089176 | Ga0373927_0089176_1186_1662 | 157 |
| 744 | 3300035695 | Ga0373927_0264690 | Ga0373927_0264690_246_722 | 157 |
| 745 | 3300035724 | Ga0373933_0262592 | Ga0373933_0262592_220_696 | 157 |
| 746 | 3300035724 | Ga0373933_0685728 | Ga0373933_0685728_108_584 | 157 |
| 747 | 3300035725 | Ga0373947_0051973 | Ga0373947_0051973_29_505 | 157 |
| 748 | 3300035725 | Ga0373947_0887615 | Ga0373947_0887615_89_565 | 157 |
| 749 | 3300036459 | Ga0372808_012541 | Ga0372808_012541_78_575 | 157 |
| 750 | 3300037068 | Ga0373925_0095058 | Ga0373925_0095058_409_885 | 157 |
| 751 | 3300037068 | Ga0373925_0112212 | Ga0373925_0112212_575_1051 | 157 |
| 752 | 3300037068 | Ga0373925_0693607 | Ga0373925_0693607_266_742 | 157 |
| 753 | 3300037312 | Ga0395899_0441481 | Ga0395899_0441481_240_716 | 157 |
| 754 | 3300037418 | Ga0395900_0062919 | Ga0395900_0062919_2058_2534 | 157 |
| 755 | 3300037466 | Ga0395898_0209258 | Ga0395898_0209258_666_1142 | 157 |
| 756 | 3300037853 | Ga0436364_0169791 | Ga0436364_0169791_89_565 | 157 |
| 757 | 3300037853 | Ga0436364_1233393 | Ga0436364_1233393_758_1234 | 157 |
| 758 | 3300037853 | Ga0436364_1554191 | Ga0436364_1554191_20_496 | 157 |
| 759 | 3300039437 | Ga0436365_0191780 | Ga0436365_0191780_2590_3066 | 157 |
| 760 | 3300039437 | Ga0436365_0251377 | Ga0436365_0251377_822_1298 | 157 |
| 761 | 3300039437 | Ga0436365_0393739 | Ga0436365_0393739_276_755 | 157 |
| 762 | 3300039437 | Ga0436365_1908037 | Ga0436365_1908037_1621_2097 | 157 |
| 763 | 3300039447 | Ga0436361_1005768 | Ga0436361_1005768_276_764 | 157 |
| 764 | 3300039450 | Ga0436363_1267832 | Ga0436363_1267832_214_690 | 157 |
| 765 | 3300041460 | Ga0451802_0888262 | Ga0451802_0888262_505_987 | 157 |
| 766 | 3300041496 | Ga0451839_1007315 | Ga0451839_1007315_214_696 | 157 |
| 767 | 3300041507 | Ga0451851_0273039 | Ga0451851_0273039_54_530 | 157 |
| 768 | 3300041512 | Ga0451853_2445747 | Ga0451853_2445747_227_703 | 157 |
| 769 | 3300044658 | Ga0466972_0030619 | Ga0466972_0030619_1427_1903 | 157 |
| 770 | 3300044683 | Ga0466965_0403188 | Ga0466965_0403188_106_582 | 157 |
| 771 | 3300044683 | Ga0466965_0684660 | Ga0466965_0684660_91_567 | 157 |
| 772 | 3300044694 | Ga0466963_0247985 | Ga0466963_0247985_296_772 | 157 |
| 773 | 3300044735 | Ga0466968_0016849 | Ga0466968_0016849_1278_1754 | 157 |
| 774 | 3300044842 | Ga0466957_0143835 | Ga0466957_0143835_183_659 | 157 |
| 775 | 3300044842 | Ga0466957_0187965 | Ga0466957_0187965_82_558 | 157 |
| 776 | 3300044901 | Ga0466960_0009101 | Ga0466960_0009101_1384_1860 | 157 |
| 777 | 3300045049 | Ga0466959_0440227 | Ga0466959_0440227_254_730 | 157 |
| 778 | 3300045836 | Ga0466958_0159600 | Ga0466958_0159600_505_996 | 157 |
| 779 | 3300045976 | Ga0466967_0140209 | Ga0466967_0140209_1243_1719 | 157 |
| 780 | 3300045976 | Ga0466967_0458301 | Ga0466967_0458301_313_789 | 157 |
| 781 | 3300046452 | Ga0495617_026835 | Ga0495617_026835_363_839 | 157 |
| 782 | 3300046454 | Ga0495592_0061168 | Ga0495592_0061168_1906_2382 | 157 |
| 783 | 3300046455 | Ga0495603_0033212 | Ga0495603_0033212_828_1304 | 157 |
| 784 | 3300046455 | Ga0495603_0130525 | Ga0495603_0130525_223_699 | 157 |
| 785 | 3300046455 | Ga0495603_0177669 | Ga0495603_0177669_126_602 | 157 |
| 786 | 3300046457 | Ga0495590_0051207 | Ga0495590_0051207_865_1356 | 157 |
| 787 | 3300046457 | Ga0495590_0053608 | Ga0495590_0053608_799_1275 | 157 |
| 788 | 3300046458 | Ga0495591_090943 | Ga0495591_090943_131_607 | 157 |
| 789 | 3300046459 | Ga0495629_0256266 | Ga0495629_0256266_566_1042 | 157 |
| 790 | 3300046459 | Ga0495629_0395399 | Ga0495629_0395399_77_553 | 157 |
| 791 | 3300046460 | Ga0495638_0023696 | Ga0495638_0023696_2728_3204 | 157 |
| 792 | 3300046460 | Ga0495638_0099406 | Ga0495638_0099406_517_1008 | 157 |
| 793 | 3300046460 | Ga0495638_0114000 | Ga0495638_0114000_221_709 | 157 |
| 794 | 3300046460 | Ga0495638_0620069 | Ga0495638_0620069_14_496 | 157 |
| 795 | 3300046461 | Ga0495641_0080026 | Ga0495641_0080026_808_1284 | 157 |
| 796 | 3300046462 | Ga0495651_0339234 | Ga0495651_0339234_404_880 | 157 |
| 797 | 3300046472 | Ga0495580_0022608 | Ga0495580_0022608_1577_2053 | 157 |
| 798 | 3300046473 | Ga0495582_0283876 | Ga0495582_0283876_427_903 | 157 |
| 799 | 3300046474 | Ga0495605_0069318 | Ga0495605_0069318_935_1411 | 157 |
| 800 | 3300046475 | Ga0495639_0046128 | Ga0495639_0046128_485_961 | 157 |
| 801 | 3300046475 | Ga0495639_0203940 | Ga0495639_0203940_462_938 | 157 |
| 802 | 3300046477 | Ga0495664_0014560 | Ga0495664_0014560_2582_3058 | 157 |
| 803 | 3300046477 | Ga0495664_0018042 | Ga0495664_0018042_1243_1731 | 157 |
| 804 | 3300046477 | Ga0495664_0443451 | Ga0495664_0443451_43_519 | 157 |
| 805 | 3300046491 | Ga0495584_0288698 | Ga0495584_0288698_342_818 | 157 |
| 806 | 3300046491 | Ga0495584_0319164 | Ga0495584_0319164_41_517 | 157 |
| 807 | 3300046492 | Ga0495585_0037608 | Ga0495585_0037608_13_489 | 157 |
| 808 | 3300046499 | Ga0495594_0166812 | Ga0495594_0166812_89_565 | 157 |
| 809 | 3300046499 | Ga0495594_0169486 | Ga0495594_0169486_150_626 | 157 |
| 810 | 3300046499 | Ga0495594_0306414 | Ga0495594_0306414_22_504 | 157 |
| 811 | 3300046500 | Ga0495596_0045661 | Ga0495596_0045661_906_1382 | 157 |
| 812 | 3300046506 | Ga0495583_0081116 | Ga0495583_0081116_705_1196 | 157 |
| 813 | 3300046506 | Ga0495583_0109194 | Ga0495583_0109194_347_847 | 157 |
| 814 | 3300046506 | Ga0495583_0135597 | Ga0495583_0135597_220_696 | 157 |
| 815 | 3300046507 | Ga0495606_0071103 | Ga0495606_0071103_1429_1905 | 157 |
| 816 | 3300046507 | Ga0495606_0147760 | Ga0495606_0147760_870_1361 | 157 |
| 817 | 3300046507 | Ga0495606_0187395 | Ga0495606_0187395_179_679 | 157 |
| 818 | 3300046507 | Ga0495606_0354754 | Ga0495606_0354754_15_491 | 157 |
| 819 | 3300046513 | Ga0495616_0102274 | Ga0495616_0102274_432_923 | 157 |
| 820 | 3300046513 | Ga0495616_0156388 | Ga0495616_0156388_95_595 | 157 |
| 821 | 3300046513 | Ga0495616_0236608 | Ga0495616_0236608_278_754 | 157 |
| 822 | 3300046515 | Ga0495620_0009664 | Ga0495620_0009664_3935_4426 | 157 |
| 823 | 3300046515 | Ga0495620_0055613 | Ga0495620_0055613_486_962 | 157 |
| 824 | 3300046515 | Ga0495620_0070892 | Ga0495620_0070892_157_657 | 157 |
| 825 | 3300046516 | Ga0495628_0366569 | Ga0495628_0366569_198_674 | 157 |
| 826 | 3300046516 | Ga0495628_0426945 | Ga0495628_0426945_344_820 | 157 |
| 827 | 3300046518 | Ga0495631_0018925 | Ga0495631_0018925_2178_2654 | 157 |
| 828 | 3300046518 | Ga0495631_0024875 | Ga0495631_0024875_1736_2227 | 157 |
| 829 | 3300046519 | Ga0495632_0055899 | Ga0495632_0055899_690_1181 | 157 |
| 830 | 3300046519 | Ga0495632_0089356 | Ga0495632_0089356_576_1052 | 157 |
| 831 | 3300046519 | Ga0495632_0166745 | Ga0495632_0166745_307_783 | 157 |
| 832 | 3300046520 | Ga0495637_0061832 | Ga0495637_0061832_174_665 | 157 |
| 833 | 3300046522 | Ga0495643_0121160 | Ga0495643_0121160_603_1094 | 157 |
| 834 | 3300046524 | Ga0495648_0171844 | Ga0495648_0171844_548_1024 | 157 |
| 835 | 3300046526 | Ga0495666_0177575 | Ga0495666_0177575_20_496 | 157 |
| 836 | 3300046529 | Ga0495652_0220869 | Ga0495652_0220869_151_627 | 157 |
| 837 | 3300046530 | Ga0495654_0032434 | Ga0495654_0032434_1021_1512 | 157 |
| 838 | 3300046533 | Ga0495640_0204182 | Ga0495640_0204182_674_1150 | 157 |
| 839 | 3300046533 | Ga0495640_0390579 | Ga0495640_0390579_322_798 | 157 |
| 840 | 3300046537 | Ga0495598_0011017 | Ga0495598_0011017_774_1256 | 157 |
| 841 | 3300046538 | Ga0495609_0069068 | Ga0495609_0069068_610_1086 | 157 |
| 842 | 3300046539 | Ga0495621_0020483 | Ga0495621_0020483_216_692 | 157 |
| 843 | 3300046542 | Ga0495597_0145358 | Ga0495597_0145358_427_903 | 157 |
| 844 | 3300046543 | Ga0495645_0013656 | Ga0495645_0013656_1489_1977 | 157 |
| 845 | 3300046543 | Ga0495645_0205321 | Ga0495645_0205321_714_1190 | 157 |
| 846 | 3300046557 | Ga0495622_0043031 | Ga0495622_0043031_573_1049 | 157 |
| 847 | 3300046557 | Ga0495622_0092790 | Ga0495622_0092790_153_629 | 157 |
| 848 | 3300046558 | Ga0495633_0223714 | Ga0495633_0223714_96_572 | 157 |
| 849 | 3300046559 | Ga0495667_0263494 | Ga0495667_0263494_355_837 | 157 |
| 850 | 3300046559 | Ga0495667_0313959 | Ga0495667_0313959_403_879 | 157 |
| 851 | 3300046615 | Ga0495656_0009134 | Ga0495656_0009134_2980_3456 | 157 |
| 852 | 3300046615 | Ga0495656_0074587 | Ga0495656_0074587_431_913 | 157 |
| 853 | 3300046615 | Ga0495656_0122454 | Ga0495656_0122454_686_1162 | 157 |
| 854 | 3300046616 | Ga0495668_0032051 | Ga0495668_0032051_1143_1634 | 157 |
| 855 | 3300046616 | Ga0495668_0086409 | Ga0495668_0086409_540_1016 | 157 |
| 856 | 3300046616 | Ga0495668_0285397 | Ga0495668_0285397_352_828 | 157 |
| 857 | 3300046616 | Ga0495668_0382603 | Ga0495668_0382603_44_544 | 157 |
| 858 | 3300046642 | Ga0495634_0016562 | Ga0495634_0016562_4385_4861 | 157 |
| 859 | 3300046642 | Ga0495634_0293367 | Ga0495634_0293367_104_580 | 157 |
| 860 | 3300046648 | Ga0495611_0043449 | Ga0495611_0043449_1432_1908 | 157 |
| 861 | 3300046648 | Ga0495611_0151438 | Ga0495611_0151438_184_675 | 157 |
| 862 | 3300046648 | Ga0495611_0187645 | Ga0495611_0187645_159_635 | 157 |
| 863 | 3300046660 | Ga0495625_0087742 | Ga0495625_0087742_584_1060 | 157 |
| 864 | 3300046660 | Ga0495625_0129626 | Ga0495625_0129626_714_1205 | 157 |
| 865 | 3300046660 | Ga0495625_0184281 | Ga0495625_0184281_626_1102 | 157 |
| 866 | 3300046660 | Ga0495625_0332132 | Ga0495625_0332132_239_739 | 157 |
| 867 | 3300046660 | Ga0495625_0489730 | Ga0495625_0489730_211_687 | 157 |
| 868 | 3300046660 | Ga0495625_0597809 | Ga0495625_0597809_146_628 | 157 |
| 869 | 3300046660 | Ga0495625_0696616 | Ga0495625_0696616_101_583 | 157 |
| 870 | 3300046663 | Ga0495635_0147910 | Ga0495635_0147910_10_486 | 157 |
| 871 | 3300046664 | Ga0495659_0085540 | Ga0495659_0085540_159_635 | 157 |
| 872 | 3300046664 | Ga0495659_0101804 | Ga0495659_0101804_529_1011 | 157 |
| 873 | 3300046665 | Ga0495661_0009212 | Ga0495661_0009212_191_682 | 157 |
| 874 | 3300046678 | Ga0495599_0164886 | Ga0495599_0164886_109_585 | 157 |
| 875 | 3300046678 | Ga0495599_0497993 | Ga0495599_0497993_123_611 | 157 |
| 876 | 3300046678 | Ga0495599_0565641 | Ga0495599_0565641_128_604 | 157 |
| 877 | 3300046678 | Ga0495599_0640760 | Ga0495599_0640760_10_486 | 157 |
| 878 | 3300046680 | Ga0495646_0341797 | Ga0495646_0341797_50_526 | 157 |
| 879 | 3300046681 | Ga0495647_0008590 | Ga0495647_0008590_2886_3362 | 157 |
| 880 | 3300046683 | Ga0495658_0104092 | Ga0495658_0104092_506_982 | 157 |
| 881 | 3300046684 | Ga0495669_0061526 | Ga0495669_0061526_774_1250 | 157 |
| 882 | 3300046684 | Ga0495669_0121917 | Ga0495669_0121917_403_885 | 157 |
| 883 | 3300046684 | Ga0495669_0317477 | Ga0495669_0317477_134_616 | 157 |
| 884 | 3300046689 | Ga0495613_0236572 | Ga0495613_0236572_721_1197 | 157 |
| 885 | 3300046690 | Ga0495624_0144728 | Ga0495624_0144728_944_1420 | 157 |
| 886 | 3300046691 | Ga0495670_0055014 | Ga0495670_0055014_890_1372 | 157 |
| 887 | 3300046691 | Ga0495670_0176288 | Ga0495670_0176288_474_950 | 157 |
| 888 | 3300046691 | Ga0495670_0315804 | Ga0495670_0315804_189_680 | 157 |
| 889 | 3300046692 | Ga0495671_0022803 | Ga0495671_0022803_384_860 | 157 |
| 890 | 3300046692 | Ga0495671_0054884 | Ga0495671_0054884_558_1049 | 157 |
| 891 | 3300046692 | Ga0495671_0448922 | Ga0495671_0448922_68_544 | 157 |
| 892 | 3300046694 | Ga0495649_0091380 | Ga0495649_0091380_791_1291 | 157 |
| 893 | 3300046694 | Ga0495649_0158538 | Ga0495649_0158538_527_1015 | 157 |
| 894 | 3300046694 | Ga0495649_0291367 | Ga0495649_0291367_337_813 | 157 |
| 895 | 3300046794 | Ga0495589_0248476 | Ga0495589_0248476_91_567 | 157 |
| 896 | 3300046810 | Ga0495660_0062347 | Ga0495660_0062347_870_1361 | 157 |
| 897 | 3300046810 | Ga0495660_0227078 | Ga0495660_0227078_324_800 | 157 |
| 898 | 3300047315 | Ga0495581_0189155 | Ga0495581_0189155_240_722 | 157 |
| 899 | 3300047319 | Ga0495674_0001682 | Ga0495674_0001682_16090_16566 | 157 |
| 900 | 3300047319 | Ga0495674_0389363 | Ga0495674_0389363_76_552 | 157 |
| 901 | 3300047320 | Ga0495672_0013335 | Ga0495672_0013335_5122_5598 | 157 |
| 902 | 3300047320 | Ga0495672_0166329 | Ga0495672_0166329_120_596 | 157 |
| 903 | 3300047320 | Ga0495672_0249953 | Ga0495672_0249953_183_674 | 157 |
| 904 | 3300047321 | Ga0495676_0050628 | Ga0495676_0050628_816_1292 | 157 |
| 905 | 3300047321 | Ga0495676_0214456 | Ga0495676_0214456_778_1254 | 157 |
| 906 | 3300047321 | Ga0495676_0696254 | Ga0495676_0696254_131_613 | 157 |
| 907 | 3300047323 | Ga0495683_0196897 | Ga0495683_0196897_43_543 | 157 |
| 908 | 3300047445 | Ga0495677_0087812 | Ga0495677_0087812_496_972 | 157 |
| 909 | 3300047469 | Ga0495673_0144799 | Ga0495673_0144799_246_722 | 157 |
| 910 | 3300047469 | Ga0495673_0236043 | Ga0495673_0236043_137_628 | 157 |
| 911 | 3300047471 | Ga0495684_0061433 | Ga0495684_0061433_1320_1796 | 157 |
| 912 | 3300047472 | Ga0495686_0030975 | Ga0495686_0030975_107_598 | 157 |
| 913 | 3300047472 | Ga0495686_0120640 | Ga0495686_0120640_439_915 | 157 |
| 914 | 3300047472 | Ga0495686_0160239 | Ga0495686_0160239_516_992 | 157 |
| 915 | 3300047472 | Ga0495686_0393509 | Ga0495686_0393509_255_731 | 157 |
| 916 | 3300047673 | Ga0495593_0004032 | Ga0495593_0004032_1572_2048 | 157 |
| 917 | 3300047673 | Ga0495593_0361226 | Ga0495593_0361226_168_644 | 157 |
| 918 | 3300047673 | Ga0495593_0396947 | Ga0495593_0396947_178_660 | 157 |
| 919 | 3300048091 | Ga0495626_0017083 | Ga0495626_0017083_2930_3421 | 157 |
| 920 | 3300048091 | Ga0495626_0290535 | Ga0495626_0290535_145_621 | 157 |
| 921 | 3300048903 | Ga0496100_0053851 | Ga0496100_0053851_1145_1621 | 157 |
| 922 | 3300048903 | Ga0496100_0300827 | Ga0496100_0300827_590_1072 | 157 |
| 923 | 3300048904 | Ga0496101_0007148 | Ga0496101_0007148_3025_3501 | 157 |
| 924 | 3300048904 | Ga0496101_0122158 | Ga0496101_0122158_1358_1834 | 157 |
| 925 | 3300048904 | Ga0496101_0628455 | Ga0496101_0628455_185_661 | 157 |
| 926 | 3300048905 | Ga0496102_0061742 | Ga0496102_0061742_1145_1621 | 157 |
| 927 | 3300048905 | Ga0496102_0363650 | Ga0496102_0363650_793_1269 | 157 |
| 928 | 3300048905 | Ga0496102_1294243 | Ga0496102_1294243_119_601 | 157 |
| 929 | 3300048906 | Ga0496103_0109799 | Ga0496103_0109799_456_932 | 157 |
| 930 | 3300048906 | Ga0496103_0209280 | Ga0496103_0209280_504_980 | 157 |
| 931 | 3300048906 | Ga0496103_0253800 | Ga0496103_0253800_188_664 | 157 |
| 932 | 3300048907 | Ga0496104_0015940 | Ga0496104_0015940_6327_6803 | 157 |
| 933 | 3300048907 | Ga0496104_0877881 | Ga0496104_0877881_186_662 | 157 |
| 934 | 3300048908 | Ga0496105_0457279 | Ga0496105_0457279_285_761 | 157 |
| 935 | 3300048909 | Ga0496106_0102769 | Ga0496106_0102769_1374_1850 | 157 |
| 936 | 3300048909 | Ga0496106_0676501 | Ga0496106_0676501_269_745 | 157 |
| 937 | 3300048910 | Ga0496107_0011954 | Ga0496107_0011954_440_916 | 157 |
| 938 | 3300048910 | Ga0496107_0392271 | Ga0496107_0392271_86_562 | 157 |
| 939 | 3300048910 | Ga0496107_1208412 | Ga0496107_1208412_52_528 | 157 |
| 940 | 3300048911 | Ga0496108_0093932 | Ga0496108_0093932_651_1127 | 157 |
| 941 | 3300048911 | Ga0496108_0762974 | Ga0496108_0762974_240_815 | 157 |
| 942 | 3300048912 | Ga0496109_0008198 | Ga0496109_0008198_1145_1621 | 157 |
| 943 | 3300048912 | Ga0496109_0048842 | Ga0496109_0048842_1111_1587 | 157 |
| 944 | 3300048913 | Ga0496110_0015882 | Ga0496110_0015882_4060_4536 | 157 |
| 945 | 3300048913 | Ga0496110_0137548 | Ga0496110_0137548_1470_1946 | 157 |
| 946 | 3300048913 | Ga0496110_0256467 | Ga0496110_0256467_355_867 | 157 |
| 947 | 3300048914 | Ga0496111_0023733 | Ga0496111_0023733_3305_3781 | 157 |
| 948 | 3300048914 | Ga0496111_0937970 | Ga0496111_0937970_81_557 | 157 |
| 949 | 3300048915 | Ga0496112_0268321 | Ga0496112_0268321_622_1098 | 157 |
| 950 | 3300048915 | Ga0496112_0860676 | Ga0496112_0860676_262_738 | 157 |
| 951 | 3300048916 | Ga0496113_0126700 | Ga0496113_0126700_478_954 | 157 |
| 952 | 3300048917 | Ga0496114_0015772 | Ga0496114_0015772_456_932 | 157 |
| 953 | 3300048917 | Ga0496114_0152086 | Ga0496114_0152086_785_1261 | 157 |
| 954 | 3300048917 | Ga0496114_0221776 | Ga0496114_0221776_1003_1479 | 157 |
| 955 | 3300048917 | Ga0496114_1556996 | Ga0496114_1556996_17_493 | 157 |
| 956 | 3300048918 | Ga0496115_0005432 | Ga0496115_0005432_2251_2727 | 157 |
| 957 | 3300048918 | Ga0496115_0285670 | Ga0496115_0285670_477_953 | 157 |
| 958 | 3300048918 | Ga0496115_0503369 | Ga0496115_0503369_77_553 | 157 |
| 959 | 3300048919 | Ga0496116_0001099 | Ga0496116_0001099_5144_5635 | 157 |
| 960 | 3300048919 | Ga0496116_0307019 | Ga0496116_0307019_126_617 | 157 |
| 961 | 3300048920 | Ga0496117_0027253 | Ga0496117_0027253_2648_3124 | 157 |
| 962 | 3300048920 | Ga0496117_0061631 | Ga0496117_0061631_325_807 | 157 |
| 963 | 3300048920 | Ga0496117_0255294 | Ga0496117_0255294_158_649 | 157 |
| 964 | 3300048921 | Ga0496118_0011793 | Ga0496118_0011793_7231_7707 | 157 |
| 965 | 3300048921 | Ga0496118_0022593 | Ga0496118_0022593_4657_5133 | 157 |
| 966 | 3300048921 | Ga0496118_0067738 | Ga0496118_0067738_1020_1496 | 157 |
| 967 | 3300048921 | Ga0496118_0081043 | Ga0496118_0081043_1128_1610 | 157 |
| 968 | 3300048921 | Ga0496118_0115655 | Ga0496118_0115655_408_899 | 157 |
| 969 | 3300048921 | Ga0496118_0143239 | Ga0496118_0143239_200_691 | 157 |
| 970 | 3300048921 | Ga0496118_0407435 | Ga0496118_0407435_67_543 | 157 |
| 971 | 3300048922 | Ga0496119_0031900 | Ga0496119_0031900_214_690 | 157 |
| 972 | 3300048922 | Ga0496119_0155124 | Ga0496119_0155124_348_824 | 157 |
| 973 | 3300048923 | Ga0496120_0011170 | Ga0496120_0011170_3274_3765 | 157 |
| 974 | 3300048923 | Ga0496120_0043295 | Ga0496120_0043295_330_821 | 157 |
| 975 | 3300048923 | Ga0496120_0329598 | Ga0496120_0329598_45_521 | 157 |
| 976 | 3300048924 | Ga0496121_0001566 | Ga0496121_0001566_530_1006 | 157 |
| 977 | 3300048924 | Ga0496121_0002300 | Ga0496121_0002300_25903_26379 | 157 |
| 978 | 3300048924 | Ga0496121_0002583 | Ga0496121_0002583_885_1376 | 157 |
| 979 | 3300048924 | Ga0496121_0002985 | Ga0496121_0002985_3691_4173 | 157 |
| 980 | 3300048924 | Ga0496121_0031009 | Ga0496121_0031009_2002_2478 | 157 |
| 981 | 3300048924 | Ga0496121_0057009 | Ga0496121_0057009_498_974 | 157 |
| 982 | 3300048924 | Ga0496121_0073592 | Ga0496121_0073592_1807_2283 | 157 |
| 983 | 3300048924 | Ga0496121_0085514 | Ga0496121_0085514_838_1314 | 157 |
| 984 | 3300048924 | Ga0496121_0087473 | Ga0496121_0087473_797_1273 | 157 |
| 985 | 3300048924 | Ga0496121_0105524 | Ga0496121_0105524_1264_1746 | 157 |
| 986 | 3300048924 | Ga0496121_0168114 | Ga0496121_0168114_884_1360 | 157 |
| 987 | 3300048924 | Ga0496121_0207701 | Ga0496121_0207701_162_644 | 157 |
| 988 | 3300048924 | Ga0496121_0221476 | Ga0496121_0221476_77_553 | 157 |
| 989 | 3300048924 | Ga0496121_0252471 | Ga0496121_0252471_186_662 | 157 |
| 990 | 3300048926 | Ga0496123_0044358 | Ga0496123_0044358_1041_1532 | 157 |
| 991 | 3300048927 | Ga0496124_0003294 | Ga0496124_0003294_413_889 | 157 |
| 992 | 3300048927 | Ga0496124_0212774 | Ga0496124_0212774_835_1311 | 157 |
| 993 | 3300048927 | Ga0496124_0571790 | Ga0496124_0571790_228_719 | 157 |
| 994 | 3300048927 | Ga0496124_0847641 | Ga0496124_0847641_45_521 | 157 |
| 995 | 3300048928 | Ga0496125_0009137 | Ga0496125_0009137_6111_6602 | 157 |
| 996 | 3300048928 | Ga0496125_0124993 | Ga0496125_0124993_18_494 | 157 |
| 997 | 3300048928 | Ga0496125_0132854 | Ga0496125_0132854_976_1452 | 157 |
| 998 | 3300048928 | Ga0496125_0190934 | Ga0496125_0190934_450_1025 | 157 |
| 999 | 3300048928 | Ga0496125_0350237 | Ga0496125_0350237_57_533 | 157 |
| 1000 | 3300048929 | Ga0496126_0003285 | Ga0496126_0003285_11223_11699 | 157 |
| 1001 | 3300048929 | Ga0496126_0034214 | Ga0496126_0034214_1538_2014 | 157 |
| 1002 | 3300048929 | Ga0496126_0037297 | Ga0496126_0037297_2318_2794 | 157 |
| 1003 | 3300048929 | Ga0496126_0101489 | Ga0496126_0101489_1042_1518 | 157 |
| 1004 | 3300048929 | Ga0496126_0117979 | Ga0496126_0117979_627_1109 | 157 |
| 1005 | 3300048929 | Ga0496126_0162562 | Ga0496126_0162562_396_872 | 157 |
| 1006 | 3300048929 | Ga0496126_0175131 | Ga0496126_0175131_148_624 | 157 |
| 1007 | 3300048929 | Ga0496126_0213222 | Ga0496126_0213222_554_1030 | 157 |
| 1008 | 3300048929 | Ga0496126_0304727 | Ga0496126_0304727_64_546 | 157 |
| 1009 | 3300048929 | Ga0496126_0308180 | Ga0496126_0308180_453_929 | 157 |
| 1010 | 3300049460 | Ga0495682_0189736 | Ga0495682_0189736_140_616 | 157 |
| 1011 | 3300049580 | Ga0501046_0268808 | Ga0501046_0268808_102_578 | 157 |
| 1012 | 3300049581 | Ga0501047_0076378 | Ga0501047_0076378_1130_1606 | 157 |
| 1013 | 3300049581 | Ga0501047_0095469 | Ga0501047_0095469_707_1183 | 157 |
| 1014 | 3300049583 | Ga0501067_0099675 | Ga0501067_0099675_52_528 | 157 |
| 1015 | 3300049584 | Ga0501068_0854246 | Ga0501068_0854246_84_572 | 157 |
| 1016 | 3300049585 | Ga0501069_0636277 | Ga0501069_0636277_71_559 | 157 |
| 1017 | 3300049586 | Ga0501070_0142293 | Ga0501070_0142293_738_1214 | 157 |
| 1018 | 3300049586 | Ga0501070_0377926 | Ga0501070_0377926_155_631 | 157 |
| 1019 | 3300049586 | Ga0501070_0485763 | Ga0501070_0485763_47_523 | 157 |
| 1020 | 3300049587 | Ga0501071_0931043 | Ga0501071_0931043_142_618 | 157 |
| 1021 | 3300049588 | Ga0501072_0654134 | Ga0501072_0654134_313_789 | 157 |
| 1022 | 3300049589 | Ga0501073_0233467 | Ga0501073_0233467_562_1038 | 157 |
| 1023 | 3300049590 | Ga0501074_0074417 | Ga0501074_0074417_1377_1853 | 157 |
| 1024 | 3300049742 | Ga0501080_0069368 | Ga0501080_0069368_972_1448 | 157 |
| 1025 | 3300049822 | Ga0501035_0062272 | Ga0501035_0062272_281_757 | 157 |
| 1026 | 3300049823 | Ga0501044_0116053 | Ga0501044_0116053_1405_1881 | 157 |
| 1027 | 3300049823 | Ga0501044_0291295 | Ga0501044_0291295_255_731 | 157 |
| 1028 | 3300050490 | nmdc:mga03n38_212664_c1 | nmdc:mga03n38_212664_c1_282_758 | 157 |
| 1029 | 3300050490 | nmdc:mga03n38_492154_c1 | nmdc:mga03n38_492154_c1_170_646 | 157 |
| 1030 | 3300050490 | nmdc:mga03n38_49430_c1 | nmdc:mga03n38_49430_c1_213_689 | 157 |
| 1031 | 3300050492 | nmdc:mga0yw44_359092_c1 | nmdc:mga0yw44_359092_c1_488_964 | 157 |
| 1032 | 3300050492 | nmdc:mga0yw44_40732_c1 | nmdc:mga0yw44_40732_c1_880_1371 | 157 |
| 1033 | 3300050492 | nmdc:mga0yw44_627679_c1 | nmdc:mga0yw44_627679_c1_13_489 | 157 |
| 1034 | 3300050493 | nmdc:mga0k408_110097_c1 | nmdc:mga0k408_110097_c1_826_1302 | 157 |
| 1035 | 3300050493 | nmdc:mga0k408_113608_c1 | nmdc:mga0k408_113608_c1_142_618 | 157 |
| 1036 | 3300050494 | nmdc:mga06z11_131121_c1 | nmdc:mga06z11_131121_c1_117_593 | 157 |
| 1037 | 3300050494 | nmdc:mga06z11_175728_c1 | nmdc:mga06z11_175728_c1_31_522 | 157 |
| 1038 | 3300050495 | nmdc:mga04h51_102777_c1 | nmdc:mga04h51_102777_c1_354_830 | 157 |
| 1039 | 3300050496 | nmdc:mga07m45_177276_c1 | nmdc:mga07m45_177276_c1_598_1080 | 157 |
| 1040 | 3300050496 | nmdc:mga07m45_261130_c1 | nmdc:mga07m45_261130_c1_509_985 | 157 |
| 1041 | 3300050496 | nmdc:mga07m45_34810_c1 | nmdc:mga07m45_34810_c1_2172_2663 | 157 |
| 1042 | 3300050496 | nmdc:mga07m45_372558_c1 | nmdc:mga07m45_372558_c1_254_730 | 157 |
| 1043 | 3300050507 | nmdc:mga05p37_1292349_c1 | nmdc:mga05p37_1292349_c1_122_598 | 157 |
| 1044 | 3300050507 | nmdc:mga05p37_2013400_c1 | nmdc:mga05p37_2013400_c1_52_528 | 157 |
| 1045 | 3300050511 | nmdc:mga08y16_908491_c1 | nmdc:mga08y16_908491_c1_257_739 | 157 |
| 1046 | 3300050512 | nmdc:mga0n895_298481_c1 | nmdc:mga0n895_298481_c1_323_835 | 157 |
| 1047 | 3300050512 | nmdc:mga0n895_929483_c1 | nmdc:mga0n895_929483_c1_354_830 | 157 |
| 1048 | 3300050516 | nmdc:mga0sz30_10924_c1 | nmdc:mga0sz30_10924_c1_18_509 | 157 |
| 1049 | 3300050516 | nmdc:mga0sz30_154132_c1 | nmdc:mga0sz30_154132_c1_138_614 | 157 |
| 1050 | 3300050516 | nmdc:mga0sz30_166150_c1 | nmdc:mga0sz30_166150_c1_122_640 | 157 |
| 1051 | 3300050516 | nmdc:mga0sz30_2979_c1 | nmdc:mga0sz30_2979_c1_265_756 | 157 |
| 1052 | 3300053077 | Ga0495601_0026159 | Ga0495601_0026159_568_1056 | 157 |
| 1053 | 3300053077 | Ga0495601_0222865 | Ga0495601_0222865_651_1127 | 157 |
| 1054 | 3300053077 | Ga0495601_0246368 | Ga0495601_0246368_59_535 | 157 |
| 1055 | 3300053078 | Ga0495612_0012482 | Ga0495612_0012482_1149_1637 | 157 |
| 1056 | 3300053078 | Ga0495612_0144867 | Ga0495612_0144867_501_977 | 157 |
| 1057 | 3300053078 | Ga0495612_0197262 | Ga0495612_0197262_153_629 | 157 |
| 1058 | 3300053080 | Ga0500635_0000999 | Ga0500635_0000999_4383_4859 | 157 |
| 1059 | 3300053080 | Ga0500635_0004951 | Ga0500635_0004951_2496_2972 | 157 |
| 1060 | 3300053080 | Ga0500635_0114234 | Ga0500635_0114234_284_760 | 157 |
| 1061 | 3300053083 | Ga0495655_0051464 | Ga0495655_0051464_154_654 | 157 |
| 1062 | 3300053087 | Ga0500643_061712 | Ga0500643_061712_442_918 | 157 |
| 1063 | 3300053088 | Ga0500644_0009244 | Ga0500644_0009244_996_1487 | 157 |
| 1064 | 3300053089 | Ga0500581_167750 | Ga0500581_167750_510_1001 | 157 |
| 1065 | 3300053090 | Ga0500646_0027414 | Ga0500646_0027414_505_996 | 157 |
| 1066 | 3300053093 | Ga0500651_0006315 | Ga0500651_0006315_4802_5290 | 157 |
| 1067 | 3300053093 | Ga0500651_0052289 | Ga0500651_0052289_1963_2454 | 157 |
| 1068 | 3300053093 | Ga0500651_0413321 | Ga0500651_0413321_142_618 | 157 |
| 1069 | 3300053093 | Ga0500651_0451444 | Ga0500651_0451444_157_633 | 157 |
| 1070 | 3300053094 | Ga0500566_0001430 | Ga0500566_0001430_1906_2397 | 157 |
| 1071 | 3300053094 | Ga0500566_0001776 | Ga0500566_0001776_9497_9973 | 157 |
| 1072 | 3300053094 | Ga0500566_0002071 | Ga0500566_0002071_9486_9962 | 157 |
| 1073 | 3300053094 | Ga0500566_0137960 | Ga0500566_0137960_141_617 | 157 |
| 1074 | 3300053094 | Ga0500566_0202509 | Ga0500566_0202509_462_938 | 157 |
| 1075 | 3300053095 | Ga0500640_000418 | Ga0500640_000418_1330_1806 | 157 |
| 1076 | 3300053096 | Ga0500641_0011747 | Ga0500641_0011747_861_1343 | 157 |
| 1077 | 3300053096 | Ga0500641_0036209 | Ga0500641_0036209_1315_1797 | 157 |
| 1078 | 3300053096 | Ga0500641_0083130 | Ga0500641_0083130_512_1000 | 157 |
| 1079 | 3300053096 | Ga0500641_0109539 | Ga0500641_0109539_420_911 | 157 |
| 1080 | 3300053098 | Ga0500650_0319367 | Ga0500650_0319367_175_657 | 157 |
| 1081 | 3300053102 | Ga0500554_014823 | Ga0500554_014823_994_1470 | 157 |
| 1082 | 3300053102 | Ga0500554_115745 | Ga0500554_115745_74_565 | 157 |
| 1083 | 3300053102 | Ga0500554_257664 | Ga0500554_257664_70_546 | 157 |
| 1084 | 3300053103 | Ga0500555_035874 | Ga0500555_035874_676_1167 | 157 |
| 1085 | 3300053103 | Ga0500555_080356 | Ga0500555_080356_239_715 | 157 |
| 1086 | 3300053104 | Ga0500556_0000019 | Ga0500556_0000019_127328_127819 | 157 |
| 1087 | 3300053105 | Ga0500557_097610 | Ga0500557_097610_318_809 | 157 |
| 1088 | 3300053106 | Ga0500558_110192 | Ga0500558_110192_480_956 | 157 |
| 1089 | 3300053109 | Ga0500569_006961 | Ga0500569_006961_1300_1791 | 157 |
| 1090 | 3300053111 | Ga0500572_000151 | Ga0500572_000151_2403_2879 | 157 |
| 1091 | 3300053111 | Ga0500572_001227 | Ga0500572_001227_3476_3952 | 157 |
| 1092 | 3300053116 | Ga0500592_000834 | Ga0500592_000834_2184_2675 | 157 |
| 1093 | 3300053116 | Ga0500592_010602 | Ga0500592_010602_799_1275 | 157 |
| 1094 | 3300053118 | Ga0500594_0041491 | Ga0500594_0041491_613_1104 | 157 |
| 1095 | 3300053118 | Ga0500594_0188770 | Ga0500594_0188770_50_532 | 157 |
| 1096 | 3300053118 | Ga0500594_0252819 | Ga0500594_0252819_58_540 | 157 |
| 1097 | 3300053119 | Ga0500595_000203 | Ga0500595_000203_21865_22341 | 157 |
| 1098 | 3300053119 | Ga0500595_002743 | Ga0500595_002743_2399_2881 | 157 |
| 1099 | 3300053119 | Ga0500595_004186 | Ga0500595_004186_139_621 | 157 |
| 1100 | 3300053119 | Ga0500595_005804 | Ga0500595_005804_3571_4053 | 157 |
| 1101 | 3300053121 | Ga0500607_246858 | Ga0500607_246858_117_608 | 157 |
| 1102 | 3300053122 | Ga0500608_022879 | Ga0500608_022879_152_643 | 157 |
| 1103 | 3300053122 | Ga0500608_066974 | Ga0500608_066974_754_1230 | 157 |
| 1104 | 3300053122 | Ga0500608_312958 | Ga0500608_312958_50_526 | 157 |
| 1105 | 3300053123 | Ga0500614_003865 | Ga0500614_003865_1340_1816 | 157 |
| 1106 | 3300053125 | Ga0500618_005679 | Ga0500618_005679_2517_3008 | 157 |
| 1107 | 3300053130 | Ga0500642_0000048 | Ga0500642_0000048_47948_48439 | 157 |
| 1108 | 3300053130 | Ga0500642_0227371 | Ga0500642_0227371_328_810 | 157 |
| 1109 | 3300053131 | Ga0500652_000394 | Ga0500652_000394_1146_1637 | 157 |
| 1110 | 3300053134 | Ga0500658_0013741 | Ga0500658_0013741_703_1194 | 157 |
| 1111 | 3300053136 | Ga0500559_0000099 | Ga0500559_0000099_47521_47997 | 157 |
| 1112 | 3300053136 | Ga0500559_0008202 | Ga0500559_0008202_1369_1860 | 157 |
| 1113 | 3300053136 | Ga0500559_0063941 | Ga0500559_0063941_584_1060 | 157 |
| 1114 | 3300053136 | Ga0500559_0207725 | Ga0500559_0207725_414_890 | 157 |
| 1115 | 3300053139 | Ga0500568_0000242 | Ga0500568_0000242_42612_43103 | 157 |
| 1116 | 3300053139 | Ga0500568_0019541 | Ga0500568_0019541_1903_2379 | 157 |
| 1117 | 3300053142 | Ga0500577_0020943 | Ga0500577_0020943_871_1362 | 157 |
| 1118 | 3300053142 | Ga0500577_0092420 | Ga0500577_0092420_214_690 | 157 |
| 1119 | 3300053145 | Ga0500586_001420 | Ga0500586_001420_2693_3184 | 157 |
| 1120 | 3300053146 | Ga0500588_0048325 | Ga0500588_0048325_510_998 | 157 |
| 1121 | 3300053148 | Ga0500590_052736 | Ga0500590_052736_1098_1574 | 157 |
| 1122 | 3300053148 | Ga0500590_266850 | Ga0500590_266850_107_598 | 157 |
| 1123 | 3300053150 | Ga0500603_002319 | Ga0500603_002319_1293_1769 | 157 |
| 1124 | 3300053150 | Ga0500603_002324 | Ga0500603_002324_2380_2856 | 157 |
| 1125 | 3300053151 | Ga0500604_0078827 | Ga0500604_0078827_144_620 | 157 |
| 1126 | 3300053151 | Ga0500604_0224167 | Ga0500604_0224167_25_516 | 157 |
| 1127 | 3300053153 | Ga0500616_0000059 | Ga0500616_0000059_134473_134964 | 157 |
| 1128 | 3300053154 | Ga0500619_065580 | Ga0500619_065580_161_652 | 157 |
| 1129 | 3300053156 | Ga0500622_0164303 | Ga0500622_0164303_184_672 | 157 |
| 1130 | 3300053156 | Ga0500622_0329401 | Ga0500622_0329401_139_630 | 157 |
| 1131 | 3300053157 | Ga0500624_016526 | Ga0500624_016526_256_747 | 157 |
| 1132 | 3300053158 | Ga0500627_0094878 | Ga0500627_0094878_286_774 | 157 |
| 1133 | 3300053159 | Ga0500630_002843 | Ga0500630_002843_2393_2869 | 157 |
| 1134 | 3300053162 | Ga0500638_063152 | Ga0500638_063152_756_1232 | 157 |
| 1135 | 3300053162 | Ga0500638_066962 | Ga0500638_066962_1010_1486 | 157 |
| 1136 | 3300053162 | Ga0500638_154662 | Ga0500638_154662_380_862 | 157 |
| 1137 | 3300053163 | Ga0500639_000579 | Ga0500639_000579_13771_14247 | 157 |
| 1138 | 3300053163 | Ga0500639_111748 | Ga0500639_111748_443_919 | 157 |
| 1139 | 3300053163 | Ga0500639_132437 | Ga0500639_132437_342_818 | 157 |
| 1140 | 3300053177 | Ga0500636_0001221 | Ga0500636_0001221_13311_13802 | 157 |
| 1141 | 3300053177 | Ga0500636_0016866 | Ga0500636_0016866_2426_2902 | 157 |
| 1142 | 3300053177 | Ga0500636_0065263 | Ga0500636_0065263_362_844 | 157 |
| 1143 | 3300053177 | Ga0500636_0165751 | Ga0500636_0165751_703_1185 | 157 |
| 1144 | 3300053177 | Ga0500636_0249174 | Ga0500636_0249174_181_657 | 157 |
| 1145 | 3300053177 | Ga0500636_0261355 | Ga0500636_0261355_160_636 | 157 |
| 1146 | 3300053178 | Ga0500637_0000130 | Ga0500637_0000130_4332_4808 | 157 |
| 1147 | 3300053178 | Ga0500637_0000328 | Ga0500637_0000328_2876_3352 | 157 |
| 1148 | 3300053178 | Ga0500637_0025623 | Ga0500637_0025623_2712_3188 | 157 |
| 1149 | 3300053178 | Ga0500637_0087119 | Ga0500637_0087119_1296_1787 | 157 |
| 1150 | 3300053724 | Ga0500570_085592 | Ga0500570_085592_78_569 | 157 |
| 1151 | 3300053725 | Ga0500576_050827 | Ga0500576_050827_271_747 | 157 |
| 1152 | 3300053730 | Ga0500645_006912 | Ga0500645_006912_1970_2461 | 157 |
| 1153 | 3300053730 | Ga0500645_170239 | Ga0500645_170239_101_577 | 157 |
| 1154 | 3300053731 | Ga0500609_031491 | Ga0500609_031491_207_695 | 157 |
| 1155 | 3300053732 | Ga0500656_018743 | Ga0500656_018743_124_600 | 157 |
| 1156 | 3300053733 | Ga0500552_005540 | Ga0500552_005540_449_925 | 157 |
| 1157 | 3300053735 | Ga0500596_000351 | Ga0500596_000351_509_985 | 157 |
| 1158 | 3300053735 | Ga0500596_004935 | Ga0500596_004935_1839_2315 | 157 |
| 1159 | 3300053735 | Ga0500596_006577 | Ga0500596_006577_654_1130 | 157 |
| 1160 | 3300053736 | Ga0500599_001092 | Ga0500599_001092_831_1319 | 157 |
| 1161 | 3300055283 | Ga0500661_004065 | Ga0500661_004065_507_983 | 157 |
| 1162 | 3300060353 | Ga0501082_0900478 | Ga0501082_0900478_271_747 | 157 |
| 1163 | 3300061719 | Ga0466962_0130558 | Ga0466962_0130558_347_823 | 157 |
| 1164 | iso_pu_bacteria | 2508501128 | 2509147658 | 157 |
| 1165 | iso_pu_bacteria | 2511231028 | 2511396273 | 157 |
| 1166 | iso_pu_bacteria | 2513237094 | 2513639301 | 157 |
| 1167 | iso_pu_bacteria | 2513237095 | 2513647324 | 157 |
| 1168 | iso_pu_bacteria | 2517093001 | 2517103944 | 157 |
| 1169 | iso_pu_bacteria | 2824653114 | 2824659327 | 157 |
| 1170 | iso_pu_bacteria | 2841957949 | 2841959897 | 157 |
| 1171 | iso_pu_bacteria | 2842694124 | 2842695047 | 157 |
| 1172 | iso_pu_bacteria | 2844315083 | 2844319839 | 157 |
| 1173 | iso_pu_bacteria | 2874620515 | 2874622288 | 157 |
| 1174 | iso_pu_bacteria | 2885409591 | 2885409827 | 157 |
| 1175 | iso_pu_bacteria | 2888378607 | 2888385258 | 157 |
| 1176 | iso_pu_bacteria | 2888419890 | 2888425406 | 157 |
| 1177 | iso_pu_bacteria | 2903727486 | 2903730490 | 157 |
| 1178 | iso_pu_bacteria | 2904666416 | 2904667899 | 157 |
| 1179 | iso_pu_bacteria | 2906602504 | 2906609711 | 157 |
| 1180 | iso_pu_bacteria | 2932794094 | 2932795340 | 157 |
| 1181 | iso_pu_bacteria | 2935959822 | 2935961238 | 157 |
| 1182 | iso_pu_bacteria | 2941531003 | 2941536857 | 157 |
| 1183 | iso_pu_bacteria | 3005710791 | 3005715637 | 157 |
| 1184 | iso_pu_bacteria | 3005718088 | 3005722968 | 157 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2o2k-assembly1.cif.gz_B | crystal structure of the activation domain of human methionine synthase isoform/mutant d963e/k1071n | 0.8819 | 39 | 64 |
| 7t30-assembly1.cif.gz_H | structure of electron bifurcating ni-fe hydrogenase complex hydabcsl in fmn/nad(h) bound state | 0.8789 | 10 | 75 |
| 6vw7-assembly1.cif.gz_A | formate dehydrogenase fdsabg subcomplex fdsbg from c. necator - nadh bound | 0.8269 | 7 | 155 |
| 7p8n-assembly1.cif.gz_b | tmhydabc- t. maritima hydrogenase with bridge closed | 0.8222 | 77 | 154 |
| 6vw7-assembly1.cif.gz_A | formate dehydrogenase fdsabg subcomplex fdsbg from c. necator - nadh bound | 0.8174 | 7 | 155 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9D6J6_126_223_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9582 | 74 | 154 | 3.40.30.10 |
| af_P0AFD1_83_165_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9494 | 73 | 154 | 3.40.30.10 |
| af_P0AFD1_83_165_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9278 | 73 | 154 | 3.40.30.10 |
| 2fug202 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.905 | 74 | 153 | 3.40.30.10 |
| af_A4HX94_128_234_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9011 | 74 | 156 | 3.40.30.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7W7Z118-F1-model_v4 | Formate dehydrogenase subunit gamma | 0.8745 | 3 | 157 |
GO:0016491
GO:0046872 GO:0051537 |
| AF-A0A2P8KF63-F1-model_v4 | Formate dehydrogenase subunit gamma | 0.8738 | 10 | 156 |
GO:0016491
GO:0046872 GO:0051537 |
| AF-A0A7W7Z118-F1-model_v4 | Formate dehydrogenase subunit gamma | 0.8645 | 3 | 157 |
GO:0016491
GO:0046872 GO:0051537 |
| AF-A0A6A7Y881-F1-model_v4 | Formate dehydrogenase subunit gamma | 0.8602 | 3 | 155 |
GO:0016491
GO:0046872 GO:0051537 |
| AF-A0A561QIW4-F1-model_v4 | Formate dehydrogenase gamma subunit | 0.8591 | 9 | 157 |
GO:0016491
GO:0046872 GO:0051537 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar