F491357
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1184 | 457 | 1142 | 376 |
Family's Representative Sequence
| Representative Sequence | 3300048918|Ga0496115_0017672|Ga0496115_0017672_1048_2520 |
| Length | 431 |
| Sequence | MKYLHLIWAALFRRKTRTILTLVSIVAAFLLFGMLDAVRSGFDQAGKSANGAQRLQTGSRLSFIQTLPQGLGAQIAQVPGVKSVAYANWFGGAYQDPHNQIFSFAVSDNYIDQYPELDVSPDARKSYETTRTGILIGEQLAKKYGWKVGDKIPLQSTIFPLHDGTKNWSFDVVGIMHAKDKSAGWYDQMILMHWKYFDDSTPYNHGTVGWYVSRVNDVNQADRVAKGIDALSANSDHETRTQTEQAASAAWMKQLADIGLIVGSIMGAVFFTLLLLSGNTMMQAVRERTSELAVMKTIGFSSHSVLAMVLAESVLLLLLGGVIGLGLAMLAVGGMQTAMGGGVPMSTIGADIWIRGVLLMVVIGLLVGALPGLRAMRLNIVDALAGRLGAHHEISAESGFIAVARGGCVGHAGGLARDGRRLCRDAGENRQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2537561836 | Rhodanobacter spathiphylli B39 | Isolate | Unclassified |
| 2 | 2593339238 | Luteibacter sp. UNCMF366Tsu5.1 | Isolate | Unclassified |
| 3 | 2593339239 | Luteibacter sp. UNCMF331Sha3.1 | Isolate | Unclassified |
| 4 | 2643221544 | Pelomonas sp. Root1444 | Isolate | Unclassified |
| 5 | 2643221562 | Rhodanobacter sp. Root561 | Isolate | Unclassified |
| 6 | 2643221577 | Rhodanobacter sp. Root627 | Isolate | Unclassified |
| 7 | 2643221585 | Pelomonas sp. Root662 | Isolate | Unclassified |
| 8 | 2643221593 | Lysobacter sp. Root690 | Isolate | Unclassified |
| 9 | 2643221639 | Pelomonas sp. Root1217 | Isolate | Unclassified |
| 10 | 2643221646 | Pelomonas sp. Root1237 | Isolate | Unclassified |
| 11 | 2643221656 | Pelomonas sp. Root405 | Isolate | Unclassified |
| 12 | 2643221685 | Rhodanobacter sp. Root480 | Isolate | Unclassified |
| 13 | 2643221695 | Lysobacter sp. Root494 | Isolate | Unclassified |
| 14 | 2687453130 | Dyella thiooxydans ATSB10 | Isolate | Unclassified |
| 15 | 2718218334 | Luteibacter rhizovicinus LJ96 | Isolate | Rhizosphere |
| 16 | 2734482264 | Dyella sp. AD052 | Isolate | Unclassified |
| 17 | 2738541337 | Pelomonas sp. BT06 | Isolate | Unclassified |
| 18 | 2738543009 | Luteibacter sp. OK325 | Isolate | Unclassified |
| 19 | 2739367700 | Dyella sp. YR388 | Isolate | Unclassified |
| 20 | 2818991440 | Luteibacter yeojuensis 583 | Isolate | Unclassified |
| 21 | 2831864461 | Roseateles noduli HZ7 | Isolate | Nodule |
| 22 | 2842780639 | Pseudoxanthomonas sp. R-71986 | Isolate | Unclassified |
| 23 | 2842914999 | Luteibacter sp. R-72151 | Isolate | Unclassified |
| 24 | 2842918807 | Luteibacter sp. R-73110 | Isolate | Unclassified |
| 25 | 2884338543 | Luteibacter pinisoli MAH-14 | Isolate | Rhizosphere |
| 26 | 2884411467 | Dyella sp. AD56 | Isolate | Rhizosphere |
| 27 | 2886848708 | Mitsuaria sp. TWR114 | Isolate | Rhizosphere |
| 28 | 2894414249 | Luteimonas sp. LNNU 24178 | Isolate | Rhizosphere |
| 29 | 2895395659 | Rhodanobacter sp. T12-5 | Isolate | Unclassified |
| 30 | 2895498888 | Pseudoxanthomonas sp. SGD-10 | Isolate | Rhizosphere |
| 31 | 2895511927 | Pseudoxanthomonas sp. SGD-5-1 | Isolate | Rhizosphere |
| 32 | 2895522137 | Pseudoxanthomonas sp. SGNA-20 | Isolate | Rhizosphere |
| 33 | 2895525241 | Pseudoxanthomonas sp. SGT-18 | Isolate | Rhizosphere |
| 34 | 2904463128 | Luteibacter yeojuensis 3191 | Isolate | Unclassified |
| 35 | 2919085039 | Luteibacter sp. 1214 | Isolate | Unclassified |
| 36 | 2919404418 | Luteibacter sp. 3190 | Isolate | Unclassified |
| 37 | 2928963466 | Dyella japonica 1073 | Isolate | Unclassified |
| 38 | 2939611941 | Rhodanobacter soli 1757 | Isolate | Rhizosphere |
| 39 | 2941471342 | Luteibacter sp. 621 | Isolate | Unclassified |
| 40 | 2953994433 | Luteibacter sp. W1I16 | Isolate | Rhizosphere |
| 41 | 2995948881 | Lysobacter enzymogenes B25 | Isolate | Unclassified |
| 42 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 43 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 44 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 45 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 46 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 47 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 48 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 49 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 50 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 51 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 52 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 53 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 54 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 55 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 56 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 57 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 58 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 59 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 60 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 61 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 62 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 63 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 64 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 65 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 66 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 67 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 68 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 69 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 70 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 71 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 72 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 73 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 74 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 75 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 76 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 77 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 78 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 79 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 80 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 81 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 82 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 84 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 87 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 88 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 89 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 91 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 92 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 94 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 100 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 101 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 102 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 104 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 105 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 106 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 107 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 108 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 109 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 110 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 111 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 112 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 113 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 114 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 115 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 116 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 117 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 118 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 119 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 120 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 121 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 122 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 123 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 124 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 125 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 126 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 127 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 128 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 129 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 130 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 131 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 132 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 133 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 134 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 136 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 137 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 138 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 140 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 141 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 144 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 146 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 147 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 148 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 149 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 150 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 151 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 152 | 3300012500 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 | Metagenome | Rhizosphere |
| 153 | 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Metagenome | Rhizosphere |
| 154 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 164 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 165 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 166 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 167 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 168 | 3300015685 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 | Metagenome | Unclassified |
| 169 | 3300015687 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 | Metagenome | Rhizosphere |
| 170 | 3300015689 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 | Metagenome | Rhizosphere |
| 171 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 172 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 173 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 174 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 175 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 176 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 177 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 178 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 179 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 180 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 181 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 182 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 183 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 184 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 185 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 186 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 187 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 188 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 189 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 190 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 191 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 192 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 193 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 194 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 195 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 196 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 197 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 198 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 199 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 200 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 201 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 202 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 203 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 204 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 261 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 262 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 263 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 264 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 265 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 266 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 267 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 268 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 269 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 270 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 271 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 272 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 273 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 274 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 275 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 276 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 277 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 278 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 279 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 280 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 281 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 282 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 283 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 284 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 285 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 286 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 287 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 288 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 289 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 290 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 291 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 292 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 293 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 294 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 295 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 296 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 297 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 298 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 299 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 300 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 301 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 302 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 303 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 304 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 305 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 306 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 307 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 308 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 309 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 310 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 311 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 312 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 313 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 314 | 3300042130 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 | Metagenome | Rhizosphere |
| 315 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 316 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 317 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 318 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 319 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 320 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 321 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 322 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 323 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 324 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 325 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 326 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 327 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 328 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 329 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 330 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 331 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 332 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 333 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 334 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 335 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 336 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 376 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 377 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 378 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 379 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 380 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 381 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 382 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 383 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 384 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 385 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 386 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 387 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 388 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 389 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 390 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 391 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 392 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 393 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 394 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 395 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 396 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 397 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 398 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 401 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 402 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 403 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 404 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 405 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 406 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 407 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 408 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 409 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 410 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 411 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 412 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 413 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 414 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 415 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 416 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 417 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 418 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 419 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 420 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 421 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 422 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 423 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 424 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 425 | 3300049687 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought | Metagenome | Rhizosphere |
| 426 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 427 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 428 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 429 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 430 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 431 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 432 | 3300049764 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control | Metagenome | Rhizosphere |
| 433 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 434 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 435 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 436 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 437 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 438 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 439 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 440 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 441 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 442 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 443 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 444 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 445 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 446 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 447 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 448 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 449 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 450 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 451 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 452 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 453 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 454 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 455 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 456 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 457 | 8002869464 | Pseudoxanthomonas helianthi 110414 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.03 |
| Metatranscriptomes | 0.42 |
| Isolates | 3.55 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 15.29 |
| Nodule | 0.17 |
| Rhizoplane | 2.7 |
| Rhizosphere | 71.54 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.3 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1002726 | 3300001904 | Bacteria | 3093 |
| 2 | JGI24741J21665_1000441 | 3300001915 | Bacteria | 12554 |
| 3 | JGI24741J21665_1001154 | 3300001915 | Bacteria | 7794 |
| 4 | JGI24740J21852_10003893 | 3300001979 | Bacteria | 6481 |
| 5 | JGI24740J21852_10012965 | 3300001979 | Bacteria | 3128 |
| 6 | JGI24739J22299_10000815 | 3300001989 | Bacteria | 11424 |
| 7 | JGI24737J22298_10002520 | 3300001990 | Bacteria | 6502 |
| 8 | JGI24735J21928_10013053 | 3300002067 | Bacteria | 2617 |
| 9 | JGI24738J21930_10000426 | 3300002075 | Bacteria | 11867 |
| 10 | JGI25156J39149_1000042 | 3300002705 | Bacteria | 105742 |
| 11 | JGI25156J39149_1001496 | 3300002705 | Bacteria | 9754 |
| 12 | JGI25156J39149_1003775 | 3300002705 | Bacteria | 4834 |
| 13 | JGI25156J39149_1009947 | 3300002705 | Bacteria | 2272 |
| 14 | JGI25162J39368_1000360 | 3300002737 | Bacteria | 38829 |
| 15 | JGI25162J39368_1000444 | 3300002737 | Bacteria | 32899 |
| 16 | JGI25162J39368_1001953 | 3300002737 | Bacteria | 9286 |
| 17 | JGI25162J39368_1004448 | 3300002737 | Bacteria | 3240 |
| 18 | JGI25162J39368_1004638 | 3300002737 | Bacteria | 3091 |
| 19 | JGI25154J39366_1006572 | 3300002738 | Bacteria | 1685 |
| 20 | JGI25157J39369_1000261 | 3300002741 | Bacteria | 38842 |
| 21 | JGI25157J39369_1001047 | 3300002741 | Bacteria | 12626 |
| 22 | JGI25157J39369_1001381 | 3300002741 | Bacteria | 9405 |
| 23 | JGI25157J39369_1001598 | 3300002741 | Bacteria | 7940 |
| 24 | JGI25157J39369_1002080 | 3300002741 | Bacteria | 5695 |
| 25 | JGI25163J39215_1000788 | 3300002771 | Bacteria | 7706 |
| 26 | JGI25164J39214_1000024 | 3300002772 | Bacteria | 165608 |
| 27 | JGI25164J39214_1000238 | 3300002772 | Bacteria | 41946 |
| 28 | JGI25164J39214_1000294 | 3300002772 | Bacteria | 34889 |
| 29 | JGI25164J39214_1002185 | 3300002772 | Bacteria | 3241 |
| 30 | JGI25164J39214_1003814 | 3300002772 | Bacteria | 1829 |
| 31 | JGI25152J39213_1002091 | 3300002773 | Bacteria | 7847 |
| 32 | JGI25151J46595_10000102 | 3300003187 | Bacteria | 114881 |
| 33 | JGI25165J46597_1000162 | 3300003214 | Bacteria | 105332 |
| 34 | JGI25165J46597_1000301 | 3300003214 | Bacteria | 62011 |
| 35 | JGI25165J46597_1001869 | 3300003214 | Bacteria | 8646 |
| 36 | JGI25165J46597_1003708 | 3300003214 | Bacteria | 3636 |
| 37 | JGI25165J46597_1008766 | 3300003214 | Bacteria | 1563 |
| 38 | JGI25153J46596_10005179 | 3300003215 | Bacteria | 6864 |
| 39 | JGI25153J46596_10018263 | 3300003215 | Bacteria | 2732 |
| 40 | rootH1_10001043 | 3300003316 | Bacteria | 4199 |
| 41 | rootH2_10011229 | 3300003320 | Bacteria | 34952 |
| 42 | rootH2_10011597 | 3300003320 | Bacteria | 8197 |
| 43 | rootH2_10098227 | 3300003320 | Bacteria | 3589 |
| 44 | rootL2_10007947 | 3300003322 | Bacteria | 5954 |
| 45 | rootL2_10043721 | 3300003322 | Bacteria | 9174 |
| 46 | rootH1_10058324 | 3300003323 | Bacteria | 7331 |
| 47 | Ga0006562J51391_1010474 | 3300003578 | Bacteria | 5410 |
| 48 | Ga0006562J51391_1010475 | 3300003578 | Bacteria | 12720 |
| 49 | Ga0006562J51391_1030224 | 3300003578 | Bacteria | 6750 |
| 50 | Ga0006562J51391_1030226 | 3300003578 | Bacteria | 4445 |
| 51 | Ga0055538_1000543 | 3300003751 | Bacteria | 13189 |
| 52 | Ga0055533_1000449 | 3300003756 | Bacteria | 15629 |
| 53 | Ga0055533_1003406 | 3300003756 | Bacteria | 3208 |
| 54 | Ga0055525_1000038 | 3300003759 | Bacteria | 297540 |
| 55 | Ga0055525_1000055 | 3300003759 | Bacteria | 215181 |
| 56 | Ga0055527_1000137 | 3300003760 | Bacteria | 52010 |
| 57 | Ga0055527_1000145 | 3300003760 | Bacteria | 50249 |
| 58 | Ga0055527_1000889 | 3300003760 | Bacteria | 7634 |
| 59 | Ga0055535_1000112 | 3300003761 | Bacteria | 87296 |
| 60 | Ga0055535_1000301 | 3300003761 | Bacteria | 50253 |
| 61 | Ga0055535_1000434 | 3300003761 | Bacteria | 38842 |
| 62 | Ga0055535_1000471 | 3300003761 | Bacteria | 36908 |
| 63 | Ga0055535_1000475 | 3300003761 | Bacteria | 36547 |
| 64 | Ga0055535_1003984 | 3300003761 | Bacteria | 3839 |
| 65 | Ga0055535_1012683 | 3300003761 | Bacteria | 1275 |
| 66 | Ga0055542_1000154 | 3300003762 | Bacteria | 87295 |
| 67 | Ga0055542_1000157 | 3300003762 | Bacteria | 85679 |
| 68 | Ga0055542_1000213 | 3300003762 | Bacteria | 70811 |
| 69 | Ga0055542_1000332 | 3300003762 | Bacteria | 50253 |
| 70 | Ga0055542_1000440 | 3300003762 | Bacteria | 39725 |
| 71 | Ga0055542_1000453 | 3300003762 | Bacteria | 38829 |
| 72 | Ga0055529_1000120 | 3300003763 | Bacteria | 115533 |
| 73 | Ga0055529_1000244 | 3300003763 | Bacteria | 66990 |
| 74 | Ga0055529_1000268 | 3300003763 | Bacteria | 61988 |
| 75 | Ga0055529_1000389 | 3300003763 | Bacteria | 47286 |
| 76 | Ga0055526_1000014 | 3300003771 | Bacteria | 233327 |
| 77 | Ga0055526_1002801 | 3300003771 | Bacteria | 11550 |
| 78 | Ga0055537_1000059 | 3300003773 | Bacteria | 79628 |
| 79 | Ga0055524_1000019 | 3300003775 | Bacteria | 233561 |
| 80 | Ga0055524_1001969 | 3300003775 | Bacteria | 11002 |
| 81 | Ga0055524_1003647 | 3300003775 | Bacteria | 7395 |
| 82 | Ga0055536_1000126 | 3300003781 | Bacteria | 65482 |
| 83 | Ga0055534_1000012 | 3300003784 | Bacteria | 153530 |
| 84 | Ga0055528_1000007 | 3300003790 | Bacteria | 233327 |
| 85 | Ga0055530_10000132 | 3300003791 | Bacteria | 65482 |
| 86 | Ga0055530_10011347 | 3300003791 | Bacteria | 3205 |
| 87 | Ga0055540_1010072 | 3300003792 | Bacteria | 3181 |
| 88 | Ga0055531_10000043 | 3300003794 | Bacteria | 133906 |
| 89 | Ga0055531_10000296 | 3300003794 | Bacteria | 49725 |
| 90 | Ga0055531_10003901 | 3300003794 | Bacteria | 9313 |
| 91 | Ga0055531_10005579 | 3300003794 | Bacteria | 7342 |
| 92 | Ga0065165_1000390 | 3300005262 | Bacteria | 71262 |
| 93 | Ga0065165_1000913 | 3300005262 | Bacteria | 38106 |
| 94 | Ga0065165_1001585 | 3300005262 | Bacteria | 23411 |
| 95 | Ga0065165_1003978 | 3300005262 | Bacteria | 9673 |
| 96 | Ga0065715_10032017 | 3300005293 | Bacteria | 1454 |
| 97 | Ga0070658_10021209 | 3300005327 | Bacteria | 5204 |
| 98 | Ga0070658_10041437 | 3300005327 | Bacteria | 3715 |
| 99 | Ga0070683_100027493 | 3300005329 | Bacteria | 5130 |
| 100 | Ga0070683_100318764 | 3300005329 | Bacteria | 1479 |
| 101 | Ga0070670_100017151 | 3300005331 | Bacteria | 6213 |
| 102 | Ga0070670_100035638 | 3300005331 | Bacteria | 4283 |
| 103 | Ga0070670_100049297 | 3300005331 | Bacteria | 3620 |
| 104 | Ga0070670_100142388 | 3300005331 | Bacteria | 2074 |
| 105 | Ga0070666_10001529 | 3300005335 | Bacteria | 14037 |
| 106 | Ga0070680_100000540 | 3300005336 | Bacteria | 25851 |
| 107 | Ga0070680_100002649 | 3300005336 | Bacteria | 13276 |
| 108 | Ga0070680_100005739 | 3300005336 | Bacteria | 9419 |
| 109 | Ga0070680_100147204 | 3300005336 | Bacteria | 1976 |
| 110 | Ga0070680_100201847 | 3300005336 | Bacteria | 1677 |
| 111 | Ga0070682_100003845 | 3300005337 | Bacteria | 8336 |
| 112 | Ga0070682_100049525 | 3300005337 | Bacteria | 2619 |
| 113 | Ga0070682_100155219 | 3300005337 | Bacteria | 1575 |
| 114 | Ga0068868_100003427 | 3300005338 | Bacteria | 11038 |
| 115 | Ga0068868_100086379 | 3300005338 | Bacteria | 2521 |
| 116 | Ga0068868_100219334 | 3300005338 | Bacteria | 1592 |
| 117 | Ga0070660_100002464 | 3300005339 | Bacteria | 12694 |
| 118 | Ga0070660_100037085 | 3300005339 | Bacteria | 3695 |
| 119 | Ga0070660_100059049 | 3300005339 | Bacteria | 2974 |
| 120 | Ga0070660_100115769 | 3300005339 | Bacteria | 2137 |
| 121 | Ga0070689_100001481 | 3300005340 | Bacteria | 14978 |
| 122 | Ga0070691_10127066 | 3300005341 | Bacteria | 1288 |
| 123 | Ga0070661_100006668 | 3300005344 | Bacteria | 7963 |
| 124 | Ga0070661_100024987 | 3300005344 | Bacteria | 4289 |
| 125 | Ga0070661_100059230 | 3300005344 | Bacteria | 2807 |
| 126 | Ga0070661_100141296 | 3300005344 | Bacteria | 1815 |
| 127 | Ga0070661_100165178 | 3300005344 | Bacteria | 1678 |
| 128 | Ga0070692_10058924 | 3300005345 | Bacteria | 2017 |
| 129 | Ga0070668_100029459 | 3300005347 | Bacteria | 4170 |
| 130 | Ga0070668_100191115 | 3300005347 | Bacteria | 1677 |
| 131 | Ga0070671_100091014 | 3300005355 | Bacteria | 2554 |
| 132 | Ga0070673_100188302 | 3300005364 | Bacteria | 1771 |
| 133 | Ga0070659_100004826 | 3300005366 | Bacteria | 9635 |
| 134 | Ga0070659_100012735 | 3300005366 | Bacteria | 6242 |
| 135 | Ga0070659_100014938 | 3300005366 | Bacteria | 5808 |
| 136 | Ga0070659_100018494 | 3300005366 | Bacteria | 5258 |
| 137 | Ga0070659_100052813 | 3300005366 | Bacteria | 3197 |
| 138 | Ga0070659_100232269 | 3300005366 | Bacteria | 1524 |
| 139 | Ga0070659_100276202 | 3300005366 | Bacteria | 1397 |
| 140 | Ga0070667_100000049 | 3300005367 | Bacteria | 158483 |
| 141 | Ga0070667_100003453 | 3300005367 | Bacteria | 13463 |
| 142 | Ga0070667_100050353 | 3300005367 | Bacteria | 3510 |
| 143 | Ga0070667_100211434 | 3300005367 | Bacteria | 1724 |
| 144 | Ga0070709_10001289 | 3300005434 | Bacteria | 13701 |
| 145 | Ga0070714_100000119 | 3300005435 | Bacteria | 63055 |
| 146 | Ga0070714_100000780 | 3300005435 | Bacteria | 22603 |
| 147 | Ga0070714_100042401 | 3300005435 | Bacteria | 3844 |
| 148 | Ga0070713_100000758 | 3300005436 | Bacteria | 20669 |
| 149 | Ga0070711_100167624 | 3300005439 | Bacteria | 1671 |
| 150 | Ga0070663_100000512 | 3300005455 | Bacteria | 20499 |
| 151 | Ga0070663_100005144 | 3300005455 | Bacteria | 7744 |
| 152 | Ga0070663_100010241 | 3300005455 | Bacteria | 5841 |
| 153 | Ga0070663_100010925 | 3300005455 | Bacteria | 5674 |
| 154 | Ga0070663_100014972 | 3300005455 | Bacteria | 4989 |
| 155 | Ga0070663_100020804 | 3300005455 | Bacteria | 4349 |
| 156 | Ga0070663_100057779 | 3300005455 | Bacteria | 2784 |
| 157 | Ga0070678_100204557 | 3300005456 | Bacteria | 1632 |
| 158 | Ga0070662_100009973 | 3300005457 | Bacteria | 6221 |
| 159 | Ga0070662_100105637 | 3300005457 | Bacteria | 2138 |
| 160 | Ga0070681_10000006 | 3300005458 | Bacteria | 169066 |
| 161 | Ga0070681_10000114 | 3300005458 | Bacteria | 59882 |
| 162 | Ga0070681_10003374 | 3300005458 | Bacteria | 14932 |
| 163 | Ga0070681_10014057 | 3300005458 | Bacteria | 7966 |
| 164 | Ga0070681_10036274 | 3300005458 | Bacteria | 4951 |
| 165 | Ga0068867_100067147 | 3300005459 | Bacteria | 2673 |
| 166 | Ga0070685_10000386 | 3300005466 | Bacteria | 26505 |
| 167 | Ga0070706_100000246 | 3300005467 | Bacteria | 66106 |
| 168 | Ga0070698_100024453 | 3300005471 | Bacteria | 6303 |
| 169 | Ga0070699_100028126 | 3300005518 | Bacteria | 4849 |
| 170 | Ga0070679_100000375 | 3300005530 | Bacteria | 37986 |
| 171 | Ga0070679_100003239 | 3300005530 | Bacteria | 14875 |
| 172 | Ga0070679_100030325 | 3300005530 | Bacteria | 5340 |
| 173 | Ga0070679_100191741 | 3300005530 | Bacteria | 2012 |
| 174 | Ga0070684_100217079 | 3300005535 | Bacteria | 1744 |
| 175 | Ga0068853_100000503 | 3300005539 | Bacteria | 26688 |
| 176 | Ga0068853_100001130 | 3300005539 | Bacteria | 18915 |
| 177 | Ga0068853_100003065 | 3300005539 | Bacteria | 12767 |
| 178 | Ga0068853_100012791 | 3300005539 | Bacteria | 6835 |
| 179 | Ga0068853_100014349 | 3300005539 | Bacteria | 6486 |
| 180 | Ga0068853_100035689 | 3300005539 | Bacteria | 4224 |
| 181 | Ga0068853_100353114 | 3300005539 | Bacteria | 1368 |
| 182 | Ga0070695_100008161 | 3300005545 | Bacteria | 6206 |
| 183 | Ga0070696_100010412 | 3300005546 | Bacteria | 6231 |
| 184 | Ga0070696_100037414 | 3300005546 | Bacteria | 3348 |
| 185 | Ga0070696_100053566 | 3300005546 | Bacteria | 2809 |
| 186 | Ga0070696_100085961 | 3300005546 | Bacteria | 2232 |
| 187 | Ga0070696_100220267 | 3300005546 | Bacteria | 1424 |
| 188 | Ga0070693_100003280 | 3300005547 | Bacteria | 7516 |
| 189 | Ga0070693_100004190 | 3300005547 | Bacteria | 6809 |
| 190 | Ga0070693_100005142 | 3300005547 | Bacteria | 6254 |
| 191 | Ga0070665_100000242 | 3300005548 | Bacteria | 90566 |
| 192 | Ga0070665_100000636 | 3300005548 | Bacteria | 47736 |
| 193 | Ga0070665_100046608 | 3300005548 | Bacteria | 4353 |
| 194 | Ga0070665_100344440 | 3300005548 | Bacteria | 1495 |
| 195 | Ga0070665_100408206 | 3300005548 | Bacteria | 1366 |
| 196 | Ga0068855_100007860 | 3300005563 | Bacteria | 12886 |
| 197 | Ga0068855_100011206 | 3300005563 | Bacteria | 10826 |
| 198 | Ga0068855_100026162 | 3300005563 | Bacteria | 6980 |
| 199 | Ga0068855_100054604 | 3300005563 | Bacteria | 4695 |
| 200 | Ga0068855_100055439 | 3300005563 | Bacteria | 4656 |
| 201 | Ga0068855_100062851 | 3300005563 | Bacteria | 4334 |
| 202 | Ga0068855_100084433 | 3300005563 | Bacteria | 3676 |
| 203 | Ga0068855_100087391 | 3300005563 | Bacteria | 3603 |
| 204 | Ga0068855_100098855 | 3300005563 | Bacteria | 3361 |
| 205 | Ga0068855_100103461 | 3300005563 | Bacteria | 3276 |
| 206 | Ga0068855_100169237 | 3300005563 | Bacteria | 2475 |
| 207 | Ga0070664_100025481 | 3300005564 | Bacteria | 4902 |
| 208 | Ga0068857_100001009 | 3300005577 | Bacteria | 21668 |
| 209 | Ga0068857_100008043 | 3300005577 | Bacteria | 9093 |
| 210 | Ga0068857_100012200 | 3300005577 | Bacteria | 7474 |
| 211 | Ga0068857_100114194 | 3300005577 | Bacteria | 2429 |
| 212 | Ga0068854_100001314 | 3300005578 | Bacteria | 14989 |
| 213 | Ga0068854_100054870 | 3300005578 | Bacteria | 2868 |
| 214 | Ga0068854_100075522 | 3300005578 | Bacteria | 2475 |
| 215 | Ga0068854_100081684 | 3300005578 | Bacteria | 2388 |
| 216 | Ga0068854_100103503 | 3300005578 | Bacteria | 2137 |
| 217 | Ga0068854_100216115 | 3300005578 | Bacteria | 1514 |
| 218 | Ga0068856_100000524 | 3300005614 | Bacteria | 42396 |
| 219 | Ga0068856_100004361 | 3300005614 | Bacteria | 14097 |
| 220 | Ga0068856_100004925 | 3300005614 | Bacteria | 13219 |
| 221 | Ga0068856_100013002 | 3300005614 | Bacteria | 8060 |
| 222 | Ga0068856_100171728 | 3300005614 | Bacteria | 2180 |
| 223 | Ga0068852_100023590 | 3300005616 | Bacteria | 4954 |
| 224 | Ga0068852_100029651 | 3300005616 | Bacteria | 4497 |
| 225 | Ga0068852_100116843 | 3300005616 | Bacteria | 2435 |
| 226 | Ga0068859_100000453 | 3300005617 | Bacteria | 40718 |
| 227 | Ga0068859_100145275 | 3300005617 | Bacteria | 2447 |
| 228 | Ga0068859_100269030 | 3300005617 | Bacteria | 1796 |
| 229 | Ga0068864_100000276 | 3300005618 | Bacteria | 45759 |
| 230 | Ga0068864_100083722 | 3300005618 | Bacteria | 2801 |
| 231 | Ga0068851_10009023 | 3300005834 | Bacteria | 4628 |
| 232 | Ga0068851_10023732 | 3300005834 | Bacteria | 3000 |
| 233 | Ga0068851_10032900 | 3300005834 | Bacteria | 2581 |
| 234 | Ga0068851_10109103 | 3300005834 | Bacteria | 1476 |
| 235 | Ga0068863_100004765 | 3300005841 | Bacteria | 13363 |
| 236 | Ga0068863_100040304 | 3300005841 | Bacteria | 4441 |
| 237 | Ga0068863_100073031 | 3300005841 | Bacteria | 3245 |
| 238 | Ga0068863_100095066 | 3300005841 | Bacteria | 2828 |
| 239 | Ga0068858_100012181 | 3300005842 | Bacteria | 8109 |
| 240 | Ga0068858_100119235 | 3300005842 | Bacteria | 2467 |
| 241 | Ga0068858_100205979 | 3300005842 | Bacteria | 1861 |
| 242 | Ga0068858_100243445 | 3300005842 | Bacteria | 1707 |
| 243 | Ga0068858_100249985 | 3300005842 | Bacteria | 1684 |
| 244 | Ga0068862_100000674 | 3300005844 | Bacteria | 34963 |
| 245 | Ga0081540_1021127 | 3300005983 | Bacteria | 3889 |
| 246 | Ga0070712_100045432 | 3300006175 | Bacteria | 3033 |
| 247 | Ga0070712_100188060 | 3300006175 | Bacteria | 1614 |
| 248 | Ga0075366_10016201 | 3300006195 | Bacteria | 4282 |
| 249 | Ga0097621_100089013 | 3300006237 | Bacteria | 2580 |
| 250 | Ga0097621_100114496 | 3300006237 | Bacteria | 2282 |
| 251 | Ga0075370_10005248 | 3300006353 | Bacteria | 6413 |
| 252 | Ga0075370_10012781 | 3300006353 | Bacteria | 4447 |
| 253 | Ga0075370_10024323 | 3300006353 | Bacteria | 3345 |
| 254 | Ga0075370_10080959 | 3300006353 | Bacteria | 1866 |
| 255 | Ga0068871_100140078 | 3300006358 | Bacteria | 2056 |
| 256 | Ga0068865_100033866 | 3300006881 | Bacteria | 3422 |
| 257 | Ga0097620_100000453 | 3300006931 | Bacteria | 40718 |
| 258 | Ga0097620_100145276 | 3300006931 | Bacteria | 2447 |
| 259 | Ga0097620_100269058 | 3300006931 | Bacteria | 1796 |
| 260 | Ga0099823_1000163 | 3300006944 | Bacteria | 35759 |
| 261 | Ga0099795_10000001 | 3300007788 | Bacteria | 179944 |
| 262 | Ga0105240_10000453 | 3300009093 | Bacteria | 75454 |
| 263 | Ga0105240_10000868 | 3300009093 | Bacteria | 54479 |
| 264 | Ga0105240_10001058 | 3300009093 | Bacteria | 48723 |
| 265 | Ga0105240_10008373 | 3300009093 | Bacteria | 14800 |
| 266 | Ga0105240_10010177 | 3300009093 | Bacteria | 13239 |
| 267 | Ga0105240_10023924 | 3300009093 | Bacteria | 8069 |
| 268 | Ga0105240_10049970 | 3300009093 | Bacteria | 5274 |
| 269 | Ga0105240_10143340 | 3300009093 | Bacteria | 2854 |
| 270 | Ga0105240_10181414 | 3300009093 | Bacteria | 2484 |
| 271 | Ga0105240_10185660 | 3300009093 | Bacteria | 2449 |
| 272 | Ga0105240_10198859 | 3300009093 | Bacteria | 2350 |
| 273 | Ga0105240_10241397 | 3300009093 | Bacteria | 2094 |
| 274 | Ga0105247_10006880 | 3300009101 | Bacteria | 7009 |
| 275 | Ga0105247_10087478 | 3300009101 | Bacteria | 1973 |
| 276 | Ga0105243_10008438 | 3300009148 | Bacteria | 7910 |
| 277 | Ga0105241_10022178 | 3300009174 | Bacteria | 4701 |
| 278 | Ga0105241_10024431 | 3300009174 | Bacteria | 4487 |
| 279 | Ga0105241_10053604 | 3300009174 | Bacteria | 3085 |
| 280 | Ga0105241_10059418 | 3300009174 | Bacteria | 2939 |
| 281 | Ga0105241_10116216 | 3300009174 | Bacteria | 2148 |
| 282 | Ga0105241_10179605 | 3300009174 | Bacteria | 1755 |
| 283 | Ga0105248_10000231 | 3300009177 | Bacteria | 64041 |
| 284 | Ga0105248_10006636 | 3300009177 | Bacteria | 12691 |
| 285 | Ga0105248_10422093 | 3300009177 | Bacteria | 1502 |
| 286 | Ga0105237_10000011 | 3300009545 | Bacteria | 307361 |
| 287 | Ga0105237_10000036 | 3300009545 | Bacteria | 191142 |
| 288 | Ga0105237_10001039 | 3300009545 | Bacteria | 37324 |
| 289 | Ga0105237_10009281 | 3300009545 | Bacteria | 10539 |
| 290 | Ga0105237_10012473 | 3300009545 | Bacteria | 8956 |
| 291 | Ga0105237_10020257 | 3300009545 | Bacteria | 6862 |
| 292 | Ga0105237_10081936 | 3300009545 | Bacteria | 3217 |
| 293 | Ga0105237_10096591 | 3300009545 | Bacteria | 2945 |
| 294 | Ga0105237_10297984 | 3300009545 | Bacteria | 1615 |
| 295 | Ga0105237_10411328 | 3300009545 | Bacteria | 1358 |
| 296 | Ga0105238_10002060 | 3300009551 | Bacteria | 20286 |
| 297 | Ga0105238_10008158 | 3300009551 | Bacteria | 10475 |
| 298 | Ga0105238_10018070 | 3300009551 | Bacteria | 7167 |
| 299 | Ga0105238_10018511 | 3300009551 | Bacteria | 7088 |
| 300 | Ga0105238_10029729 | 3300009551 | Bacteria | 5565 |
| 301 | Ga0105238_10034105 | 3300009551 | Bacteria | 5179 |
| 302 | Ga0105238_10083391 | 3300009551 | Bacteria | 3185 |
| 303 | Ga0105238_10087813 | 3300009551 | Bacteria | 3096 |
| 304 | Ga0105238_10355216 | 3300009551 | Bacteria | 1455 |
| 305 | Ga0105249_10002941 | 3300009553 | Bacteria | 14702 |
| 306 | Ga0105249_10052034 | 3300009553 | Bacteria | 3739 |
| 307 | Ga0105249_10234227 | 3300009553 | Bacteria | 1812 |
| 308 | Ga0099796_10000001 | 3300010159 | Bacteria | 107173 |
| 309 | Ga0105239_10000027 | 3300010375 | Bacteria | 248028 |
| 310 | Ga0105239_10001667 | 3300010375 | Bacteria | 29272 |
| 311 | Ga0105239_10012342 | 3300010375 | Bacteria | 9515 |
| 312 | Ga0105239_10017601 | 3300010375 | Bacteria | 7904 |
| 313 | Ga0105239_10020796 | 3300010375 | Bacteria | 7241 |
| 314 | Ga0105239_10021558 | 3300010375 | Bacteria | 7104 |
| 315 | Ga0105239_10029600 | 3300010375 | Bacteria | 6021 |
| 316 | Ga0105239_10076147 | 3300010375 | Bacteria | 3690 |
| 317 | Ga0105239_10176769 | 3300010375 | Bacteria | 2387 |
| 318 | Ga0157319_1000003 | 3300012497 | Bacteria | 397199 |
| 319 | Ga0157314_1000231 | 3300012500 | Bacteria | 6066 |
| 320 | Ga0157327_1000119 | 3300012512 | Bacteria | 3578 |
| 321 | Ga0157373_10005386 | 3300013100 | Bacteria | 9610 |
| 322 | Ga0157373_10017594 | 3300013100 | Bacteria | 5207 |
| 323 | Ga0157373_10050414 | 3300013100 | Bacteria | 2964 |
| 324 | Ga0157373_10102087 | 3300013100 | Bacteria | 2018 |
| 325 | Ga0157373_10211176 | 3300013100 | Bacteria | 1369 |
| 326 | Ga0157371_10027073 | 3300013102 | Bacteria | 4162 |
| 327 | Ga0157371_10042222 | 3300013102 | Bacteria | 3251 |
| 328 | Ga0157371_10042939 | 3300013102 | Bacteria | 3222 |
| 329 | Ga0157371_10111704 | 3300013102 | Bacteria | 1940 |
| 330 | Ga0157371_10142272 | 3300013102 | Bacteria | 1708 |
| 331 | Ga0157371_10196539 | 3300013102 | Bacteria | 1445 |
| 332 | Ga0157370_10000045 | 3300013104 | Bacteria | 127627 |
| 333 | Ga0157370_10009778 | 3300013104 | Bacteria | 10173 |
| 334 | Ga0157370_10011339 | 3300013104 | Bacteria | 9335 |
| 335 | Ga0157370_10014570 | 3300013104 | Bacteria | 8034 |
| 336 | Ga0157370_10046561 | 3300013104 | Bacteria | 4159 |
| 337 | Ga0157370_10139004 | 3300013104 | Bacteria | 2263 |
| 338 | Ga0157370_10221136 | 3300013104 | Bacteria | 1754 |
| 339 | Ga0157369_10000318 | 3300013105 | Bacteria | 64959 |
| 340 | Ga0157369_10003874 | 3300013105 | Bacteria | 17759 |
| 341 | Ga0157369_10006716 | 3300013105 | Bacteria | 13275 |
| 342 | Ga0157369_10031828 | 3300013105 | Bacteria | 5804 |
| 343 | Ga0157369_10046210 | 3300013105 | Bacteria | 4732 |
| 344 | Ga0157369_10093848 | 3300013105 | Bacteria | 3203 |
| 345 | Ga0157369_10105608 | 3300013105 | Bacteria | 2998 |
| 346 | Ga0157369_10110398 | 3300013105 | Bacteria | 2924 |
| 347 | Ga0157374_10148198 | 3300013296 | Bacteria | 2280 |
| 348 | Ga0157374_10329169 | 3300013296 | Bacteria | 1515 |
| 349 | Ga0163162_10000042 | 3300013306 | Bacteria | 131540 |
| 350 | Ga0163162_10051376 | 3300013306 | Bacteria | 4137 |
| 351 | Ga0163162_10228414 | 3300013306 | Bacteria | 1991 |
| 352 | Ga0163162_10563793 | 3300013306 | Bacteria | 1266 |
| 353 | Ga0157372_10003468 | 3300013307 | Bacteria | 17017 |
| 354 | Ga0157372_10007233 | 3300013307 | Bacteria | 11821 |
| 355 | Ga0157372_10050379 | 3300013307 | Bacteria | 4632 |
| 356 | Ga0157372_10102701 | 3300013307 | Bacteria | 3266 |
| 357 | Ga0157372_10122834 | 3300013307 | Bacteria | 2984 |
| 358 | Ga0157372_10129150 | 3300013307 | Bacteria | 2907 |
| 359 | Ga0157372_10280541 | 3300013307 | Bacteria | 1937 |
| 360 | Ga0157372_10369738 | 3300013307 | Bacteria | 1671 |
| 361 | Ga0157375_10014123 | 3300013308 | Bacteria | 7122 |
| 362 | Ga0157375_10293910 | 3300013308 | Bacteria | 1788 |
| 363 | Ga0157375_10462636 | 3300013308 | Bacteria | 1434 |
| 364 | Ga0157380_10199059 | 3300014326 | Bacteria | 1776 |
| 365 | Ga0182008_10021481 | 3300014497 | Bacteria | 3314 |
| 366 | Ga0182008_10023024 | 3300014497 | Bacteria | 3186 |
| 367 | Ga0157379_10038541 | 3300014968 | Bacteria | 4264 |
| 368 | Ga0157379_10058679 | 3300014968 | Bacteria | 3442 |
| 369 | Ga0182006_1000556 | 3300015261 | Bacteria | 27959 |
| 370 | Ga0182006_1000731 | 3300015261 | Bacteria | 22632 |
| 371 | Ga0182007_10008118 | 3300015262 | Bacteria | 4332 |
| 372 | Ga0182007_10010679 | 3300015262 | Bacteria | 3615 |
| 373 | Ga0182007_10026907 | 3300015262 | Bacteria | 1988 |
| 374 | Ga0182005_1000113 | 3300015265 | Bacteria | 58004 |
| 375 | Ga0182005_1002812 | 3300015265 | Bacteria | 6065 |
| 376 | Ga0183369_1004 | 3300015685 | Bacteria | 539301 |
| 377 | Ga0183368_1003 | 3300015687 | Bacteria | 1276390 |
| 378 | Ga0183360_10002 | 3300015689 | Bacteria | 953821 |
| 379 | Ga0163161_10119818 | 3300017792 | Bacteria | 1976 |
| 380 | Ga0206353_11071570 | 3300020082 | Bacteria | 1659 |
| 381 | Ga0213872_10000044 | 3300021361 | Bacteria | 114843 |
| 382 | Ga0213872_10000125 | 3300021361 | Bacteria | 71792 |
| 383 | Ga0213872_10000284 | 3300021361 | Bacteria | 43286 |
| 384 | Ga0213872_10001189 | 3300021361 | Bacteria | 17673 |
| 385 | Ga0213872_10009785 | 3300021361 | Bacteria | 4583 |
| 386 | Ga0213872_10018969 | 3300021361 | Bacteria | 3169 |
| 387 | Ga0209760_100341 | 3300025207 | Bacteria | 13609 |
| 388 | Ga0209784_100156 | 3300025224 | Bacteria | 62150 |
| 389 | Ga0209674_100033 | 3300025226 | Bacteria | 423450 |
| 390 | Ga0209674_100077 | 3300025226 | Bacteria | 206312 |
| 391 | Ga0209674_100556 | 3300025226 | Bacteria | 14827 |
| 392 | Ga0209674_101279 | 3300025226 | Bacteria | 7011 |
| 393 | Ga0209672_100004 | 3300025228 | Bacteria | 1467504 |
| 394 | Ga0209672_100022 | 3300025228 | Bacteria | 374313 |
| 395 | Ga0209672_100118 | 3300025228 | Bacteria | 85928 |
| 396 | Ga0209672_100204 | 3300025228 | Bacteria | 47024 |
| 397 | Ga0209672_105512 | 3300025228 | Bacteria | 2160 |
| 398 | Ga0209147_105652 | 3300025229 | Bacteria | 1838 |
| 399 | Ga0209563_100005 | 3300025230 | Bacteria | 1774893 |
| 400 | Ga0209563_100076 | 3300025230 | Bacteria | 215269 |
| 401 | Ga0207427_100058 | 3300025231 | Bacteria | 192979 |
| 402 | Ga0207427_100070 | 3300025231 | Bacteria | 160908 |
| 403 | Ga0207427_100133 | 3300025231 | Bacteria | 92763 |
| 404 | Ga0207427_100285 | 3300025231 | Bacteria | 36432 |
| 405 | Ga0207427_102685 | 3300025231 | Bacteria | 4482 |
| 406 | Ga0207427_102846 | 3300025231 | Bacteria | 4179 |
| 407 | Ga0209437_100005 | 3300025233 | Bacteria | 1071596 |
| 408 | Ga0209437_100059 | 3300025233 | Bacteria | 355048 |
| 409 | Ga0209437_100141 | 3300025233 | Bacteria | 166553 |
| 410 | Ga0209437_100142 | 3300025233 | Bacteria | 165628 |
| 411 | Ga0209437_100303 | 3300025233 | Bacteria | 68428 |
| 412 | Ga0209437_102792 | 3300025233 | Bacteria | 3281 |
| 413 | Ga0209437_104557 | 3300025233 | Bacteria | 2429 |
| 414 | Ga0209258_100003 | 3300025242 | Bacteria | 1467504 |
| 415 | Ga0209258_100004 | 3300025242 | Bacteria | 1376422 |
| 416 | Ga0209258_100034 | 3300025242 | Bacteria | 437372 |
| 417 | Ga0209258_100122 | 3300025242 | Bacteria | 180314 |
| 418 | Ga0209258_100158 | 3300025242 | Bacteria | 156881 |
| 419 | Ga0209258_100564 | 3300025242 | Bacteria | 32099 |
| 420 | Ga0209258_101959 | 3300025242 | Bacteria | 6003 |
| 421 | Ga0207425_1002775 | 3300025245 | Bacteria | 5949 |
| 422 | Ga0209646_1002061 | 3300025246 | Bacteria | 4746 |
| 423 | Ga0209646_1002602 | 3300025246 | Bacteria | 3891 |
| 424 | Ga0209646_1003394 | 3300025246 | Bacteria | 3158 |
| 425 | Ga0209646_1005145 | 3300025246 | Bacteria | 2311 |
| 426 | Ga0209026_1000017 | 3300025250 | Bacteria | 385214 |
| 427 | Ga0209026_1000087 | 3300025250 | Bacteria | 184044 |
| 428 | Ga0209026_1000269 | 3300025250 | Bacteria | 62546 |
| 429 | Ga0209026_1000671 | 3300025250 | Bacteria | 20709 |
| 430 | Ga0209026_1000944 | 3300025250 | Bacteria | 14626 |
| 431 | Ga0209677_103496 | 3300025253 | Bacteria | 5049 |
| 432 | Ga0209148_1000001 | 3300025254 | Bacteria | 2545271 |
| 433 | Ga0209148_1000002 | 3300025254 | Bacteria | 2399500 |
| 434 | Ga0209148_1000025 | 3300025254 | Bacteria | 663262 |
| 435 | Ga0209148_1000062 | 3300025254 | Bacteria | 347704 |
| 436 | Ga0209148_1000083 | 3300025254 | Bacteria | 270142 |
| 437 | Ga0209148_1000092 | 3300025254 | Bacteria | 249076 |
| 438 | Ga0209148_1001448 | 3300025254 | Bacteria | 12048 |
| 439 | Ga0209759_1000299 | 3300025256 | Bacteria | 68401 |
| 440 | Ga0209759_1000503 | 3300025256 | Bacteria | 42712 |
| 441 | Ga0209759_1000915 | 3300025256 | Bacteria | 21851 |
| 442 | Ga0209759_1002563 | 3300025256 | Bacteria | 7871 |
| 443 | Ga0209759_1012258 | 3300025256 | Bacteria | 2385 |
| 444 | Ga0209759_1012781 | 3300025256 | Bacteria | 2306 |
| 445 | Ga0209129_1000697 | 3300025258 | Bacteria | 22024 |
| 446 | Ga0209129_1004673 | 3300025258 | Bacteria | 5226 |
| 447 | Ga0209233_1000002 | 3300025261 | Bacteria | 2501366 |
| 448 | Ga0209233_1000011 | 3300025261 | Bacteria | 1071611 |
| 449 | Ga0209233_1000141 | 3300025261 | Bacteria | 192978 |
| 450 | Ga0209233_1000273 | 3300025261 | Bacteria | 73280 |
| 451 | Ga0209233_1005102 | 3300025261 | Bacteria | 4393 |
| 452 | Ga0209565_1000001 | 3300025263 | Bacteria | 2950419 |
| 453 | Ga0209565_1011717 | 3300025263 | Bacteria | 2121 |
| 454 | Ga0209455_1000004 | 3300025272 | Bacteria | 1467504 |
| 455 | Ga0209455_1000040 | 3300025272 | Bacteria | 430197 |
| 456 | Ga0209455_1000054 | 3300025272 | Bacteria | 358936 |
| 457 | Ga0209455_1000084 | 3300025272 | Bacteria | 253164 |
| 458 | Ga0209455_1000318 | 3300025272 | Bacteria | 47836 |
| 459 | Ga0209673_1000001 | 3300025273 | Bacteria | 3176258 |
| 460 | Ga0209673_1008915 | 3300025273 | Bacteria | 4410 |
| 461 | Ga0209675_1000001 | 3300025291 | Bacteria | 2950293 |
| 462 | Ga0209676_1000011 | 3300025292 | Bacteria | 860463 |
| 463 | Ga0209676_1004340 | 3300025292 | Bacteria | 7950 |
| 464 | Ga0209025_1000006 | 3300025294 | Bacteria | 1153444 |
| 465 | Ga0209025_1011481 | 3300025294 | Bacteria | 5828 |
| 466 | Ga0209564_1000001 | 3300025295 | Bacteria | 3176258 |
| 467 | Ga0209564_1000051 | 3300025295 | Bacteria | 357748 |
| 468 | Ga0209758_1000096 | 3300025297 | Bacteria | 231496 |
| 469 | Ga0209758_1002225 | 3300025297 | Bacteria | 20148 |
| 470 | Ga0209758_1005359 | 3300025297 | Bacteria | 9945 |
| 471 | Ga0209758_1023075 | 3300025297 | Bacteria | 2828 |
| 472 | Ga0209050_1000032 | 3300025298 | Bacteria | 456335 |
| 473 | Ga0209050_1001300 | 3300025298 | Bacteria | 28170 |
| 474 | Ga0209050_1006165 | 3300025298 | Bacteria | 7210 |
| 475 | Ga0209256_1000006 | 3300025299 | Bacteria | 1250310 |
| 476 | Ga0209256_1000675 | 3300025299 | Bacteria | 46128 |
| 477 | Ga0209256_1004060 | 3300025299 | Bacteria | 9517 |
| 478 | Ga0209256_1010216 | 3300025299 | Bacteria | 3966 |
| 479 | Ga0207426_1023974 | 3300025302 | Bacteria | 2076 |
| 480 | Ga0209051_1000382 | 3300025303 | Bacteria | 62931 |
| 481 | Ga0209051_1000981 | 3300025303 | Bacteria | 27697 |
| 482 | Ga0209051_1004509 | 3300025303 | Bacteria | 8546 |
| 483 | Ga0209051_1004799 | 3300025303 | Bacteria | 8153 |
| 484 | Ga0209257_1000014 | 3300025304 | Bacteria | 946850 |
| 485 | Ga0209257_1000182 | 3300025304 | Bacteria | 156672 |
| 486 | Ga0209257_1000414 | 3300025304 | Bacteria | 82489 |
| 487 | Ga0209257_1002753 | 3300025304 | Bacteria | 16625 |
| 488 | Ga0209257_1003470 | 3300025304 | Bacteria | 13469 |
| 489 | Ga0207656_10003708 | 3300025321 | Bacteria | 5287 |
| 490 | Ga0207656_10025795 | 3300025321 | Bacteria | 2390 |
| 491 | Ga0207680_10000002 | 3300025903 | Bacteria | 1018646 |
| 492 | Ga0207647_10000015 | 3300025904 | Bacteria | 138626 |
| 493 | Ga0207647_10000066 | 3300025904 | Bacteria | 81782 |
| 494 | Ga0207647_10002322 | 3300025904 | Bacteria | 14453 |
| 495 | Ga0207647_10041012 | 3300025904 | Bacteria | 2913 |
| 496 | Ga0207647_10047939 | 3300025904 | Bacteria | 2655 |
| 497 | Ga0207647_10088879 | 3300025904 | Bacteria | 1844 |
| 498 | Ga0207699_10001222 | 3300025906 | Bacteria | 12185 |
| 499 | Ga0207699_10134903 | 3300025906 | Bacteria | 1615 |
| 500 | Ga0207645_10036201 | 3300025907 | Bacteria | 3169 |
| 501 | Ga0207705_10001071 | 3300025909 | Bacteria | 22220 |
| 502 | Ga0207705_10007229 | 3300025909 | Bacteria | 8173 |
| 503 | Ga0207705_10056409 | 3300025909 | Bacteria | 2832 |
| 504 | Ga0207705_10083746 | 3300025909 | Bacteria | 2327 |
| 505 | Ga0207684_10002337 | 3300025910 | Bacteria | 19212 |
| 506 | Ga0207654_10000251 | 3300025911 | Bacteria | 32477 |
| 507 | Ga0207654_10104133 | 3300025911 | Bacteria | 1754 |
| 508 | Ga0207707_10000095 | 3300025912 | Bacteria | 89126 |
| 509 | Ga0207707_10000230 | 3300025912 | Bacteria | 60267 |
| 510 | Ga0207707_10000245 | 3300025912 | Bacteria | 59259 |
| 511 | Ga0207707_10000869 | 3300025912 | Bacteria | 29531 |
| 512 | Ga0207707_10001440 | 3300025912 | Bacteria | 22021 |
| 513 | Ga0207707_10017761 | 3300025912 | Bacteria | 6203 |
| 514 | Ga0207707_10022905 | 3300025912 | Bacteria | 5463 |
| 515 | Ga0207707_10159737 | 3300025912 | Bacteria | 1971 |
| 516 | Ga0207707_10301994 | 3300025912 | Bacteria | 1384 |
| 517 | Ga0207707_10345262 | 3300025912 | Bacteria | 1283 |
| 518 | Ga0207695_10000172 | 3300025913 | Bacteria | 190573 |
| 519 | Ga0207695_10000441 | 3300025913 | Bacteria | 90937 |
| 520 | Ga0207695_10000743 | 3300025913 | Bacteria | 63072 |
| 521 | Ga0207695_10000938 | 3300025913 | Bacteria | 52009 |
| 522 | Ga0207695_10002199 | 3300025913 | Bacteria | 29371 |
| 523 | Ga0207695_10002388 | 3300025913 | Bacteria | 27843 |
| 524 | Ga0207695_10003102 | 3300025913 | Bacteria | 23788 |
| 525 | Ga0207695_10009353 | 3300025913 | Bacteria | 12118 |
| 526 | Ga0207695_10012023 | 3300025913 | Bacteria | 10412 |
| 527 | Ga0207695_10014719 | 3300025913 | Bacteria | 9251 |
| 528 | Ga0207695_10137445 | 3300025913 | Bacteria | 2396 |
| 529 | Ga0207695_10238901 | 3300025913 | Bacteria | 1719 |
| 530 | Ga0207671_10000011 | 3300025914 | Bacteria | 530349 |
| 531 | Ga0207671_10001404 | 3300025914 | Bacteria | 28043 |
| 532 | Ga0207671_10021933 | 3300025914 | Bacteria | 4838 |
| 533 | Ga0207671_10053665 | 3300025914 | Bacteria | 2987 |
| 534 | Ga0207671_10074315 | 3300025914 | Bacteria | 2540 |
| 535 | Ga0207671_10158134 | 3300025914 | Bacteria | 1754 |
| 536 | Ga0207671_10224729 | 3300025914 | Bacteria | 1471 |
| 537 | Ga0207663_10101765 | 3300025916 | Bacteria | 1931 |
| 538 | Ga0207660_10000084 | 3300025917 | Bacteria | 49904 |
| 539 | Ga0207660_10002081 | 3300025917 | Bacteria | 13255 |
| 540 | Ga0207660_10006573 | 3300025917 | Bacteria | 7545 |
| 541 | Ga0207657_10007064 | 3300025919 | Bacteria | 11534 |
| 542 | Ga0207657_10039214 | 3300025919 | Bacteria | 4211 |
| 543 | Ga0207657_10040416 | 3300025919 | Bacteria | 4132 |
| 544 | Ga0207657_10054162 | 3300025919 | Bacteria | 3471 |
| 545 | Ga0207657_10063548 | 3300025919 | Bacteria | 3155 |
| 546 | Ga0207657_10073706 | 3300025919 | Bacteria | 2884 |
| 547 | Ga0207649_10007325 | 3300025920 | Bacteria | 6005 |
| 548 | Ga0207649_10009430 | 3300025920 | Bacteria | 5340 |
| 549 | Ga0207649_10010983 | 3300025920 | Bacteria | 4981 |
| 550 | Ga0207649_10012746 | 3300025920 | Bacteria | 4674 |
| 551 | Ga0207649_10128437 | 3300025920 | Bacteria | 1718 |
| 552 | Ga0207652_10000318 | 3300025921 | Bacteria | 49778 |
| 553 | Ga0207652_10000560 | 3300025921 | Bacteria | 37572 |
| 554 | Ga0207652_10001869 | 3300025921 | Bacteria | 18289 |
| 555 | Ga0207652_10023320 | 3300025921 | Bacteria | 5125 |
| 556 | Ga0207694_10000253 | 3300025924 | Bacteria | 50728 |
| 557 | Ga0207694_10000308 | 3300025924 | Bacteria | 45953 |
| 558 | Ga0207694_10002841 | 3300025924 | Bacteria | 13972 |
| 559 | Ga0207694_10008890 | 3300025924 | Bacteria | 7581 |
| 560 | Ga0207694_10031103 | 3300025924 | Bacteria | 4076 |
| 561 | Ga0207694_10041392 | 3300025924 | Bacteria | 3550 |
| 562 | Ga0207694_10188381 | 3300025924 | Bacteria | 1675 |
| 563 | Ga0207650_10048590 | 3300025925 | Bacteria | 3130 |
| 564 | Ga0207700_10009061 | 3300025928 | Bacteria | 6196 |
| 565 | Ga0207664_10000090 | 3300025929 | Bacteria | 84944 |
| 566 | Ga0207664_10000358 | 3300025929 | Bacteria | 33535 |
| 567 | Ga0207690_10002773 | 3300025932 | Bacteria | 10581 |
| 568 | Ga0207690_10003291 | 3300025932 | Bacteria | 9675 |
| 569 | Ga0207690_10005359 | 3300025932 | Bacteria | 7559 |
| 570 | Ga0207690_10010328 | 3300025932 | Bacteria | 5543 |
| 571 | Ga0207690_10011576 | 3300025932 | Bacteria | 5269 |
| 572 | Ga0207690_10015169 | 3300025932 | Bacteria | 4665 |
| 573 | Ga0207690_10029644 | 3300025932 | Bacteria | 3482 |
| 574 | Ga0207690_10178563 | 3300025932 | Bacteria | 1596 |
| 575 | Ga0207706_10012788 | 3300025933 | Bacteria | 7640 |
| 576 | Ga0207706_10037330 | 3300025933 | Bacteria | 4315 |
| 577 | Ga0207706_10038523 | 3300025933 | Bacteria | 4240 |
| 578 | Ga0207706_10041359 | 3300025933 | Bacteria | 4086 |
| 579 | Ga0207706_10135429 | 3300025933 | Bacteria | 2167 |
| 580 | Ga0207686_10057224 | 3300025934 | Bacteria | 2454 |
| 581 | Ga0207709_10008092 | 3300025935 | Bacteria | 5824 |
| 582 | Ga0207670_10083824 | 3300025936 | Bacteria | 2237 |
| 583 | Ga0207704_10100432 | 3300025938 | Bacteria | 1927 |
| 584 | Ga0207691_10049500 | 3300025940 | Bacteria | 3850 |
| 585 | Ga0207711_10000539 | 3300025941 | Bacteria | 38710 |
| 586 | Ga0207711_10031060 | 3300025941 | Bacteria | 4507 |
| 587 | Ga0207689_10191357 | 3300025942 | Bacteria | 1688 |
| 588 | Ga0207661_10004766 | 3300025944 | Bacteria | 9498 |
| 589 | Ga0207679_10015863 | 3300025945 | Bacteria | 4992 |
| 590 | Ga0207679_10149172 | 3300025945 | Bacteria | 1901 |
| 591 | Ga0207679_10163727 | 3300025945 | Bacteria | 1824 |
| 592 | Ga0207667_10000224 | 3300025949 | Bacteria | 79334 |
| 593 | Ga0207667_10000240 | 3300025949 | Bacteria | 76766 |
| 594 | Ga0207667_10001418 | 3300025949 | Bacteria | 30009 |
| 595 | Ga0207667_10006504 | 3300025949 | Bacteria | 14138 |
| 596 | Ga0207667_10009556 | 3300025949 | Bacteria | 11412 |
| 597 | Ga0207667_10010505 | 3300025949 | Bacteria | 10817 |
| 598 | Ga0207667_10013260 | 3300025949 | Bacteria | 9445 |
| 599 | Ga0207667_10014602 | 3300025949 | Bacteria | 8944 |
| 600 | Ga0207667_10032547 | 3300025949 | Bacteria | 5617 |
| 601 | Ga0207667_10039237 | 3300025949 | Bacteria | 5049 |
| 602 | Ga0207667_10058768 | 3300025949 | Bacteria | 4031 |
| 603 | Ga0207667_10137843 | 3300025949 | Bacteria | 2512 |
| 604 | Ga0207667_10154287 | 3300025949 | Bacteria | 2363 |
| 605 | Ga0207667_10167675 | 3300025949 | Bacteria | 2257 |
| 606 | Ga0207667_10182163 | 3300025949 | Bacteria | 2157 |
| 607 | Ga0207651_10021204 | 3300025960 | Bacteria | 3943 |
| 608 | Ga0207712_10000589 | 3300025961 | Bacteria | 29134 |
| 609 | Ga0207712_10007177 | 3300025961 | Bacteria | 7027 |
| 610 | Ga0207712_10013249 | 3300025961 | Bacteria | 5285 |
| 611 | Ga0207712_10179214 | 3300025961 | Bacteria | 1663 |
| 612 | Ga0207668_10069939 | 3300025972 | Bacteria | 2501 |
| 613 | Ga0207668_10176337 | 3300025972 | Bacteria | 1681 |
| 614 | Ga0207640_10000115 | 3300025981 | Bacteria | 60633 |
| 615 | Ga0207640_10004459 | 3300025981 | Bacteria | 7588 |
| 616 | Ga0207640_10005333 | 3300025981 | Bacteria | 7006 |
| 617 | Ga0207640_10012552 | 3300025981 | Bacteria | 4829 |
| 618 | Ga0207640_10023346 | 3300025981 | Bacteria | 3715 |
| 619 | Ga0207640_10043090 | 3300025981 | Bacteria | 2882 |
| 620 | Ga0207658_10000033 | 3300025986 | Bacteria | 158540 |
| 621 | Ga0207658_10008954 | 3300025986 | Bacteria | 6790 |
| 622 | Ga0207677_10168668 | 3300026023 | Bacteria | 1709 |
| 623 | Ga0207677_10218693 | 3300026023 | Bacteria | 1526 |
| 624 | Ga0207703_10057766 | 3300026035 | Bacteria | 3165 |
| 625 | Ga0207703_10080414 | 3300026035 | Bacteria | 2714 |
| 626 | Ga0207703_10198375 | 3300026035 | Bacteria | 1782 |
| 627 | Ga0207639_10001429 | 3300026041 | Bacteria | 16142 |
| 628 | Ga0207639_10001885 | 3300026041 | Bacteria | 14083 |
| 629 | Ga0207639_10002310 | 3300026041 | Bacteria | 12792 |
| 630 | Ga0207639_10006186 | 3300026041 | Bacteria | 8130 |
| 631 | Ga0207639_10024619 | 3300026041 | Bacteria | 4358 |
| 632 | Ga0207639_10027516 | 3300026041 | Bacteria | 4143 |
| 633 | Ga0207639_10119391 | 3300026041 | Bacteria | 2164 |
| 634 | Ga0207639_10191486 | 3300026041 | Bacteria | 1747 |
| 635 | Ga0207678_10000140 | 3300026067 | Bacteria | 59288 |
| 636 | Ga0207678_10000577 | 3300026067 | Bacteria | 33572 |
| 637 | Ga0207678_10000643 | 3300026067 | Bacteria | 32112 |
| 638 | Ga0207678_10002307 | 3300026067 | Bacteria | 17274 |
| 639 | Ga0207678_10026314 | 3300026067 | Bacteria | 5075 |
| 640 | Ga0207678_10074092 | 3300026067 | Bacteria | 2917 |
| 641 | Ga0207678_10081182 | 3300026067 | Bacteria | 2775 |
| 642 | Ga0207702_10000717 | 3300026078 | Bacteria | 35600 |
| 643 | Ga0207702_10001870 | 3300026078 | Bacteria | 20641 |
| 644 | Ga0207702_10013999 | 3300026078 | Bacteria | 6664 |
| 645 | Ga0207702_10018943 | 3300026078 | Bacteria | 5695 |
| 646 | Ga0207702_10026144 | 3300026078 | Bacteria | 4845 |
| 647 | Ga0207702_10071028 | 3300026078 | Bacteria | 2996 |
| 648 | Ga0207702_10187910 | 3300026078 | Bacteria | 1906 |
| 649 | Ga0207702_10272894 | 3300026078 | Bacteria | 1596 |
| 650 | Ga0207641_10001904 | 3300026088 | Bacteria | 20032 |
| 651 | Ga0207641_10009763 | 3300026088 | Bacteria | 7904 |
| 652 | Ga0207648_10027795 | 3300026089 | Bacteria | 5019 |
| 653 | Ga0207648_10047957 | 3300026089 | Bacteria | 3742 |
| 654 | Ga0207676_10141543 | 3300026095 | Bacteria | 2060 |
| 655 | Ga0207674_10000055 | 3300026116 | Bacteria | 114021 |
| 656 | Ga0207674_10001010 | 3300026116 | Bacteria | 36767 |
| 657 | Ga0207674_10003546 | 3300026116 | Bacteria | 19045 |
| 658 | Ga0207674_10032918 | 3300026116 | Bacteria | 5433 |
| 659 | Ga0207674_10063368 | 3300026116 | Bacteria | 3732 |
| 660 | Ga0207674_10067033 | 3300026116 | Bacteria | 3614 |
| 661 | Ga0207674_10068046 | 3300026116 | Bacteria | 3584 |
| 662 | Ga0207674_10155643 | 3300026116 | Bacteria | 2241 |
| 663 | Ga0207674_10203879 | 3300026116 | Bacteria | 1927 |
| 664 | Ga0207698_10003633 | 3300026142 | Bacteria | 9311 |
| 665 | Ga0207698_10110762 | 3300026142 | Bacteria | 2300 |
| 666 | Ga0207698_10259261 | 3300026142 | Bacteria | 1596 |
| 667 | Ga0209981_1003695 | 3300027378 | Bacteria | 1990 |
| 668 | Ga0209179_1000006 | 3300027512 | Bacteria | 101289 |
| 669 | Ga0209999_1000340 | 3300027543 | Bacteria | 7033 |
| 670 | Ga0209983_1003433 | 3300027665 | Bacteria | 3388 |
| 671 | Ga0209971_1001679 | 3300027682 | Bacteria | 5473 |
| 672 | Ga0209974_10012587 | 3300027876 | Bacteria | 2827 |
| 673 | Ga0209974_10020661 | 3300027876 | Bacteria | 2182 |
| 674 | Ga0268266_10000001 | 3300028379 | Bacteria | 4040580 |
| 675 | Ga0268266_10000004 | 3300028379 | Bacteria | 1495817 |
| 676 | Ga0268266_10000008 | 3300028379 | Bacteria | 1161875 |
| 677 | Ga0268266_10343754 | 3300028379 | Bacteria | 1401 |
| 678 | Ga0268265_10000539 | 3300028380 | Bacteria | 38528 |
| 679 | Ga0268264_10265542 | 3300028381 | Bacteria | 1601 |
| 680 | Ga0265319_1010847 | 3300028563 | Bacteria | 3775 |
| 681 | Ga0265334_10000127 | 3300028573 | Bacteria | 48527 |
| 682 | Ga0265318_10000024 | 3300028577 | Bacteria | 159801 |
| 683 | Ga0307515_10000066 | 3300028794 | Bacteria | 244076 |
| 684 | Ga0307515_10006088 | 3300028794 | Bacteria | 24256 |
| 685 | Ga0307515_10091298 | 3300028794 | Bacteria | 3807 |
| 686 | Ga0265338_10015683 | 3300028800 | Bacteria | 8303 |
| 687 | Ga0314311_1007966 | 3300030733 | Bacteria | 5374 |
| 688 | Ga0265330_10004503 | 3300031235 | Bacteria | 7067 |
| 689 | Ga0265332_10009553 | 3300031238 | Bacteria | 4326 |
| 690 | Ga0265328_10004240 | 3300031239 | Bacteria | 6236 |
| 691 | Ga0265320_10030607 | 3300031240 | Bacteria | 2773 |
| 692 | Ga0265325_10021155 | 3300031241 | Bacteria | 3579 |
| 693 | Ga0265329_10001926 | 3300031242 | Bacteria | 9783 |
| 694 | Ga0265331_10002534 | 3300031250 | Bacteria | 12300 |
| 695 | Ga0265331_10015495 | 3300031250 | Bacteria | 4022 |
| 696 | Ga0265327_10000028 | 3300031251 | Bacteria | 361066 |
| 697 | Ga0265316_10004022 | 3300031344 | Bacteria | 14723 |
| 698 | Ga0307408_100000023 | 3300031548 | Bacteria | 295931 |
| 699 | Ga0307408_100037957 | 3300031548 | Bacteria | 3396 |
| 700 | Ga0307408_100106860 | 3300031548 | Bacteria | 2142 |
| 701 | Ga0307408_100161390 | 3300031548 | Bacteria | 1781 |
| 702 | Ga0265313_10001194 | 3300031595 | Bacteria | 24878 |
| 703 | Ga0307508_10263730 | 3300031616 | Bacteria | 1317 |
| 704 | Ga0307514_10020148 | 3300031649 | Bacteria | 5446 |
| 705 | Ga0316575_10035503 | 3300031665 | Bacteria | 1960 |
| 706 | Ga0316575_10055344 | 3300031665 | Bacteria | 1580 |
| 707 | Ga0265314_10001695 | 3300031711 | Bacteria | 23953 |
| 708 | Ga0265314_10011218 | 3300031711 | Bacteria | 7417 |
| 709 | Ga0265342_10010591 | 3300031712 | Bacteria | 6379 |
| 710 | Ga0307516_10000109 | 3300031730 | Bacteria | 94762 |
| 711 | Ga0307405_10145699 | 3300031731 | Bacteria | 1658 |
| 712 | Ga0307412_10006311 | 3300031911 | Bacteria | 6695 |
| 713 | Ga0307416_100363264 | 3300032002 | Bacteria | 1471 |
| 714 | Ga0307414_10017415 | 3300032004 | Bacteria | 4395 |
| 715 | Ga0307414_10034341 | 3300032004 | Bacteria | 3361 |
| 716 | Ga0307411_10035548 | 3300032005 | Bacteria | 3113 |
| 717 | Ga0307510_10003563 | 3300033180 | Bacteria | 18174 |
| 718 | Ga0373934_0008452 | 3300035086 | Bacteria | 3838 |
| 719 | Ga0373939_0000033 | 3300035114 | Bacteria | 49449 |
| 720 | Ga0373960_0008484 | 3300035121 | Bacteria | 2463 |
| 721 | Ga0316574_0028022 | 3300035398 | Bacteria | 3395 |
| 722 | Ga0395899_0000106 | 3300037312 | Bacteria | 144668 |
| 723 | Ga0395899_0011603 | 3300037312 | Bacteria | 6747 |
| 724 | Ga0395899_0112654 | 3300037312 | Bacteria | 1954 |
| 725 | Ga0395900_0000049 | 3300037418 | Bacteria | 226847 |
| 726 | Ga0395900_0000256 | 3300037418 | Bacteria | 82977 |
| 727 | Ga0395900_0000690 | 3300037418 | Bacteria | 45062 |
| 728 | Ga0395900_0009320 | 3300037418 | Bacteria | 10065 |
| 729 | Ga0395900_0015207 | 3300037418 | Bacteria | 7847 |
| 730 | Ga0395900_0095385 | 3300037418 | Bacteria | 3056 |
| 731 | Ga0395900_0136531 | 3300037418 | Bacteria | 2513 |
| 732 | Ga0395898_0000023 | 3300037466 | Bacteria | 379477 |
| 733 | Ga0395898_0000110 | 3300037466 | Bacteria | 217100 |
| 734 | Ga0395898_0001044 | 3300037466 | Bacteria | 43200 |
| 735 | Ga0395898_0021645 | 3300037466 | Bacteria | 6517 |
| 736 | Ga0395898_0035555 | 3300037466 | Bacteria | 4951 |
| 737 | Ga0395898_0111554 | 3300037466 | Bacteria | 2621 |
| 738 | Ga0395905_0000071 | 3300037471 | Bacteria | 174580 |
| 739 | Ga0395905_0000126 | 3300037471 | Bacteria | 126035 |
| 740 | Ga0395905_0001072 | 3300037471 | Bacteria | 34497 |
| 741 | Ga0395905_0002192 | 3300037471 | Bacteria | 22052 |
| 742 | Ga0395905_0015036 | 3300037471 | Bacteria | 7375 |
| 743 | Ga0395905_0015602 | 3300037471 | Bacteria | 7217 |
| 744 | Ga0395905_0020334 | 3300037471 | Bacteria | 6288 |
| 745 | Ga0395905_0029445 | 3300037471 | Bacteria | 5173 |
| 746 | Ga0395905_0103718 | 3300037471 | Bacteria | 2670 |
| 747 | Ga0395905_0113959 | 3300037471 | Bacteria | 2540 |
| 748 | Ga0395905_0147273 | 3300037471 | Bacteria | 2215 |
| 749 | Ga0395901_0003311 | 3300038443 | Bacteria | 16231 |
| 750 | Ga0395901_0015804 | 3300038443 | Bacteria | 7691 |
| 751 | Ga0395901_0033337 | 3300038443 | Bacteria | 5316 |
| 752 | Ga0395901_0051425 | 3300038443 | Bacteria | 4284 |
| 753 | Ga0395901_0056054 | 3300038443 | Bacteria | 4099 |
| 754 | Ga0395901_0121038 | 3300038443 | Bacteria | 2750 |
| 755 | Ga0395901_0196920 | 3300038443 | Bacteria | 2112 |
| 756 | Ga0395901_0269610 | 3300038443 | Bacteria | 1771 |
| 757 | Ga0436365_0478863 | 3300039437 | Bacteria | 3097 |
| 758 | Ga0436365_0770231 | 3300039437 | Bacteria | 1909 |
| 759 | Ga0436360_0478772 | 3300039438 | Bacteria | 1635 |
| 760 | Ga0436361_0117093 | 3300039447 | Bacteria | 18045 |
| 761 | Ga0436361_0181855 | 3300039447 | Bacteria | 10118 |
| 762 | Ga0436361_0285207 | 3300039447 | Bacteria | 30209 |
| 763 | Ga0436361_0332176 | 3300039447 | Bacteria | 56332 |
| 764 | Ga0436361_0549178 | 3300039447 | Bacteria | 6106 |
| 765 | Ga0436361_0886712 | 3300039447 | Bacteria | 114879 |
| 766 | Ga0436361_1067608 | 3300039447 | Bacteria | 3127 |
| 767 | Ga0436361_1071853 | 3300039447 | Bacteria | 4345 |
| 768 | Ga0436362_0539290 | 3300039453 | Bacteria | 4161 |
| 769 | Ga0439436_0000007 | 3300041404 | Bacteria | 120812 |
| 770 | Ga0439436_0011783 | 3300041404 | Bacteria | 2654 |
| 771 | Ga0439447_002843 | 3300041407 | Bacteria | 6217 |
| 772 | Ga0439465_0001319 | 3300041413 | Bacteria | 7985 |
| 773 | Ga0451800_0725589 | 3300041459 | Bacteria | 1955 |
| 774 | Ga0451802_0710763 | 3300041460 | Bacteria | 4619 |
| 775 | Ga0451806_572563 | 3300041462 | Bacteria | 11300 |
| 776 | Ga0451807_0955740 | 3300041486 | Bacteria | 2107 |
| 777 | Ga0451807_1808547 | 3300041486 | Bacteria | 1894 |
| 778 | Ga0439448_0027552 | 3300042005 | Bacteria | 1792 |
| 779 | Ga0439432_002019 | 3300042006 | Bacteria | 7683 |
| 780 | Ga0439432_008708 | 3300042006 | Bacteria | 3555 |
| 781 | Ga0439432_018054 | 3300042006 | Bacteria | 2361 |
| 782 | Ga0439449_0026676 | 3300042007 | Bacteria | 2156 |
| 783 | Ga0439449_0032110 | 3300042007 | Bacteria | 1957 |
| 784 | Ga0450888_000128 | 3300042126 | Bacteria | 6175 |
| 785 | Ga0450890_001491 | 3300042127 | Bacteria | 3366 |
| 786 | Ga0450890_002413 | 3300042127 | Bacteria | 2573 |
| 787 | Ga0450892_000486 | 3300042130 | Bacteria | 4586 |
| 788 | Ga0450889_000377 | 3300042144 | Bacteria | 4962 |
| 789 | Ga0439446_0018704 | 3300042156 | Bacteria | 1944 |
| 790 | Ga0450908_000033 | 3300042184 | Bacteria | 31285 |
| 791 | Ga0439459_0000956 | 3300042438 | Bacteria | 4089 |
| 792 | Ga0450893_0001034 | 3300042532 | Bacteria | 4185 |
| 793 | Ga0466969_0003393 | 3300044656 | Bacteria | 8474 |
| 794 | Ga0466969_0005020 | 3300044656 | Bacteria | 7043 |
| 795 | Ga0466969_0053743 | 3300044656 | Bacteria | 1974 |
| 796 | Ga0466969_0069861 | 3300044656 | Bacteria | 1690 |
| 797 | Ga0466972_0000761 | 3300044658 | Bacteria | 15355 |
| 798 | Ga0466982_0000001 | 3300044672 | Bacteria | 514662 |
| 799 | Ga0466982_0000083 | 3300044672 | Bacteria | 24784 |
| 800 | Ga0466965_0003924 | 3300044683 | Bacteria | 6582 |
| 801 | Ga0466965_0020584 | 3300044683 | Bacteria | 3172 |
| 802 | Ga0466966_0018259 | 3300044684 | Bacteria | 4627 |
| 803 | Ga0466966_0021980 | 3300044684 | Bacteria | 4188 |
| 804 | Ga0466966_0077877 | 3300044684 | Bacteria | 2068 |
| 805 | Ga0466961_0000391 | 3300044693 | Bacteria | 28076 |
| 806 | Ga0466961_0002089 | 3300044693 | Bacteria | 12446 |
| 807 | Ga0466961_0007752 | 3300044693 | Bacteria | 6834 |
| 808 | Ga0466961_0013754 | 3300044693 | Bacteria | 5186 |
| 809 | Ga0466961_0033183 | 3300044693 | Bacteria | 3317 |
| 810 | Ga0466961_0054799 | 3300044693 | Bacteria | 2543 |
| 811 | Ga0466963_0142660 | 3300044694 | Bacteria | 1660 |
| 812 | Ga0466963_0229597 | 3300044694 | Bacteria | 1300 |
| 813 | Ga0466964_0001887 | 3300044706 | Bacteria | 7317 |
| 814 | Ga0466964_0014757 | 3300044706 | Bacteria | 2972 |
| 815 | Ga0466964_0057500 | 3300044706 | Bacteria | 1610 |
| 816 | Ga0466971_0000637 | 3300044719 | Bacteria | 13969 |
| 817 | Ga0466971_0008613 | 3300044719 | Bacteria | 4449 |
| 818 | Ga0466971_0014458 | 3300044719 | Bacteria | 3472 |
| 819 | Ga0466971_0056552 | 3300044719 | Bacteria | 1769 |
| 820 | Ga0466968_0049671 | 3300044735 | Bacteria | 1788 |
| 821 | Ga0466970_0008744 | 3300044765 | Bacteria | 5102 |
| 822 | Ga0466970_0009866 | 3300044765 | Bacteria | 4835 |
| 823 | Ga0466970_0054849 | 3300044765 | Bacteria | 2128 |
| 824 | Ga0466957_0004185 | 3300044842 | Bacteria | 7995 |
| 825 | Ga0466957_0017758 | 3300044842 | Bacteria | 4173 |
| 826 | Ga0466957_0055839 | 3300044842 | Bacteria | 2413 |
| 827 | Ga0466957_0066255 | 3300044842 | Bacteria | 2226 |
| 828 | Ga0466960_0017957 | 3300044901 | Bacteria | 3093 |
| 829 | Ga0466960_0033971 | 3300044901 | Bacteria | 2373 |
| 830 | Ga0466959_0000022 | 3300045049 | Bacteria | 125849 |
| 831 | Ga0466959_0000132 | 3300045049 | Bacteria | 48490 |
| 832 | Ga0466959_0002678 | 3300045049 | Bacteria | 11431 |
| 833 | Ga0466959_0036023 | 3300045049 | Bacteria | 3656 |
| 834 | Ga0466959_0049203 | 3300045049 | Bacteria | 3096 |
| 835 | Ga0466958_0034855 | 3300045836 | Bacteria | 3004 |
| 836 | Ga0466958_0041201 | 3300045836 | Bacteria | 2777 |
| 837 | Ga0466958_0166523 | 3300045836 | Bacteria | 1395 |
| 838 | Ga0466967_0023893 | 3300045976 | Bacteria | 5017 |
| 839 | Ga0466967_0116785 | 3300045976 | Bacteria | 2459 |
| 840 | Ga0495617_000149 | 3300046452 | Bacteria | 44892 |
| 841 | Ga0495617_001199 | 3300046452 | Bacteria | 11663 |
| 842 | Ga0495638_0000071 | 3300046460 | Bacteria | 166300 |
| 843 | Ga0495638_0000152 | 3300046460 | Bacteria | 109586 |
| 844 | Ga0495638_0000378 | 3300046460 | Bacteria | 55320 |
| 845 | Ga0495638_0001285 | 3300046460 | Bacteria | 23401 |
| 846 | Ga0495650_0000074 | 3300046471 | Bacteria | 251346 |
| 847 | Ga0495650_0000112 | 3300046471 | Bacteria | 197339 |
| 848 | Ga0495650_0000838 | 3300046471 | Bacteria | 37106 |
| 849 | Ga0495650_0015578 | 3300046471 | Bacteria | 3893 |
| 850 | Ga0495582_0055081 | 3300046473 | Bacteria | 2192 |
| 851 | Ga0495584_0021179 | 3300046491 | Bacteria | 3301 |
| 852 | Ga0495585_0000063 | 3300046492 | Bacteria | 109530 |
| 853 | Ga0495585_0006782 | 3300046492 | Bacteria | 7069 |
| 854 | Ga0495607_0000029 | 3300046501 | Bacteria | 155005 |
| 855 | Ga0495607_0000061 | 3300046501 | Bacteria | 108427 |
| 856 | Ga0495607_0004279 | 3300046501 | Bacteria | 10560 |
| 857 | Ga0495607_0084794 | 3300046501 | Bacteria | 1732 |
| 858 | Ga0495583_0016839 | 3300046506 | Bacteria | 3907 |
| 859 | Ga0495606_0000301 | 3300046507 | Bacteria | 85258 |
| 860 | Ga0495606_0000546 | 3300046507 | Bacteria | 60458 |
| 861 | Ga0495606_0000749 | 3300046507 | Bacteria | 50146 |
| 862 | Ga0495606_0019997 | 3300046507 | Bacteria | 4955 |
| 863 | Ga0495606_0032493 | 3300046507 | Bacteria | 3614 |
| 864 | Ga0495606_0120429 | 3300046507 | Bacteria | 1571 |
| 865 | Ga0495610_0000944 | 3300046512 | Bacteria | 26960 |
| 866 | Ga0495610_0018926 | 3300046512 | Bacteria | 3870 |
| 867 | Ga0495616_0000128 | 3300046513 | Bacteria | 66249 |
| 868 | Ga0495616_0003416 | 3300046513 | Bacteria | 10177 |
| 869 | Ga0495620_0000274 | 3300046515 | Bacteria | 37605 |
| 870 | Ga0495620_0009426 | 3300046515 | Bacteria | 5194 |
| 871 | Ga0495631_0000098 | 3300046518 | Bacteria | 58396 |
| 872 | Ga0495631_0000749 | 3300046518 | Bacteria | 20780 |
| 873 | Ga0495632_0000014 | 3300046519 | Bacteria | 243913 |
| 874 | Ga0495632_0016317 | 3300046519 | Bacteria | 4134 |
| 875 | Ga0495637_0005239 | 3300046520 | Bacteria | 6637 |
| 876 | Ga0495648_0000643 | 3300046524 | Bacteria | 37243 |
| 877 | Ga0495648_0029108 | 3300046524 | Bacteria | 3670 |
| 878 | Ga0495663_0000696 | 3300046525 | Bacteria | 11574 |
| 879 | Ga0495663_0018500 | 3300046525 | Bacteria | 1984 |
| 880 | Ga0495663_0028092 | 3300046525 | Bacteria | 1654 |
| 881 | Ga0495598_0001101 | 3300046537 | Bacteria | 5186 |
| 882 | Ga0495609_0002356 | 3300046538 | Bacteria | 11663 |
| 883 | Ga0495621_0014733 | 3300046539 | Bacteria | 2480 |
| 884 | Ga0495597_0006722 | 3300046542 | Bacteria | 5921 |
| 885 | Ga0495622_0009004 | 3300046557 | Bacteria | 4623 |
| 886 | Ga0495656_0003555 | 3300046615 | Bacteria | 5278 |
| 887 | Ga0495668_0001831 | 3300046616 | Bacteria | 19230 |
| 888 | Ga0495668_0009921 | 3300046616 | Bacteria | 5806 |
| 889 | Ga0495668_0023691 | 3300046616 | Bacteria | 3498 |
| 890 | Ga0495611_0000003 | 3300046648 | Bacteria | 395679 |
| 891 | Ga0495611_0000014 | 3300046648 | Bacteria | 130151 |
| 892 | Ga0495625_0000019 | 3300046660 | Bacteria | 298330 |
| 893 | Ga0495625_0122019 | 3300046660 | Bacteria | 1772 |
| 894 | Ga0495625_0126058 | 3300046660 | Bacteria | 1738 |
| 895 | Ga0495661_0000703 | 3300046665 | Bacteria | 33156 |
| 896 | Ga0495670_0000482 | 3300046691 | Bacteria | 18898 |
| 897 | Ga0495670_0001847 | 3300046691 | Bacteria | 10420 |
| 898 | Ga0495670_0039847 | 3300046691 | Bacteria | 2343 |
| 899 | Ga0495671_0000549 | 3300046692 | Bacteria | 28132 |
| 900 | Ga0495649_0000594 | 3300046694 | Bacteria | 30227 |
| 901 | Ga0495649_0001665 | 3300046694 | Bacteria | 16510 |
| 902 | Ga0495589_0000018 | 3300046794 | Bacteria | 204851 |
| 903 | Ga0495660_0000122 | 3300046810 | Bacteria | 85116 |
| 904 | Ga0495660_0000585 | 3300046810 | Bacteria | 29006 |
| 905 | Ga0495636_0004489 | 3300047318 | Bacteria | 5470 |
| 906 | Ga0495636_0022908 | 3300047318 | Bacteria | 2527 |
| 907 | Ga0495683_0042707 | 3300047323 | Bacteria | 2285 |
| 908 | Ga0495687_000248 | 3300047443 | Bacteria | 72947 |
| 909 | Ga0495687_011305 | 3300047443 | Bacteria | 4812 |
| 910 | Ga0495679_000017 | 3300047446 | Bacteria | 263230 |
| 911 | Ga0495673_0000004 | 3300047469 | Bacteria | 1354526 |
| 912 | Ga0495673_0000347 | 3300047469 | Bacteria | 58250 |
| 913 | Ga0495673_0001611 | 3300047469 | Bacteria | 17516 |
| 914 | Ga0495686_0000024 | 3300047472 | Bacteria | 400343 |
| 915 | Ga0495686_0000409 | 3300047472 | Bacteria | 67869 |
| 916 | Ga0495686_0003267 | 3300047472 | Bacteria | 14189 |
| 917 | Ga0495686_0018839 | 3300047472 | Bacteria | 4622 |
| 918 | Ga0495686_0025591 | 3300047472 | Bacteria | 3867 |
| 919 | Ga0495593_0012401 | 3300047673 | Bacteria | 4873 |
| 920 | Ga0496100_0031843 | 3300048903 | Bacteria | 3282 |
| 921 | Ga0496100_0097421 | 3300048903 | Bacteria | 2020 |
| 922 | Ga0496101_0001464 | 3300048904 | Bacteria | 14105 |
| 923 | Ga0496101_0004029 | 3300048904 | Bacteria | 9189 |
| 924 | Ga0496102_0097922 | 3300048905 | Bacteria | 2721 |
| 925 | Ga0496104_0017116 | 3300048907 | Bacteria | 6595 |
| 926 | Ga0496104_0033408 | 3300048907 | Bacteria | 4792 |
| 927 | Ga0496105_0030457 | 3300048908 | Bacteria | 4421 |
| 928 | Ga0496105_0169066 | 3300048908 | Bacteria | 1793 |
| 929 | Ga0496106_0001770 | 3300048909 | Bacteria | 16112 |
| 930 | Ga0496106_0187888 | 3300048909 | Bacteria | 1642 |
| 931 | Ga0496107_0246978 | 3300048910 | Bacteria | 1328 |
| 932 | Ga0496108_0067336 | 3300048911 | Bacteria | 3020 |
| 933 | Ga0496108_0125251 | 3300048911 | Bacteria | 2205 |
| 934 | Ga0496109_0091283 | 3300048912 | Bacteria | 2817 |
| 935 | Ga0496109_0117634 | 3300048912 | Bacteria | 2474 |
| 936 | Ga0496110_0184289 | 3300048913 | Bacteria | 1895 |
| 937 | Ga0496112_0127012 | 3300048915 | Bacteria | 2520 |
| 938 | Ga0496112_0301098 | 3300048915 | Bacteria | 1549 |
| 939 | Ga0496113_0004524 | 3300048916 | Bacteria | 8561 |
| 940 | Ga0496113_0165710 | 3300048916 | Bacteria | 1748 |
| 941 | Ga0496115_0000008 | 3300048918 | Bacteria | 237485 |
| 942 | Ga0496115_0000043 | 3300048918 | Bacteria | 116422 |
| 943 | Ga0496115_0000474 | 3300048918 | Bacteria | 31973 |
| 944 | Ga0496115_0017672 | 3300048918 | Bacteria | 5459 |
| 945 | Ga0496115_0039836 | 3300048918 | Bacteria | 3733 |
| 946 | Ga0496115_0159181 | 3300048918 | Bacteria | 1866 |
| 947 | Ga0496117_0005621 | 3300048920 | Bacteria | 13091 |
| 948 | Ga0496117_0014937 | 3300048920 | Bacteria | 6657 |
| 949 | Ga0496117_0038495 | 3300048920 | Bacteria | 3544 |
| 950 | Ga0496117_0038598 | 3300048920 | Bacteria | 3536 |
| 951 | Ga0496117_0057035 | 3300048920 | Bacteria | 2716 |
| 952 | Ga0496118_0000081 | 3300048921 | Bacteria | 188525 |
| 953 | Ga0496118_0001013 | 3300048921 | Bacteria | 43722 |
| 954 | Ga0496118_0001137 | 3300048921 | Bacteria | 40981 |
| 955 | Ga0496118_0002106 | 3300048921 | Bacteria | 27904 |
| 956 | Ga0496118_0003206 | 3300048921 | Bacteria | 20878 |
| 957 | Ga0496118_0005866 | 3300048921 | Bacteria | 13763 |
| 958 | Ga0496118_0006022 | 3300048921 | Bacteria | 13511 |
| 959 | Ga0496118_0064638 | 3300048921 | Bacteria | 2683 |
| 960 | Ga0496118_0145705 | 3300048921 | Bacteria | 1492 |
| 961 | Ga0496119_0000235 | 3300048922 | Bacteria | 77921 |
| 962 | Ga0496119_0056719 | 3300048922 | Bacteria | 2372 |
| 963 | Ga0496120_0000208 | 3300048923 | Bacteria | 100328 |
| 964 | Ga0496120_0000282 | 3300048923 | Bacteria | 85605 |
| 965 | Ga0496121_0000109 | 3300048924 | Bacteria | 187307 |
| 966 | Ga0496121_0000480 | 3300048924 | Bacteria | 77305 |
| 967 | Ga0496121_0000708 | 3300048924 | Bacteria | 61851 |
| 968 | Ga0496121_0001959 | 3300048924 | Bacteria | 32773 |
| 969 | Ga0496121_0013832 | 3300048924 | Bacteria | 8637 |
| 970 | Ga0496121_0034748 | 3300048924 | Bacteria | 4532 |
| 971 | Ga0496121_0041518 | 3300048924 | Bacteria | 4018 |
| 972 | Ga0496121_0093178 | 3300048924 | Bacteria | 2346 |
| 973 | Ga0496122_0000362 | 3300048925 | Bacteria | 97690 |
| 974 | Ga0496122_0009488 | 3300048925 | Bacteria | 10244 |
| 975 | Ga0496122_0051113 | 3300048925 | Bacteria | 3144 |
| 976 | Ga0496123_0000317 | 3300048926 | Bacteria | 92079 |
| 977 | Ga0496123_0011106 | 3300048926 | Bacteria | 7854 |
| 978 | Ga0496123_0021372 | 3300048926 | Bacteria | 5032 |
| 979 | Ga0496124_0000006 | 3300048927 | Bacteria | 904259 |
| 980 | Ga0496124_0016949 | 3300048927 | Bacteria | 6899 |
| 981 | Ga0496124_0019749 | 3300048927 | Bacteria | 6257 |
| 982 | Ga0496125_0000118 | 3300048928 | Bacteria | 176551 |
| 983 | Ga0496125_0007510 | 3300048928 | Bacteria | 11587 |
| 984 | Ga0496126_0000087 | 3300048929 | Bacteria | 215031 |
| 985 | Ga0496126_0001680 | 3300048929 | Bacteria | 33123 |
| 986 | Ga0496126_0007774 | 3300048929 | Bacteria | 11684 |
| 987 | Ga0496126_0008899 | 3300048929 | Bacteria | 10750 |
| 988 | Ga0496126_0018409 | 3300048929 | Bacteria | 6920 |
| 989 | Ga0496126_0159567 | 3300048929 | Bacteria | 1928 |
| 990 | Ga0496126_0301082 | 3300048929 | Bacteria | 1323 |
| 991 | Ga0495678_000210 | 3300049459 | Bacteria | 68186 |
| 992 | Ga0495682_0026578 | 3300049460 | Bacteria | 2147 |
| 993 | Ga0501031_0005177 | 3300049568 | Bacteria | 8500 |
| 994 | Ga0501031_0032185 | 3300049568 | Bacteria | 3420 |
| 995 | Ga0501031_0064295 | 3300049568 | Bacteria | 2389 |
| 996 | Ga0501031_0080818 | 3300049568 | Bacteria | 2119 |
| 997 | Ga0501031_0200034 | 3300049568 | Bacteria | 1304 |
| 998 | Ga0501032_0001872 | 3300049569 | Bacteria | 16617 |
| 999 | Ga0501032_0002036 | 3300049569 | Bacteria | 15952 |
| 1000 | Ga0501032_0094424 | 3300049569 | Bacteria | 1983 |
| 1001 | Ga0501033_0001111 | 3300049570 | Bacteria | 24415 |
| 1002 | Ga0501033_0025850 | 3300049570 | Bacteria | 4420 |
| 1003 | Ga0501033_0054178 | 3300049570 | Bacteria | 2968 |
| 1004 | Ga0501033_0097146 | 3300049570 | Bacteria | 2152 |
| 1005 | Ga0501034_0001904 | 3300049571 | Bacteria | 26429 |
| 1006 | Ga0501034_0003143 | 3300049571 | Bacteria | 18996 |
| 1007 | Ga0501034_0003634 | 3300049571 | Bacteria | 17477 |
| 1008 | Ga0501034_0005592 | 3300049571 | Bacteria | 13692 |
| 1009 | Ga0501034_0048973 | 3300049571 | Bacteria | 4264 |
| 1010 | Ga0501034_0114928 | 3300049571 | Bacteria | 2680 |
| 1011 | Ga0501036_0082697 | 3300049572 | Bacteria | 2714 |
| 1012 | Ga0501036_0095052 | 3300049572 | Bacteria | 2519 |
| 1013 | Ga0501036_0095555 | 3300049572 | Bacteria | 2512 |
| 1014 | Ga0501036_0239297 | 3300049572 | Bacteria | 1523 |
| 1015 | Ga0501037_0000948 | 3300049573 | Bacteria | 21559 |
| 1016 | Ga0501037_0032551 | 3300049573 | Bacteria | 3851 |
| 1017 | Ga0501038_0000712 | 3300049574 | Bacteria | 29729 |
| 1018 | Ga0501038_0171471 | 3300049574 | Bacteria | 1756 |
| 1019 | Ga0501039_0087821 | 3300049575 | Bacteria | 2422 |
| 1020 | Ga0501039_0099173 | 3300049575 | Bacteria | 2273 |
| 1021 | Ga0501040_0056164 | 3300049576 | Bacteria | 2701 |
| 1022 | Ga0501042_0099878 | 3300049578 | Bacteria | 2086 |
| 1023 | Ga0501043_0004817 | 3300049579 | Bacteria | 10922 |
| 1024 | Ga0501043_0014565 | 3300049579 | Bacteria | 6157 |
| 1025 | Ga0501043_0025027 | 3300049579 | Bacteria | 4683 |
| 1026 | Ga0501043_0032578 | 3300049579 | Bacteria | 4098 |
| 1027 | Ga0501043_0094542 | 3300049579 | Bacteria | 2350 |
| 1028 | Ga0501043_0254424 | 3300049579 | Bacteria | 1352 |
| 1029 | Ga0501046_0007434 | 3300049580 | Bacteria | 9630 |
| 1030 | Ga0501046_0007779 | 3300049580 | Bacteria | 9403 |
| 1031 | Ga0501046_0017496 | 3300049580 | Bacteria | 5979 |
| 1032 | Ga0501046_0022598 | 3300049580 | Bacteria | 5181 |
| 1033 | Ga0501046_0038270 | 3300049580 | Bacteria | 3850 |
| 1034 | Ga0501046_0071888 | 3300049580 | Bacteria | 2686 |
| 1035 | Ga0501046_0173733 | 3300049580 | Bacteria | 1615 |
| 1036 | Ga0501047_0000492 | 3300049581 | Bacteria | 42926 |
| 1037 | Ga0501047_0000904 | 3300049581 | Bacteria | 30280 |
| 1038 | Ga0501047_0001924 | 3300049581 | Bacteria | 19960 |
| 1039 | Ga0501047_0010764 | 3300049581 | Bacteria | 8645 |
| 1040 | Ga0501048_0072422 | 3300049582 | Bacteria | 2432 |
| 1041 | Ga0501048_0081261 | 3300049582 | Bacteria | 2286 |
| 1042 | Ga0501067_0000426 | 3300049583 | Bacteria | 22971 |
| 1043 | Ga0501069_0002407 | 3300049585 | Bacteria | 9508 |
| 1044 | Ga0501070_0001125 | 3300049586 | Bacteria | 23991 |
| 1045 | Ga0501070_0003048 | 3300049586 | Bacteria | 14590 |
| 1046 | Ga0501070_0003914 | 3300049586 | Bacteria | 12847 |
| 1047 | Ga0501070_0006408 | 3300049586 | Bacteria | 10014 |
| 1048 | Ga0501070_0006453 | 3300049586 | Bacteria | 9986 |
| 1049 | Ga0501070_0034335 | 3300049586 | Bacteria | 4241 |
| 1050 | Ga0501070_0050466 | 3300049586 | Bacteria | 3454 |
| 1051 | Ga0501070_0055108 | 3300049586 | Bacteria | 3296 |
| 1052 | Ga0501070_0061295 | 3300049586 | Bacteria | 3117 |
| 1053 | Ga0501070_0151240 | 3300049586 | Bacteria | 1915 |
| 1054 | Ga0501070_0184247 | 3300049586 | Bacteria | 1717 |
| 1055 | Ga0501071_0002518 | 3300049587 | Bacteria | 11150 |
| 1056 | Ga0501072_0001604 | 3300049588 | Bacteria | 16909 |
| 1057 | Ga0501073_0000557 | 3300049589 | Bacteria | 26288 |
| 1058 | Ga0501073_0000757 | 3300049589 | Bacteria | 22907 |
| 1059 | Ga0501073_0018962 | 3300049589 | Bacteria | 4972 |
| 1060 | Ga0501073_0023067 | 3300049589 | Bacteria | 4474 |
| 1061 | Ga0501073_0090310 | 3300049589 | Bacteria | 2129 |
| 1062 | Ga0501074_0000162 | 3300049590 | Bacteria | 35443 |
| 1063 | Ga0501074_0000967 | 3300049590 | Bacteria | 18578 |
| 1064 | Ga0501074_0001529 | 3300049590 | Bacteria | 15658 |
| 1065 | Ga0501074_0007914 | 3300049590 | Bacteria | 7699 |
| 1066 | Ga0501074_0024898 | 3300049590 | Bacteria | 4348 |
| 1067 | Ga0501074_0028997 | 3300049590 | Bacteria | 4009 |
| 1068 | Ga0501074_0078312 | 3300049590 | Bacteria | 2372 |
| 1069 | Ga0501074_0107767 | 3300049590 | Bacteria | 1994 |
| 1070 | Ga0501217_032436 | 3300049661 | Bacteria | 1293 |
| 1071 | Ga0501222_003405 | 3300049662 | Bacteria | 2174 |
| 1072 | Ga0501227_013967 | 3300049665 | Bacteria | 1776 |
| 1073 | Ga0501233_026477 | 3300049668 | Bacteria | 1281 |
| 1074 | Ga0501258_000331 | 3300049687 | Bacteria | 3019 |
| 1075 | Ga0501221_001217 | 3300049704 | Bacteria | 4264 |
| 1076 | Ga0501229_000077 | 3300049706 | Bacteria | 9792 |
| 1077 | Ga0501079_0018533 | 3300049741 | Bacteria | 5318 |
| 1078 | Ga0501079_0031442 | 3300049741 | Bacteria | 4080 |
| 1079 | Ga0501080_0000381 | 3300049742 | Bacteria | 34167 |
| 1080 | Ga0501080_0000997 | 3300049742 | Bacteria | 23230 |
| 1081 | Ga0501080_0001633 | 3300049742 | Bacteria | 19070 |
| 1082 | Ga0501080_0004536 | 3300049742 | Bacteria | 12378 |
| 1083 | Ga0501080_0011327 | 3300049742 | Bacteria | 8163 |
| 1084 | Ga0501080_0017413 | 3300049742 | Bacteria | 6645 |
| 1085 | Ga0501080_0020342 | 3300049742 | Bacteria | 6142 |
| 1086 | Ga0501080_0133574 | 3300049742 | Bacteria | 2297 |
| 1087 | Ga0501081_0030435 | 3300049743 | Bacteria | 3653 |
| 1088 | Ga0501083_0001097 | 3300049744 | Bacteria | 18095 |
| 1089 | Ga0501083_0007218 | 3300049744 | Bacteria | 7889 |
| 1090 | Ga0501267_001243 | 3300049764 | Bacteria | 2149 |
| 1091 | Ga0501282_003805 | 3300049778 | Bacteria | 1621 |
| 1092 | Ga0501035_0001396 | 3300049822 | Bacteria | 24796 |
| 1093 | Ga0501035_0005645 | 3300049822 | Bacteria | 11813 |
| 1094 | Ga0501035_0007879 | 3300049822 | Bacteria | 9954 |
| 1095 | Ga0501035_0022978 | 3300049822 | Bacteria | 5724 |
| 1096 | Ga0501035_0055098 | 3300049822 | Bacteria | 3551 |
| 1097 | Ga0501035_0073532 | 3300049822 | Bacteria | 3024 |
| 1098 | Ga0501035_0075569 | 3300049822 | Bacteria | 2979 |
| 1099 | Ga0501035_0169767 | 3300049822 | Bacteria | 1885 |
| 1100 | Ga0501035_0180379 | 3300049822 | Bacteria | 1819 |
| 1101 | Ga0501035_0203588 | 3300049822 | Bacteria | 1696 |
| 1102 | Ga0501044_0001170 | 3300049823 | Bacteria | 31091 |
| 1103 | Ga0501044_0003235 | 3300049823 | Bacteria | 18336 |
| 1104 | Ga0501044_0007762 | 3300049823 | Bacteria | 11796 |
| 1105 | Ga0501044_0079869 | 3300049823 | Bacteria | 3313 |
| 1106 | Ga0501044_0094745 | 3300049823 | Bacteria | 3009 |
| 1107 | Ga0501044_0194674 | 3300049823 | Bacteria | 1988 |
| 1108 | Ga0501044_0320591 | 3300049823 | Bacteria | 1474 |
| 1109 | nmdc:mga03683_2992_c1 | 3300050489 | Bacteria | 5352 |
| 1110 | nmdc:mga0k408_10407_c1 | 3300050493 | Bacteria | 5030 |
| 1111 | nmdc:mga0k408_10582_c1 | 3300050493 | Bacteria | 4994 |
| 1112 | nmdc:mga0k408_20025_c1 | 3300050493 | Bacteria | 3744 |
| 1113 | nmdc:mga06z11_37238_c1 | 3300050494 | Bacteria | 2408 |
| 1114 | nmdc:mga07m45_10280_c1 | 3300050496 | Bacteria | 4884 |
| 1115 | nmdc:mga07m45_1940_c1 | 3300050496 | Bacteria | 9565 |
| 1116 | nmdc:mga07m45_44945_c1 | 3300050496 | Bacteria | 2479 |
| 1117 | Ga0495612_0046153 | 3300053078 | Bacteria | 1784 |
| 1118 | Ga0500610_0002424 | 3300053079 | Bacteria | 6864 |
| 1119 | Ga0500578_0000075 | 3300053086 | Bacteria | 109315 |
| 1120 | Ga0500643_000029 | 3300053087 | Bacteria | 211149 |
| 1121 | Ga0500643_002365 | 3300053087 | Bacteria | 9833 |
| 1122 | Ga0500651_0000166 | 3300053093 | Bacteria | 42732 |
| 1123 | Ga0500651_0036039 | 3300053093 | Bacteria | 3117 |
| 1124 | Ga0500651_0074795 | 3300053093 | Bacteria | 2105 |
| 1125 | Ga0500555_000067 | 3300053103 | Bacteria | 52543 |
| 1126 | Ga0500597_000058 | 3300053120 | Bacteria | 22169 |
| 1127 | Ga0500658_0003351 | 3300053134 | Bacteria | 6073 |
| 1128 | Ga0500559_0009650 | 3300053136 | Bacteria | 4167 |
| 1129 | Ga0500568_0003657 | 3300053139 | Bacteria | 8457 |
| 1130 | Ga0500590_005767 | 3300053148 | Bacteria | 5984 |
| 1131 | Ga0500622_0003844 | 3300053156 | Bacteria | 9770 |
| 1132 | Ga0500633_0000757 | 3300053160 | Bacteria | 5501 |
| 1133 | Ga0500645_004295 | 3300053730 | Bacteria | 5500 |
| 1134 | Ga0590071_001475 | 3300059421 | Bacteria | 6207 |
| 1135 | Ga0501082_0000234 | 3300060353 | Bacteria | 48354 |
| 1136 | Ga0501082_0005091 | 3300060353 | Bacteria | 11453 |
| 1137 | Ga0501082_0077129 | 3300060353 | Bacteria | 2873 |
| 1138 | Ga0501082_0115329 | 3300060353 | Bacteria | 2326 |
| 1139 | Ga0466962_0000447 | 3300061719 | Bacteria | 17893 |
| 1140 | Ga0466962_0000829 | 3300061719 | Bacteria | 13923 |
| 1141 | Ga0466962_0006825 | 3300061719 | Bacteria | 5479 |
| 1142 | Ga0466962_0067891 | 3300061719 | Bacteria | 1703 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025912 | Ga0207707_10001440 | Ga0207707_1000144013 | 316 |
| 2 | 3300039453 | Ga0436362_0539290 | Ga0436362_0539290_2018_3181 | 324 |
| 3 | 3300003323 | rootH1_10058324 | rootH1_100583245 | 328 |
| 4 | 3300030733 | Ga0314311_1007966 | Ga0314311_10079665 | 334 |
| 5 | 3300041486 | Ga0451807_1808547 | Ga0451807_1808547_255_1415 | 334 |
| 6 | 3300049578 | Ga0501042_0099878 | Ga0501042_0099878_17_1087 | 334 |
| 7 | 3300049822 | Ga0501035_0075569 | Ga0501035_0075569_1858_2928 | 334 |
| 8 | 3300044683 | Ga0466965_0020584 | Ga0466965_0020584_1477_2646 | 335 |
| 9 | 3300044693 | Ga0466961_0002089 | Ga0466961_0002089_1136_2305 | 335 |
| 10 | 3300044719 | Ga0466971_0056552 | Ga0466971_0056552_564_1733 | 335 |
| 11 | 3300044842 | Ga0466957_0017758 | Ga0466957_0017758_1612_2781 | 335 |
| 12 | 3300045049 | Ga0466959_0002678 | Ga0466959_0002678_3842_5011 | 335 |
| 13 | 3300061719 | Ga0466962_0000829 | Ga0466962_0000829_9347_10516 | 335 |
| 14 | 3300015689 | Ga0183360_10002 | Ga0183360_10002780 | 338 |
| 15 | 3300025263 | Ga0209565_1011717 | Ga0209565_10117172 | 338 |
| 16 | 3300049568 | Ga0501031_0005177 | Ga0501031_0005177_6463_7623 | 338 |
| 17 | 3300049569 | Ga0501032_0002036 | Ga0501032_0002036_13243_14403 | 338 |
| 18 | 3300049571 | Ga0501034_0001904 | Ga0501034_0001904_23763_24923 | 338 |
| 19 | 3300049572 | Ga0501036_0095555 | Ga0501036_0095555_1028_2188 | 338 |
| 20 | 3300049573 | Ga0501037_0000948 | Ga0501037_0000948_3621_4781 | 338 |
| 21 | 3300049574 | Ga0501038_0000712 | Ga0501038_0000712_26098_27258 | 338 |
| 22 | 3300049575 | Ga0501039_0087821 | Ga0501039_0087821_45_1205 | 338 |
| 23 | 3300049579 | Ga0501043_0014565 | Ga0501043_0014565_4221_5381 | 338 |
| 24 | 3300049580 | Ga0501046_0017496 | Ga0501046_0017496_3060_4220 | 338 |
| 25 | 3300049582 | Ga0501048_0072422 | Ga0501048_0072422_384_1544 | 338 |
| 26 | 3300049589 | Ga0501073_0023067 | Ga0501073_0023067_1466_2626 | 338 |
| 27 | 3300049822 | Ga0501035_0001396 | Ga0501035_0001396_22826_23986 | 338 |
| 28 | 3300005455 | Ga0070663_100000512 | Ga0070663_10000051219 | 342 |
| 29 | 3300005539 | Ga0068853_100000503 | Ga0068853_10000050319 | 342 |
| 30 | 3300005617 | Ga0068859_100269030 | Ga0068859_1002690302 | 342 |
| 31 | 3300005842 | Ga0068858_100243445 | Ga0068858_1002434452 | 342 |
| 32 | 3300006931 | Ga0097620_100269058 | Ga0097620_1002690582 | 342 |
| 33 | 3300009177 | Ga0105248_10000231 | Ga0105248_1000023126 | 342 |
| 34 | 3300009545 | Ga0105237_10001039 | Ga0105237_100010392 | 342 |
| 35 | 3300025913 | Ga0207695_10238901 | Ga0207695_102389011 | 342 |
| 36 | 3300025914 | Ga0207671_10158134 | Ga0207671_101581341 | 342 |
| 37 | 3300025941 | Ga0207711_10000539 | Ga0207711_100005392 | 342 |
| 38 | 3300026067 | Ga0207678_10000140 | Ga0207678_1000014024 | 342 |
| 39 | 3300048925 | Ga0496122_0000362 | Ga0496122_0000362_18450_19610 | 342 |
| 40 | 3300048926 | Ga0496123_0000317 | Ga0496123_0000317_67464_68624 | 342 |
| 41 | 3300053087 | Ga0500643_002365 | Ga0500643_002365_8493_9653 | 343 |
| 42 | 3300053120 | Ga0500597_000058 | Ga0500597_000058_1122_2282 | 343 |
| 43 | 3300042005 | Ga0439448_0027552 | Ga0439448_0027552_231_1421 | 346 |
| 44 | 3300037466 | Ga0395898_0111554 | Ga0395898_0111554_755_1921 | 347 |
| 45 | 3300038443 | Ga0395901_0015804 | Ga0395901_0015804_4848_6014 | 347 |
| 46 | 3300039437 | Ga0436365_0478863 | Ga0436365_0478863_529_1692 | 347 |
| 47 | 3300003771 | Ga0055526_1000014 | Ga0055526_10000149 | 348 |
| 48 | 3300003773 | Ga0055537_1000059 | Ga0055537_10000595 | 348 |
| 49 | 3300003775 | Ga0055524_1000019 | Ga0055524_1000019207 | 348 |
| 50 | 3300003784 | Ga0055534_1000012 | Ga0055534_10000129 | 348 |
| 51 | 3300003790 | Ga0055528_1000007 | Ga0055528_10000079 | 348 |
| 52 | 3300005344 | Ga0070661_100165178 | Ga0070661_1001651782 | 348 |
| 53 | 3300005366 | Ga0070659_100276202 | Ga0070659_1002762021 | 348 |
| 54 | 3300005539 | Ga0068853_100001130 | Ga0068853_10000113017 | 348 |
| 55 | 3300005563 | Ga0068855_100062851 | Ga0068855_1000628513 | 348 |
| 56 | 3300005578 | Ga0068854_100216115 | Ga0068854_1002161152 | 348 |
| 57 | 3300025263 | Ga0209565_1000001 | Ga0209565_1000001447 | 348 |
| 58 | 3300025273 | Ga0209673_1000001 | Ga0209673_1000001447 | 348 |
| 59 | 3300025291 | Ga0209675_1000001 | Ga0209675_10000012085 | 348 |
| 60 | 3300025295 | Ga0209564_1000001 | Ga0209564_10000012247 | 348 |
| 61 | 3300025299 | Ga0209256_1000006 | Ga0209256_1000006683 | 348 |
| 62 | 3300025949 | Ga0207667_10154287 | Ga0207667_101542872 | 348 |
| 63 | 3300026041 | Ga0207639_10001429 | Ga0207639_100014298 | 348 |
| 64 | 3300031548 | Ga0307408_100037957 | Ga0307408_1000379572 | 348 |
| 65 | 3300053079 | Ga0500610_0002424 | Ga0500610_0002424_1557_2717 | 348 |
| 66 | 3300001915 | JGI24741J21665_1000441 | JGI24741J21665_10004413 | 349 |
| 67 | 3300005329 | Ga0070683_100027493 | Ga0070683_1000274933 | 349 |
| 68 | 3300005345 | Ga0070692_10058924 | Ga0070692_100589242 | 349 |
| 69 | 3300005366 | Ga0070659_100018494 | Ga0070659_1000184942 | 349 |
| 70 | 3300005539 | Ga0068853_100035689 | Ga0068853_1000356894 | 349 |
| 71 | 3300005546 | Ga0070696_100053566 | Ga0070696_1000535661 | 349 |
| 72 | 3300005564 | Ga0070664_100025481 | Ga0070664_1000254815 | 349 |
| 73 | 3300005614 | Ga0068856_100013002 | Ga0068856_1000130026 | 349 |
| 74 | 3300013102 | Ga0157371_10142272 | Ga0157371_101422722 | 349 |
| 75 | 3300025909 | Ga0207705_10083746 | Ga0207705_100837461 | 349 |
| 76 | 3300025913 | Ga0207695_10009353 | Ga0207695_100093534 | 349 |
| 77 | 3300025917 | Ga0207660_10006573 | Ga0207660_100065738 | 349 |
| 78 | 3300025920 | Ga0207649_10128437 | Ga0207649_101284372 | 349 |
| 79 | 3300025921 | Ga0207652_10023320 | Ga0207652_100233203 | 349 |
| 80 | 3300025932 | Ga0207690_10178563 | Ga0207690_101785631 | 349 |
| 81 | 3300025945 | Ga0207679_10149172 | Ga0207679_101491721 | 349 |
| 82 | 3300025949 | Ga0207667_10013260 | Ga0207667_100132609 | 349 |
| 83 | 3300025981 | Ga0207640_10023346 | Ga0207640_100233463 | 349 |
| 84 | 3300026041 | Ga0207639_10024619 | Ga0207639_100246192 | 349 |
| 85 | 3300026116 | Ga0207674_10003546 | Ga0207674_100035467 | 349 |
| 86 | 3300032004 | Ga0307414_10034341 | Ga0307414_100343413 | 350 |
| 87 | 3300005367 | Ga0070667_100000049 | Ga0070667_100000049124 | 351 |
| 88 | 3300009093 | Ga0105240_10143340 | Ga0105240_101433402 | 351 |
| 89 | 3300025986 | Ga0207658_10000033 | Ga0207658_1000003328 | 351 |
| 90 | 3300005336 | Ga0070680_100000540 | Ga0070680_10000054023 | 352 |
| 91 | 3300037471 | Ga0395905_0015036 | Ga0395905_0015036_1871_3037 | 352 |
| 92 | 3300053093 | Ga0500651_0036039 | Ga0500651_0036039_1713_2873 | 352 |
| 93 | 3300005336 | Ga0070680_100002649 | Ga0070680_1000026499 | 353 |
| 94 | 3300005458 | Ga0070681_10003374 | Ga0070681_1000337413 | 353 |
| 95 | 3300005530 | Ga0070679_100003239 | Ga0070679_1000032392 | 353 |
| 96 | 3300006353 | Ga0075370_10005248 | Ga0075370_100052482 | 353 |
| 97 | 3300025917 | Ga0207660_10002081 | Ga0207660_100020816 | 353 |
| 98 | 3300025921 | Ga0207652_10001869 | Ga0207652_1000186918 | 353 |
| 99 | 3300046519 | Ga0495632_0000014 | Ga0495632_0000014_165599_166720 | 353 |
| 100 | 3300050496 | nmdc:mga07m45_1940_c1 | nmdc:mga07m45_1940_c1_155_1324 | 353 |
| 101 | 3300003187 | JGI25151J46595_10000102 | JGI25151J46595_1000010217 | 354 |
| 102 | 3300025245 | Ga0207425_1002775 | Ga0207425_10027752 | 354 |
| 103 | 3300025294 | Ga0209025_1000006 | Ga0209025_1000006641 | 354 |
| 104 | 3300002705 | JGI25156J39149_1009947 | JGI25156J39149_10099472 | 355 |
| 105 | 3300002741 | JGI25157J39369_1001047 | JGI25157J39369_10010476 | 355 |
| 106 | 3300009553 | Ga0105249_10002941 | Ga0105249_100029416 | 355 |
| 107 | 3300010375 | Ga0105239_10076147 | Ga0105239_100761473 | 355 |
| 108 | 3300025250 | Ga0209026_1000087 | Ga0209026_100008798 | 355 |
| 109 | 3300025256 | Ga0209759_1000503 | Ga0209759_100050327 | 355 |
| 110 | 3300025961 | Ga0207712_10007177 | Ga0207712_100071772 | 355 |
| 111 | 3300037312 | Ga0395899_0000106 | Ga0395899_0000106_71890_73059 | 355 |
| 112 | 3300037418 | Ga0395900_0000049 | Ga0395900_0000049_54866_56035 | 355 |
| 113 | 3300037466 | Ga0395898_0000110 | Ga0395898_0000110_171239_172408 | 355 |
| 114 | 3300038443 | Ga0395901_0196920 | Ga0395901_0196920_881_2050 | 355 |
| 115 | 3300044656 | Ga0466969_0053743 | Ga0466969_0053743_14_1183 | 355 |
| 116 | 3300044693 | Ga0466961_0033183 | Ga0466961_0033183_595_1764 | 355 |
| 117 | 3300044706 | Ga0466964_0057500 | Ga0466964_0057500_146_1315 | 355 |
| 118 | 3300044765 | Ga0466970_0008744 | Ga0466970_0008744_2844_4013 | 355 |
| 119 | 3300044842 | Ga0466957_0004185 | Ga0466957_0004185_3786_4955 | 355 |
| 120 | 3300045049 | Ga0466959_0000022 | Ga0466959_0000022_68134_69303 | 355 |
| 121 | 3300061719 | Ga0466962_0067891 | Ga0466962_0067891_65_1234 | 355 |
| 122 | 3300002737 | JGI25162J39368_1000444 | JGI25162J39368_10004442 | 356 |
| 123 | 3300002772 | JGI25164J39214_1000294 | JGI25164J39214_100029429 | 356 |
| 124 | 3300003214 | JGI25165J46597_1003708 | JGI25165J46597_10037082 | 356 |
| 125 | 3300005339 | Ga0070660_100037085 | Ga0070660_1000370853 | 356 |
| 126 | 3300005458 | Ga0070681_10014057 | Ga0070681_100140573 | 356 |
| 127 | 3300005530 | Ga0070679_100030325 | Ga0070679_1000303253 | 356 |
| 128 | 3300005546 | Ga0070696_100010412 | Ga0070696_1000104124 | 356 |
| 129 | 3300005547 | Ga0070693_100004190 | Ga0070693_1000041905 | 356 |
| 130 | 3300005577 | Ga0068857_100012200 | Ga0068857_1000122003 | 356 |
| 131 | 3300013100 | Ga0157373_10102087 | Ga0157373_101020872 | 356 |
| 132 | 3300013102 | Ga0157371_10042222 | Ga0157371_100422223 | 356 |
| 133 | 3300013306 | Ga0163162_10000042 | Ga0163162_100000428 | 356 |
| 134 | 3300013307 | Ga0157372_10102701 | Ga0157372_101027012 | 356 |
| 135 | 3300025231 | Ga0207427_100133 | Ga0207427_10013326 | 356 |
| 136 | 3300025233 | Ga0209437_100005 | Ga0209437_100005599 | 356 |
| 137 | 3300025261 | Ga0209233_1000011 | Ga0209233_1000011343 | 356 |
| 138 | 3300025912 | Ga0207707_10022905 | Ga0207707_100229053 | 356 |
| 139 | 3300025919 | Ga0207657_10039214 | Ga0207657_100392142 | 356 |
| 140 | 3300025932 | Ga0207690_10010328 | Ga0207690_100103284 | 356 |
| 141 | 3300026116 | Ga0207674_10032918 | Ga0207674_100329183 | 356 |
| 142 | 3300041404 | Ga0439436_0011783 | Ga0439436_0011783_167_1333 | 356 |
| 143 | 3300047472 | Ga0495686_0003267 | Ga0495686_0003267_1476_2636 | 356 |
| 144 | 3300025949 | Ga0207667_10182163 | Ga0207667_101821632 | 357 |
| 145 | 3300031548 | Ga0307408_100000023 | Ga0307408_1000000233 | 357 |
| 146 | 3300037312 | Ga0395899_0011603 | Ga0395899_0011603_3095_4264 | 357 |
| 147 | 3300037466 | Ga0395898_0000023 | Ga0395898_0000023_129987_131156 | 357 |
| 148 | 3300038443 | Ga0395901_0269610 | Ga0395901_0269610_265_1434 | 357 |
| 149 | 3300046525 | Ga0495663_0000696 | Ga0495663_0000696_6170_7336 | 357 |
| 150 | 3300048929 | Ga0496126_0018409 | Ga0496126_0018409_3361_4524 | 357 |
| 151 | 3300001915 | JGI24741J21665_1001154 | JGI24741J21665_10011548 | 358 |
| 152 | 3300001979 | JGI24740J21852_10012965 | JGI24740J21852_100129652 | 358 |
| 153 | 3300005329 | Ga0070683_100318764 | Ga0070683_1003187641 | 358 |
| 154 | 3300005337 | Ga0070682_100049525 | Ga0070682_1000495252 | 358 |
| 155 | 3300005341 | Ga0070691_10127066 | Ga0070691_101270661 | 358 |
| 156 | 3300005436 | Ga0070713_100000758 | Ga0070713_10000075812 | 358 |
| 157 | 3300005535 | Ga0070684_100217079 | Ga0070684_1002170792 | 358 |
| 158 | 3300005546 | Ga0070696_100085961 | Ga0070696_1000859612 | 358 |
| 159 | 3300005547 | Ga0070693_100003280 | Ga0070693_1000032802 | 358 |
| 160 | 3300005578 | Ga0068854_100103503 | Ga0068854_1001035033 | 358 |
| 161 | 3300005614 | Ga0068856_100171728 | Ga0068856_1001717281 | 358 |
| 162 | 3300009093 | Ga0105240_10241397 | Ga0105240_102413972 | 358 |
| 163 | 3300009551 | Ga0105238_10034105 | Ga0105238_100341052 | 358 |
| 164 | 3300013104 | Ga0157370_10009778 | Ga0157370_100097789 | 358 |
| 165 | 3300014968 | Ga0157379_10058679 | Ga0157379_100586793 | 358 |
| 166 | 3300015262 | Ga0182007_10010679 | Ga0182007_100106792 | 358 |
| 167 | 3300020082 | Ga0206353_11071570 | Ga0206353_110715702 | 358 |
| 168 | 3300025904 | Ga0207647_10002322 | Ga0207647_1000232212 | 358 |
| 169 | 3300025909 | Ga0207705_10001071 | Ga0207705_100010717 | 358 |
| 170 | 3300025912 | Ga0207707_10000230 | Ga0207707_1000023041 | 358 |
| 171 | 3300025912 | Ga0207707_10000245 | Ga0207707_1000024540 | 358 |
| 172 | 3300025913 | Ga0207695_10014719 | Ga0207695_100147197 | 358 |
| 173 | 3300025917 | Ga0207660_10000084 | Ga0207660_1000008417 | 358 |
| 174 | 3300025919 | Ga0207657_10007064 | Ga0207657_100070648 | 358 |
| 175 | 3300025920 | Ga0207649_10012746 | Ga0207649_100127463 | 358 |
| 176 | 3300025921 | Ga0207652_10000318 | Ga0207652_1000031817 | 358 |
| 177 | 3300025928 | Ga0207700_10009061 | Ga0207700_100090614 | 358 |
| 178 | 3300025932 | Ga0207690_10003291 | Ga0207690_100032918 | 358 |
| 179 | 3300025933 | Ga0207706_10041359 | Ga0207706_100413593 | 358 |
| 180 | 3300025944 | Ga0207661_10004766 | Ga0207661_100047668 | 358 |
| 181 | 3300025945 | Ga0207679_10015863 | Ga0207679_100158632 | 358 |
| 182 | 3300025949 | Ga0207667_10001418 | Ga0207667_1000141813 | 358 |
| 183 | 3300025981 | Ga0207640_10004459 | Ga0207640_100044597 | 358 |
| 184 | 3300026041 | Ga0207639_10002310 | Ga0207639_100023108 | 358 |
| 185 | 3300026067 | Ga0207678_10002307 | Ga0207678_1000230713 | 358 |
| 186 | 3300026078 | Ga0207702_10013999 | Ga0207702_100139991 | 358 |
| 187 | 3300026116 | Ga0207674_10001010 | Ga0207674_1000101018 | 358 |
| 188 | 3300026142 | Ga0207698_10110762 | Ga0207698_101107622 | 358 |
| 189 | 3300038443 | Ga0395901_0121038 | Ga0395901_0121038_437_1600 | 358 |
| 190 | 3300039447 | Ga0436361_1067608 | Ga0436361_1067608_1543_2709 | 358 |
| 191 | 3300042156 | Ga0439446_0018704 | Ga0439446_0018704_539_1705 | 358 |
| 192 | 3300046507 | Ga0495606_0032493 | Ga0495606_0032493_1773_2939 | 358 |
| 193 | 3300049744 | Ga0501083_0007218 | Ga0501083_0007218_6383_7552 | 358 |
| 194 | 3300049822 | Ga0501035_0007879 | Ga0501035_0007879_6442_7605 | 358 |
| 195 | 3300001979 | JGI24740J21852_10003893 | JGI24740J21852_100038936 | 359 |
| 196 | 3300001990 | JGI24737J22298_10002520 | JGI24737J22298_100025205 | 359 |
| 197 | 3300002067 | JGI24735J21928_10013053 | JGI24735J21928_100130532 | 359 |
| 198 | 3300003215 | JGI25153J46596_10005179 | JGI25153J46596_100051792 | 359 |
| 199 | 3300003320 | rootH2_10011229 | rootH2_1001122928 | 359 |
| 200 | 3300003578 | Ga0006562J51391_1010474 | Ga0006562J51391_10104742 | 359 |
| 201 | 3300003578 | Ga0006562J51391_1010475 | Ga0006562J51391_10104755 | 359 |
| 202 | 3300005435 | Ga0070714_100042401 | Ga0070714_1000424013 | 359 |
| 203 | 3300005455 | Ga0070663_100010241 | Ga0070663_1000102413 | 359 |
| 204 | 3300005547 | Ga0070693_100005142 | Ga0070693_1000051423 | 359 |
| 205 | 3300005563 | Ga0068855_100007860 | Ga0068855_1000078603 | 359 |
| 206 | 3300005563 | Ga0068855_100011206 | Ga0068855_1000112066 | 359 |
| 207 | 3300005577 | Ga0068857_100001009 | Ga0068857_10000100911 | 359 |
| 208 | 3300005616 | Ga0068852_100116843 | Ga0068852_1001168433 | 359 |
| 209 | 3300005834 | Ga0068851_10023732 | Ga0068851_100237323 | 359 |
| 210 | 3300009093 | Ga0105240_10010177 | Ga0105240_100101775 | 359 |
| 211 | 3300009093 | Ga0105240_10198859 | Ga0105240_101988592 | 359 |
| 212 | 3300009174 | Ga0105241_10053604 | Ga0105241_100536042 | 359 |
| 213 | 3300009545 | Ga0105237_10000011 | Ga0105237_10000011167 | 359 |
| 214 | 3300010375 | Ga0105239_10021558 | Ga0105239_100215583 | 359 |
| 215 | 3300012500 | Ga0157314_1000231 | Ga0157314_10002312 | 359 |
| 216 | 3300013105 | Ga0157369_10003874 | Ga0157369_100038746 | 359 |
| 217 | 3300013307 | Ga0157372_10129150 | Ga0157372_101291502 | 359 |
| 218 | 3300014497 | Ga0182008_10021481 | Ga0182008_100214812 | 359 |
| 219 | 3300025258 | Ga0209129_1004673 | Ga0209129_10046734 | 359 |
| 220 | 3300025297 | Ga0209758_1002225 | Ga0209758_100222512 | 359 |
| 221 | 3300025321 | Ga0207656_10025795 | Ga0207656_100257952 | 359 |
| 222 | 3300025904 | Ga0207647_10041012 | Ga0207647_100410123 | 359 |
| 223 | 3300025913 | Ga0207695_10002388 | Ga0207695_100023886 | 359 |
| 224 | 3300025914 | Ga0207671_10000011 | Ga0207671_10000011164 | 359 |
| 225 | 3300025949 | Ga0207667_10000240 | Ga0207667_1000024039 | 359 |
| 226 | 3300026116 | Ga0207674_10000055 | Ga0207674_100000559 | 359 |
| 227 | 3300026142 | Ga0207698_10003633 | Ga0207698_100036331 | 359 |
| 228 | 3300048921 | Ga0496118_0145705 | Ga0496118_0145705_187_1350 | 359 |
| 229 | 3300048924 | Ga0496121_0013832 | Ga0496121_0013832_3923_5086 | 359 |
| 230 | 3300048928 | Ga0496125_0000118 | Ga0496125_0000118_133030_134193 | 359 |
| 231 | 3300049579 | Ga0501043_0032578 | Ga0501043_0032578_742_1887 | 359 |
| 232 | 3300049586 | Ga0501070_0184247 | Ga0501070_0184247_331_1494 | 359 |
| 233 | 3300049590 | Ga0501074_0007914 | Ga0501074_0007914_6380_7543 | 359 |
| 234 | 3300002741 | JGI25157J39369_1001598 | JGI25157J39369_10015987 | 360 |
| 235 | 3300005364 | Ga0070673_100188302 | Ga0070673_1001883022 | 360 |
| 236 | 3300006175 | Ga0070712_100188060 | Ga0070712_1001880602 | 360 |
| 237 | 3300025226 | Ga0209674_101279 | Ga0209674_1012792 | 360 |
| 238 | 3300025250 | Ga0209026_1000017 | Ga0209026_1000017173 | 360 |
| 239 | 3300025256 | Ga0209759_1012258 | Ga0209759_10122581 | 360 |
| 240 | 3300025960 | Ga0207651_10021204 | Ga0207651_100212043 | 360 |
| 241 | 3300031665 | Ga0316575_10055344 | Ga0316575_100553441 | 360 |
| 242 | 3300035398 | Ga0316574_0028022 | Ga0316574_0028022_742_1896 | 360 |
| 243 | 3300048903 | Ga0496100_0097421 | Ga0496100_0097421_135_1301 | 360 |
| 244 | iso_pu_bacteria | 2886848708 | 2886850251 | 360 |
| 245 | 3300042006 | Ga0439432_018054 | Ga0439432_018054_767_1933 | 361 |
| 246 | 3300048920 | Ga0496117_0038598 | Ga0496117_0038598_57_1217 | 361 |
| 247 | 3300048921 | Ga0496118_0000081 | Ga0496118_0000081_87655_88815 | 361 |
| 248 | 3300005262 | Ga0065165_1001585 | Ga0065165_100158519 | 362 |
| 249 | 3300053136 | Ga0500559_0009650 | Ga0500559_0009650_1210_2376 | 363 |
| 250 | 3300001989 | JGI24739J22299_10000815 | JGI24739J22299_100008154 | 364 |
| 251 | 3300005331 | Ga0070670_100049297 | Ga0070670_1000492971 | 364 |
| 252 | 3300005548 | Ga0070665_100408206 | Ga0070665_1004082062 | 364 |
| 253 | 3300013105 | Ga0157369_10110398 | Ga0157369_101103983 | 364 |
| 254 | 3300037471 | Ga0395905_0147273 | Ga0395905_0147273_581_1747 | 364 |
| 255 | 3300041460 | Ga0451802_0710763 | Ga0451802_0710763_1475_2635 | 364 |
| 256 | 3300044735 | Ga0466968_0049671 | Ga0466968_0049671_59_1222 | 364 |
| 257 | 3300049590 | Ga0501074_0000967 | Ga0501074_0000967_1713_2876 | 364 |
| 258 | 3300049822 | Ga0501035_0005645 | Ga0501035_0005645_942_2105 | 364 |
| 259 | 3300049823 | Ga0501044_0001170 | Ga0501044_0001170_20733_21896 | 364 |
| 260 | 3300003322 | rootL2_10043721 | rootL2_100437215 | 365 |
| 261 | 3300005577 | Ga0068857_100008043 | Ga0068857_1000080434 | 365 |
| 262 | 3300005618 | Ga0068864_100000276 | Ga0068864_10000027646 | 365 |
| 263 | 3300005841 | Ga0068863_100073031 | Ga0068863_1000730312 | 365 |
| 264 | 3300025912 | Ga0207707_10345262 | Ga0207707_103452621 | 365 |
| 265 | 3300026078 | Ga0207702_10272894 | Ga0207702_102728941 | 365 |
| 266 | 3300026088 | Ga0207641_10009763 | Ga0207641_100097634 | 365 |
| 267 | 3300026116 | Ga0207674_10155643 | Ga0207674_101556432 | 365 |
| 268 | 3300041486 | Ga0451807_0955740 | Ga0451807_0955740_91_1260 | 365 |
| 269 | 3300048912 | Ga0496109_0091283 | Ga0496109_0091283_75_1241 | 365 |
| 270 | 3300048915 | Ga0496112_0301098 | Ga0496112_0301098_199_1365 | 365 |
| 271 | 3300048922 | Ga0496119_0056719 | Ga0496119_0056719_389_1552 | 365 |
| 272 | 3300048923 | Ga0496120_0000282 | Ga0496120_0000282_55224_56387 | 365 |
| 273 | 3300005344 | Ga0070661_100059230 | Ga0070661_1000592302 | 366 |
| 274 | 3300005563 | Ga0068855_100103461 | Ga0068855_1001034612 | 366 |
| 275 | 3300005578 | Ga0068854_100054870 | Ga0068854_1000548702 | 366 |
| 276 | 3300005614 | Ga0068856_100004361 | Ga0068856_10000436110 | 366 |
| 277 | 3300005616 | Ga0068852_100023590 | Ga0068852_1000235903 | 366 |
| 278 | 3300009093 | Ga0105240_10049970 | Ga0105240_100499702 | 366 |
| 279 | 3300009174 | Ga0105241_10024431 | Ga0105241_100244312 | 366 |
| 280 | 3300009545 | Ga0105237_10020257 | Ga0105237_100202572 | 366 |
| 281 | 3300009551 | Ga0105238_10018511 | Ga0105238_100185116 | 366 |
| 282 | 3300010375 | Ga0105239_10001667 | Ga0105239_1000166718 | 366 |
| 283 | 3300013105 | Ga0157369_10046210 | Ga0157369_100462104 | 366 |
| 284 | 3300013307 | Ga0157372_10003468 | Ga0157372_100034686 | 366 |
| 285 | 3300025911 | Ga0207654_10104133 | Ga0207654_101041332 | 366 |
| 286 | 3300025913 | Ga0207695_10002199 | Ga0207695_1000219923 | 366 |
| 287 | 3300025914 | Ga0207671_10021933 | Ga0207671_100219332 | 366 |
| 288 | 3300025920 | Ga0207649_10007325 | Ga0207649_100073252 | 366 |
| 289 | 3300025924 | Ga0207694_10031103 | Ga0207694_100311034 | 366 |
| 290 | 3300025949 | Ga0207667_10010505 | Ga0207667_100105052 | 366 |
| 291 | 3300025981 | Ga0207640_10012552 | Ga0207640_100125523 | 366 |
| 292 | 3300026078 | Ga0207702_10026144 | Ga0207702_100261443 | 366 |
| 293 | 3300026142 | Ga0207698_10259261 | Ga0207698_102592611 | 366 |
| 294 | 3300049822 | Ga0501035_0203588 | Ga0501035_0203588_124_1287 | 366 |
| 295 | 3300003775 | Ga0055524_1001969 | Ga0055524_10019698 | 367 |
| 296 | 3300003775 | Ga0055524_1003647 | Ga0055524_10036472 | 367 |
| 297 | 3300003792 | Ga0055540_1010072 | Ga0055540_10100723 | 367 |
| 298 | 3300003794 | Ga0055531_10005579 | Ga0055531_100055792 | 367 |
| 299 | 3300005331 | Ga0070670_100142388 | Ga0070670_1001423882 | 367 |
| 300 | 3300005355 | Ga0070671_100091014 | Ga0070671_1000910142 | 367 |
| 301 | 3300005563 | Ga0068855_100054604 | Ga0068855_1000546043 | 367 |
| 302 | 3300005834 | Ga0068851_10032900 | Ga0068851_100329002 | 367 |
| 303 | 3300005983 | Ga0081540_1021127 | Ga0081540_10211272 | 367 |
| 304 | 3300006237 | Ga0097621_100089013 | Ga0097621_1000890133 | 367 |
| 305 | 3300006237 | Ga0097621_100114496 | Ga0097621_1001144962 | 367 |
| 306 | 3300006358 | Ga0068871_100140078 | Ga0068871_1001400781 | 367 |
| 307 | 3300006881 | Ga0068865_100033866 | Ga0068865_1000338662 | 367 |
| 308 | 3300006944 | Ga0099823_1000163 | Ga0099823_100016311 | 367 |
| 309 | 3300009148 | Ga0105243_10008438 | Ga0105243_100084389 | 367 |
| 310 | 3300012497 | Ga0157319_1000003 | Ga0157319_1000003326 | 367 |
| 311 | 3300013296 | Ga0157374_10148198 | Ga0157374_101481982 | 367 |
| 312 | 3300025299 | Ga0209256_1000675 | Ga0209256_10006756 | 367 |
| 313 | 3300025299 | Ga0209256_1004060 | Ga0209256_10040607 | 367 |
| 314 | 3300025303 | Ga0209051_1000981 | Ga0209051_100098126 | 367 |
| 315 | 3300025304 | Ga0209257_1002753 | Ga0209257_10027538 | 367 |
| 316 | 3300025304 | Ga0209257_1003470 | Ga0209257_10034709 | 367 |
| 317 | 3300025935 | Ga0207709_10008092 | Ga0207709_100080923 | 367 |
| 318 | 3300025938 | Ga0207704_10100432 | Ga0207704_101004321 | 367 |
| 319 | 3300025940 | Ga0207691_10049500 | Ga0207691_100495002 | 367 |
| 320 | 3300025942 | Ga0207689_10191357 | Ga0207689_101913572 | 367 |
| 321 | 3300025945 | Ga0207679_10163727 | Ga0207679_101637272 | 367 |
| 322 | 3300026023 | Ga0207677_10168668 | Ga0207677_101686682 | 367 |
| 323 | 3300026041 | Ga0207639_10191486 | Ga0207639_101914862 | 367 |
| 324 | 3300026116 | Ga0207674_10067033 | Ga0207674_100670332 | 367 |
| 325 | 3300031548 | Ga0307408_100106860 | Ga0307408_1001068602 | 367 |
| 326 | 3300042127 | Ga0450890_002413 | Ga0450890_002413_859_2028 | 367 |
| 327 | 3300042438 | Ga0439459_0000956 | Ga0439459_0000956_1799_2968 | 367 |
| 328 | 3300046452 | Ga0495617_001199 | Ga0495617_001199_6306_7472 | 367 |
| 329 | 3300046460 | Ga0495638_0001285 | Ga0495638_0001285_2178_3344 | 367 |
| 330 | 3300046501 | Ga0495607_0000029 | Ga0495607_0000029_24685_25851 | 367 |
| 331 | 3300046506 | Ga0495583_0016839 | Ga0495583_0016839_189_1355 | 367 |
| 332 | 3300046513 | Ga0495616_0003416 | Ga0495616_0003416_3008_4174 | 367 |
| 333 | 3300046520 | Ga0495637_0005239 | Ga0495637_0005239_5249_6415 | 367 |
| 334 | 3300046538 | Ga0495609_0002356 | Ga0495609_0002356_3525_4691 | 367 |
| 335 | 3300046648 | Ga0495611_0000003 | Ga0495611_0000003_63553_64719 | 367 |
| 336 | 3300046660 | Ga0495625_0000019 | Ga0495625_0000019_241931_243097 | 367 |
| 337 | 3300046692 | Ga0495671_0000549 | Ga0495671_0000549_11859_13025 | 367 |
| 338 | 3300046794 | Ga0495589_0000018 | Ga0495589_0000018_179017_180183 | 367 |
| 339 | 3300046810 | Ga0495660_0000122 | Ga0495660_0000122_53993_55159 | 367 |
| 340 | 3300047446 | Ga0495679_000017 | Ga0495679_000017_198494_199660 | 367 |
| 341 | 3300047469 | Ga0495673_0001611 | Ga0495673_0001611_10045_11211 | 367 |
| 342 | 3300049459 | Ga0495678_000210 | Ga0495678_000210_24658_25824 | 367 |
| 343 | 3300049460 | Ga0495682_0026578 | Ga0495682_0026578_588_1754 | 367 |
| 344 | 3300049568 | Ga0501031_0064295 | Ga0501031_0064295_490_1659 | 367 |
| 345 | 3300049576 | Ga0501040_0056164 | Ga0501040_0056164_902_2071 | 367 |
| 346 | 3300049579 | Ga0501043_0254424 | Ga0501043_0254424_70_1239 | 367 |
| 347 | 3300049580 | Ga0501046_0038270 | Ga0501046_0038270_1796_2965 | 367 |
| 348 | 3300049586 | Ga0501070_0034335 | Ga0501070_0034335_2642_3805 | 367 |
| 349 | 3300049590 | Ga0501074_0107767 | Ga0501074_0107767_403_1572 | 367 |
| 350 | 3300049743 | Ga0501081_0030435 | Ga0501081_0030435_803_1972 | 367 |
| 351 | 3300049822 | Ga0501035_0169767 | Ga0501035_0169767_462_1631 | 367 |
| 352 | 3300049823 | Ga0501044_0094745 | Ga0501044_0094745_1657_2826 | 367 |
| 353 | 3300053087 | Ga0500643_000029 | Ga0500643_000029_63476_64642 | 367 |
| 354 | 3300053103 | Ga0500555_000067 | Ga0500555_000067_13120_14286 | 367 |
| 355 | 3300060353 | Ga0501082_0115329 | Ga0501082_0115329_809_1978 | 367 |
| 356 | 3300005337 | Ga0070682_100155219 | Ga0070682_1001552191 | 368 |
| 357 | 3300005434 | Ga0070709_10001289 | Ga0070709_100012894 | 368 |
| 358 | 3300005439 | Ga0070711_100167624 | Ga0070711_1001676241 | 368 |
| 359 | 3300005518 | Ga0070699_100028126 | Ga0070699_1000281262 | 368 |
| 360 | 3300005545 | Ga0070695_100008161 | Ga0070695_1000081614 | 368 |
| 361 | 3300013104 | Ga0157370_10221136 | Ga0157370_102211362 | 368 |
| 362 | 3300025906 | Ga0207699_10001222 | Ga0207699_100012222 | 368 |
| 363 | 3300025916 | Ga0207663_10101765 | Ga0207663_101017652 | 368 |
| 364 | 3300037418 | Ga0395900_0000690 | Ga0395900_0000690_20935_22101 | 368 |
| 365 | 3300037466 | Ga0395898_0001044 | Ga0395898_0001044_16667_17833 | 368 |
| 366 | 3300048918 | Ga0496115_0159181 | Ga0496115_0159181_592_1785 | 368 |
| 367 | 3300053078 | Ga0495612_0046153 | Ga0495612_0046153_345_1508 | 368 |
| 368 | 3300003578 | Ga0006562J51391_1030224 | Ga0006562J51391_10302243 | 369 |
| 369 | 3300003578 | Ga0006562J51391_1030226 | Ga0006562J51391_10302262 | 369 |
| 370 | 3300005455 | Ga0070663_100020804 | Ga0070663_1000208043 | 369 |
| 371 | 3300005548 | Ga0070665_100046608 | Ga0070665_1000466082 | 369 |
| 372 | 3300005563 | Ga0068855_100084433 | Ga0068855_1000844332 | 369 |
| 373 | 3300005841 | Ga0068863_100040304 | Ga0068863_1000403043 | 369 |
| 374 | 3300025914 | Ga0207671_10074315 | Ga0207671_100743152 | 369 |
| 375 | 3300025949 | Ga0207667_10009556 | Ga0207667_1000955612 | 369 |
| 376 | 3300026041 | Ga0207639_10006186 | Ga0207639_100061862 | 369 |
| 377 | 3300026067 | Ga0207678_10074092 | Ga0207678_100740923 | 369 |
| 378 | 3300037471 | Ga0395905_0000071 | Ga0395905_0000071_48628_49797 | 369 |
| 379 | 3300005539 | Ga0068853_100012791 | Ga0068853_1000127917 | 370 |
| 380 | 3300006353 | Ga0075370_10024323 | Ga0075370_100243233 | 370 |
| 381 | 3300025912 | Ga0207707_10159737 | Ga0207707_101597371 | 370 |
| 382 | 3300046471 | Ga0495650_0000838 | Ga0495650_0000838_32470_33627 | 370 |
| 383 | 3300046507 | Ga0495606_0120429 | Ga0495606_0120429_71_1228 | 370 |
| 384 | 3300046512 | Ga0495610_0018926 | Ga0495610_0018926_2026_3183 | 370 |
| 385 | 3300046515 | Ga0495620_0009426 | Ga0495620_0009426_3128_4285 | 370 |
| 386 | 3300046518 | Ga0495631_0000098 | Ga0495631_0000098_2677_3834 | 370 |
| 387 | 3300046524 | Ga0495648_0029108 | Ga0495648_0029108_2038_3195 | 370 |
| 388 | 3300047469 | Ga0495673_0000347 | Ga0495673_0000347_42792_43949 | 370 |
| 389 | 3300053160 | Ga0500633_0000757 | Ga0500633_0000757_3346_4503 | 370 |
| 390 | 3300017792 | Ga0163161_10119818 | Ga0163161_101198182 | 371 |
| 391 | 3300037418 | Ga0395900_0000256 | Ga0395900_0000256_10723_11889 | 371 |
| 392 | 3300048903 | Ga0496100_0031843 | Ga0496100_0031843_1646_2812 | 371 |
| 393 | 3300048904 | Ga0496101_0001464 | Ga0496101_0001464_1494_2660 | 371 |
| 394 | 3300049742 | Ga0501080_0020342 | Ga0501080_0020342_3593_4762 | 371 |
| 395 | 3300005337 | Ga0070682_100003845 | Ga0070682_1000038452 | 372 |
| 396 | 3300005366 | Ga0070659_100014938 | Ga0070659_1000149384 | 372 |
| 397 | 3300005539 | Ga0068853_100003065 | Ga0068853_1000030657 | 372 |
| 398 | 3300005546 | Ga0070696_100220267 | Ga0070696_1002202671 | 372 |
| 399 | 3300005834 | Ga0068851_10109103 | Ga0068851_101091032 | 372 |
| 400 | 3300009545 | Ga0105237_10411328 | Ga0105237_104113282 | 372 |
| 401 | 3300009551 | Ga0105238_10008158 | Ga0105238_100081587 | 372 |
| 402 | 3300013100 | Ga0157373_10050414 | Ga0157373_100504142 | 372 |
| 403 | 3300013102 | Ga0157371_10042939 | Ga0157371_100429393 | 372 |
| 404 | 3300013307 | Ga0157372_10007233 | Ga0157372_100072337 | 372 |
| 405 | 3300025949 | Ga0207667_10006504 | Ga0207667_100065046 | 372 |
| 406 | 3300026041 | Ga0207639_10027516 | Ga0207639_100275163 | 372 |
| 407 | 3300044672 | Ga0466982_0000083 | Ga0466982_0000083_3432_4598 | 372 |
| 408 | 3300046501 | Ga0495607_0000061 | Ga0495607_0000061_17872_19038 | 372 |
| 409 | 3300046507 | Ga0495606_0019997 | Ga0495606_0019997_2105_3271 | 372 |
| 410 | 3300048924 | Ga0496121_0000708 | Ga0496121_0000708_10981_12147 | 372 |
| 411 | 3300048929 | Ga0496126_0159567 | Ga0496126_0159567_111_1277 | 372 |
| 412 | 3300005335 | Ga0070666_10001529 | Ga0070666_1000152916 | 373 |
| 413 | 3300005336 | Ga0070680_100147204 | Ga0070680_1001472042 | 373 |
| 414 | 3300005344 | Ga0070661_100006668 | Ga0070661_1000066685 | 373 |
| 415 | 3300005347 | Ga0070668_100191115 | Ga0070668_1001911151 | 373 |
| 416 | 3300005435 | Ga0070714_100000780 | Ga0070714_1000007808 | 373 |
| 417 | 3300005530 | Ga0070679_100191741 | Ga0070679_1001917412 | 373 |
| 418 | 3300005548 | Ga0070665_100344440 | Ga0070665_1003444402 | 373 |
| 419 | 3300005842 | Ga0068858_100119235 | Ga0068858_1001192353 | 373 |
| 420 | 3300005842 | Ga0068858_100205979 | Ga0068858_1002059792 | 373 |
| 421 | 3300006175 | Ga0070712_100045432 | Ga0070712_1000454323 | 373 |
| 422 | 3300009093 | Ga0105240_10185660 | Ga0105240_101856601 | 373 |
| 423 | 3300009101 | Ga0105247_10006880 | Ga0105247_100068805 | 373 |
| 424 | 3300009174 | Ga0105241_10022178 | Ga0105241_100221783 | 373 |
| 425 | 3300009545 | Ga0105237_10009281 | Ga0105237_100092813 | 373 |
| 426 | 3300009551 | Ga0105238_10002060 | Ga0105238_100020603 | 373 |
| 427 | 3300009553 | Ga0105249_10234227 | Ga0105249_102342272 | 373 |
| 428 | 3300010375 | Ga0105239_10017601 | Ga0105239_100176012 | 373 |
| 429 | 3300013102 | Ga0157371_10196539 | Ga0157371_101965392 | 373 |
| 430 | 3300013104 | Ga0157370_10011339 | Ga0157370_100113399 | 373 |
| 431 | 3300013105 | Ga0157369_10000318 | Ga0157369_1000031825 | 373 |
| 432 | 3300013306 | Ga0163162_10563793 | Ga0163162_105637931 | 373 |
| 433 | 3300014968 | Ga0157379_10038541 | Ga0157379_100385413 | 373 |
| 434 | 3300015261 | Ga0182006_1000556 | Ga0182006_10005566 | 373 |
| 435 | 3300015261 | Ga0182006_1000731 | Ga0182006_100073124 | 373 |
| 436 | 3300015262 | Ga0182007_10008118 | Ga0182007_100081182 | 373 |
| 437 | 3300015262 | Ga0182007_10026907 | Ga0182007_100269072 | 373 |
| 438 | 3300015265 | Ga0182005_1002812 | Ga0182005_10028125 | 373 |
| 439 | 3300025903 | Ga0207680_10000002 | Ga0207680_10000002148 | 373 |
| 440 | 3300025906 | Ga0207699_10134903 | Ga0207699_101349032 | 373 |
| 441 | 3300025913 | Ga0207695_10003102 | Ga0207695_100031026 | 373 |
| 442 | 3300025914 | Ga0207671_10053665 | Ga0207671_100536652 | 373 |
| 443 | 3300025920 | Ga0207649_10009430 | Ga0207649_100094305 | 373 |
| 444 | 3300025924 | Ga0207694_10000253 | Ga0207694_100002532 | 373 |
| 445 | 3300025924 | Ga0207694_10002841 | Ga0207694_1000284113 | 373 |
| 446 | 3300025929 | Ga0207664_10000358 | Ga0207664_1000035810 | 373 |
| 447 | 3300025961 | Ga0207712_10013249 | Ga0207712_100132495 | 373 |
| 448 | 3300025972 | Ga0207668_10069939 | Ga0207668_100699392 | 373 |
| 449 | 3300026035 | Ga0207703_10080414 | Ga0207703_100804143 | 373 |
| 450 | 3300026035 | Ga0207703_10198375 | Ga0207703_101983752 | 373 |
| 451 | 3300028379 | Ga0268266_10000004 | Ga0268266_10000004155 | 373 |
| 452 | 3300031911 | Ga0307412_10006311 | Ga0307412_100063116 | 373 |
| 453 | 3300033180 | Ga0307510_10003563 | Ga0307510_1000356315 | 373 |
| 454 | 3300037418 | Ga0395900_0015207 | Ga0395900_0015207_3545_4708 | 373 |
| 455 | 3300037418 | Ga0395900_0136531 | Ga0395900_0136531_1320_2486 | 373 |
| 456 | 3300041404 | Ga0439436_0000007 | Ga0439436_0000007_66210_67376 | 373 |
| 457 | 3300046471 | Ga0495650_0000074 | Ga0495650_0000074_156706_157872 | 373 |
| 458 | 3300046512 | Ga0495610_0000944 | Ga0495610_0000944_14973_16139 | 373 |
| 459 | 3300046519 | Ga0495632_0016317 | Ga0495632_0016317_19_1185 | 373 |
| 460 | 3300046616 | Ga0495668_0009921 | Ga0495668_0009921_4141_5307 | 373 |
| 461 | 3300046660 | Ga0495625_0126058 | Ga0495625_0126058_415_1581 | 373 |
| 462 | 3300046694 | Ga0495649_0001665 | Ga0495649_0001665_6200_7366 | 373 |
| 463 | 3300046810 | Ga0495660_0000585 | Ga0495660_0000585_4195_5361 | 373 |
| 464 | 3300047443 | Ga0495687_011305 | Ga0495687_011305_1531_2697 | 373 |
| 465 | 3300047469 | Ga0495673_0000004 | Ga0495673_0000004_898591_899757 | 373 |
| 466 | 3300048924 | Ga0496121_0093178 | Ga0496121_0093178_1128_2294 | 373 |
| 467 | 3300053134 | Ga0500658_0003351 | Ga0500658_0003351_342_1508 | 373 |
| 468 | 3300002075 | JGI24738J21930_10000426 | JGI24738J21930_100004264 | 374 |
| 469 | 3300025258 | Ga0209129_1000697 | Ga0209129_10006977 | 374 |
| 470 | 3300025297 | Ga0209758_1005359 | Ga0209758_10053595 | 374 |
| 471 | 3300025299 | Ga0209256_1010216 | Ga0209256_10102162 | 374 |
| 472 | 3300041413 | Ga0439465_0001319 | Ga0439465_0001319_947_2113 | 374 |
| 473 | 3300046501 | Ga0495607_0084794 | Ga0495607_0084794_124_1281 | 374 |
| 474 | 3300046691 | Ga0495670_0000482 | Ga0495670_0000482_14020_15186 | 374 |
| 475 | 3300049823 | Ga0501044_0194674 | Ga0501044_0194674_286_1455 | 374 |
| 476 | 3300053139 | Ga0500568_0003657 | Ga0500568_0003657_1539_2708 | 374 |
| 477 | 3300060353 | Ga0501082_0000234 | Ga0501082_0000234_2888_4057 | 374 |
| 478 | 3300003781 | Ga0055536_1000126 | Ga0055536_100012634 | 375 |
| 479 | 3300003791 | Ga0055530_10000132 | Ga0055530_1000013234 | 375 |
| 480 | 3300003794 | Ga0055531_10000296 | Ga0055531_1000029620 | 375 |
| 481 | 3300009093 | Ga0105240_10008373 | Ga0105240_100083736 | 375 |
| 482 | 3300009174 | Ga0105241_10179605 | Ga0105241_101796052 | 375 |
| 483 | 3300025254 | Ga0209148_1001448 | Ga0209148_100144812 | 375 |
| 484 | 3300025292 | Ga0209676_1000011 | Ga0209676_1000011348 | 375 |
| 485 | 3300025298 | Ga0209050_1000032 | Ga0209050_1000032227 | 375 |
| 486 | 3300025303 | Ga0209051_1000382 | Ga0209051_10003827 | 375 |
| 487 | 3300025304 | Ga0209257_1000014 | Ga0209257_1000014407 | 375 |
| 488 | 3300027378 | Ga0209981_1003695 | Ga0209981_10036952 | 375 |
| 489 | 3300027543 | Ga0209999_1000340 | Ga0209999_10003401 | 375 |
| 490 | 3300027665 | Ga0209983_1003433 | Ga0209983_10034333 | 375 |
| 491 | 3300027682 | Ga0209971_1001679 | Ga0209971_10016793 | 375 |
| 492 | 3300027876 | Ga0209974_10020661 | Ga0209974_100206613 | 375 |
| 493 | 3300035086 | Ga0373934_0008452 | Ga0373934_0008452_696_1862 | 375 |
| 494 | 3300037471 | Ga0395905_0000126 | Ga0395905_0000126_96855_98021 | 375 |
| 495 | 3300048927 | Ga0496124_0016949 | Ga0496124_0016949_3986_5143 | 375 |
| 496 | 3300003759 | Ga0055525_1000038 | Ga0055525_100003834 | 376 |
| 497 | 3300005344 | Ga0070661_100024987 | Ga0070661_1000249872 | 376 |
| 498 | 3300021361 | Ga0213872_10009785 | Ga0213872_100097852 | 376 |
| 499 | 3300025230 | Ga0209563_100005 | Ga0209563_1000051238 | 376 |
| 500 | 3300025920 | Ga0207649_10010983 | Ga0207649_100109834 | 376 |
| 501 | 3300026089 | Ga0207648_10027795 | Ga0207648_100277952 | 376 |
| 502 | 3300037418 | Ga0395900_0095385 | Ga0395900_0095385_1429_2595 | 376 |
| 503 | 3300037471 | Ga0395905_0029445 | Ga0395905_0029445_2967_4133 | 376 |
| 504 | 3300038443 | Ga0395901_0033337 | Ga0395901_0033337_3026_4192 | 376 |
| 505 | 3300046460 | Ga0495638_0000071 | Ga0495638_0000071_144050_145216 | 376 |
| 506 | 3300046491 | Ga0495584_0021179 | Ga0495584_0021179_147_1313 | 376 |
| 507 | 3300046492 | Ga0495585_0006782 | Ga0495585_0006782_5416_6582 | 376 |
| 508 | 3300046507 | Ga0495606_0000546 | Ga0495606_0000546_32438_33604 | 376 |
| 509 | 3300046513 | Ga0495616_0000128 | Ga0495616_0000128_26857_28023 | 376 |
| 510 | 3300046691 | Ga0495670_0001847 | Ga0495670_0001847_8560_9726 | 376 |
| 511 | 3300047323 | Ga0495683_0042707 | Ga0495683_0042707_871_2037 | 376 |
| 512 | 3300047472 | Ga0495686_0018839 | Ga0495686_0018839_1599_2765 | 376 |
| 513 | 3300047472 | Ga0495686_0025591 | Ga0495686_0025591_2499_3665 | 376 |
| 514 | 3300048909 | Ga0496106_0001770 | Ga0496106_0001770_11809_12975 | 376 |
| 515 | 3300048924 | Ga0496121_0001959 | Ga0496121_0001959_4819_5985 | 376 |
| 516 | 3300048924 | Ga0496121_0034748 | Ga0496121_0034748_471_1637 | 376 |
| 517 | 3300048927 | Ga0496124_0019749 | Ga0496124_0019749_1685_2851 | 376 |
| 518 | 3300005262 | Ga0065165_1003978 | Ga0065165_10039786 | 377 |
| 519 | 3300005466 | Ga0070685_10000386 | Ga0070685_1000038613 | 377 |
| 520 | 3300009093 | Ga0105240_10000453 | Ga0105240_1000045322 | 377 |
| 521 | 3300009545 | Ga0105237_10012473 | Ga0105237_100124733 | 377 |
| 522 | 3300010375 | Ga0105239_10176769 | Ga0105239_101767692 | 377 |
| 523 | 3300013306 | Ga0163162_10051376 | Ga0163162_100513762 | 377 |
| 524 | 3300025226 | Ga0209674_100556 | Ga0209674_10055612 | 377 |
| 525 | 3300025233 | Ga0209437_102792 | Ga0209437_1027923 | 377 |
| 526 | 3300032004 | Ga0307414_10017415 | Ga0307414_100174154 | 377 |
| 527 | 3300046452 | Ga0495617_000149 | Ga0495617_000149_24728_25894 | 377 |
| 528 | 3300046515 | Ga0495620_0000274 | Ga0495620_0000274_6275_7441 | 377 |
| 529 | 3300049568 | Ga0501031_0200034 | Ga0501031_0200034_41_1207 | 377 |
| 530 | 3300049569 | Ga0501032_0094424 | Ga0501032_0094424_292_1458 | 377 |
| 531 | 3300049570 | Ga0501033_0025850 | Ga0501033_0025850_1465_2631 | 377 |
| 532 | 3300049579 | Ga0501043_0004817 | Ga0501043_0004817_7481_8647 | 377 |
| 533 | 3300049586 | Ga0501070_0151240 | Ga0501070_0151240_251_1417 | 377 |
| 534 | 3300049822 | Ga0501035_0073532 | Ga0501035_0073532_1246_2412 | 377 |
| 535 | 3300049823 | Ga0501044_0079869 | Ga0501044_0079869_177_1343 | 377 |
| 536 | 3300005331 | Ga0070670_100017151 | Ga0070670_1000171515 | 378 |
| 537 | 3300009177 | Ga0105248_10006636 | Ga0105248_1000663616 | 378 |
| 538 | 3300010375 | Ga0105239_10020796 | Ga0105239_100207962 | 378 |
| 539 | 3300013104 | Ga0157370_10000045 | Ga0157370_1000004579 | 378 |
| 540 | 3300015265 | Ga0182005_1000113 | Ga0182005_100011329 | 378 |
| 541 | 3300025297 | Ga0209758_1023075 | Ga0209758_10230753 | 378 |
| 542 | 3300025911 | Ga0207654_10000251 | Ga0207654_1000025118 | 378 |
| 543 | 3300025913 | Ga0207695_10000172 | Ga0207695_10000172145 | 378 |
| 544 | 3300025924 | Ga0207694_10008890 | Ga0207694_100088906 | 378 |
| 545 | 3300025941 | Ga0207711_10031060 | Ga0207711_100310603 | 378 |
| 546 | 3300028563 | Ga0265319_1010847 | Ga0265319_10108472 | 378 |
| 547 | 3300028573 | Ga0265334_10000127 | Ga0265334_1000012718 | 378 |
| 548 | 3300028577 | Ga0265318_10000024 | Ga0265318_1000002448 | 378 |
| 549 | 3300028800 | Ga0265338_10015683 | Ga0265338_100156833 | 378 |
| 550 | 3300031235 | Ga0265330_10004503 | Ga0265330_100045037 | 378 |
| 551 | 3300031238 | Ga0265332_10009553 | Ga0265332_100095532 | 378 |
| 552 | 3300031239 | Ga0265328_10004240 | Ga0265328_100042407 | 378 |
| 553 | 3300031240 | Ga0265320_10030607 | Ga0265320_100306073 | 378 |
| 554 | 3300031241 | Ga0265325_10021155 | Ga0265325_100211553 | 378 |
| 555 | 3300031242 | Ga0265329_10001926 | Ga0265329_100019268 | 378 |
| 556 | 3300031250 | Ga0265331_10015495 | Ga0265331_100154954 | 378 |
| 557 | 3300031344 | Ga0265316_10004022 | Ga0265316_100040226 | 378 |
| 558 | 3300031595 | Ga0265313_10001194 | Ga0265313_1000119414 | 378 |
| 559 | 3300031711 | Ga0265314_10001695 | Ga0265314_1000169527 | 378 |
| 560 | 3300031712 | Ga0265342_10010591 | Ga0265342_100105912 | 378 |
| 561 | 3300039438 | Ga0436360_0478772 | Ga0436360_0478772_427_1590 | 378 |
| 562 | 3300042184 | Ga0450908_000033 | Ga0450908_000033_3468_4634 | 378 |
| 563 | 3300046473 | Ga0495582_0055081 | Ga0495582_0055081_186_1349 | 378 |
| 564 | 3300046492 | Ga0495585_0000063 | Ga0495585_0000063_104908_106074 | 378 |
| 565 | 3300046501 | Ga0495607_0004279 | Ga0495607_0004279_6230_7396 | 378 |
| 566 | 3300046518 | Ga0495631_0000749 | Ga0495631_0000749_3438_4604 | 378 |
| 567 | 3300046524 | Ga0495648_0000643 | Ga0495648_0000643_3556_4722 | 378 |
| 568 | 3300046665 | Ga0495661_0000703 | Ga0495661_0000703_3513_4679 | 378 |
| 569 | 3300048907 | Ga0496104_0033408 | Ga0496104_0033408_1379_2545 | 378 |
| 570 | 3300048908 | Ga0496105_0169066 | Ga0496105_0169066_10_1176 | 378 |
| 571 | 3300048911 | Ga0496108_0067336 | Ga0496108_0067336_705_1871 | 378 |
| 572 | 3300048912 | Ga0496109_0117634 | Ga0496109_0117634_336_1502 | 378 |
| 573 | 3300048915 | Ga0496112_0127012 | Ga0496112_0127012_245_1411 | 378 |
| 574 | 3300048916 | Ga0496113_0165710 | Ga0496113_0165710_492_1658 | 378 |
| 575 | 3300048920 | Ga0496117_0057035 | Ga0496117_0057035_1510_2670 | 378 |
| 576 | 3300048921 | Ga0496118_0006022 | Ga0496118_0006022_5997_7157 | 378 |
| 577 | 3300048925 | Ga0496122_0009488 | Ga0496122_0009488_2729_3895 | 378 |
| 578 | 3300048926 | Ga0496123_0011106 | Ga0496123_0011106_298_1464 | 378 |
| 579 | 3300049570 | Ga0501033_0097146 | Ga0501033_0097146_934_2091 | 378 |
| 580 | 3300053730 | Ga0500645_004295 | Ga0500645_004295_3455_4621 | 378 |
| 581 | 3300002737 | JGI25162J39368_1004448 | JGI25162J39368_10044482 | 379 |
| 582 | 3300002772 | JGI25164J39214_1002185 | JGI25164J39214_10021852 | 379 |
| 583 | 3300003214 | JGI25165J46597_1001869 | JGI25165J46597_10018698 | 379 |
| 584 | 3300025231 | Ga0207427_100285 | Ga0207427_1002858 | 379 |
| 585 | 3300025233 | Ga0209437_100303 | Ga0209437_10030360 | 379 |
| 586 | 3300025261 | Ga0209233_1000273 | Ga0209233_100027341 | 379 |
| 587 | 3300025961 | Ga0207712_10179214 | Ga0207712_101792142 | 379 |
| 588 | 3300031616 | Ga0307508_10263730 | Ga0307508_102637302 | 379 |
| 589 | 3300037312 | Ga0395899_0112654 | Ga0395899_0112654_146_1312 | 379 |
| 590 | 3300037466 | Ga0395898_0021645 | Ga0395898_0021645_2362_3528 | 379 |
| 591 | 3300038443 | Ga0395901_0056054 | Ga0395901_0056054_1706_2872 | 379 |
| 592 | 3300048905 | Ga0496102_0097922 | Ga0496102_0097922_260_1420 | 379 |
| 593 | 3300048921 | Ga0496118_0064638 | Ga0496118_0064638_76_1236 | 379 |
| 594 | 3300049570 | Ga0501033_0001111 | Ga0501033_0001111_5268_6431 | 380 |
| 595 | 3300049586 | Ga0501070_0061295 | Ga0501070_0061295_737_1900 | 380 |
| 596 | iso_pu_bacteria | 2537561836 | 2538833564 | 380 |
| 597 | iso_pu_bacteria | 2643221562 | 2643829212 | 380 |
| 598 | iso_pu_bacteria | 2842780639 | 2842782576 | 380 |
| 599 | iso_pu_bacteria | 2895395659 | 2895396162 | 380 |
| 600 | iso_pu_bacteria | 2939611941 | 2939613048 | 380 |
| 601 | 3300005617 | Ga0068859_100145275 | Ga0068859_1001452752 | 381 |
| 602 | 3300006931 | Ga0097620_100145276 | Ga0097620_1001452762 | 381 |
| 603 | 3300048929 | Ga0496126_0007774 | Ga0496126_0007774_6460_7626 | 381 |
| 604 | iso_pu_bacteria | 2643221695 | 2644528206 | 381 |
| 605 | 3300039437 | Ga0436365_0770231 | Ga0436365_0770231_665_1819 | 382 |
| 606 | iso_pu_bacteria | 2643221544 | 2643743895 | 382 |
| 607 | iso_pu_bacteria | 2643221577 | 2643896397 | 382 |
| 608 | iso_pu_bacteria | 2643221585 | 2643933063 | 382 |
| 609 | iso_pu_bacteria | 2643221593 | 2643973362 | 382 |
| 610 | iso_pu_bacteria | 2643221639 | 2644217205 | 382 |
| 611 | iso_pu_bacteria | 2643221646 | 2644259025 | 382 |
| 612 | iso_pu_bacteria | 2643221656 | 2644314312 | 382 |
| 613 | iso_pu_bacteria | 2643221685 | 2644478842 | 382 |
| 614 | iso_pu_bacteria | 2687453130 | 2687584480 | 382 |
| 615 | iso_pu_bacteria | 2738541337 | 2739055763 | 382 |
| 616 | iso_pu_bacteria | 2739367700 | 2739732603 | 382 |
| 617 | iso_pu_bacteria | 2831864461 | 2831866099 | 382 |
| 618 | iso_pu_bacteria | 2884411467 | 2884414890 | 382 |
| 619 | iso_pu_bacteria | 2894414249 | 2894414268 | 382 |
| 620 | iso_pu_bacteria | 2895498888 | 2895501792 | 382 |
| 621 | iso_pu_bacteria | 2895511927 | 2895517658 | 382 |
| 622 | iso_pu_bacteria | 2895522137 | 2895525222 | 382 |
| 623 | iso_pu_bacteria | 2895525241 | 2895526166 | 382 |
| 624 | iso_pu_bacteria | 2928963466 | 2928965321 | 382 |
| 625 | iso_pu_bacteria | 2995948881 | 2995949641 | 382 |
| 626 | iso_pu_bacteria | 8002869464 | 8002870956 | 382 |
| 627 | 3300005841 | Ga0068863_100004765 | Ga0068863_1000047653 | 383 |
| 628 | 3300005842 | Ga0068858_100249985 | Ga0068858_1002499852 | 383 |
| 629 | 3300026088 | Ga0207641_10001904 | Ga0207641_1000190412 | 383 |
| 630 | 3300003214 | JGI25165J46597_1008766 | JGI25165J46597_10087661 | 384 |
| 631 | 3300005331 | Ga0070670_100035638 | Ga0070670_1000356383 | 384 |
| 632 | 3300005338 | Ga0068868_100086379 | Ga0068868_1000863793 | 384 |
| 633 | 3300005435 | Ga0070714_100000119 | Ga0070714_10000011921 | 384 |
| 634 | 3300005455 | Ga0070663_100005144 | Ga0070663_1000051443 | 384 |
| 635 | 3300005457 | Ga0070662_100009973 | Ga0070662_1000099732 | 384 |
| 636 | 3300005459 | Ga0068867_100067147 | Ga0068867_1000671472 | 384 |
| 637 | 3300005548 | Ga0070665_100000242 | Ga0070665_10000024246 | 384 |
| 638 | 3300005563 | Ga0068855_100087391 | Ga0068855_1000873912 | 384 |
| 639 | 3300005563 | Ga0068855_100169237 | Ga0068855_1001692372 | 384 |
| 640 | 3300005577 | Ga0068857_100114194 | Ga0068857_1001141942 | 384 |
| 641 | 3300005578 | Ga0068854_100081684 | Ga0068854_1000816842 | 384 |
| 642 | 3300005616 | Ga0068852_100029651 | Ga0068852_1000296513 | 384 |
| 643 | 3300005834 | Ga0068851_10009023 | Ga0068851_100090234 | 384 |
| 644 | 3300005842 | Ga0068858_100012181 | Ga0068858_1000121816 | 384 |
| 645 | 3300009174 | Ga0105241_10059418 | Ga0105241_100594183 | 384 |
| 646 | 3300009545 | Ga0105237_10096591 | Ga0105237_100965912 | 384 |
| 647 | 3300009545 | Ga0105237_10297984 | Ga0105237_102979842 | 384 |
| 648 | 3300009551 | Ga0105238_10087813 | Ga0105238_100878134 | 384 |
| 649 | 3300009553 | Ga0105249_10052034 | Ga0105249_100520343 | 384 |
| 650 | 3300010375 | Ga0105239_10012342 | Ga0105239_100123421 | 384 |
| 651 | 3300013100 | Ga0157373_10005386 | Ga0157373_100053865 | 384 |
| 652 | 3300013100 | Ga0157373_10211176 | Ga0157373_102111762 | 384 |
| 653 | 3300013102 | Ga0157371_10027073 | Ga0157371_100270734 | 384 |
| 654 | 3300013105 | Ga0157369_10105608 | Ga0157369_101056082 | 384 |
| 655 | 3300013296 | Ga0157374_10329169 | Ga0157374_103291692 | 384 |
| 656 | 3300013307 | Ga0157372_10122834 | Ga0157372_101228342 | 384 |
| 657 | 3300013307 | Ga0157372_10280541 | Ga0157372_102805412 | 384 |
| 658 | 3300013308 | Ga0157375_10014123 | Ga0157375_100141233 | 384 |
| 659 | 3300025261 | Ga0209233_1005102 | Ga0209233_10051025 | 384 |
| 660 | 3300025321 | Ga0207656_10003708 | Ga0207656_100037084 | 384 |
| 661 | 3300025904 | Ga0207647_10000066 | Ga0207647_1000006648 | 384 |
| 662 | 3300025909 | Ga0207705_10056409 | Ga0207705_100564092 | 384 |
| 663 | 3300025913 | Ga0207695_10012023 | Ga0207695_1001202311 | 384 |
| 664 | 3300025914 | Ga0207671_10224729 | Ga0207671_102247291 | 384 |
| 665 | 3300025919 | Ga0207657_10073706 | Ga0207657_100737061 | 384 |
| 666 | 3300025924 | Ga0207694_10000308 | Ga0207694_1000030821 | 384 |
| 667 | 3300025924 | Ga0207694_10188381 | Ga0207694_101883812 | 384 |
| 668 | 3300025925 | Ga0207650_10048590 | Ga0207650_100485903 | 384 |
| 669 | 3300025929 | Ga0207664_10000090 | Ga0207664_1000009042 | 384 |
| 670 | 3300025932 | Ga0207690_10002773 | Ga0207690_100027738 | 384 |
| 671 | 3300025932 | Ga0207690_10005359 | Ga0207690_100053593 | 384 |
| 672 | 3300025933 | Ga0207706_10012788 | Ga0207706_100127886 | 384 |
| 673 | 3300025933 | Ga0207706_10037330 | Ga0207706_100373302 | 384 |
| 674 | 3300025934 | Ga0207686_10057224 | Ga0207686_100572243 | 384 |
| 675 | 3300025949 | Ga0207667_10014602 | Ga0207667_100146028 | 384 |
| 676 | 3300025949 | Ga0207667_10137843 | Ga0207667_101378433 | 384 |
| 677 | 3300025961 | Ga0207712_10000589 | Ga0207712_1000058922 | 384 |
| 678 | 3300025981 | Ga0207640_10005333 | Ga0207640_100053336 | 384 |
| 679 | 3300026023 | Ga0207677_10218693 | Ga0207677_102186932 | 384 |
| 680 | 3300026035 | Ga0207703_10057766 | Ga0207703_100577663 | 384 |
| 681 | 3300026041 | Ga0207639_10001885 | Ga0207639_100018853 | 384 |
| 682 | 3300026067 | Ga0207678_10000577 | Ga0207678_100005778 | 384 |
| 683 | 3300026078 | Ga0207702_10018943 | Ga0207702_100189433 | 384 |
| 684 | 3300026078 | Ga0207702_10071028 | Ga0207702_100710282 | 384 |
| 685 | 3300026089 | Ga0207648_10047957 | Ga0207648_100479573 | 384 |
| 686 | 3300026116 | Ga0207674_10063368 | Ga0207674_100633682 | 384 |
| 687 | 3300026116 | Ga0207674_10068046 | Ga0207674_100680462 | 384 |
| 688 | 3300028379 | Ga0268266_10000008 | Ga0268266_10000008960 | 384 |
| 689 | 3300042006 | Ga0439432_008708 | Ga0439432_008708_1726_2886 | 384 |
| 690 | 3300042007 | Ga0439449_0026676 | Ga0439449_0026676_293_1450 | 384 |
| 691 | 3300048918 | Ga0496115_0000043 | Ga0496115_0000043_45989_47149 | 384 |
| 692 | 3300048927 | Ga0496124_0000006 | Ga0496124_0000006_374471_375631 | 384 |
| 693 | 3300048929 | Ga0496126_0000087 | Ga0496126_0000087_69561_70721 | 384 |
| 694 | iso_pu_bacteria | 2593339238 | 2595447738 | 384 |
| 695 | iso_pu_bacteria | 2593339239 | 2595450297 | 384 |
| 696 | iso_pu_bacteria | 2718218334 | 2721025808 | 384 |
| 697 | iso_pu_bacteria | 2734482264 | 2735834225 | 384 |
| 698 | iso_pu_bacteria | 2738543009 | 2739225639 | 384 |
| 699 | iso_pu_bacteria | 2818991440 | 2819566289 | 384 |
| 700 | iso_pu_bacteria | 2842914999 | 2842917093 | 384 |
| 701 | iso_pu_bacteria | 2842918807 | 2842920650 | 384 |
| 702 | iso_pu_bacteria | 2884338543 | 2884339144 | 384 |
| 703 | iso_pu_bacteria | 2904463128 | 2904466565 | 384 |
| 704 | iso_pu_bacteria | 2919085039 | 2919086180 | 384 |
| 705 | iso_pu_bacteria | 2919404418 | 2919406843 | 384 |
| 706 | iso_pu_bacteria | 2941471342 | 2941471933 | 384 |
| 707 | iso_pu_bacteria | 2953994433 | 2953995929 | 384 |
| 708 | 3300002705 | JGI25156J39149_1001496 | JGI25156J39149_10014962 | 385 |
| 709 | 3300002737 | JGI25162J39368_1001953 | JGI25162J39368_10019532 | 385 |
| 710 | 3300002741 | JGI25157J39369_1001381 | JGI25157J39369_10013819 | 385 |
| 711 | 3300002772 | JGI25164J39214_1000024 | JGI25164J39214_1000024150 | 385 |
| 712 | 3300003214 | JGI25165J46597_1000162 | JGI25165J46597_100016290 | 385 |
| 713 | 3300003756 | Ga0055533_1003406 | Ga0055533_10034063 | 385 |
| 714 | 3300003759 | Ga0055525_1000055 | Ga0055525_100005590 | 385 |
| 715 | 3300003760 | Ga0055527_1000137 | Ga0055527_100013726 | 385 |
| 716 | 3300003760 | Ga0055527_1000145 | Ga0055527_100014515 | 385 |
| 717 | 3300003760 | Ga0055527_1000889 | Ga0055527_10008895 | 385 |
| 718 | 3300003761 | Ga0055535_1000112 | Ga0055535_100011226 | 385 |
| 719 | 3300003761 | Ga0055535_1000301 | Ga0055535_100030115 | 385 |
| 720 | 3300003761 | Ga0055535_1000471 | Ga0055535_10004717 | 385 |
| 721 | 3300003761 | Ga0055535_1000475 | Ga0055535_100047510 | 385 |
| 722 | 3300003762 | Ga0055542_1000154 | Ga0055542_100015426 | 385 |
| 723 | 3300003762 | Ga0055542_1000157 | Ga0055542_100015729 | 385 |
| 724 | 3300003762 | Ga0055542_1000332 | Ga0055542_100033215 | 385 |
| 725 | 3300003762 | Ga0055542_1000440 | Ga0055542_100044015 | 385 |
| 726 | 3300003763 | Ga0055529_1000120 | Ga0055529_1000120101 | 385 |
| 727 | 3300003763 | Ga0055529_1000244 | Ga0055529_100024448 | 385 |
| 728 | 3300003763 | Ga0055529_1000389 | Ga0055529_100038920 | 385 |
| 729 | 3300003794 | Ga0055531_10003901 | Ga0055531_100039013 | 385 |
| 730 | 3300005293 | Ga0065715_10032017 | Ga0065715_100320172 | 385 |
| 731 | 3300005347 | Ga0070668_100029459 | Ga0070668_1000294593 | 385 |
| 732 | 3300005367 | Ga0070667_100003453 | Ga0070667_1000034535 | 385 |
| 733 | 3300005367 | Ga0070667_100050353 | Ga0070667_1000503533 | 385 |
| 734 | 3300005455 | Ga0070663_100057779 | Ga0070663_1000577791 | 385 |
| 735 | 3300005539 | Ga0068853_100014349 | Ga0068853_1000143492 | 385 |
| 736 | 3300005548 | Ga0070665_100000636 | Ga0070665_10000063640 | 385 |
| 737 | 3300005578 | Ga0068854_100001314 | Ga0068854_10000131410 | 385 |
| 738 | 3300005614 | Ga0068856_100004925 | Ga0068856_10000492513 | 385 |
| 739 | 3300005617 | Ga0068859_100000453 | Ga0068859_10000045341 | 385 |
| 740 | 3300005618 | Ga0068864_100083722 | Ga0068864_1000837222 | 385 |
| 741 | 3300005841 | Ga0068863_100095066 | Ga0068863_1000950663 | 385 |
| 742 | 3300005844 | Ga0068862_100000674 | Ga0068862_1000006742 | 385 |
| 743 | 3300006931 | Ga0097620_100000453 | Ga0097620_10000045341 | 385 |
| 744 | 3300009093 | Ga0105240_10000868 | Ga0105240_1000086819 | 385 |
| 745 | 3300009093 | Ga0105240_10001058 | Ga0105240_1000105820 | 385 |
| 746 | 3300009101 | Ga0105247_10087478 | Ga0105247_100874782 | 385 |
| 747 | 3300009177 | Ga0105248_10422093 | Ga0105248_104220932 | 385 |
| 748 | 3300009545 | Ga0105237_10081936 | Ga0105237_100819363 | 385 |
| 749 | 3300010375 | Ga0105239_10000027 | Ga0105239_10000027132 | 385 |
| 750 | 3300010375 | Ga0105239_10029600 | Ga0105239_100296006 | 385 |
| 751 | 3300012512 | Ga0157327_1000119 | Ga0157327_10001192 | 385 |
| 752 | 3300013104 | Ga0157370_10014570 | Ga0157370_100145705 | 385 |
| 753 | 3300013308 | Ga0157375_10293910 | Ga0157375_102939102 | 385 |
| 754 | 3300013308 | Ga0157375_10462636 | Ga0157375_104626362 | 385 |
| 755 | 3300014326 | Ga0157380_10199059 | Ga0157380_101990592 | 385 |
| 756 | 3300025226 | Ga0209674_100077 | Ga0209674_100077195 | 385 |
| 757 | 3300025228 | Ga0209672_100004 | Ga0209672_1000041076 | 385 |
| 758 | 3300025228 | Ga0209672_100022 | Ga0209672_100022183 | 385 |
| 759 | 3300025228 | Ga0209672_100118 | Ga0209672_10011856 | 385 |
| 760 | 3300025228 | Ga0209672_105512 | Ga0209672_1055122 | 385 |
| 761 | 3300025230 | Ga0209563_100076 | Ga0209563_10007690 | 385 |
| 762 | 3300025231 | Ga0207427_100058 | Ga0207427_10005843 | 385 |
| 763 | 3300025233 | Ga0209437_100142 | Ga0209437_100142148 | 385 |
| 764 | 3300025242 | Ga0209258_100003 | Ga0209258_1000031076 | 385 |
| 765 | 3300025242 | Ga0209258_100004 | Ga0209258_100004197 | 385 |
| 766 | 3300025242 | Ga0209258_100122 | Ga0209258_10012282 | 385 |
| 767 | 3300025242 | Ga0209258_100158 | Ga0209258_10015829 | 385 |
| 768 | 3300025246 | Ga0209646_1002061 | Ga0209646_10020613 | 385 |
| 769 | 3300025250 | Ga0209026_1000671 | Ga0209026_10006718 | 385 |
| 770 | 3300025253 | Ga0209677_103496 | Ga0209677_1034963 | 385 |
| 771 | 3300025254 | Ga0209148_1000025 | Ga0209148_1000025380 | 385 |
| 772 | 3300025254 | Ga0209148_1000062 | Ga0209148_1000062226 | 385 |
| 773 | 3300025254 | Ga0209148_1000083 | Ga0209148_100008359 | 385 |
| 774 | 3300025254 | Ga0209148_1000092 | Ga0209148_1000092143 | 385 |
| 775 | 3300025256 | Ga0209759_1000299 | Ga0209759_100029915 | 385 |
| 776 | 3300025261 | Ga0209233_1000141 | Ga0209233_100014143 | 385 |
| 777 | 3300025272 | Ga0209455_1000004 | Ga0209455_10000041076 | 385 |
| 778 | 3300025272 | Ga0209455_1000040 | Ga0209455_1000040233 | 385 |
| 779 | 3300025272 | Ga0209455_1000084 | Ga0209455_100008459 | 385 |
| 780 | 3300025292 | Ga0209676_1004340 | Ga0209676_10043402 | 385 |
| 781 | 3300025294 | Ga0209025_1011481 | Ga0209025_10114815 | 385 |
| 782 | 3300025298 | Ga0209050_1006165 | Ga0209050_10061656 | 385 |
| 783 | 3300025304 | Ga0209257_1000414 | Ga0209257_100041411 | 385 |
| 784 | 3300025913 | Ga0207695_10000441 | Ga0207695_1000044122 | 385 |
| 785 | 3300025913 | Ga0207695_10000743 | Ga0207695_1000074319 | 385 |
| 786 | 3300025949 | Ga0207667_10000224 | Ga0207667_1000022461 | 385 |
| 787 | 3300025972 | Ga0207668_10176337 | Ga0207668_101763372 | 385 |
| 788 | 3300025981 | Ga0207640_10000115 | Ga0207640_100001156 | 385 |
| 789 | 3300025986 | Ga0207658_10008954 | Ga0207658_100089546 | 385 |
| 790 | 3300026067 | Ga0207678_10081182 | Ga0207678_100811822 | 385 |
| 791 | 3300026078 | Ga0207702_10001870 | Ga0207702_1000187020 | 385 |
| 792 | 3300026095 | Ga0207676_10141543 | Ga0207676_101415432 | 385 |
| 793 | 3300027876 | Ga0209974_10012587 | Ga0209974_100125873 | 385 |
| 794 | 3300028379 | Ga0268266_10000001 | Ga0268266_10000001816 | 385 |
| 795 | 3300028379 | Ga0268266_10343754 | Ga0268266_103437542 | 385 |
| 796 | 3300028380 | Ga0268265_10000539 | Ga0268265_100005392 | 385 |
| 797 | 3300028381 | Ga0268264_10265542 | Ga0268264_102655422 | 385 |
| 798 | 3300031711 | Ga0265314_10011218 | Ga0265314_100112186 | 385 |
| 799 | 3300031731 | Ga0307405_10145699 | Ga0307405_101456992 | 385 |
| 800 | 3300032005 | Ga0307411_10035548 | Ga0307411_100355482 | 385 |
| 801 | 3300037418 | Ga0395900_0009320 | Ga0395900_0009320_459_1619 | 385 |
| 802 | 3300037471 | Ga0395905_0002192 | Ga0395905_0002192_9458_10618 | 385 |
| 803 | 3300037471 | Ga0395905_0015602 | Ga0395905_0015602_5775_6935 | 385 |
| 804 | 3300042006 | Ga0439432_002019 | Ga0439432_002019_304_1464 | 385 |
| 805 | 3300042007 | Ga0439449_0032110 | Ga0439449_0032110_392_1552 | 385 |
| 806 | 3300044656 | Ga0466969_0003393 | Ga0466969_0003393_288_1457 | 385 |
| 807 | 3300044656 | Ga0466969_0069861 | Ga0466969_0069861_478_1641 | 385 |
| 808 | 3300044672 | Ga0466982_0000001 | Ga0466982_0000001_13455_14618 | 385 |
| 809 | 3300044684 | Ga0466966_0021980 | Ga0466966_0021980_691_1854 | 385 |
| 810 | 3300044693 | Ga0466961_0000391 | Ga0466961_0000391_11019_12188 | 385 |
| 811 | 3300044694 | Ga0466963_0142660 | Ga0466963_0142660_77_1246 | 385 |
| 812 | 3300044706 | Ga0466964_0014757 | Ga0466964_0014757_1560_2723 | 385 |
| 813 | 3300044719 | Ga0466971_0000637 | Ga0466971_0000637_1045_2208 | 385 |
| 814 | 3300044765 | Ga0466970_0009866 | Ga0466970_0009866_3551_4714 | 385 |
| 815 | 3300044901 | Ga0466960_0033971 | Ga0466960_0033971_758_1921 | 385 |
| 816 | 3300045049 | Ga0466959_0049203 | Ga0466959_0049203_1115_2284 | 385 |
| 817 | 3300045836 | Ga0466958_0034855 | Ga0466958_0034855_619_1788 | 385 |
| 818 | 3300045836 | Ga0466958_0166523 | Ga0466958_0166523_195_1355 | 385 |
| 819 | 3300045976 | Ga0466967_0023893 | Ga0466967_0023893_2551_3720 | 385 |
| 820 | 3300046525 | Ga0495663_0018500 | Ga0495663_0018500_645_1805 | 385 |
| 821 | 3300046525 | Ga0495663_0028092 | Ga0495663_0028092_33_1193 | 385 |
| 822 | 3300046537 | Ga0495598_0001101 | Ga0495598_0001101_161_1321 | 385 |
| 823 | 3300046539 | Ga0495621_0014733 | Ga0495621_0014733_617_1777 | 385 |
| 824 | 3300046615 | Ga0495656_0003555 | Ga0495656_0003555_3997_5157 | 385 |
| 825 | 3300046616 | Ga0495668_0023691 | Ga0495668_0023691_842_2002 | 385 |
| 826 | 3300046648 | Ga0495611_0000014 | Ga0495611_0000014_90754_91911 | 385 |
| 827 | 3300047318 | Ga0495636_0004489 | Ga0495636_0004489_3101_4261 | 385 |
| 828 | 3300047318 | Ga0495636_0022908 | Ga0495636_0022908_1349_2509 | 385 |
| 829 | 3300048904 | Ga0496101_0004029 | Ga0496101_0004029_1676_2839 | 385 |
| 830 | 3300048907 | Ga0496104_0017116 | Ga0496104_0017116_4822_5985 | 385 |
| 831 | 3300048908 | Ga0496105_0030457 | Ga0496105_0030457_194_1357 | 385 |
| 832 | 3300048910 | Ga0496107_0246978 | Ga0496107_0246978_121_1284 | 385 |
| 833 | 3300048911 | Ga0496108_0125251 | Ga0496108_0125251_131_1291 | 385 |
| 834 | 3300048913 | Ga0496110_0184289 | Ga0496110_0184289_204_1364 | 385 |
| 835 | 3300048918 | Ga0496115_0017672 | Ga0496115_0017672_1048_2520 | 385 |
| 836 | 3300048920 | Ga0496117_0005621 | Ga0496117_0005621_232_1395 | 385 |
| 837 | 3300048921 | Ga0496118_0002106 | Ga0496118_0002106_22892_24055 | 385 |
| 838 | 3300048921 | Ga0496118_0003206 | Ga0496118_0003206_3429_4592 | 385 |
| 839 | 3300048922 | Ga0496119_0000235 | Ga0496119_0000235_44964_46127 | 385 |
| 840 | 3300048923 | Ga0496120_0000208 | Ga0496120_0000208_53969_55132 | 385 |
| 841 | 3300048924 | Ga0496121_0000480 | Ga0496121_0000480_46713_47876 | 385 |
| 842 | 3300048924 | Ga0496121_0041518 | Ga0496121_0041518_69_1232 | 385 |
| 843 | 3300048929 | Ga0496126_0001680 | Ga0496126_0001680_18365_19528 | 385 |
| 844 | 3300049571 | Ga0501034_0003143 | Ga0501034_0003143_2192_3352 | 385 |
| 845 | 3300049571 | Ga0501034_0114928 | Ga0501034_0114928_1065_2228 | 385 |
| 846 | 3300049572 | Ga0501036_0082697 | Ga0501036_0082697_236_1396 | 385 |
| 847 | 3300049572 | Ga0501036_0239297 | Ga0501036_0239297_175_1344 | 385 |
| 848 | 3300049574 | Ga0501038_0171471 | Ga0501038_0171471_187_1347 | 385 |
| 849 | 3300049579 | Ga0501043_0025027 | Ga0501043_0025027_1818_2978 | 385 |
| 850 | 3300049580 | Ga0501046_0007434 | Ga0501046_0007434_3731_4894 | 385 |
| 851 | 3300049580 | Ga0501046_0007779 | Ga0501046_0007779_1491_2651 | 385 |
| 852 | 3300049580 | Ga0501046_0022598 | Ga0501046_0022598_2455_3615 | 385 |
| 853 | 3300049581 | Ga0501047_0000492 | Ga0501047_0000492_3804_4964 | 385 |
| 854 | 3300049581 | Ga0501047_0001924 | Ga0501047_0001924_3955_5115 | 385 |
| 855 | 3300049586 | Ga0501070_0006408 | Ga0501070_0006408_4823_5983 | 385 |
| 856 | 3300049586 | Ga0501070_0006453 | Ga0501070_0006453_7873_9033 | 385 |
| 857 | 3300049589 | Ga0501073_0018962 | Ga0501073_0018962_3317_4477 | 385 |
| 858 | 3300049590 | Ga0501074_0024898 | Ga0501074_0024898_1441_2601 | 385 |
| 859 | 3300049590 | Ga0501074_0028997 | Ga0501074_0028997_344_1504 | 385 |
| 860 | 3300049741 | Ga0501079_0031442 | Ga0501079_0031442_252_1412 | 385 |
| 861 | 3300049742 | Ga0501080_0000381 | Ga0501080_0000381_8050_9210 | 385 |
| 862 | 3300049742 | Ga0501080_0001633 | Ga0501080_0001633_13800_14960 | 385 |
| 863 | 3300049822 | Ga0501035_0022978 | Ga0501035_0022978_2616_3776 | 385 |
| 864 | 3300053093 | Ga0500651_0000166 | Ga0500651_0000166_27925_29088 | 385 |
| 865 | 3300053093 | Ga0500651_0074795 | Ga0500651_0074795_764_1933 | 385 |
| 866 | 3300060353 | Ga0501082_0077129 | Ga0501082_0077129_144_1304 | 385 |
| 867 | 3300061719 | Ga0466962_0000447 | Ga0466962_0000447_12754_13917 | 385 |
| 868 | 3300002705 | JGI25156J39149_1000042 | JGI25156J39149_100004262 | 386 |
| 869 | 3300002705 | JGI25156J39149_1003775 | JGI25156J39149_10037752 | 386 |
| 870 | 3300002737 | JGI25162J39368_1000360 | JGI25162J39368_100036013 | 386 |
| 871 | 3300002737 | JGI25162J39368_1004638 | JGI25162J39368_10046382 | 386 |
| 872 | 3300002738 | JGI25154J39366_1006572 | JGI25154J39366_10065721 | 386 |
| 873 | 3300002741 | JGI25157J39369_1000261 | JGI25157J39369_100026113 | 386 |
| 874 | 3300002741 | JGI25157J39369_1002080 | JGI25157J39369_10020804 | 386 |
| 875 | 3300002771 | JGI25163J39215_1000788 | JGI25163J39215_10007882 | 386 |
| 876 | 3300002772 | JGI25164J39214_1000238 | JGI25164J39214_100023824 | 386 |
| 877 | 3300002772 | JGI25164J39214_1003814 | JGI25164J39214_10038142 | 386 |
| 878 | 3300002773 | JGI25152J39213_1002091 | JGI25152J39213_10020912 | 386 |
| 879 | 3300003214 | JGI25165J46597_1000301 | JGI25165J46597_100030143 | 386 |
| 880 | 3300003215 | JGI25153J46596_10018263 | JGI25153J46596_100182633 | 386 |
| 881 | 3300003316 | rootH1_10001043 | rootH1_100010432 | 386 |
| 882 | 3300003320 | rootH2_10011597 | rootH2_1001159711 | 386 |
| 883 | 3300003320 | rootH2_10098227 | rootH2_100982275 | 386 |
| 884 | 3300003322 | rootL2_10007947 | rootL2_100079478 | 386 |
| 885 | 3300003751 | Ga0055538_1000543 | Ga0055538_10005433 | 386 |
| 886 | 3300003756 | Ga0055533_1000449 | Ga0055533_10004493 | 386 |
| 887 | 3300003761 | Ga0055535_1000434 | Ga0055535_100043413 | 386 |
| 888 | 3300003761 | Ga0055535_1003984 | Ga0055535_10039842 | 386 |
| 889 | 3300003761 | Ga0055535_1012683 | Ga0055535_10126831 | 386 |
| 890 | 3300003762 | Ga0055542_1000213 | Ga0055542_100021347 | 386 |
| 891 | 3300003762 | Ga0055542_1000453 | Ga0055542_100045313 | 386 |
| 892 | 3300003763 | Ga0055529_1000268 | Ga0055529_100026813 | 386 |
| 893 | 3300003771 | Ga0055526_1002801 | Ga0055526_10028018 | 386 |
| 894 | 3300003791 | Ga0055530_10011347 | Ga0055530_100113472 | 386 |
| 895 | 3300003794 | Ga0055531_10000043 | Ga0055531_1000004363 | 386 |
| 896 | 3300005262 | Ga0065165_1000390 | Ga0065165_100039055 | 386 |
| 897 | 3300005327 | Ga0070658_10021209 | Ga0070658_100212092 | 386 |
| 898 | 3300005327 | Ga0070658_10041437 | Ga0070658_100414372 | 386 |
| 899 | 3300005336 | Ga0070680_100005739 | Ga0070680_1000057394 | 386 |
| 900 | 3300005336 | Ga0070680_100201847 | Ga0070680_1002018472 | 386 |
| 901 | 3300005338 | Ga0068868_100003427 | Ga0068868_1000034274 | 386 |
| 902 | 3300005338 | Ga0068868_100219334 | Ga0068868_1002193341 | 386 |
| 903 | 3300005339 | Ga0070660_100002464 | Ga0070660_10000246416 | 386 |
| 904 | 3300005339 | Ga0070660_100059049 | Ga0070660_1000590491 | 386 |
| 905 | 3300005339 | Ga0070660_100115769 | Ga0070660_1001157692 | 386 |
| 906 | 3300005340 | Ga0070689_100001481 | Ga0070689_1000014812 | 386 |
| 907 | 3300005344 | Ga0070661_100141296 | Ga0070661_1001412961 | 386 |
| 908 | 3300005366 | Ga0070659_100004826 | Ga0070659_1000048268 | 386 |
| 909 | 3300005366 | Ga0070659_100012735 | Ga0070659_1000127355 | 386 |
| 910 | 3300005366 | Ga0070659_100052813 | Ga0070659_1000528132 | 386 |
| 911 | 3300005366 | Ga0070659_100232269 | Ga0070659_1002322691 | 386 |
| 912 | 3300005367 | Ga0070667_100211434 | Ga0070667_1002114342 | 386 |
| 913 | 3300005455 | Ga0070663_100010925 | Ga0070663_1000109254 | 386 |
| 914 | 3300005455 | Ga0070663_100014972 | Ga0070663_1000149722 | 386 |
| 915 | 3300005456 | Ga0070678_100204557 | Ga0070678_1002045572 | 386 |
| 916 | 3300005457 | Ga0070662_100105637 | Ga0070662_1001056372 | 386 |
| 917 | 3300005458 | Ga0070681_10000006 | Ga0070681_1000000655 | 386 |
| 918 | 3300005458 | Ga0070681_10000114 | Ga0070681_1000011452 | 386 |
| 919 | 3300005458 | Ga0070681_10036274 | Ga0070681_100362743 | 386 |
| 920 | 3300005467 | Ga0070706_100000246 | Ga0070706_10000024653 | 386 |
| 921 | 3300005471 | Ga0070698_100024453 | Ga0070698_1000244534 | 386 |
| 922 | 3300005530 | Ga0070679_100000375 | Ga0070679_1000003754 | 386 |
| 923 | 3300005539 | Ga0068853_100353114 | Ga0068853_1003531141 | 386 |
| 924 | 3300005546 | Ga0070696_100037414 | Ga0070696_1000374142 | 386 |
| 925 | 3300005563 | Ga0068855_100026162 | Ga0068855_1000261624 | 386 |
| 926 | 3300005563 | Ga0068855_100055439 | Ga0068855_1000554392 | 386 |
| 927 | 3300005563 | Ga0068855_100098855 | Ga0068855_1000988553 | 386 |
| 928 | 3300005578 | Ga0068854_100075522 | Ga0068854_1000755222 | 386 |
| 929 | 3300005614 | Ga0068856_100000524 | Ga0068856_10000052417 | 386 |
| 930 | 3300006195 | Ga0075366_10016201 | Ga0075366_100162012 | 386 |
| 931 | 3300006353 | Ga0075370_10012781 | Ga0075370_100127813 | 386 |
| 932 | 3300006353 | Ga0075370_10080959 | Ga0075370_100809592 | 386 |
| 933 | 3300007788 | Ga0099795_10000001 | Ga0099795_10000001100 | 386 |
| 934 | 3300009093 | Ga0105240_10023924 | Ga0105240_100239248 | 386 |
| 935 | 3300009093 | Ga0105240_10181414 | Ga0105240_101814142 | 386 |
| 936 | 3300009174 | Ga0105241_10116216 | Ga0105241_101162162 | 386 |
| 937 | 3300009545 | Ga0105237_10000036 | Ga0105237_10000036122 | 386 |
| 938 | 3300009551 | Ga0105238_10018070 | Ga0105238_100180707 | 386 |
| 939 | 3300009551 | Ga0105238_10029729 | Ga0105238_100297293 | 386 |
| 940 | 3300009551 | Ga0105238_10083391 | Ga0105238_100833913 | 386 |
| 941 | 3300009551 | Ga0105238_10355216 | Ga0105238_103552162 | 386 |
| 942 | 3300010159 | Ga0099796_10000001 | Ga0099796_1000000185 | 386 |
| 943 | 3300013100 | Ga0157373_10017594 | Ga0157373_100175942 | 386 |
| 944 | 3300013102 | Ga0157371_10111704 | Ga0157371_101117042 | 386 |
| 945 | 3300013104 | Ga0157370_10046561 | Ga0157370_100465614 | 386 |
| 946 | 3300013104 | Ga0157370_10139004 | Ga0157370_101390042 | 386 |
| 947 | 3300013105 | Ga0157369_10031828 | Ga0157369_100318283 | 386 |
| 948 | 3300013105 | Ga0157369_10093848 | Ga0157369_100938482 | 386 |
| 949 | 3300013306 | Ga0163162_10228414 | Ga0163162_102284142 | 386 |
| 950 | 3300013307 | Ga0157372_10050379 | Ga0157372_100503793 | 386 |
| 951 | 3300013307 | Ga0157372_10369738 | Ga0157372_103697382 | 386 |
| 952 | 3300014497 | Ga0182008_10023024 | Ga0182008_100230242 | 386 |
| 953 | 3300015685 | Ga0183369_1004 | Ga0183369_100433 | 386 |
| 954 | 3300015687 | Ga0183368_1003 | Ga0183368_1003127 | 386 |
| 955 | 3300021361 | Ga0213872_10000044 | Ga0213872_100000442 | 386 |
| 956 | 3300021361 | Ga0213872_10000125 | Ga0213872_1000012521 | 386 |
| 957 | 3300021361 | Ga0213872_10000284 | Ga0213872_1000028417 | 386 |
| 958 | 3300021361 | Ga0213872_10001189 | Ga0213872_100011894 | 386 |
| 959 | 3300021361 | Ga0213872_10018969 | Ga0213872_100189693 | 386 |
| 960 | 3300025207 | Ga0209760_100341 | Ga0209760_10034111 | 386 |
| 961 | 3300025224 | Ga0209784_100156 | Ga0209784_10015613 | 386 |
| 962 | 3300025226 | Ga0209674_100033 | Ga0209674_100033138 | 386 |
| 963 | 3300025228 | Ga0209672_100204 | Ga0209672_10020422 | 386 |
| 964 | 3300025231 | Ga0207427_100070 | Ga0207427_10007099 | 386 |
| 965 | 3300025231 | Ga0207427_102685 | Ga0207427_1026853 | 386 |
| 966 | 3300025231 | Ga0207427_102846 | Ga0207427_1028464 | 386 |
| 967 | 3300025233 | Ga0209437_100059 | Ga0209437_100059157 | 386 |
| 968 | 3300025233 | Ga0209437_100141 | Ga0209437_10014131 | 386 |
| 969 | 3300025233 | Ga0209437_104557 | Ga0209437_1045572 | 386 |
| 970 | 3300025242 | Ga0209258_100034 | Ga0209258_10003444 | 386 |
| 971 | 3300025242 | Ga0209258_100564 | Ga0209258_10056417 | 386 |
| 972 | 3300025242 | Ga0209258_101959 | Ga0209258_1019593 | 386 |
| 973 | 3300025246 | Ga0209646_1002602 | Ga0209646_10026023 | 386 |
| 974 | 3300025246 | Ga0209646_1003394 | Ga0209646_10033942 | 386 |
| 975 | 3300025246 | Ga0209646_1005145 | Ga0209646_10051452 | 386 |
| 976 | 3300025250 | Ga0209026_1000269 | Ga0209026_100026943 | 386 |
| 977 | 3300025250 | Ga0209026_1000944 | Ga0209026_100094412 | 386 |
| 978 | 3300025254 | Ga0209148_1000001 | Ga0209148_1000001660 | 386 |
| 979 | 3300025254 | Ga0209148_1000002 | Ga0209148_1000002749 | 386 |
| 980 | 3300025256 | Ga0209759_1000915 | Ga0209759_10009157 | 386 |
| 981 | 3300025256 | Ga0209759_1002563 | Ga0209759_10025633 | 386 |
| 982 | 3300025256 | Ga0209759_1012781 | Ga0209759_10127812 | 386 |
| 983 | 3300025261 | Ga0209233_1000002 | Ga0209233_10000021571 | 386 |
| 984 | 3300025272 | Ga0209455_1000054 | Ga0209455_100005413 | 386 |
| 985 | 3300025272 | Ga0209455_1000318 | Ga0209455_100031833 | 386 |
| 986 | 3300025273 | Ga0209673_1008915 | Ga0209673_10089153 | 386 |
| 987 | 3300025295 | Ga0209564_1000051 | Ga0209564_1000051125 | 386 |
| 988 | 3300025297 | Ga0209758_1000096 | Ga0209758_100009675 | 386 |
| 989 | 3300025298 | Ga0209050_1001300 | Ga0209050_10013008 | 386 |
| 990 | 3300025303 | Ga0209051_1004799 | Ga0209051_10047995 | 386 |
| 991 | 3300025304 | Ga0209257_1000182 | Ga0209257_100018254 | 386 |
| 992 | 3300025904 | Ga0207647_10047939 | Ga0207647_100479392 | 386 |
| 993 | 3300025904 | Ga0207647_10088879 | Ga0207647_100888792 | 386 |
| 994 | 3300025907 | Ga0207645_10036201 | Ga0207645_100362012 | 386 |
| 995 | 3300025909 | Ga0207705_10007229 | Ga0207705_100072297 | 386 |
| 996 | 3300025910 | Ga0207684_10002337 | Ga0207684_100023375 | 386 |
| 997 | 3300025912 | Ga0207707_10000095 | Ga0207707_1000009576 | 386 |
| 998 | 3300025912 | Ga0207707_10000869 | Ga0207707_1000086920 | 386 |
| 999 | 3300025912 | Ga0207707_10017761 | Ga0207707_100177613 | 386 |
| 1000 | 3300025912 | Ga0207707_10301994 | Ga0207707_103019941 | 386 |
| 1001 | 3300025913 | Ga0207695_10000938 | Ga0207695_100009383 | 386 |
| 1002 | 3300025913 | Ga0207695_10137445 | Ga0207695_101374452 | 386 |
| 1003 | 3300025914 | Ga0207671_10001404 | Ga0207671_100014049 | 386 |
| 1004 | 3300025919 | Ga0207657_10040416 | Ga0207657_100404162 | 386 |
| 1005 | 3300025919 | Ga0207657_10054162 | Ga0207657_100541623 | 386 |
| 1006 | 3300025919 | Ga0207657_10063548 | Ga0207657_100635482 | 386 |
| 1007 | 3300025921 | Ga0207652_10000560 | Ga0207652_1000056034 | 386 |
| 1008 | 3300025924 | Ga0207694_10041392 | Ga0207694_100413922 | 386 |
| 1009 | 3300025932 | Ga0207690_10011576 | Ga0207690_100115763 | 386 |
| 1010 | 3300025932 | Ga0207690_10015169 | Ga0207690_100151693 | 386 |
| 1011 | 3300025932 | Ga0207690_10029644 | Ga0207690_100296442 | 386 |
| 1012 | 3300025933 | Ga0207706_10038523 | Ga0207706_100385233 | 386 |
| 1013 | 3300025933 | Ga0207706_10135429 | Ga0207706_101354292 | 386 |
| 1014 | 3300025936 | Ga0207670_10083824 | Ga0207670_100838242 | 386 |
| 1015 | 3300025949 | Ga0207667_10032547 | Ga0207667_100325473 | 386 |
| 1016 | 3300025949 | Ga0207667_10039237 | Ga0207667_100392374 | 386 |
| 1017 | 3300025949 | Ga0207667_10058768 | Ga0207667_100587681 | 386 |
| 1018 | 3300025949 | Ga0207667_10167675 | Ga0207667_101676752 | 386 |
| 1019 | 3300025981 | Ga0207640_10043090 | Ga0207640_100430902 | 386 |
| 1020 | 3300026041 | Ga0207639_10119391 | Ga0207639_101193912 | 386 |
| 1021 | 3300026067 | Ga0207678_10000643 | Ga0207678_1000064325 | 386 |
| 1022 | 3300026067 | Ga0207678_10026314 | Ga0207678_100263143 | 386 |
| 1023 | 3300026078 | Ga0207702_10000717 | Ga0207702_1000071718 | 386 |
| 1024 | 3300026078 | Ga0207702_10187910 | Ga0207702_101879101 | 386 |
| 1025 | 3300026116 | Ga0207674_10203879 | Ga0207674_102038792 | 386 |
| 1026 | 3300027512 | Ga0209179_1000006 | Ga0209179_100000648 | 386 |
| 1027 | 3300028794 | Ga0307515_10000066 | Ga0307515_10000066117 | 386 |
| 1028 | 3300028794 | Ga0307515_10006088 | Ga0307515_1000608822 | 386 |
| 1029 | 3300028794 | Ga0307515_10091298 | Ga0307515_100912983 | 386 |
| 1030 | 3300031250 | Ga0265331_10002534 | Ga0265331_100025346 | 386 |
| 1031 | 3300031251 | Ga0265327_10000028 | Ga0265327_10000028178 | 386 |
| 1032 | 3300031548 | Ga0307408_100161390 | Ga0307408_1001613902 | 386 |
| 1033 | 3300031649 | Ga0307514_10020148 | Ga0307514_100201482 | 386 |
| 1034 | 3300031665 | Ga0316575_10035503 | Ga0316575_100355032 | 386 |
| 1035 | 3300031730 | Ga0307516_10000109 | Ga0307516_100001095 | 386 |
| 1036 | 3300032002 | Ga0307416_100363264 | Ga0307416_1003632642 | 386 |
| 1037 | 3300035114 | Ga0373939_0000033 | Ga0373939_0000033_21476_22645 | 386 |
| 1038 | 3300035121 | Ga0373960_0008484 | Ga0373960_0008484_535_1704 | 386 |
| 1039 | 3300037466 | Ga0395898_0035555 | Ga0395898_0035555_2080_3246 | 386 |
| 1040 | 3300037471 | Ga0395905_0001072 | Ga0395905_0001072_14602_15768 | 386 |
| 1041 | 3300037471 | Ga0395905_0020334 | Ga0395905_0020334_1789_2958 | 386 |
| 1042 | 3300037471 | Ga0395905_0103718 | Ga0395905_0103718_1455_2621 | 386 |
| 1043 | 3300037471 | Ga0395905_0113959 | Ga0395905_0113959_1253_2419 | 386 |
| 1044 | 3300038443 | Ga0395901_0003311 | Ga0395901_0003311_1813_2979 | 386 |
| 1045 | 3300038443 | Ga0395901_0051425 | Ga0395901_0051425_524_1690 | 386 |
| 1046 | 3300039447 | Ga0436361_0117093 | Ga0436361_0117093_2121_3287 | 386 |
| 1047 | 3300039447 | Ga0436361_0181855 | Ga0436361_0181855_7949_9115 | 386 |
| 1048 | 3300039447 | Ga0436361_0285207 | Ga0436361_0285207_25374_26540 | 386 |
| 1049 | 3300039447 | Ga0436361_0332176 | Ga0436361_0332176_14368_15534 | 386 |
| 1050 | 3300039447 | Ga0436361_0549178 | Ga0436361_0549178_3494_4660 | 386 |
| 1051 | 3300039447 | Ga0436361_0886712 | Ga0436361_0886712_1806_2975 | 386 |
| 1052 | 3300039447 | Ga0436361_1071853 | Ga0436361_1071853_433_1599 | 386 |
| 1053 | 3300041407 | Ga0439447_002843 | Ga0439447_002843_996_2162 | 386 |
| 1054 | 3300041459 | Ga0451800_0725589 | Ga0451800_0725589_523_1689 | 386 |
| 1055 | 3300041462 | Ga0451806_572563 | Ga0451806_572563_1654_2820 | 386 |
| 1056 | 3300042126 | Ga0450888_000128 | Ga0450888_000128_3238_4407 | 386 |
| 1057 | 3300042127 | Ga0450890_001491 | Ga0450890_001491_487_1656 | 386 |
| 1058 | 3300042130 | Ga0450892_000486 | Ga0450892_000486_2178_3347 | 386 |
| 1059 | 3300042144 | Ga0450889_000377 | Ga0450889_000377_1152_2321 | 386 |
| 1060 | 3300042532 | Ga0450893_0001034 | Ga0450893_0001034_839_2008 | 386 |
| 1061 | 3300044656 | Ga0466969_0005020 | Ga0466969_0005020_991_2157 | 386 |
| 1062 | 3300044658 | Ga0466972_0000761 | Ga0466972_0000761_6777_7943 | 386 |
| 1063 | 3300044683 | Ga0466965_0003924 | Ga0466965_0003924_4825_5991 | 386 |
| 1064 | 3300044684 | Ga0466966_0018259 | Ga0466966_0018259_2404_3570 | 386 |
| 1065 | 3300044684 | Ga0466966_0077877 | Ga0466966_0077877_279_1445 | 386 |
| 1066 | 3300044693 | Ga0466961_0007752 | Ga0466961_0007752_2151_3317 | 386 |
| 1067 | 3300044693 | Ga0466961_0013754 | Ga0466961_0013754_938_2104 | 386 |
| 1068 | 3300044693 | Ga0466961_0054799 | Ga0466961_0054799_1316_2482 | 386 |
| 1069 | 3300044694 | Ga0466963_0229597 | Ga0466963_0229597_110_1276 | 386 |
| 1070 | 3300044706 | Ga0466964_0001887 | Ga0466964_0001887_162_1328 | 386 |
| 1071 | 3300044719 | Ga0466971_0008613 | Ga0466971_0008613_2765_3931 | 386 |
| 1072 | 3300044719 | Ga0466971_0014458 | Ga0466971_0014458_121_1287 | 386 |
| 1073 | 3300044765 | Ga0466970_0054849 | Ga0466970_0054849_434_1600 | 386 |
| 1074 | 3300044842 | Ga0466957_0055839 | Ga0466957_0055839_710_1876 | 386 |
| 1075 | 3300044842 | Ga0466957_0066255 | Ga0466957_0066255_786_1952 | 386 |
| 1076 | 3300044901 | Ga0466960_0017957 | Ga0466960_0017957_273_1439 | 386 |
| 1077 | 3300045049 | Ga0466959_0000132 | Ga0466959_0000132_32120_33286 | 386 |
| 1078 | 3300045049 | Ga0466959_0036023 | Ga0466959_0036023_2396_3562 | 386 |
| 1079 | 3300045836 | Ga0466958_0041201 | Ga0466958_0041201_1309_2475 | 386 |
| 1080 | 3300045976 | Ga0466967_0116785 | Ga0466967_0116785_729_1895 | 386 |
| 1081 | 3300046460 | Ga0495638_0000152 | Ga0495638_0000152_61034_62200 | 386 |
| 1082 | 3300046460 | Ga0495638_0000378 | Ga0495638_0000378_26970_28136 | 386 |
| 1083 | 3300046471 | Ga0495650_0000112 | Ga0495650_0000112_26945_28111 | 386 |
| 1084 | 3300046471 | Ga0495650_0015578 | Ga0495650_0015578_1067_2233 | 386 |
| 1085 | 3300046507 | Ga0495606_0000749 | Ga0495606_0000749_1846_3012 | 386 |
| 1086 | 3300046542 | Ga0495597_0006722 | Ga0495597_0006722_1922_3088 | 386 |
| 1087 | 3300046557 | Ga0495622_0009004 | Ga0495622_0009004_899_2065 | 386 |
| 1088 | 3300046616 | Ga0495668_0001831 | Ga0495668_0001831_8067_9233 | 386 |
| 1089 | 3300046660 | Ga0495625_0122019 | Ga0495625_0122019_230_1396 | 386 |
| 1090 | 3300046691 | Ga0495670_0039847 | Ga0495670_0039847_237_1406 | 386 |
| 1091 | 3300046694 | Ga0495649_0000594 | Ga0495649_0000594_10503_11669 | 386 |
| 1092 | 3300047443 | Ga0495687_000248 | Ga0495687_000248_23371_24537 | 386 |
| 1093 | 3300047673 | Ga0495593_0012401 | Ga0495593_0012401_2269_3438 | 386 |
| 1094 | 3300048909 | Ga0496106_0187888 | Ga0496106_0187888_132_1298 | 386 |
| 1095 | 3300048916 | Ga0496113_0004524 | Ga0496113_0004524_6024_7190 | 386 |
| 1096 | 3300048918 | Ga0496115_0000008 | Ga0496115_0000008_186182_187348 | 386 |
| 1097 | 3300048918 | Ga0496115_0000474 | Ga0496115_0000474_4901_6067 | 386 |
| 1098 | 3300048918 | Ga0496115_0039836 | Ga0496115_0039836_627_1793 | 386 |
| 1099 | 3300048920 | Ga0496117_0014937 | Ga0496117_0014937_2307_3473 | 386 |
| 1100 | 3300048921 | Ga0496118_0005866 | Ga0496118_0005866_7517_8683 | 386 |
| 1101 | 3300048929 | Ga0496126_0008899 | Ga0496126_0008899_5144_6310 | 386 |
| 1102 | 3300048929 | Ga0496126_0301082 | Ga0496126_0301082_60_1229 | 386 |
| 1103 | 3300049568 | Ga0501031_0032185 | Ga0501031_0032185_1317_2480 | 386 |
| 1104 | 3300049568 | Ga0501031_0080818 | Ga0501031_0080818_80_1246 | 386 |
| 1105 | 3300049569 | Ga0501032_0001872 | Ga0501032_0001872_10148_11314 | 386 |
| 1106 | 3300049570 | Ga0501033_0054178 | Ga0501033_0054178_782_1945 | 386 |
| 1107 | 3300049571 | Ga0501034_0003634 | Ga0501034_0003634_8294_9460 | 386 |
| 1108 | 3300049571 | Ga0501034_0005592 | Ga0501034_0005592_2921_4087 | 386 |
| 1109 | 3300049571 | Ga0501034_0048973 | Ga0501034_0048973_2386_3549 | 386 |
| 1110 | 3300049572 | Ga0501036_0095052 | Ga0501036_0095052_294_1457 | 386 |
| 1111 | 3300049573 | Ga0501037_0032551 | Ga0501037_0032551_2663_3826 | 386 |
| 1112 | 3300049575 | Ga0501039_0099173 | Ga0501039_0099173_426_1592 | 386 |
| 1113 | 3300049579 | Ga0501043_0094542 | Ga0501043_0094542_720_1886 | 386 |
| 1114 | 3300049580 | Ga0501046_0071888 | Ga0501046_0071888_107_1270 | 386 |
| 1115 | 3300049580 | Ga0501046_0173733 | Ga0501046_0173733_40_1206 | 386 |
| 1116 | 3300049581 | Ga0501047_0000904 | Ga0501047_0000904_5359_6525 | 386 |
| 1117 | 3300049581 | Ga0501047_0010764 | Ga0501047_0010764_2590_3753 | 386 |
| 1118 | 3300049582 | Ga0501048_0081261 | Ga0501048_0081261_1086_2249 | 386 |
| 1119 | 3300049583 | Ga0501067_0000426 | Ga0501067_0000426_18959_20125 | 386 |
| 1120 | 3300049585 | Ga0501069_0002407 | Ga0501069_0002407_6965_8131 | 386 |
| 1121 | 3300049586 | Ga0501070_0001125 | Ga0501070_0001125_17545_18708 | 386 |
| 1122 | 3300049586 | Ga0501070_0003048 | Ga0501070_0003048_4582_5748 | 386 |
| 1123 | 3300049586 | Ga0501070_0003914 | Ga0501070_0003914_8601_9767 | 386 |
| 1124 | 3300049586 | Ga0501070_0050466 | Ga0501070_0050466_2264_3424 | 386 |
| 1125 | 3300049586 | Ga0501070_0055108 | Ga0501070_0055108_1565_2728 | 386 |
| 1126 | 3300049587 | Ga0501071_0002518 | Ga0501071_0002518_8168_9331 | 386 |
| 1127 | 3300049588 | Ga0501072_0001604 | Ga0501072_0001604_8454_9620 | 386 |
| 1128 | 3300049589 | Ga0501073_0000557 | Ga0501073_0000557_16283_17446 | 386 |
| 1129 | 3300049589 | Ga0501073_0000757 | Ga0501073_0000757_21282_22448 | 386 |
| 1130 | 3300049589 | Ga0501073_0090310 | Ga0501073_0090310_69_1232 | 386 |
| 1131 | 3300049590 | Ga0501074_0000162 | Ga0501074_0000162_1772_2935 | 386 |
| 1132 | 3300049590 | Ga0501074_0001529 | Ga0501074_0001529_8018_9184 | 386 |
| 1133 | 3300049590 | Ga0501074_0078312 | Ga0501074_0078312_83_1246 | 386 |
| 1134 | 3300049661 | Ga0501217_032436 | Ga0501217_032436_68_1237 | 386 |
| 1135 | 3300049662 | Ga0501222_003405 | Ga0501222_003405_489_1658 | 386 |
| 1136 | 3300049665 | Ga0501227_013967 | Ga0501227_013967_479_1648 | 386 |
| 1137 | 3300049668 | Ga0501233_026477 | Ga0501233_026477_37_1206 | 386 |
| 1138 | 3300049687 | Ga0501258_000331 | Ga0501258_000331_1532_2701 | 386 |
| 1139 | 3300049704 | Ga0501221_001217 | Ga0501221_001217_183_1352 | 386 |
| 1140 | 3300049706 | Ga0501229_000077 | Ga0501229_000077_2560_3729 | 386 |
| 1141 | 3300049741 | Ga0501079_0018533 | Ga0501079_0018533_826_1992 | 386 |
| 1142 | 3300049742 | Ga0501080_0000997 | Ga0501080_0000997_17232_18398 | 386 |
| 1143 | 3300049742 | Ga0501080_0004536 | Ga0501080_0004536_2373_3536 | 386 |
| 1144 | 3300049742 | Ga0501080_0011327 | Ga0501080_0011327_724_1890 | 386 |
| 1145 | 3300049742 | Ga0501080_0017413 | Ga0501080_0017413_1007_2170 | 386 |
| 1146 | 3300049742 | Ga0501080_0133574 | Ga0501080_0133574_462_1622 | 386 |
| 1147 | 3300049744 | Ga0501083_0001097 | Ga0501083_0001097_14672_15838 | 386 |
| 1148 | 3300049764 | Ga0501267_001243 | Ga0501267_001243_546_1715 | 386 |
| 1149 | 3300049778 | Ga0501282_003805 | Ga0501282_003805_402_1571 | 386 |
| 1150 | 3300049822 | Ga0501035_0055098 | Ga0501035_0055098_2299_3465 | 386 |
| 1151 | 3300049822 | Ga0501035_0180379 | Ga0501035_0180379_603_1763 | 386 |
| 1152 | 3300049823 | Ga0501044_0003235 | Ga0501044_0003235_263_1426 | 386 |
| 1153 | 3300049823 | Ga0501044_0007762 | Ga0501044_0007762_5182_6348 | 386 |
| 1154 | 3300049823 | Ga0501044_0320591 | Ga0501044_0320591_212_1378 | 386 |
| 1155 | 3300050489 | nmdc:mga03683_2992_c1 | nmdc:mga03683_2992_c1_3459_4625 | 386 |
| 1156 | 3300050493 | nmdc:mga0k408_10407_c1 | nmdc:mga0k408_10407_c1_1502_2668 | 386 |
| 1157 | 3300050493 | nmdc:mga0k408_10582_c1 | nmdc:mga0k408_10582_c1_1522_2688 | 386 |
| 1158 | 3300050493 | nmdc:mga0k408_20025_c1 | nmdc:mga0k408_20025_c1_212_1378 | 386 |
| 1159 | 3300050494 | nmdc:mga06z11_37238_c1 | nmdc:mga06z11_37238_c1_1222_2388 | 386 |
| 1160 | 3300050496 | nmdc:mga07m45_10280_c1 | nmdc:mga07m45_10280_c1_2217_3383 | 386 |
| 1161 | 3300050496 | nmdc:mga07m45_44945_c1 | nmdc:mga07m45_44945_c1_677_1843 | 386 |
| 1162 | 3300053086 | Ga0500578_0000075 | Ga0500578_0000075_40630_41796 | 386 |
| 1163 | 3300053148 | Ga0500590_005767 | Ga0500590_005767_381_1547 | 386 |
| 1164 | 3300053156 | Ga0500622_0003844 | Ga0500622_0003844_49_1218 | 386 |
| 1165 | 3300059421 | Ga0590071_001475 | Ga0590071_001475_2901_4067 | 386 |
| 1166 | 3300060353 | Ga0501082_0005091 | Ga0501082_0005091_3817_4983 | 386 |
| 1167 | 3300061719 | Ga0466962_0006825 | Ga0466962_0006825_1366_2532 | 386 |
| 1168 | 3300001904 | JGI24736J21556_1002726 | JGI24736J21556_10027262 | 388 |
| 1169 | 3300005262 | Ga0065165_1000913 | Ga0065165_100091326 | 388 |
| 1170 | 3300013105 | Ga0157369_10006716 | Ga0157369_100067167 | 388 |
| 1171 | 3300025229 | Ga0209147_105652 | Ga0209147_1056522 | 388 |
| 1172 | 3300025302 | Ga0207426_1023974 | Ga0207426_10239743 | 388 |
| 1173 | 3300025303 | Ga0209051_1004509 | Ga0209051_10045096 | 388 |
| 1174 | 3300025904 | Ga0207647_10000015 | Ga0207647_1000001584 | 388 |
| 1175 | 3300046507 | Ga0495606_0000301 | Ga0495606_0000301_57474_58640 | 388 |
| 1176 | 3300047472 | Ga0495686_0000024 | Ga0495686_0000024_328200_329366 | 388 |
| 1177 | 3300047472 | Ga0495686_0000409 | Ga0495686_0000409_37207_38373 | 388 |
| 1178 | 3300048920 | Ga0496117_0038495 | Ga0496117_0038495_1047_2213 | 388 |
| 1179 | 3300048921 | Ga0496118_0001013 | Ga0496118_0001013_5211_6377 | 388 |
| 1180 | 3300048921 | Ga0496118_0001137 | Ga0496118_0001137_184_1350 | 388 |
| 1181 | 3300048924 | Ga0496121_0000109 | Ga0496121_0000109_42264_43430 | 388 |
| 1182 | 3300048925 | Ga0496122_0051113 | Ga0496122_0051113_1304_2470 | 388 |
| 1183 | 3300048926 | Ga0496123_0021372 | Ga0496123_0021372_3497_4663 | 388 |
| 1184 | 3300048928 | Ga0496125_0007510 | Ga0496125_0007510_4047_5213 | 388 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7w7c-assembly1.cif.gz_B-2 | heme exporter in the unliganded form | 0.7616 | 263 | 385 |
| 7oat-assembly1.cif.gz_B | structural basis for targeted p97 remodelling by aspl as prerequisite for p97 trimethylation by mettl21d | 0.7091 | 129 | 199 |
| 5f9q-assembly1.cif.gz_A | crystal structure of the extracellular domain of noncanonic abc-type transporter yknz from gram-positive bacteria | 0.7038 | 53 | 244 |
| 8tzj-assembly1.cif.gz_D | cryo-em structure of vibrio cholerae ftse/ftsx complex | 0.6973 | 247 | 381 |
| 5f9q-assembly1.cif.gz_A | crystal structure of the extracellular domain of noncanonic abc-type transporter yknz from gram-positive bacteria | 0.6969 | 53 | 244 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2b0gA00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain | 0.7213 | 208 | 244 | 3.30.70.330 |
| af_Q21322_125_206_3.30.70.330 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain | 0.718 | 210 | 244 | 3.30.70.330 |
| af_Q8I3T1_44_150_3.30.70.330 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain | 0.7147 | 206 | 252 | 3.30.70.330 |
| af_Q54HN5_852_956_3.30.70.330 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain | 0.7068 | 207 | 244 | 3.30.70.330 |
| af_Q5AGV4_31_131_3.30.70.330 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain | 0.7038 | 207 | 250 | 3.30.70.330 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1B5DAU1-F1-model_v4 | ABC3 transporter permease C-terminal domain-containing protein | 0.9081 | 2 | 378 |
GO:0005886
|
| AF-A0A1B5DAU1-F1-model_v4 | ABC3 transporter permease C-terminal domain-containing protein | 0.89 | 2 | 378 |
GO:0005886
|
| AF-A0A6L7N2S5-F1-model_v4 | FtsX-like permease family protein | 0.8835 | 1 | 388 |
GO:0005886
|
| AF-A0A6L7XSH9-F1-model_v4 | ABC transporter permease | 0.8785 | 59 | 388 |
GO:0005886
|
| AF-A0A368C7Z6-F1-model_v4 | ABC3 transporter permease C-terminal domain-containing protein | 0.876 | 3 | 388 |
GO:0005886
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar