F491357

General Info

Members Datasets Scaffolds Average Seq Length
1184 457 1142 376

Family's Representative Sequence

Representative Sequence 3300048918|Ga0496115_0017672|Ga0496115_0017672_1048_2520
Length 431
Sequence MKYLHLIWAALFRRKTRTILTLVSIVAAFLLFGMLDAVRSGFDQAGKSANGAQRLQTGSRLSFIQTLPQGLGAQIAQVPGVKSVAYANWFGGAYQDPHNQIFSFAVSDNYIDQYPELDVSPDARKSYETTRTGILIGEQLAKKYGWKVGDKIPLQSTIFPLHDGTKNWSFDVVGIMHAKDKSAGWYDQMILMHWKYFDDSTPYNHGTVGWYVSRVNDVNQADRVAKGIDALSANSDHETRTQTEQAASAAWMKQLADIGLIVGSIMGAVFFTLLLLSGNTMMQAVRERTSELAVMKTIGFSSHSVLAMVLAESVLLLLLGGVIGLGLAMLAVGGMQTAMGGGVPMSTIGADIWIRGVLLMVVIGLLVGALPGLRAMRLNIVDALAGRLGAHHEISAESGFIAVARGGCVGHAGGLARDGRRLCRDAGENRQ

Samples

Sample ID Description Type Environment
1 2537561836 Rhodanobacter spathiphylli B39 Isolate Unclassified
2 2593339238 Luteibacter sp. UNCMF366Tsu5.1 Isolate Unclassified
3 2593339239 Luteibacter sp. UNCMF331Sha3.1 Isolate Unclassified
4 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
5 2643221562 Rhodanobacter sp. Root561 Isolate Unclassified
6 2643221577 Rhodanobacter sp. Root627 Isolate Unclassified
7 2643221585 Pelomonas sp. Root662 Isolate Unclassified
8 2643221593 Lysobacter sp. Root690 Isolate Unclassified
9 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
10 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
11 2643221656 Pelomonas sp. Root405 Isolate Unclassified
12 2643221685 Rhodanobacter sp. Root480 Isolate Unclassified
13 2643221695 Lysobacter sp. Root494 Isolate Unclassified
14 2687453130 Dyella thiooxydans ATSB10 Isolate Unclassified
15 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere
16 2734482264 Dyella sp. AD052 Isolate Unclassified
17 2738541337 Pelomonas sp. BT06 Isolate Unclassified
18 2738543009 Luteibacter sp. OK325 Isolate Unclassified
19 2739367700 Dyella sp. YR388 Isolate Unclassified
20 2818991440 Luteibacter yeojuensis 583 Isolate Unclassified
21 2831864461 Roseateles noduli HZ7 Isolate Nodule
22 2842780639 Pseudoxanthomonas sp. R-71986 Isolate Unclassified
23 2842914999 Luteibacter sp. R-72151 Isolate Unclassified
24 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
25 2884338543 Luteibacter pinisoli MAH-14 Isolate Rhizosphere
26 2884411467 Dyella sp. AD56 Isolate Rhizosphere
27 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
28 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere
29 2895395659 Rhodanobacter sp. T12-5 Isolate Unclassified
30 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
31 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
32 2895522137 Pseudoxanthomonas sp. SGNA-20 Isolate Rhizosphere
33 2895525241 Pseudoxanthomonas sp. SGT-18 Isolate Rhizosphere
34 2904463128 Luteibacter yeojuensis 3191 Isolate Unclassified
35 2919085039 Luteibacter sp. 1214 Isolate Unclassified
36 2919404418 Luteibacter sp. 3190 Isolate Unclassified
37 2928963466 Dyella japonica 1073 Isolate Unclassified
38 2939611941 Rhodanobacter soli 1757 Isolate Rhizosphere
39 2941471342 Luteibacter sp. 621 Isolate Unclassified
40 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere
41 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified
42 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
43 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
44 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
45 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
46 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
47 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
48 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
49 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
50 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
51 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
52 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
53 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
54 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
55 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
56 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
57 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
58 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
59 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
60 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
61 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
62 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
63 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
64 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
65 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
66 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
67 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
68 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
69 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
70 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
71 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
72 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
73 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
74 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
75 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
76 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
77 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
78 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
79 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
80 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
81 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
82 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
83 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
84 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
85 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
86 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
87 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
88 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
89 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
90 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
91 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
92 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
93 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
94 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
95 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
96 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
97 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
98 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
99 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
100 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
101 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
102 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
103 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
104 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
105 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
106 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
107 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
108 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
109 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
110 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
111 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
112 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
113 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
114 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
115 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
116 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
117 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
118 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
119 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
120 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
121 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
122 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
123 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
124 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
125 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
126 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
127 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
128 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
129 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
130 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
131 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
132 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
133 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
134 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
135 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
136 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
137 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
138 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
139 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
140 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
141 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
142 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
143 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
144 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
145 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
146 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
147 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
148 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
149 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
150 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
151 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
152 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
153 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
154 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
155 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
156 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
157 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
158 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
159 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
160 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
161 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
162 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
163 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
164 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
165 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
166 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
167 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
168 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
169 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
170 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
171 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
172 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
173 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
174 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
175 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
176 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
177 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
178 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
179 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
180 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
181 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
182 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
183 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
184 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
185 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
186 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
187 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
188 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
189 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
190 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
191 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
192 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
193 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
194 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
195 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
196 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
197 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
198 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
199 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
200 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
201 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
202 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
203 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
204 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
246 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
247 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
248 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
249 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
250 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
251 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
252 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
253 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
254 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
255 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
256 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
257 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
259 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
260 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
261 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
262 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
263 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
264 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
265 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
266 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
267 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
268 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
269 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
270 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
271 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
272 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
273 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
274 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
275 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
276 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
277 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
278 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
279 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
280 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
281 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
282 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
283 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
284 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
285 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
286 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
287 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
288 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
289 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
290 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
291 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
292 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
293 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
294 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
295 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
296 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
297 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
298 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
299 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
300 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
301 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
302 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
303 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
304 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
305 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
306 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
307 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
308 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
309 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
310 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
311 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
312 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
313 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
314 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
315 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
316 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
317 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
318 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
319 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
320 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
321 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
322 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
323 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
324 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
325 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
326 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
327 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
328 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
329 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
330 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
331 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
332 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
333 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
334 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
335 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
336 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
337 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
338 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
339 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
340 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
341 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
342 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
343 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
344 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
345 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
346 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
347 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
348 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
349 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
350 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
351 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
352 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
353 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
354 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
355 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
356 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
357 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
358 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
359 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
360 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
361 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
362 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
363 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
364 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
365 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
366 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
367 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
368 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
369 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
370 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
371 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
372 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
373 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
374 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
375 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
376 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
377 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
378 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
379 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
380 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
381 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
382 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
383 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
384 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
385 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
386 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
387 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
388 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
389 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
390 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
391 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
392 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
393 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
394 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
395 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
396 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
397 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
398 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
399 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
400 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
401 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
402 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
403 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
404 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
405 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
406 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
407 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
408 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
409 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
410 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
411 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
412 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
413 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
414 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
415 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
416 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
417 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
418 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
419 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
420 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
421 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
422 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
423 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
424 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
425 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
426 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
427 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
428 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
429 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
430 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
431 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
432 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
433 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
434 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
435 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
436 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
437 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
438 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
439 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
440 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
441 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
442 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
443 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
444 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
445 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
446 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
447 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
448 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
449 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
450 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
451 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
452 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
453 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
454 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
455 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
456 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
457 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.03
Metatranscriptomes 0.42
Isolates 3.55

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.29
Nodule 0.17
Rhizoplane 2.7
Rhizosphere 71.54
Stem 0
Stem Tuber 0
Unclassified 10.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1002726 3300001904 Bacteria 3093
2 JGI24741J21665_1000441 3300001915 Bacteria 12554
3 JGI24741J21665_1001154 3300001915 Bacteria 7794
4 JGI24740J21852_10003893 3300001979 Bacteria 6481
5 JGI24740J21852_10012965 3300001979 Bacteria 3128
6 JGI24739J22299_10000815 3300001989 Bacteria 11424
7 JGI24737J22298_10002520 3300001990 Bacteria 6502
8 JGI24735J21928_10013053 3300002067 Bacteria 2617
9 JGI24738J21930_10000426 3300002075 Bacteria 11867
10 JGI25156J39149_1000042 3300002705 Bacteria 105742
11 JGI25156J39149_1001496 3300002705 Bacteria 9754
12 JGI25156J39149_1003775 3300002705 Bacteria 4834
13 JGI25156J39149_1009947 3300002705 Bacteria 2272
14 JGI25162J39368_1000360 3300002737 Bacteria 38829
15 JGI25162J39368_1000444 3300002737 Bacteria 32899
16 JGI25162J39368_1001953 3300002737 Bacteria 9286
17 JGI25162J39368_1004448 3300002737 Bacteria 3240
18 JGI25162J39368_1004638 3300002737 Bacteria 3091
19 JGI25154J39366_1006572 3300002738 Bacteria 1685
20 JGI25157J39369_1000261 3300002741 Bacteria 38842
21 JGI25157J39369_1001047 3300002741 Bacteria 12626
22 JGI25157J39369_1001381 3300002741 Bacteria 9405
23 JGI25157J39369_1001598 3300002741 Bacteria 7940
24 JGI25157J39369_1002080 3300002741 Bacteria 5695
25 JGI25163J39215_1000788 3300002771 Bacteria 7706
26 JGI25164J39214_1000024 3300002772 Bacteria 165608
27 JGI25164J39214_1000238 3300002772 Bacteria 41946
28 JGI25164J39214_1000294 3300002772 Bacteria 34889
29 JGI25164J39214_1002185 3300002772 Bacteria 3241
30 JGI25164J39214_1003814 3300002772 Bacteria 1829
31 JGI25152J39213_1002091 3300002773 Bacteria 7847
32 JGI25151J46595_10000102 3300003187 Bacteria 114881
33 JGI25165J46597_1000162 3300003214 Bacteria 105332
34 JGI25165J46597_1000301 3300003214 Bacteria 62011
35 JGI25165J46597_1001869 3300003214 Bacteria 8646
36 JGI25165J46597_1003708 3300003214 Bacteria 3636
37 JGI25165J46597_1008766 3300003214 Bacteria 1563
38 JGI25153J46596_10005179 3300003215 Bacteria 6864
39 JGI25153J46596_10018263 3300003215 Bacteria 2732
40 rootH1_10001043 3300003316 Bacteria 4199
41 rootH2_10011229 3300003320 Bacteria 34952
42 rootH2_10011597 3300003320 Bacteria 8197
43 rootH2_10098227 3300003320 Bacteria 3589
44 rootL2_10007947 3300003322 Bacteria 5954
45 rootL2_10043721 3300003322 Bacteria 9174
46 rootH1_10058324 3300003323 Bacteria 7331
47 Ga0006562J51391_1010474 3300003578 Bacteria 5410
48 Ga0006562J51391_1010475 3300003578 Bacteria 12720
49 Ga0006562J51391_1030224 3300003578 Bacteria 6750
50 Ga0006562J51391_1030226 3300003578 Bacteria 4445
51 Ga0055538_1000543 3300003751 Bacteria 13189
52 Ga0055533_1000449 3300003756 Bacteria 15629
53 Ga0055533_1003406 3300003756 Bacteria 3208
54 Ga0055525_1000038 3300003759 Bacteria 297540
55 Ga0055525_1000055 3300003759 Bacteria 215181
56 Ga0055527_1000137 3300003760 Bacteria 52010
57 Ga0055527_1000145 3300003760 Bacteria 50249
58 Ga0055527_1000889 3300003760 Bacteria 7634
59 Ga0055535_1000112 3300003761 Bacteria 87296
60 Ga0055535_1000301 3300003761 Bacteria 50253
61 Ga0055535_1000434 3300003761 Bacteria 38842
62 Ga0055535_1000471 3300003761 Bacteria 36908
63 Ga0055535_1000475 3300003761 Bacteria 36547
64 Ga0055535_1003984 3300003761 Bacteria 3839
65 Ga0055535_1012683 3300003761 Bacteria 1275
66 Ga0055542_1000154 3300003762 Bacteria 87295
67 Ga0055542_1000157 3300003762 Bacteria 85679
68 Ga0055542_1000213 3300003762 Bacteria 70811
69 Ga0055542_1000332 3300003762 Bacteria 50253
70 Ga0055542_1000440 3300003762 Bacteria 39725
71 Ga0055542_1000453 3300003762 Bacteria 38829
72 Ga0055529_1000120 3300003763 Bacteria 115533
73 Ga0055529_1000244 3300003763 Bacteria 66990
74 Ga0055529_1000268 3300003763 Bacteria 61988
75 Ga0055529_1000389 3300003763 Bacteria 47286
76 Ga0055526_1000014 3300003771 Bacteria 233327
77 Ga0055526_1002801 3300003771 Bacteria 11550
78 Ga0055537_1000059 3300003773 Bacteria 79628
79 Ga0055524_1000019 3300003775 Bacteria 233561
80 Ga0055524_1001969 3300003775 Bacteria 11002
81 Ga0055524_1003647 3300003775 Bacteria 7395
82 Ga0055536_1000126 3300003781 Bacteria 65482
83 Ga0055534_1000012 3300003784 Bacteria 153530
84 Ga0055528_1000007 3300003790 Bacteria 233327
85 Ga0055530_10000132 3300003791 Bacteria 65482
86 Ga0055530_10011347 3300003791 Bacteria 3205
87 Ga0055540_1010072 3300003792 Bacteria 3181
88 Ga0055531_10000043 3300003794 Bacteria 133906
89 Ga0055531_10000296 3300003794 Bacteria 49725
90 Ga0055531_10003901 3300003794 Bacteria 9313
91 Ga0055531_10005579 3300003794 Bacteria 7342
92 Ga0065165_1000390 3300005262 Bacteria 71262
93 Ga0065165_1000913 3300005262 Bacteria 38106
94 Ga0065165_1001585 3300005262 Bacteria 23411
95 Ga0065165_1003978 3300005262 Bacteria 9673
96 Ga0065715_10032017 3300005293 Bacteria 1454
97 Ga0070658_10021209 3300005327 Bacteria 5204
98 Ga0070658_10041437 3300005327 Bacteria 3715
99 Ga0070683_100027493 3300005329 Bacteria 5130
100 Ga0070683_100318764 3300005329 Bacteria 1479
101 Ga0070670_100017151 3300005331 Bacteria 6213
102 Ga0070670_100035638 3300005331 Bacteria 4283
103 Ga0070670_100049297 3300005331 Bacteria 3620
104 Ga0070670_100142388 3300005331 Bacteria 2074
105 Ga0070666_10001529 3300005335 Bacteria 14037
106 Ga0070680_100000540 3300005336 Bacteria 25851
107 Ga0070680_100002649 3300005336 Bacteria 13276
108 Ga0070680_100005739 3300005336 Bacteria 9419
109 Ga0070680_100147204 3300005336 Bacteria 1976
110 Ga0070680_100201847 3300005336 Bacteria 1677
111 Ga0070682_100003845 3300005337 Bacteria 8336
112 Ga0070682_100049525 3300005337 Bacteria 2619
113 Ga0070682_100155219 3300005337 Bacteria 1575
114 Ga0068868_100003427 3300005338 Bacteria 11038
115 Ga0068868_100086379 3300005338 Bacteria 2521
116 Ga0068868_100219334 3300005338 Bacteria 1592
117 Ga0070660_100002464 3300005339 Bacteria 12694
118 Ga0070660_100037085 3300005339 Bacteria 3695
119 Ga0070660_100059049 3300005339 Bacteria 2974
120 Ga0070660_100115769 3300005339 Bacteria 2137
121 Ga0070689_100001481 3300005340 Bacteria 14978
122 Ga0070691_10127066 3300005341 Bacteria 1288
123 Ga0070661_100006668 3300005344 Bacteria 7963
124 Ga0070661_100024987 3300005344 Bacteria 4289
125 Ga0070661_100059230 3300005344 Bacteria 2807
126 Ga0070661_100141296 3300005344 Bacteria 1815
127 Ga0070661_100165178 3300005344 Bacteria 1678
128 Ga0070692_10058924 3300005345 Bacteria 2017
129 Ga0070668_100029459 3300005347 Bacteria 4170
130 Ga0070668_100191115 3300005347 Bacteria 1677
131 Ga0070671_100091014 3300005355 Bacteria 2554
132 Ga0070673_100188302 3300005364 Bacteria 1771
133 Ga0070659_100004826 3300005366 Bacteria 9635
134 Ga0070659_100012735 3300005366 Bacteria 6242
135 Ga0070659_100014938 3300005366 Bacteria 5808
136 Ga0070659_100018494 3300005366 Bacteria 5258
137 Ga0070659_100052813 3300005366 Bacteria 3197
138 Ga0070659_100232269 3300005366 Bacteria 1524
139 Ga0070659_100276202 3300005366 Bacteria 1397
140 Ga0070667_100000049 3300005367 Bacteria 158483
141 Ga0070667_100003453 3300005367 Bacteria 13463
142 Ga0070667_100050353 3300005367 Bacteria 3510
143 Ga0070667_100211434 3300005367 Bacteria 1724
144 Ga0070709_10001289 3300005434 Bacteria 13701
145 Ga0070714_100000119 3300005435 Bacteria 63055
146 Ga0070714_100000780 3300005435 Bacteria 22603
147 Ga0070714_100042401 3300005435 Bacteria 3844
148 Ga0070713_100000758 3300005436 Bacteria 20669
149 Ga0070711_100167624 3300005439 Bacteria 1671
150 Ga0070663_100000512 3300005455 Bacteria 20499
151 Ga0070663_100005144 3300005455 Bacteria 7744
152 Ga0070663_100010241 3300005455 Bacteria 5841
153 Ga0070663_100010925 3300005455 Bacteria 5674
154 Ga0070663_100014972 3300005455 Bacteria 4989
155 Ga0070663_100020804 3300005455 Bacteria 4349
156 Ga0070663_100057779 3300005455 Bacteria 2784
157 Ga0070678_100204557 3300005456 Bacteria 1632
158 Ga0070662_100009973 3300005457 Bacteria 6221
159 Ga0070662_100105637 3300005457 Bacteria 2138
160 Ga0070681_10000006 3300005458 Bacteria 169066
161 Ga0070681_10000114 3300005458 Bacteria 59882
162 Ga0070681_10003374 3300005458 Bacteria 14932
163 Ga0070681_10014057 3300005458 Bacteria 7966
164 Ga0070681_10036274 3300005458 Bacteria 4951
165 Ga0068867_100067147 3300005459 Bacteria 2673
166 Ga0070685_10000386 3300005466 Bacteria 26505
167 Ga0070706_100000246 3300005467 Bacteria 66106
168 Ga0070698_100024453 3300005471 Bacteria 6303
169 Ga0070699_100028126 3300005518 Bacteria 4849
170 Ga0070679_100000375 3300005530 Bacteria 37986
171 Ga0070679_100003239 3300005530 Bacteria 14875
172 Ga0070679_100030325 3300005530 Bacteria 5340
173 Ga0070679_100191741 3300005530 Bacteria 2012
174 Ga0070684_100217079 3300005535 Bacteria 1744
175 Ga0068853_100000503 3300005539 Bacteria 26688
176 Ga0068853_100001130 3300005539 Bacteria 18915
177 Ga0068853_100003065 3300005539 Bacteria 12767
178 Ga0068853_100012791 3300005539 Bacteria 6835
179 Ga0068853_100014349 3300005539 Bacteria 6486
180 Ga0068853_100035689 3300005539 Bacteria 4224
181 Ga0068853_100353114 3300005539 Bacteria 1368
182 Ga0070695_100008161 3300005545 Bacteria 6206
183 Ga0070696_100010412 3300005546 Bacteria 6231
184 Ga0070696_100037414 3300005546 Bacteria 3348
185 Ga0070696_100053566 3300005546 Bacteria 2809
186 Ga0070696_100085961 3300005546 Bacteria 2232
187 Ga0070696_100220267 3300005546 Bacteria 1424
188 Ga0070693_100003280 3300005547 Bacteria 7516
189 Ga0070693_100004190 3300005547 Bacteria 6809
190 Ga0070693_100005142 3300005547 Bacteria 6254
191 Ga0070665_100000242 3300005548 Bacteria 90566
192 Ga0070665_100000636 3300005548 Bacteria 47736
193 Ga0070665_100046608 3300005548 Bacteria 4353
194 Ga0070665_100344440 3300005548 Bacteria 1495
195 Ga0070665_100408206 3300005548 Bacteria 1366
196 Ga0068855_100007860 3300005563 Bacteria 12886
197 Ga0068855_100011206 3300005563 Bacteria 10826
198 Ga0068855_100026162 3300005563 Bacteria 6980
199 Ga0068855_100054604 3300005563 Bacteria 4695
200 Ga0068855_100055439 3300005563 Bacteria 4656
201 Ga0068855_100062851 3300005563 Bacteria 4334
202 Ga0068855_100084433 3300005563 Bacteria 3676
203 Ga0068855_100087391 3300005563 Bacteria 3603
204 Ga0068855_100098855 3300005563 Bacteria 3361
205 Ga0068855_100103461 3300005563 Bacteria 3276
206 Ga0068855_100169237 3300005563 Bacteria 2475
207 Ga0070664_100025481 3300005564 Bacteria 4902
208 Ga0068857_100001009 3300005577 Bacteria 21668
209 Ga0068857_100008043 3300005577 Bacteria 9093
210 Ga0068857_100012200 3300005577 Bacteria 7474
211 Ga0068857_100114194 3300005577 Bacteria 2429
212 Ga0068854_100001314 3300005578 Bacteria 14989
213 Ga0068854_100054870 3300005578 Bacteria 2868
214 Ga0068854_100075522 3300005578 Bacteria 2475
215 Ga0068854_100081684 3300005578 Bacteria 2388
216 Ga0068854_100103503 3300005578 Bacteria 2137
217 Ga0068854_100216115 3300005578 Bacteria 1514
218 Ga0068856_100000524 3300005614 Bacteria 42396
219 Ga0068856_100004361 3300005614 Bacteria 14097
220 Ga0068856_100004925 3300005614 Bacteria 13219
221 Ga0068856_100013002 3300005614 Bacteria 8060
222 Ga0068856_100171728 3300005614 Bacteria 2180
223 Ga0068852_100023590 3300005616 Bacteria 4954
224 Ga0068852_100029651 3300005616 Bacteria 4497
225 Ga0068852_100116843 3300005616 Bacteria 2435
226 Ga0068859_100000453 3300005617 Bacteria 40718
227 Ga0068859_100145275 3300005617 Bacteria 2447
228 Ga0068859_100269030 3300005617 Bacteria 1796
229 Ga0068864_100000276 3300005618 Bacteria 45759
230 Ga0068864_100083722 3300005618 Bacteria 2801
231 Ga0068851_10009023 3300005834 Bacteria 4628
232 Ga0068851_10023732 3300005834 Bacteria 3000
233 Ga0068851_10032900 3300005834 Bacteria 2581
234 Ga0068851_10109103 3300005834 Bacteria 1476
235 Ga0068863_100004765 3300005841 Bacteria 13363
236 Ga0068863_100040304 3300005841 Bacteria 4441
237 Ga0068863_100073031 3300005841 Bacteria 3245
238 Ga0068863_100095066 3300005841 Bacteria 2828
239 Ga0068858_100012181 3300005842 Bacteria 8109
240 Ga0068858_100119235 3300005842 Bacteria 2467
241 Ga0068858_100205979 3300005842 Bacteria 1861
242 Ga0068858_100243445 3300005842 Bacteria 1707
243 Ga0068858_100249985 3300005842 Bacteria 1684
244 Ga0068862_100000674 3300005844 Bacteria 34963
245 Ga0081540_1021127 3300005983 Bacteria 3889
246 Ga0070712_100045432 3300006175 Bacteria 3033
247 Ga0070712_100188060 3300006175 Bacteria 1614
248 Ga0075366_10016201 3300006195 Bacteria 4282
249 Ga0097621_100089013 3300006237 Bacteria 2580
250 Ga0097621_100114496 3300006237 Bacteria 2282
251 Ga0075370_10005248 3300006353 Bacteria 6413
252 Ga0075370_10012781 3300006353 Bacteria 4447
253 Ga0075370_10024323 3300006353 Bacteria 3345
254 Ga0075370_10080959 3300006353 Bacteria 1866
255 Ga0068871_100140078 3300006358 Bacteria 2056
256 Ga0068865_100033866 3300006881 Bacteria 3422
257 Ga0097620_100000453 3300006931 Bacteria 40718
258 Ga0097620_100145276 3300006931 Bacteria 2447
259 Ga0097620_100269058 3300006931 Bacteria 1796
260 Ga0099823_1000163 3300006944 Bacteria 35759
261 Ga0099795_10000001 3300007788 Bacteria 179944
262 Ga0105240_10000453 3300009093 Bacteria 75454
263 Ga0105240_10000868 3300009093 Bacteria 54479
264 Ga0105240_10001058 3300009093 Bacteria 48723
265 Ga0105240_10008373 3300009093 Bacteria 14800
266 Ga0105240_10010177 3300009093 Bacteria 13239
267 Ga0105240_10023924 3300009093 Bacteria 8069
268 Ga0105240_10049970 3300009093 Bacteria 5274
269 Ga0105240_10143340 3300009093 Bacteria 2854
270 Ga0105240_10181414 3300009093 Bacteria 2484
271 Ga0105240_10185660 3300009093 Bacteria 2449
272 Ga0105240_10198859 3300009093 Bacteria 2350
273 Ga0105240_10241397 3300009093 Bacteria 2094
274 Ga0105247_10006880 3300009101 Bacteria 7009
275 Ga0105247_10087478 3300009101 Bacteria 1973
276 Ga0105243_10008438 3300009148 Bacteria 7910
277 Ga0105241_10022178 3300009174 Bacteria 4701
278 Ga0105241_10024431 3300009174 Bacteria 4487
279 Ga0105241_10053604 3300009174 Bacteria 3085
280 Ga0105241_10059418 3300009174 Bacteria 2939
281 Ga0105241_10116216 3300009174 Bacteria 2148
282 Ga0105241_10179605 3300009174 Bacteria 1755
283 Ga0105248_10000231 3300009177 Bacteria 64041
284 Ga0105248_10006636 3300009177 Bacteria 12691
285 Ga0105248_10422093 3300009177 Bacteria 1502
286 Ga0105237_10000011 3300009545 Bacteria 307361
287 Ga0105237_10000036 3300009545 Bacteria 191142
288 Ga0105237_10001039 3300009545 Bacteria 37324
289 Ga0105237_10009281 3300009545 Bacteria 10539
290 Ga0105237_10012473 3300009545 Bacteria 8956
291 Ga0105237_10020257 3300009545 Bacteria 6862
292 Ga0105237_10081936 3300009545 Bacteria 3217
293 Ga0105237_10096591 3300009545 Bacteria 2945
294 Ga0105237_10297984 3300009545 Bacteria 1615
295 Ga0105237_10411328 3300009545 Bacteria 1358
296 Ga0105238_10002060 3300009551 Bacteria 20286
297 Ga0105238_10008158 3300009551 Bacteria 10475
298 Ga0105238_10018070 3300009551 Bacteria 7167
299 Ga0105238_10018511 3300009551 Bacteria 7088
300 Ga0105238_10029729 3300009551 Bacteria 5565
301 Ga0105238_10034105 3300009551 Bacteria 5179
302 Ga0105238_10083391 3300009551 Bacteria 3185
303 Ga0105238_10087813 3300009551 Bacteria 3096
304 Ga0105238_10355216 3300009551 Bacteria 1455
305 Ga0105249_10002941 3300009553 Bacteria 14702
306 Ga0105249_10052034 3300009553 Bacteria 3739
307 Ga0105249_10234227 3300009553 Bacteria 1812
308 Ga0099796_10000001 3300010159 Bacteria 107173
309 Ga0105239_10000027 3300010375 Bacteria 248028
310 Ga0105239_10001667 3300010375 Bacteria 29272
311 Ga0105239_10012342 3300010375 Bacteria 9515
312 Ga0105239_10017601 3300010375 Bacteria 7904
313 Ga0105239_10020796 3300010375 Bacteria 7241
314 Ga0105239_10021558 3300010375 Bacteria 7104
315 Ga0105239_10029600 3300010375 Bacteria 6021
316 Ga0105239_10076147 3300010375 Bacteria 3690
317 Ga0105239_10176769 3300010375 Bacteria 2387
318 Ga0157319_1000003 3300012497 Bacteria 397199
319 Ga0157314_1000231 3300012500 Bacteria 6066
320 Ga0157327_1000119 3300012512 Bacteria 3578
321 Ga0157373_10005386 3300013100 Bacteria 9610
322 Ga0157373_10017594 3300013100 Bacteria 5207
323 Ga0157373_10050414 3300013100 Bacteria 2964
324 Ga0157373_10102087 3300013100 Bacteria 2018
325 Ga0157373_10211176 3300013100 Bacteria 1369
326 Ga0157371_10027073 3300013102 Bacteria 4162
327 Ga0157371_10042222 3300013102 Bacteria 3251
328 Ga0157371_10042939 3300013102 Bacteria 3222
329 Ga0157371_10111704 3300013102 Bacteria 1940
330 Ga0157371_10142272 3300013102 Bacteria 1708
331 Ga0157371_10196539 3300013102 Bacteria 1445
332 Ga0157370_10000045 3300013104 Bacteria 127627
333 Ga0157370_10009778 3300013104 Bacteria 10173
334 Ga0157370_10011339 3300013104 Bacteria 9335
335 Ga0157370_10014570 3300013104 Bacteria 8034
336 Ga0157370_10046561 3300013104 Bacteria 4159
337 Ga0157370_10139004 3300013104 Bacteria 2263
338 Ga0157370_10221136 3300013104 Bacteria 1754
339 Ga0157369_10000318 3300013105 Bacteria 64959
340 Ga0157369_10003874 3300013105 Bacteria 17759
341 Ga0157369_10006716 3300013105 Bacteria 13275
342 Ga0157369_10031828 3300013105 Bacteria 5804
343 Ga0157369_10046210 3300013105 Bacteria 4732
344 Ga0157369_10093848 3300013105 Bacteria 3203
345 Ga0157369_10105608 3300013105 Bacteria 2998
346 Ga0157369_10110398 3300013105 Bacteria 2924
347 Ga0157374_10148198 3300013296 Bacteria 2280
348 Ga0157374_10329169 3300013296 Bacteria 1515
349 Ga0163162_10000042 3300013306 Bacteria 131540
350 Ga0163162_10051376 3300013306 Bacteria 4137
351 Ga0163162_10228414 3300013306 Bacteria 1991
352 Ga0163162_10563793 3300013306 Bacteria 1266
353 Ga0157372_10003468 3300013307 Bacteria 17017
354 Ga0157372_10007233 3300013307 Bacteria 11821
355 Ga0157372_10050379 3300013307 Bacteria 4632
356 Ga0157372_10102701 3300013307 Bacteria 3266
357 Ga0157372_10122834 3300013307 Bacteria 2984
358 Ga0157372_10129150 3300013307 Bacteria 2907
359 Ga0157372_10280541 3300013307 Bacteria 1937
360 Ga0157372_10369738 3300013307 Bacteria 1671
361 Ga0157375_10014123 3300013308 Bacteria 7122
362 Ga0157375_10293910 3300013308 Bacteria 1788
363 Ga0157375_10462636 3300013308 Bacteria 1434
364 Ga0157380_10199059 3300014326 Bacteria 1776
365 Ga0182008_10021481 3300014497 Bacteria 3314
366 Ga0182008_10023024 3300014497 Bacteria 3186
367 Ga0157379_10038541 3300014968 Bacteria 4264
368 Ga0157379_10058679 3300014968 Bacteria 3442
369 Ga0182006_1000556 3300015261 Bacteria 27959
370 Ga0182006_1000731 3300015261 Bacteria 22632
371 Ga0182007_10008118 3300015262 Bacteria 4332
372 Ga0182007_10010679 3300015262 Bacteria 3615
373 Ga0182007_10026907 3300015262 Bacteria 1988
374 Ga0182005_1000113 3300015265 Bacteria 58004
375 Ga0182005_1002812 3300015265 Bacteria 6065
376 Ga0183369_1004 3300015685 Bacteria 539301
377 Ga0183368_1003 3300015687 Bacteria 1276390
378 Ga0183360_10002 3300015689 Bacteria 953821
379 Ga0163161_10119818 3300017792 Bacteria 1976
380 Ga0206353_11071570 3300020082 Bacteria 1659
381 Ga0213872_10000044 3300021361 Bacteria 114843
382 Ga0213872_10000125 3300021361 Bacteria 71792
383 Ga0213872_10000284 3300021361 Bacteria 43286
384 Ga0213872_10001189 3300021361 Bacteria 17673
385 Ga0213872_10009785 3300021361 Bacteria 4583
386 Ga0213872_10018969 3300021361 Bacteria 3169
387 Ga0209760_100341 3300025207 Bacteria 13609
388 Ga0209784_100156 3300025224 Bacteria 62150
389 Ga0209674_100033 3300025226 Bacteria 423450
390 Ga0209674_100077 3300025226 Bacteria 206312
391 Ga0209674_100556 3300025226 Bacteria 14827
392 Ga0209674_101279 3300025226 Bacteria 7011
393 Ga0209672_100004 3300025228 Bacteria 1467504
394 Ga0209672_100022 3300025228 Bacteria 374313
395 Ga0209672_100118 3300025228 Bacteria 85928
396 Ga0209672_100204 3300025228 Bacteria 47024
397 Ga0209672_105512 3300025228 Bacteria 2160
398 Ga0209147_105652 3300025229 Bacteria 1838
399 Ga0209563_100005 3300025230 Bacteria 1774893
400 Ga0209563_100076 3300025230 Bacteria 215269
401 Ga0207427_100058 3300025231 Bacteria 192979
402 Ga0207427_100070 3300025231 Bacteria 160908
403 Ga0207427_100133 3300025231 Bacteria 92763
404 Ga0207427_100285 3300025231 Bacteria 36432
405 Ga0207427_102685 3300025231 Bacteria 4482
406 Ga0207427_102846 3300025231 Bacteria 4179
407 Ga0209437_100005 3300025233 Bacteria 1071596
408 Ga0209437_100059 3300025233 Bacteria 355048
409 Ga0209437_100141 3300025233 Bacteria 166553
410 Ga0209437_100142 3300025233 Bacteria 165628
411 Ga0209437_100303 3300025233 Bacteria 68428
412 Ga0209437_102792 3300025233 Bacteria 3281
413 Ga0209437_104557 3300025233 Bacteria 2429
414 Ga0209258_100003 3300025242 Bacteria 1467504
415 Ga0209258_100004 3300025242 Bacteria 1376422
416 Ga0209258_100034 3300025242 Bacteria 437372
417 Ga0209258_100122 3300025242 Bacteria 180314
418 Ga0209258_100158 3300025242 Bacteria 156881
419 Ga0209258_100564 3300025242 Bacteria 32099
420 Ga0209258_101959 3300025242 Bacteria 6003
421 Ga0207425_1002775 3300025245 Bacteria 5949
422 Ga0209646_1002061 3300025246 Bacteria 4746
423 Ga0209646_1002602 3300025246 Bacteria 3891
424 Ga0209646_1003394 3300025246 Bacteria 3158
425 Ga0209646_1005145 3300025246 Bacteria 2311
426 Ga0209026_1000017 3300025250 Bacteria 385214
427 Ga0209026_1000087 3300025250 Bacteria 184044
428 Ga0209026_1000269 3300025250 Bacteria 62546
429 Ga0209026_1000671 3300025250 Bacteria 20709
430 Ga0209026_1000944 3300025250 Bacteria 14626
431 Ga0209677_103496 3300025253 Bacteria 5049
432 Ga0209148_1000001 3300025254 Bacteria 2545271
433 Ga0209148_1000002 3300025254 Bacteria 2399500
434 Ga0209148_1000025 3300025254 Bacteria 663262
435 Ga0209148_1000062 3300025254 Bacteria 347704
436 Ga0209148_1000083 3300025254 Bacteria 270142
437 Ga0209148_1000092 3300025254 Bacteria 249076
438 Ga0209148_1001448 3300025254 Bacteria 12048
439 Ga0209759_1000299 3300025256 Bacteria 68401
440 Ga0209759_1000503 3300025256 Bacteria 42712
441 Ga0209759_1000915 3300025256 Bacteria 21851
442 Ga0209759_1002563 3300025256 Bacteria 7871
443 Ga0209759_1012258 3300025256 Bacteria 2385
444 Ga0209759_1012781 3300025256 Bacteria 2306
445 Ga0209129_1000697 3300025258 Bacteria 22024
446 Ga0209129_1004673 3300025258 Bacteria 5226
447 Ga0209233_1000002 3300025261 Bacteria 2501366
448 Ga0209233_1000011 3300025261 Bacteria 1071611
449 Ga0209233_1000141 3300025261 Bacteria 192978
450 Ga0209233_1000273 3300025261 Bacteria 73280
451 Ga0209233_1005102 3300025261 Bacteria 4393
452 Ga0209565_1000001 3300025263 Bacteria 2950419
453 Ga0209565_1011717 3300025263 Bacteria 2121
454 Ga0209455_1000004 3300025272 Bacteria 1467504
455 Ga0209455_1000040 3300025272 Bacteria 430197
456 Ga0209455_1000054 3300025272 Bacteria 358936
457 Ga0209455_1000084 3300025272 Bacteria 253164
458 Ga0209455_1000318 3300025272 Bacteria 47836
459 Ga0209673_1000001 3300025273 Bacteria 3176258
460 Ga0209673_1008915 3300025273 Bacteria 4410
461 Ga0209675_1000001 3300025291 Bacteria 2950293
462 Ga0209676_1000011 3300025292 Bacteria 860463
463 Ga0209676_1004340 3300025292 Bacteria 7950
464 Ga0209025_1000006 3300025294 Bacteria 1153444
465 Ga0209025_1011481 3300025294 Bacteria 5828
466 Ga0209564_1000001 3300025295 Bacteria 3176258
467 Ga0209564_1000051 3300025295 Bacteria 357748
468 Ga0209758_1000096 3300025297 Bacteria 231496
469 Ga0209758_1002225 3300025297 Bacteria 20148
470 Ga0209758_1005359 3300025297 Bacteria 9945
471 Ga0209758_1023075 3300025297 Bacteria 2828
472 Ga0209050_1000032 3300025298 Bacteria 456335
473 Ga0209050_1001300 3300025298 Bacteria 28170
474 Ga0209050_1006165 3300025298 Bacteria 7210
475 Ga0209256_1000006 3300025299 Bacteria 1250310
476 Ga0209256_1000675 3300025299 Bacteria 46128
477 Ga0209256_1004060 3300025299 Bacteria 9517
478 Ga0209256_1010216 3300025299 Bacteria 3966
479 Ga0207426_1023974 3300025302 Bacteria 2076
480 Ga0209051_1000382 3300025303 Bacteria 62931
481 Ga0209051_1000981 3300025303 Bacteria 27697
482 Ga0209051_1004509 3300025303 Bacteria 8546
483 Ga0209051_1004799 3300025303 Bacteria 8153
484 Ga0209257_1000014 3300025304 Bacteria 946850
485 Ga0209257_1000182 3300025304 Bacteria 156672
486 Ga0209257_1000414 3300025304 Bacteria 82489
487 Ga0209257_1002753 3300025304 Bacteria 16625
488 Ga0209257_1003470 3300025304 Bacteria 13469
489 Ga0207656_10003708 3300025321 Bacteria 5287
490 Ga0207656_10025795 3300025321 Bacteria 2390
491 Ga0207680_10000002 3300025903 Bacteria 1018646
492 Ga0207647_10000015 3300025904 Bacteria 138626
493 Ga0207647_10000066 3300025904 Bacteria 81782
494 Ga0207647_10002322 3300025904 Bacteria 14453
495 Ga0207647_10041012 3300025904 Bacteria 2913
496 Ga0207647_10047939 3300025904 Bacteria 2655
497 Ga0207647_10088879 3300025904 Bacteria 1844
498 Ga0207699_10001222 3300025906 Bacteria 12185
499 Ga0207699_10134903 3300025906 Bacteria 1615
500 Ga0207645_10036201 3300025907 Bacteria 3169
501 Ga0207705_10001071 3300025909 Bacteria 22220
502 Ga0207705_10007229 3300025909 Bacteria 8173
503 Ga0207705_10056409 3300025909 Bacteria 2832
504 Ga0207705_10083746 3300025909 Bacteria 2327
505 Ga0207684_10002337 3300025910 Bacteria 19212
506 Ga0207654_10000251 3300025911 Bacteria 32477
507 Ga0207654_10104133 3300025911 Bacteria 1754
508 Ga0207707_10000095 3300025912 Bacteria 89126
509 Ga0207707_10000230 3300025912 Bacteria 60267
510 Ga0207707_10000245 3300025912 Bacteria 59259
511 Ga0207707_10000869 3300025912 Bacteria 29531
512 Ga0207707_10001440 3300025912 Bacteria 22021
513 Ga0207707_10017761 3300025912 Bacteria 6203
514 Ga0207707_10022905 3300025912 Bacteria 5463
515 Ga0207707_10159737 3300025912 Bacteria 1971
516 Ga0207707_10301994 3300025912 Bacteria 1384
517 Ga0207707_10345262 3300025912 Bacteria 1283
518 Ga0207695_10000172 3300025913 Bacteria 190573
519 Ga0207695_10000441 3300025913 Bacteria 90937
520 Ga0207695_10000743 3300025913 Bacteria 63072
521 Ga0207695_10000938 3300025913 Bacteria 52009
522 Ga0207695_10002199 3300025913 Bacteria 29371
523 Ga0207695_10002388 3300025913 Bacteria 27843
524 Ga0207695_10003102 3300025913 Bacteria 23788
525 Ga0207695_10009353 3300025913 Bacteria 12118
526 Ga0207695_10012023 3300025913 Bacteria 10412
527 Ga0207695_10014719 3300025913 Bacteria 9251
528 Ga0207695_10137445 3300025913 Bacteria 2396
529 Ga0207695_10238901 3300025913 Bacteria 1719
530 Ga0207671_10000011 3300025914 Bacteria 530349
531 Ga0207671_10001404 3300025914 Bacteria 28043
532 Ga0207671_10021933 3300025914 Bacteria 4838
533 Ga0207671_10053665 3300025914 Bacteria 2987
534 Ga0207671_10074315 3300025914 Bacteria 2540
535 Ga0207671_10158134 3300025914 Bacteria 1754
536 Ga0207671_10224729 3300025914 Bacteria 1471
537 Ga0207663_10101765 3300025916 Bacteria 1931
538 Ga0207660_10000084 3300025917 Bacteria 49904
539 Ga0207660_10002081 3300025917 Bacteria 13255
540 Ga0207660_10006573 3300025917 Bacteria 7545
541 Ga0207657_10007064 3300025919 Bacteria 11534
542 Ga0207657_10039214 3300025919 Bacteria 4211
543 Ga0207657_10040416 3300025919 Bacteria 4132
544 Ga0207657_10054162 3300025919 Bacteria 3471
545 Ga0207657_10063548 3300025919 Bacteria 3155
546 Ga0207657_10073706 3300025919 Bacteria 2884
547 Ga0207649_10007325 3300025920 Bacteria 6005
548 Ga0207649_10009430 3300025920 Bacteria 5340
549 Ga0207649_10010983 3300025920 Bacteria 4981
550 Ga0207649_10012746 3300025920 Bacteria 4674
551 Ga0207649_10128437 3300025920 Bacteria 1718
552 Ga0207652_10000318 3300025921 Bacteria 49778
553 Ga0207652_10000560 3300025921 Bacteria 37572
554 Ga0207652_10001869 3300025921 Bacteria 18289
555 Ga0207652_10023320 3300025921 Bacteria 5125
556 Ga0207694_10000253 3300025924 Bacteria 50728
557 Ga0207694_10000308 3300025924 Bacteria 45953
558 Ga0207694_10002841 3300025924 Bacteria 13972
559 Ga0207694_10008890 3300025924 Bacteria 7581
560 Ga0207694_10031103 3300025924 Bacteria 4076
561 Ga0207694_10041392 3300025924 Bacteria 3550
562 Ga0207694_10188381 3300025924 Bacteria 1675
563 Ga0207650_10048590 3300025925 Bacteria 3130
564 Ga0207700_10009061 3300025928 Bacteria 6196
565 Ga0207664_10000090 3300025929 Bacteria 84944
566 Ga0207664_10000358 3300025929 Bacteria 33535
567 Ga0207690_10002773 3300025932 Bacteria 10581
568 Ga0207690_10003291 3300025932 Bacteria 9675
569 Ga0207690_10005359 3300025932 Bacteria 7559
570 Ga0207690_10010328 3300025932 Bacteria 5543
571 Ga0207690_10011576 3300025932 Bacteria 5269
572 Ga0207690_10015169 3300025932 Bacteria 4665
573 Ga0207690_10029644 3300025932 Bacteria 3482
574 Ga0207690_10178563 3300025932 Bacteria 1596
575 Ga0207706_10012788 3300025933 Bacteria 7640
576 Ga0207706_10037330 3300025933 Bacteria 4315
577 Ga0207706_10038523 3300025933 Bacteria 4240
578 Ga0207706_10041359 3300025933 Bacteria 4086
579 Ga0207706_10135429 3300025933 Bacteria 2167
580 Ga0207686_10057224 3300025934 Bacteria 2454
581 Ga0207709_10008092 3300025935 Bacteria 5824
582 Ga0207670_10083824 3300025936 Bacteria 2237
583 Ga0207704_10100432 3300025938 Bacteria 1927
584 Ga0207691_10049500 3300025940 Bacteria 3850
585 Ga0207711_10000539 3300025941 Bacteria 38710
586 Ga0207711_10031060 3300025941 Bacteria 4507
587 Ga0207689_10191357 3300025942 Bacteria 1688
588 Ga0207661_10004766 3300025944 Bacteria 9498
589 Ga0207679_10015863 3300025945 Bacteria 4992
590 Ga0207679_10149172 3300025945 Bacteria 1901
591 Ga0207679_10163727 3300025945 Bacteria 1824
592 Ga0207667_10000224 3300025949 Bacteria 79334
593 Ga0207667_10000240 3300025949 Bacteria 76766
594 Ga0207667_10001418 3300025949 Bacteria 30009
595 Ga0207667_10006504 3300025949 Bacteria 14138
596 Ga0207667_10009556 3300025949 Bacteria 11412
597 Ga0207667_10010505 3300025949 Bacteria 10817
598 Ga0207667_10013260 3300025949 Bacteria 9445
599 Ga0207667_10014602 3300025949 Bacteria 8944
600 Ga0207667_10032547 3300025949 Bacteria 5617
601 Ga0207667_10039237 3300025949 Bacteria 5049
602 Ga0207667_10058768 3300025949 Bacteria 4031
603 Ga0207667_10137843 3300025949 Bacteria 2512
604 Ga0207667_10154287 3300025949 Bacteria 2363
605 Ga0207667_10167675 3300025949 Bacteria 2257
606 Ga0207667_10182163 3300025949 Bacteria 2157
607 Ga0207651_10021204 3300025960 Bacteria 3943
608 Ga0207712_10000589 3300025961 Bacteria 29134
609 Ga0207712_10007177 3300025961 Bacteria 7027
610 Ga0207712_10013249 3300025961 Bacteria 5285
611 Ga0207712_10179214 3300025961 Bacteria 1663
612 Ga0207668_10069939 3300025972 Bacteria 2501
613 Ga0207668_10176337 3300025972 Bacteria 1681
614 Ga0207640_10000115 3300025981 Bacteria 60633
615 Ga0207640_10004459 3300025981 Bacteria 7588
616 Ga0207640_10005333 3300025981 Bacteria 7006
617 Ga0207640_10012552 3300025981 Bacteria 4829
618 Ga0207640_10023346 3300025981 Bacteria 3715
619 Ga0207640_10043090 3300025981 Bacteria 2882
620 Ga0207658_10000033 3300025986 Bacteria 158540
621 Ga0207658_10008954 3300025986 Bacteria 6790
622 Ga0207677_10168668 3300026023 Bacteria 1709
623 Ga0207677_10218693 3300026023 Bacteria 1526
624 Ga0207703_10057766 3300026035 Bacteria 3165
625 Ga0207703_10080414 3300026035 Bacteria 2714
626 Ga0207703_10198375 3300026035 Bacteria 1782
627 Ga0207639_10001429 3300026041 Bacteria 16142
628 Ga0207639_10001885 3300026041 Bacteria 14083
629 Ga0207639_10002310 3300026041 Bacteria 12792
630 Ga0207639_10006186 3300026041 Bacteria 8130
631 Ga0207639_10024619 3300026041 Bacteria 4358
632 Ga0207639_10027516 3300026041 Bacteria 4143
633 Ga0207639_10119391 3300026041 Bacteria 2164
634 Ga0207639_10191486 3300026041 Bacteria 1747
635 Ga0207678_10000140 3300026067 Bacteria 59288
636 Ga0207678_10000577 3300026067 Bacteria 33572
637 Ga0207678_10000643 3300026067 Bacteria 32112
638 Ga0207678_10002307 3300026067 Bacteria 17274
639 Ga0207678_10026314 3300026067 Bacteria 5075
640 Ga0207678_10074092 3300026067 Bacteria 2917
641 Ga0207678_10081182 3300026067 Bacteria 2775
642 Ga0207702_10000717 3300026078 Bacteria 35600
643 Ga0207702_10001870 3300026078 Bacteria 20641
644 Ga0207702_10013999 3300026078 Bacteria 6664
645 Ga0207702_10018943 3300026078 Bacteria 5695
646 Ga0207702_10026144 3300026078 Bacteria 4845
647 Ga0207702_10071028 3300026078 Bacteria 2996
648 Ga0207702_10187910 3300026078 Bacteria 1906
649 Ga0207702_10272894 3300026078 Bacteria 1596
650 Ga0207641_10001904 3300026088 Bacteria 20032
651 Ga0207641_10009763 3300026088 Bacteria 7904
652 Ga0207648_10027795 3300026089 Bacteria 5019
653 Ga0207648_10047957 3300026089 Bacteria 3742
654 Ga0207676_10141543 3300026095 Bacteria 2060
655 Ga0207674_10000055 3300026116 Bacteria 114021
656 Ga0207674_10001010 3300026116 Bacteria 36767
657 Ga0207674_10003546 3300026116 Bacteria 19045
658 Ga0207674_10032918 3300026116 Bacteria 5433
659 Ga0207674_10063368 3300026116 Bacteria 3732
660 Ga0207674_10067033 3300026116 Bacteria 3614
661 Ga0207674_10068046 3300026116 Bacteria 3584
662 Ga0207674_10155643 3300026116 Bacteria 2241
663 Ga0207674_10203879 3300026116 Bacteria 1927
664 Ga0207698_10003633 3300026142 Bacteria 9311
665 Ga0207698_10110762 3300026142 Bacteria 2300
666 Ga0207698_10259261 3300026142 Bacteria 1596
667 Ga0209981_1003695 3300027378 Bacteria 1990
668 Ga0209179_1000006 3300027512 Bacteria 101289
669 Ga0209999_1000340 3300027543 Bacteria 7033
670 Ga0209983_1003433 3300027665 Bacteria 3388
671 Ga0209971_1001679 3300027682 Bacteria 5473
672 Ga0209974_10012587 3300027876 Bacteria 2827
673 Ga0209974_10020661 3300027876 Bacteria 2182
674 Ga0268266_10000001 3300028379 Bacteria 4040580
675 Ga0268266_10000004 3300028379 Bacteria 1495817
676 Ga0268266_10000008 3300028379 Bacteria 1161875
677 Ga0268266_10343754 3300028379 Bacteria 1401
678 Ga0268265_10000539 3300028380 Bacteria 38528
679 Ga0268264_10265542 3300028381 Bacteria 1601
680 Ga0265319_1010847 3300028563 Bacteria 3775
681 Ga0265334_10000127 3300028573 Bacteria 48527
682 Ga0265318_10000024 3300028577 Bacteria 159801
683 Ga0307515_10000066 3300028794 Bacteria 244076
684 Ga0307515_10006088 3300028794 Bacteria 24256
685 Ga0307515_10091298 3300028794 Bacteria 3807
686 Ga0265338_10015683 3300028800 Bacteria 8303
687 Ga0314311_1007966 3300030733 Bacteria 5374
688 Ga0265330_10004503 3300031235 Bacteria 7067
689 Ga0265332_10009553 3300031238 Bacteria 4326
690 Ga0265328_10004240 3300031239 Bacteria 6236
691 Ga0265320_10030607 3300031240 Bacteria 2773
692 Ga0265325_10021155 3300031241 Bacteria 3579
693 Ga0265329_10001926 3300031242 Bacteria 9783
694 Ga0265331_10002534 3300031250 Bacteria 12300
695 Ga0265331_10015495 3300031250 Bacteria 4022
696 Ga0265327_10000028 3300031251 Bacteria 361066
697 Ga0265316_10004022 3300031344 Bacteria 14723
698 Ga0307408_100000023 3300031548 Bacteria 295931
699 Ga0307408_100037957 3300031548 Bacteria 3396
700 Ga0307408_100106860 3300031548 Bacteria 2142
701 Ga0307408_100161390 3300031548 Bacteria 1781
702 Ga0265313_10001194 3300031595 Bacteria 24878
703 Ga0307508_10263730 3300031616 Bacteria 1317
704 Ga0307514_10020148 3300031649 Bacteria 5446
705 Ga0316575_10035503 3300031665 Bacteria 1960
706 Ga0316575_10055344 3300031665 Bacteria 1580
707 Ga0265314_10001695 3300031711 Bacteria 23953
708 Ga0265314_10011218 3300031711 Bacteria 7417
709 Ga0265342_10010591 3300031712 Bacteria 6379
710 Ga0307516_10000109 3300031730 Bacteria 94762
711 Ga0307405_10145699 3300031731 Bacteria 1658
712 Ga0307412_10006311 3300031911 Bacteria 6695
713 Ga0307416_100363264 3300032002 Bacteria 1471
714 Ga0307414_10017415 3300032004 Bacteria 4395
715 Ga0307414_10034341 3300032004 Bacteria 3361
716 Ga0307411_10035548 3300032005 Bacteria 3113
717 Ga0307510_10003563 3300033180 Bacteria 18174
718 Ga0373934_0008452 3300035086 Bacteria 3838
719 Ga0373939_0000033 3300035114 Bacteria 49449
720 Ga0373960_0008484 3300035121 Bacteria 2463
721 Ga0316574_0028022 3300035398 Bacteria 3395
722 Ga0395899_0000106 3300037312 Bacteria 144668
723 Ga0395899_0011603 3300037312 Bacteria 6747
724 Ga0395899_0112654 3300037312 Bacteria 1954
725 Ga0395900_0000049 3300037418 Bacteria 226847
726 Ga0395900_0000256 3300037418 Bacteria 82977
727 Ga0395900_0000690 3300037418 Bacteria 45062
728 Ga0395900_0009320 3300037418 Bacteria 10065
729 Ga0395900_0015207 3300037418 Bacteria 7847
730 Ga0395900_0095385 3300037418 Bacteria 3056
731 Ga0395900_0136531 3300037418 Bacteria 2513
732 Ga0395898_0000023 3300037466 Bacteria 379477
733 Ga0395898_0000110 3300037466 Bacteria 217100
734 Ga0395898_0001044 3300037466 Bacteria 43200
735 Ga0395898_0021645 3300037466 Bacteria 6517
736 Ga0395898_0035555 3300037466 Bacteria 4951
737 Ga0395898_0111554 3300037466 Bacteria 2621
738 Ga0395905_0000071 3300037471 Bacteria 174580
739 Ga0395905_0000126 3300037471 Bacteria 126035
740 Ga0395905_0001072 3300037471 Bacteria 34497
741 Ga0395905_0002192 3300037471 Bacteria 22052
742 Ga0395905_0015036 3300037471 Bacteria 7375
743 Ga0395905_0015602 3300037471 Bacteria 7217
744 Ga0395905_0020334 3300037471 Bacteria 6288
745 Ga0395905_0029445 3300037471 Bacteria 5173
746 Ga0395905_0103718 3300037471 Bacteria 2670
747 Ga0395905_0113959 3300037471 Bacteria 2540
748 Ga0395905_0147273 3300037471 Bacteria 2215
749 Ga0395901_0003311 3300038443 Bacteria 16231
750 Ga0395901_0015804 3300038443 Bacteria 7691
751 Ga0395901_0033337 3300038443 Bacteria 5316
752 Ga0395901_0051425 3300038443 Bacteria 4284
753 Ga0395901_0056054 3300038443 Bacteria 4099
754 Ga0395901_0121038 3300038443 Bacteria 2750
755 Ga0395901_0196920 3300038443 Bacteria 2112
756 Ga0395901_0269610 3300038443 Bacteria 1771
757 Ga0436365_0478863 3300039437 Bacteria 3097
758 Ga0436365_0770231 3300039437 Bacteria 1909
759 Ga0436360_0478772 3300039438 Bacteria 1635
760 Ga0436361_0117093 3300039447 Bacteria 18045
761 Ga0436361_0181855 3300039447 Bacteria 10118
762 Ga0436361_0285207 3300039447 Bacteria 30209
763 Ga0436361_0332176 3300039447 Bacteria 56332
764 Ga0436361_0549178 3300039447 Bacteria 6106
765 Ga0436361_0886712 3300039447 Bacteria 114879
766 Ga0436361_1067608 3300039447 Bacteria 3127
767 Ga0436361_1071853 3300039447 Bacteria 4345
768 Ga0436362_0539290 3300039453 Bacteria 4161
769 Ga0439436_0000007 3300041404 Bacteria 120812
770 Ga0439436_0011783 3300041404 Bacteria 2654
771 Ga0439447_002843 3300041407 Bacteria 6217
772 Ga0439465_0001319 3300041413 Bacteria 7985
773 Ga0451800_0725589 3300041459 Bacteria 1955
774 Ga0451802_0710763 3300041460 Bacteria 4619
775 Ga0451806_572563 3300041462 Bacteria 11300
776 Ga0451807_0955740 3300041486 Bacteria 2107
777 Ga0451807_1808547 3300041486 Bacteria 1894
778 Ga0439448_0027552 3300042005 Bacteria 1792
779 Ga0439432_002019 3300042006 Bacteria 7683
780 Ga0439432_008708 3300042006 Bacteria 3555
781 Ga0439432_018054 3300042006 Bacteria 2361
782 Ga0439449_0026676 3300042007 Bacteria 2156
783 Ga0439449_0032110 3300042007 Bacteria 1957
784 Ga0450888_000128 3300042126 Bacteria 6175
785 Ga0450890_001491 3300042127 Bacteria 3366
786 Ga0450890_002413 3300042127 Bacteria 2573
787 Ga0450892_000486 3300042130 Bacteria 4586
788 Ga0450889_000377 3300042144 Bacteria 4962
789 Ga0439446_0018704 3300042156 Bacteria 1944
790 Ga0450908_000033 3300042184 Bacteria 31285
791 Ga0439459_0000956 3300042438 Bacteria 4089
792 Ga0450893_0001034 3300042532 Bacteria 4185
793 Ga0466969_0003393 3300044656 Bacteria 8474
794 Ga0466969_0005020 3300044656 Bacteria 7043
795 Ga0466969_0053743 3300044656 Bacteria 1974
796 Ga0466969_0069861 3300044656 Bacteria 1690
797 Ga0466972_0000761 3300044658 Bacteria 15355
798 Ga0466982_0000001 3300044672 Bacteria 514662
799 Ga0466982_0000083 3300044672 Bacteria 24784
800 Ga0466965_0003924 3300044683 Bacteria 6582
801 Ga0466965_0020584 3300044683 Bacteria 3172
802 Ga0466966_0018259 3300044684 Bacteria 4627
803 Ga0466966_0021980 3300044684 Bacteria 4188
804 Ga0466966_0077877 3300044684 Bacteria 2068
805 Ga0466961_0000391 3300044693 Bacteria 28076
806 Ga0466961_0002089 3300044693 Bacteria 12446
807 Ga0466961_0007752 3300044693 Bacteria 6834
808 Ga0466961_0013754 3300044693 Bacteria 5186
809 Ga0466961_0033183 3300044693 Bacteria 3317
810 Ga0466961_0054799 3300044693 Bacteria 2543
811 Ga0466963_0142660 3300044694 Bacteria 1660
812 Ga0466963_0229597 3300044694 Bacteria 1300
813 Ga0466964_0001887 3300044706 Bacteria 7317
814 Ga0466964_0014757 3300044706 Bacteria 2972
815 Ga0466964_0057500 3300044706 Bacteria 1610
816 Ga0466971_0000637 3300044719 Bacteria 13969
817 Ga0466971_0008613 3300044719 Bacteria 4449
818 Ga0466971_0014458 3300044719 Bacteria 3472
819 Ga0466971_0056552 3300044719 Bacteria 1769
820 Ga0466968_0049671 3300044735 Bacteria 1788
821 Ga0466970_0008744 3300044765 Bacteria 5102
822 Ga0466970_0009866 3300044765 Bacteria 4835
823 Ga0466970_0054849 3300044765 Bacteria 2128
824 Ga0466957_0004185 3300044842 Bacteria 7995
825 Ga0466957_0017758 3300044842 Bacteria 4173
826 Ga0466957_0055839 3300044842 Bacteria 2413
827 Ga0466957_0066255 3300044842 Bacteria 2226
828 Ga0466960_0017957 3300044901 Bacteria 3093
829 Ga0466960_0033971 3300044901 Bacteria 2373
830 Ga0466959_0000022 3300045049 Bacteria 125849
831 Ga0466959_0000132 3300045049 Bacteria 48490
832 Ga0466959_0002678 3300045049 Bacteria 11431
833 Ga0466959_0036023 3300045049 Bacteria 3656
834 Ga0466959_0049203 3300045049 Bacteria 3096
835 Ga0466958_0034855 3300045836 Bacteria 3004
836 Ga0466958_0041201 3300045836 Bacteria 2777
837 Ga0466958_0166523 3300045836 Bacteria 1395
838 Ga0466967_0023893 3300045976 Bacteria 5017
839 Ga0466967_0116785 3300045976 Bacteria 2459
840 Ga0495617_000149 3300046452 Bacteria 44892
841 Ga0495617_001199 3300046452 Bacteria 11663
842 Ga0495638_0000071 3300046460 Bacteria 166300
843 Ga0495638_0000152 3300046460 Bacteria 109586
844 Ga0495638_0000378 3300046460 Bacteria 55320
845 Ga0495638_0001285 3300046460 Bacteria 23401
846 Ga0495650_0000074 3300046471 Bacteria 251346
847 Ga0495650_0000112 3300046471 Bacteria 197339
848 Ga0495650_0000838 3300046471 Bacteria 37106
849 Ga0495650_0015578 3300046471 Bacteria 3893
850 Ga0495582_0055081 3300046473 Bacteria 2192
851 Ga0495584_0021179 3300046491 Bacteria 3301
852 Ga0495585_0000063 3300046492 Bacteria 109530
853 Ga0495585_0006782 3300046492 Bacteria 7069
854 Ga0495607_0000029 3300046501 Bacteria 155005
855 Ga0495607_0000061 3300046501 Bacteria 108427
856 Ga0495607_0004279 3300046501 Bacteria 10560
857 Ga0495607_0084794 3300046501 Bacteria 1732
858 Ga0495583_0016839 3300046506 Bacteria 3907
859 Ga0495606_0000301 3300046507 Bacteria 85258
860 Ga0495606_0000546 3300046507 Bacteria 60458
861 Ga0495606_0000749 3300046507 Bacteria 50146
862 Ga0495606_0019997 3300046507 Bacteria 4955
863 Ga0495606_0032493 3300046507 Bacteria 3614
864 Ga0495606_0120429 3300046507 Bacteria 1571
865 Ga0495610_0000944 3300046512 Bacteria 26960
866 Ga0495610_0018926 3300046512 Bacteria 3870
867 Ga0495616_0000128 3300046513 Bacteria 66249
868 Ga0495616_0003416 3300046513 Bacteria 10177
869 Ga0495620_0000274 3300046515 Bacteria 37605
870 Ga0495620_0009426 3300046515 Bacteria 5194
871 Ga0495631_0000098 3300046518 Bacteria 58396
872 Ga0495631_0000749 3300046518 Bacteria 20780
873 Ga0495632_0000014 3300046519 Bacteria 243913
874 Ga0495632_0016317 3300046519 Bacteria 4134
875 Ga0495637_0005239 3300046520 Bacteria 6637
876 Ga0495648_0000643 3300046524 Bacteria 37243
877 Ga0495648_0029108 3300046524 Bacteria 3670
878 Ga0495663_0000696 3300046525 Bacteria 11574
879 Ga0495663_0018500 3300046525 Bacteria 1984
880 Ga0495663_0028092 3300046525 Bacteria 1654
881 Ga0495598_0001101 3300046537 Bacteria 5186
882 Ga0495609_0002356 3300046538 Bacteria 11663
883 Ga0495621_0014733 3300046539 Bacteria 2480
884 Ga0495597_0006722 3300046542 Bacteria 5921
885 Ga0495622_0009004 3300046557 Bacteria 4623
886 Ga0495656_0003555 3300046615 Bacteria 5278
887 Ga0495668_0001831 3300046616 Bacteria 19230
888 Ga0495668_0009921 3300046616 Bacteria 5806
889 Ga0495668_0023691 3300046616 Bacteria 3498
890 Ga0495611_0000003 3300046648 Bacteria 395679
891 Ga0495611_0000014 3300046648 Bacteria 130151
892 Ga0495625_0000019 3300046660 Bacteria 298330
893 Ga0495625_0122019 3300046660 Bacteria 1772
894 Ga0495625_0126058 3300046660 Bacteria 1738
895 Ga0495661_0000703 3300046665 Bacteria 33156
896 Ga0495670_0000482 3300046691 Bacteria 18898
897 Ga0495670_0001847 3300046691 Bacteria 10420
898 Ga0495670_0039847 3300046691 Bacteria 2343
899 Ga0495671_0000549 3300046692 Bacteria 28132
900 Ga0495649_0000594 3300046694 Bacteria 30227
901 Ga0495649_0001665 3300046694 Bacteria 16510
902 Ga0495589_0000018 3300046794 Bacteria 204851
903 Ga0495660_0000122 3300046810 Bacteria 85116
904 Ga0495660_0000585 3300046810 Bacteria 29006
905 Ga0495636_0004489 3300047318 Bacteria 5470
906 Ga0495636_0022908 3300047318 Bacteria 2527
907 Ga0495683_0042707 3300047323 Bacteria 2285
908 Ga0495687_000248 3300047443 Bacteria 72947
909 Ga0495687_011305 3300047443 Bacteria 4812
910 Ga0495679_000017 3300047446 Bacteria 263230
911 Ga0495673_0000004 3300047469 Bacteria 1354526
912 Ga0495673_0000347 3300047469 Bacteria 58250
913 Ga0495673_0001611 3300047469 Bacteria 17516
914 Ga0495686_0000024 3300047472 Bacteria 400343
915 Ga0495686_0000409 3300047472 Bacteria 67869
916 Ga0495686_0003267 3300047472 Bacteria 14189
917 Ga0495686_0018839 3300047472 Bacteria 4622
918 Ga0495686_0025591 3300047472 Bacteria 3867
919 Ga0495593_0012401 3300047673 Bacteria 4873
920 Ga0496100_0031843 3300048903 Bacteria 3282
921 Ga0496100_0097421 3300048903 Bacteria 2020
922 Ga0496101_0001464 3300048904 Bacteria 14105
923 Ga0496101_0004029 3300048904 Bacteria 9189
924 Ga0496102_0097922 3300048905 Bacteria 2721
925 Ga0496104_0017116 3300048907 Bacteria 6595
926 Ga0496104_0033408 3300048907 Bacteria 4792
927 Ga0496105_0030457 3300048908 Bacteria 4421
928 Ga0496105_0169066 3300048908 Bacteria 1793
929 Ga0496106_0001770 3300048909 Bacteria 16112
930 Ga0496106_0187888 3300048909 Bacteria 1642
931 Ga0496107_0246978 3300048910 Bacteria 1328
932 Ga0496108_0067336 3300048911 Bacteria 3020
933 Ga0496108_0125251 3300048911 Bacteria 2205
934 Ga0496109_0091283 3300048912 Bacteria 2817
935 Ga0496109_0117634 3300048912 Bacteria 2474
936 Ga0496110_0184289 3300048913 Bacteria 1895
937 Ga0496112_0127012 3300048915 Bacteria 2520
938 Ga0496112_0301098 3300048915 Bacteria 1549
939 Ga0496113_0004524 3300048916 Bacteria 8561
940 Ga0496113_0165710 3300048916 Bacteria 1748
941 Ga0496115_0000008 3300048918 Bacteria 237485
942 Ga0496115_0000043 3300048918 Bacteria 116422
943 Ga0496115_0000474 3300048918 Bacteria 31973
944 Ga0496115_0017672 3300048918 Bacteria 5459
945 Ga0496115_0039836 3300048918 Bacteria 3733
946 Ga0496115_0159181 3300048918 Bacteria 1866
947 Ga0496117_0005621 3300048920 Bacteria 13091
948 Ga0496117_0014937 3300048920 Bacteria 6657
949 Ga0496117_0038495 3300048920 Bacteria 3544
950 Ga0496117_0038598 3300048920 Bacteria 3536
951 Ga0496117_0057035 3300048920 Bacteria 2716
952 Ga0496118_0000081 3300048921 Bacteria 188525
953 Ga0496118_0001013 3300048921 Bacteria 43722
954 Ga0496118_0001137 3300048921 Bacteria 40981
955 Ga0496118_0002106 3300048921 Bacteria 27904
956 Ga0496118_0003206 3300048921 Bacteria 20878
957 Ga0496118_0005866 3300048921 Bacteria 13763
958 Ga0496118_0006022 3300048921 Bacteria 13511
959 Ga0496118_0064638 3300048921 Bacteria 2683
960 Ga0496118_0145705 3300048921 Bacteria 1492
961 Ga0496119_0000235 3300048922 Bacteria 77921
962 Ga0496119_0056719 3300048922 Bacteria 2372
963 Ga0496120_0000208 3300048923 Bacteria 100328
964 Ga0496120_0000282 3300048923 Bacteria 85605
965 Ga0496121_0000109 3300048924 Bacteria 187307
966 Ga0496121_0000480 3300048924 Bacteria 77305
967 Ga0496121_0000708 3300048924 Bacteria 61851
968 Ga0496121_0001959 3300048924 Bacteria 32773
969 Ga0496121_0013832 3300048924 Bacteria 8637
970 Ga0496121_0034748 3300048924 Bacteria 4532
971 Ga0496121_0041518 3300048924 Bacteria 4018
972 Ga0496121_0093178 3300048924 Bacteria 2346
973 Ga0496122_0000362 3300048925 Bacteria 97690
974 Ga0496122_0009488 3300048925 Bacteria 10244
975 Ga0496122_0051113 3300048925 Bacteria 3144
976 Ga0496123_0000317 3300048926 Bacteria 92079
977 Ga0496123_0011106 3300048926 Bacteria 7854
978 Ga0496123_0021372 3300048926 Bacteria 5032
979 Ga0496124_0000006 3300048927 Bacteria 904259
980 Ga0496124_0016949 3300048927 Bacteria 6899
981 Ga0496124_0019749 3300048927 Bacteria 6257
982 Ga0496125_0000118 3300048928 Bacteria 176551
983 Ga0496125_0007510 3300048928 Bacteria 11587
984 Ga0496126_0000087 3300048929 Bacteria 215031
985 Ga0496126_0001680 3300048929 Bacteria 33123
986 Ga0496126_0007774 3300048929 Bacteria 11684
987 Ga0496126_0008899 3300048929 Bacteria 10750
988 Ga0496126_0018409 3300048929 Bacteria 6920
989 Ga0496126_0159567 3300048929 Bacteria 1928
990 Ga0496126_0301082 3300048929 Bacteria 1323
991 Ga0495678_000210 3300049459 Bacteria 68186
992 Ga0495682_0026578 3300049460 Bacteria 2147
993 Ga0501031_0005177 3300049568 Bacteria 8500
994 Ga0501031_0032185 3300049568 Bacteria 3420
995 Ga0501031_0064295 3300049568 Bacteria 2389
996 Ga0501031_0080818 3300049568 Bacteria 2119
997 Ga0501031_0200034 3300049568 Bacteria 1304
998 Ga0501032_0001872 3300049569 Bacteria 16617
999 Ga0501032_0002036 3300049569 Bacteria 15952
1000 Ga0501032_0094424 3300049569 Bacteria 1983
1001 Ga0501033_0001111 3300049570 Bacteria 24415
1002 Ga0501033_0025850 3300049570 Bacteria 4420
1003 Ga0501033_0054178 3300049570 Bacteria 2968
1004 Ga0501033_0097146 3300049570 Bacteria 2152
1005 Ga0501034_0001904 3300049571 Bacteria 26429
1006 Ga0501034_0003143 3300049571 Bacteria 18996
1007 Ga0501034_0003634 3300049571 Bacteria 17477
1008 Ga0501034_0005592 3300049571 Bacteria 13692
1009 Ga0501034_0048973 3300049571 Bacteria 4264
1010 Ga0501034_0114928 3300049571 Bacteria 2680
1011 Ga0501036_0082697 3300049572 Bacteria 2714
1012 Ga0501036_0095052 3300049572 Bacteria 2519
1013 Ga0501036_0095555 3300049572 Bacteria 2512
1014 Ga0501036_0239297 3300049572 Bacteria 1523
1015 Ga0501037_0000948 3300049573 Bacteria 21559
1016 Ga0501037_0032551 3300049573 Bacteria 3851
1017 Ga0501038_0000712 3300049574 Bacteria 29729
1018 Ga0501038_0171471 3300049574 Bacteria 1756
1019 Ga0501039_0087821 3300049575 Bacteria 2422
1020 Ga0501039_0099173 3300049575 Bacteria 2273
1021 Ga0501040_0056164 3300049576 Bacteria 2701
1022 Ga0501042_0099878 3300049578 Bacteria 2086
1023 Ga0501043_0004817 3300049579 Bacteria 10922
1024 Ga0501043_0014565 3300049579 Bacteria 6157
1025 Ga0501043_0025027 3300049579 Bacteria 4683
1026 Ga0501043_0032578 3300049579 Bacteria 4098
1027 Ga0501043_0094542 3300049579 Bacteria 2350
1028 Ga0501043_0254424 3300049579 Bacteria 1352
1029 Ga0501046_0007434 3300049580 Bacteria 9630
1030 Ga0501046_0007779 3300049580 Bacteria 9403
1031 Ga0501046_0017496 3300049580 Bacteria 5979
1032 Ga0501046_0022598 3300049580 Bacteria 5181
1033 Ga0501046_0038270 3300049580 Bacteria 3850
1034 Ga0501046_0071888 3300049580 Bacteria 2686
1035 Ga0501046_0173733 3300049580 Bacteria 1615
1036 Ga0501047_0000492 3300049581 Bacteria 42926
1037 Ga0501047_0000904 3300049581 Bacteria 30280
1038 Ga0501047_0001924 3300049581 Bacteria 19960
1039 Ga0501047_0010764 3300049581 Bacteria 8645
1040 Ga0501048_0072422 3300049582 Bacteria 2432
1041 Ga0501048_0081261 3300049582 Bacteria 2286
1042 Ga0501067_0000426 3300049583 Bacteria 22971
1043 Ga0501069_0002407 3300049585 Bacteria 9508
1044 Ga0501070_0001125 3300049586 Bacteria 23991
1045 Ga0501070_0003048 3300049586 Bacteria 14590
1046 Ga0501070_0003914 3300049586 Bacteria 12847
1047 Ga0501070_0006408 3300049586 Bacteria 10014
1048 Ga0501070_0006453 3300049586 Bacteria 9986
1049 Ga0501070_0034335 3300049586 Bacteria 4241
1050 Ga0501070_0050466 3300049586 Bacteria 3454
1051 Ga0501070_0055108 3300049586 Bacteria 3296
1052 Ga0501070_0061295 3300049586 Bacteria 3117
1053 Ga0501070_0151240 3300049586 Bacteria 1915
1054 Ga0501070_0184247 3300049586 Bacteria 1717
1055 Ga0501071_0002518 3300049587 Bacteria 11150
1056 Ga0501072_0001604 3300049588 Bacteria 16909
1057 Ga0501073_0000557 3300049589 Bacteria 26288
1058 Ga0501073_0000757 3300049589 Bacteria 22907
1059 Ga0501073_0018962 3300049589 Bacteria 4972
1060 Ga0501073_0023067 3300049589 Bacteria 4474
1061 Ga0501073_0090310 3300049589 Bacteria 2129
1062 Ga0501074_0000162 3300049590 Bacteria 35443
1063 Ga0501074_0000967 3300049590 Bacteria 18578
1064 Ga0501074_0001529 3300049590 Bacteria 15658
1065 Ga0501074_0007914 3300049590 Bacteria 7699
1066 Ga0501074_0024898 3300049590 Bacteria 4348
1067 Ga0501074_0028997 3300049590 Bacteria 4009
1068 Ga0501074_0078312 3300049590 Bacteria 2372
1069 Ga0501074_0107767 3300049590 Bacteria 1994
1070 Ga0501217_032436 3300049661 Bacteria 1293
1071 Ga0501222_003405 3300049662 Bacteria 2174
1072 Ga0501227_013967 3300049665 Bacteria 1776
1073 Ga0501233_026477 3300049668 Bacteria 1281
1074 Ga0501258_000331 3300049687 Bacteria 3019
1075 Ga0501221_001217 3300049704 Bacteria 4264
1076 Ga0501229_000077 3300049706 Bacteria 9792
1077 Ga0501079_0018533 3300049741 Bacteria 5318
1078 Ga0501079_0031442 3300049741 Bacteria 4080
1079 Ga0501080_0000381 3300049742 Bacteria 34167
1080 Ga0501080_0000997 3300049742 Bacteria 23230
1081 Ga0501080_0001633 3300049742 Bacteria 19070
1082 Ga0501080_0004536 3300049742 Bacteria 12378
1083 Ga0501080_0011327 3300049742 Bacteria 8163
1084 Ga0501080_0017413 3300049742 Bacteria 6645
1085 Ga0501080_0020342 3300049742 Bacteria 6142
1086 Ga0501080_0133574 3300049742 Bacteria 2297
1087 Ga0501081_0030435 3300049743 Bacteria 3653
1088 Ga0501083_0001097 3300049744 Bacteria 18095
1089 Ga0501083_0007218 3300049744 Bacteria 7889
1090 Ga0501267_001243 3300049764 Bacteria 2149
1091 Ga0501282_003805 3300049778 Bacteria 1621
1092 Ga0501035_0001396 3300049822 Bacteria 24796
1093 Ga0501035_0005645 3300049822 Bacteria 11813
1094 Ga0501035_0007879 3300049822 Bacteria 9954
1095 Ga0501035_0022978 3300049822 Bacteria 5724
1096 Ga0501035_0055098 3300049822 Bacteria 3551
1097 Ga0501035_0073532 3300049822 Bacteria 3024
1098 Ga0501035_0075569 3300049822 Bacteria 2979
1099 Ga0501035_0169767 3300049822 Bacteria 1885
1100 Ga0501035_0180379 3300049822 Bacteria 1819
1101 Ga0501035_0203588 3300049822 Bacteria 1696
1102 Ga0501044_0001170 3300049823 Bacteria 31091
1103 Ga0501044_0003235 3300049823 Bacteria 18336
1104 Ga0501044_0007762 3300049823 Bacteria 11796
1105 Ga0501044_0079869 3300049823 Bacteria 3313
1106 Ga0501044_0094745 3300049823 Bacteria 3009
1107 Ga0501044_0194674 3300049823 Bacteria 1988
1108 Ga0501044_0320591 3300049823 Bacteria 1474
1109 nmdc:mga03683_2992_c1 3300050489 Bacteria 5352
1110 nmdc:mga0k408_10407_c1 3300050493 Bacteria 5030
1111 nmdc:mga0k408_10582_c1 3300050493 Bacteria 4994
1112 nmdc:mga0k408_20025_c1 3300050493 Bacteria 3744
1113 nmdc:mga06z11_37238_c1 3300050494 Bacteria 2408
1114 nmdc:mga07m45_10280_c1 3300050496 Bacteria 4884
1115 nmdc:mga07m45_1940_c1 3300050496 Bacteria 9565
1116 nmdc:mga07m45_44945_c1 3300050496 Bacteria 2479
1117 Ga0495612_0046153 3300053078 Bacteria 1784
1118 Ga0500610_0002424 3300053079 Bacteria 6864
1119 Ga0500578_0000075 3300053086 Bacteria 109315
1120 Ga0500643_000029 3300053087 Bacteria 211149
1121 Ga0500643_002365 3300053087 Bacteria 9833
1122 Ga0500651_0000166 3300053093 Bacteria 42732
1123 Ga0500651_0036039 3300053093 Bacteria 3117
1124 Ga0500651_0074795 3300053093 Bacteria 2105
1125 Ga0500555_000067 3300053103 Bacteria 52543
1126 Ga0500597_000058 3300053120 Bacteria 22169
1127 Ga0500658_0003351 3300053134 Bacteria 6073
1128 Ga0500559_0009650 3300053136 Bacteria 4167
1129 Ga0500568_0003657 3300053139 Bacteria 8457
1130 Ga0500590_005767 3300053148 Bacteria 5984
1131 Ga0500622_0003844 3300053156 Bacteria 9770
1132 Ga0500633_0000757 3300053160 Bacteria 5501
1133 Ga0500645_004295 3300053730 Bacteria 5500
1134 Ga0590071_001475 3300059421 Bacteria 6207
1135 Ga0501082_0000234 3300060353 Bacteria 48354
1136 Ga0501082_0005091 3300060353 Bacteria 11453
1137 Ga0501082_0077129 3300060353 Bacteria 2873
1138 Ga0501082_0115329 3300060353 Bacteria 2326
1139 Ga0466962_0000447 3300061719 Bacteria 17893
1140 Ga0466962_0000829 3300061719 Bacteria 13923
1141 Ga0466962_0006825 3300061719 Bacteria 5479
1142 Ga0466962_0067891 3300061719 Bacteria 1703

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025912 Ga0207707_10001440 Ga0207707_1000144013 316
2 3300039453 Ga0436362_0539290 Ga0436362_0539290_2018_3181 324
3 3300003323 rootH1_10058324 rootH1_100583245 328
4 3300030733 Ga0314311_1007966 Ga0314311_10079665 334
5 3300041486 Ga0451807_1808547 Ga0451807_1808547_255_1415 334
6 3300049578 Ga0501042_0099878 Ga0501042_0099878_17_1087 334
7 3300049822 Ga0501035_0075569 Ga0501035_0075569_1858_2928 334
8 3300044683 Ga0466965_0020584 Ga0466965_0020584_1477_2646 335
9 3300044693 Ga0466961_0002089 Ga0466961_0002089_1136_2305 335
10 3300044719 Ga0466971_0056552 Ga0466971_0056552_564_1733 335
11 3300044842 Ga0466957_0017758 Ga0466957_0017758_1612_2781 335
12 3300045049 Ga0466959_0002678 Ga0466959_0002678_3842_5011 335
13 3300061719 Ga0466962_0000829 Ga0466962_0000829_9347_10516 335
14 3300015689 Ga0183360_10002 Ga0183360_10002780 338
15 3300025263 Ga0209565_1011717 Ga0209565_10117172 338
16 3300049568 Ga0501031_0005177 Ga0501031_0005177_6463_7623 338
17 3300049569 Ga0501032_0002036 Ga0501032_0002036_13243_14403 338
18 3300049571 Ga0501034_0001904 Ga0501034_0001904_23763_24923 338
19 3300049572 Ga0501036_0095555 Ga0501036_0095555_1028_2188 338
20 3300049573 Ga0501037_0000948 Ga0501037_0000948_3621_4781 338
21 3300049574 Ga0501038_0000712 Ga0501038_0000712_26098_27258 338
22 3300049575 Ga0501039_0087821 Ga0501039_0087821_45_1205 338
23 3300049579 Ga0501043_0014565 Ga0501043_0014565_4221_5381 338
24 3300049580 Ga0501046_0017496 Ga0501046_0017496_3060_4220 338
25 3300049582 Ga0501048_0072422 Ga0501048_0072422_384_1544 338
26 3300049589 Ga0501073_0023067 Ga0501073_0023067_1466_2626 338
27 3300049822 Ga0501035_0001396 Ga0501035_0001396_22826_23986 338
28 3300005455 Ga0070663_100000512 Ga0070663_10000051219 342
29 3300005539 Ga0068853_100000503 Ga0068853_10000050319 342
30 3300005617 Ga0068859_100269030 Ga0068859_1002690302 342
31 3300005842 Ga0068858_100243445 Ga0068858_1002434452 342
32 3300006931 Ga0097620_100269058 Ga0097620_1002690582 342
33 3300009177 Ga0105248_10000231 Ga0105248_1000023126 342
34 3300009545 Ga0105237_10001039 Ga0105237_100010392 342
35 3300025913 Ga0207695_10238901 Ga0207695_102389011 342
36 3300025914 Ga0207671_10158134 Ga0207671_101581341 342
37 3300025941 Ga0207711_10000539 Ga0207711_100005392 342
38 3300026067 Ga0207678_10000140 Ga0207678_1000014024 342
39 3300048925 Ga0496122_0000362 Ga0496122_0000362_18450_19610 342
40 3300048926 Ga0496123_0000317 Ga0496123_0000317_67464_68624 342
41 3300053087 Ga0500643_002365 Ga0500643_002365_8493_9653 343
42 3300053120 Ga0500597_000058 Ga0500597_000058_1122_2282 343
43 3300042005 Ga0439448_0027552 Ga0439448_0027552_231_1421 346
44 3300037466 Ga0395898_0111554 Ga0395898_0111554_755_1921 347
45 3300038443 Ga0395901_0015804 Ga0395901_0015804_4848_6014 347
46 3300039437 Ga0436365_0478863 Ga0436365_0478863_529_1692 347
47 3300003771 Ga0055526_1000014 Ga0055526_10000149 348
48 3300003773 Ga0055537_1000059 Ga0055537_10000595 348
49 3300003775 Ga0055524_1000019 Ga0055524_1000019207 348
50 3300003784 Ga0055534_1000012 Ga0055534_10000129 348
51 3300003790 Ga0055528_1000007 Ga0055528_10000079 348
52 3300005344 Ga0070661_100165178 Ga0070661_1001651782 348
53 3300005366 Ga0070659_100276202 Ga0070659_1002762021 348
54 3300005539 Ga0068853_100001130 Ga0068853_10000113017 348
55 3300005563 Ga0068855_100062851 Ga0068855_1000628513 348
56 3300005578 Ga0068854_100216115 Ga0068854_1002161152 348
57 3300025263 Ga0209565_1000001 Ga0209565_1000001447 348
58 3300025273 Ga0209673_1000001 Ga0209673_1000001447 348
59 3300025291 Ga0209675_1000001 Ga0209675_10000012085 348
60 3300025295 Ga0209564_1000001 Ga0209564_10000012247 348
61 3300025299 Ga0209256_1000006 Ga0209256_1000006683 348
62 3300025949 Ga0207667_10154287 Ga0207667_101542872 348
63 3300026041 Ga0207639_10001429 Ga0207639_100014298 348
64 3300031548 Ga0307408_100037957 Ga0307408_1000379572 348
65 3300053079 Ga0500610_0002424 Ga0500610_0002424_1557_2717 348
66 3300001915 JGI24741J21665_1000441 JGI24741J21665_10004413 349
67 3300005329 Ga0070683_100027493 Ga0070683_1000274933 349
68 3300005345 Ga0070692_10058924 Ga0070692_100589242 349
69 3300005366 Ga0070659_100018494 Ga0070659_1000184942 349
70 3300005539 Ga0068853_100035689 Ga0068853_1000356894 349
71 3300005546 Ga0070696_100053566 Ga0070696_1000535661 349
72 3300005564 Ga0070664_100025481 Ga0070664_1000254815 349
73 3300005614 Ga0068856_100013002 Ga0068856_1000130026 349
74 3300013102 Ga0157371_10142272 Ga0157371_101422722 349
75 3300025909 Ga0207705_10083746 Ga0207705_100837461 349
76 3300025913 Ga0207695_10009353 Ga0207695_100093534 349
77 3300025917 Ga0207660_10006573 Ga0207660_100065738 349
78 3300025920 Ga0207649_10128437 Ga0207649_101284372 349
79 3300025921 Ga0207652_10023320 Ga0207652_100233203 349
80 3300025932 Ga0207690_10178563 Ga0207690_101785631 349
81 3300025945 Ga0207679_10149172 Ga0207679_101491721 349
82 3300025949 Ga0207667_10013260 Ga0207667_100132609 349
83 3300025981 Ga0207640_10023346 Ga0207640_100233463 349
84 3300026041 Ga0207639_10024619 Ga0207639_100246192 349
85 3300026116 Ga0207674_10003546 Ga0207674_100035467 349
86 3300032004 Ga0307414_10034341 Ga0307414_100343413 350
87 3300005367 Ga0070667_100000049 Ga0070667_100000049124 351
88 3300009093 Ga0105240_10143340 Ga0105240_101433402 351
89 3300025986 Ga0207658_10000033 Ga0207658_1000003328 351
90 3300005336 Ga0070680_100000540 Ga0070680_10000054023 352
91 3300037471 Ga0395905_0015036 Ga0395905_0015036_1871_3037 352
92 3300053093 Ga0500651_0036039 Ga0500651_0036039_1713_2873 352
93 3300005336 Ga0070680_100002649 Ga0070680_1000026499 353
94 3300005458 Ga0070681_10003374 Ga0070681_1000337413 353
95 3300005530 Ga0070679_100003239 Ga0070679_1000032392 353
96 3300006353 Ga0075370_10005248 Ga0075370_100052482 353
97 3300025917 Ga0207660_10002081 Ga0207660_100020816 353
98 3300025921 Ga0207652_10001869 Ga0207652_1000186918 353
99 3300046519 Ga0495632_0000014 Ga0495632_0000014_165599_166720 353
100 3300050496 nmdc:mga07m45_1940_c1 nmdc:mga07m45_1940_c1_155_1324 353
101 3300003187 JGI25151J46595_10000102 JGI25151J46595_1000010217 354
102 3300025245 Ga0207425_1002775 Ga0207425_10027752 354
103 3300025294 Ga0209025_1000006 Ga0209025_1000006641 354
104 3300002705 JGI25156J39149_1009947 JGI25156J39149_10099472 355
105 3300002741 JGI25157J39369_1001047 JGI25157J39369_10010476 355
106 3300009553 Ga0105249_10002941 Ga0105249_100029416 355
107 3300010375 Ga0105239_10076147 Ga0105239_100761473 355
108 3300025250 Ga0209026_1000087 Ga0209026_100008798 355
109 3300025256 Ga0209759_1000503 Ga0209759_100050327 355
110 3300025961 Ga0207712_10007177 Ga0207712_100071772 355
111 3300037312 Ga0395899_0000106 Ga0395899_0000106_71890_73059 355
112 3300037418 Ga0395900_0000049 Ga0395900_0000049_54866_56035 355
113 3300037466 Ga0395898_0000110 Ga0395898_0000110_171239_172408 355
114 3300038443 Ga0395901_0196920 Ga0395901_0196920_881_2050 355
115 3300044656 Ga0466969_0053743 Ga0466969_0053743_14_1183 355
116 3300044693 Ga0466961_0033183 Ga0466961_0033183_595_1764 355
117 3300044706 Ga0466964_0057500 Ga0466964_0057500_146_1315 355
118 3300044765 Ga0466970_0008744 Ga0466970_0008744_2844_4013 355
119 3300044842 Ga0466957_0004185 Ga0466957_0004185_3786_4955 355
120 3300045049 Ga0466959_0000022 Ga0466959_0000022_68134_69303 355
121 3300061719 Ga0466962_0067891 Ga0466962_0067891_65_1234 355
122 3300002737 JGI25162J39368_1000444 JGI25162J39368_10004442 356
123 3300002772 JGI25164J39214_1000294 JGI25164J39214_100029429 356
124 3300003214 JGI25165J46597_1003708 JGI25165J46597_10037082 356
125 3300005339 Ga0070660_100037085 Ga0070660_1000370853 356
126 3300005458 Ga0070681_10014057 Ga0070681_100140573 356
127 3300005530 Ga0070679_100030325 Ga0070679_1000303253 356
128 3300005546 Ga0070696_100010412 Ga0070696_1000104124 356
129 3300005547 Ga0070693_100004190 Ga0070693_1000041905 356
130 3300005577 Ga0068857_100012200 Ga0068857_1000122003 356
131 3300013100 Ga0157373_10102087 Ga0157373_101020872 356
132 3300013102 Ga0157371_10042222 Ga0157371_100422223 356
133 3300013306 Ga0163162_10000042 Ga0163162_100000428 356
134 3300013307 Ga0157372_10102701 Ga0157372_101027012 356
135 3300025231 Ga0207427_100133 Ga0207427_10013326 356
136 3300025233 Ga0209437_100005 Ga0209437_100005599 356
137 3300025261 Ga0209233_1000011 Ga0209233_1000011343 356
138 3300025912 Ga0207707_10022905 Ga0207707_100229053 356
139 3300025919 Ga0207657_10039214 Ga0207657_100392142 356
140 3300025932 Ga0207690_10010328 Ga0207690_100103284 356
141 3300026116 Ga0207674_10032918 Ga0207674_100329183 356
142 3300041404 Ga0439436_0011783 Ga0439436_0011783_167_1333 356
143 3300047472 Ga0495686_0003267 Ga0495686_0003267_1476_2636 356
144 3300025949 Ga0207667_10182163 Ga0207667_101821632 357
145 3300031548 Ga0307408_100000023 Ga0307408_1000000233 357
146 3300037312 Ga0395899_0011603 Ga0395899_0011603_3095_4264 357
147 3300037466 Ga0395898_0000023 Ga0395898_0000023_129987_131156 357
148 3300038443 Ga0395901_0269610 Ga0395901_0269610_265_1434 357
149 3300046525 Ga0495663_0000696 Ga0495663_0000696_6170_7336 357
150 3300048929 Ga0496126_0018409 Ga0496126_0018409_3361_4524 357
151 3300001915 JGI24741J21665_1001154 JGI24741J21665_10011548 358
152 3300001979 JGI24740J21852_10012965 JGI24740J21852_100129652 358
153 3300005329 Ga0070683_100318764 Ga0070683_1003187641 358
154 3300005337 Ga0070682_100049525 Ga0070682_1000495252 358
155 3300005341 Ga0070691_10127066 Ga0070691_101270661 358
156 3300005436 Ga0070713_100000758 Ga0070713_10000075812 358
157 3300005535 Ga0070684_100217079 Ga0070684_1002170792 358
158 3300005546 Ga0070696_100085961 Ga0070696_1000859612 358
159 3300005547 Ga0070693_100003280 Ga0070693_1000032802 358
160 3300005578 Ga0068854_100103503 Ga0068854_1001035033 358
161 3300005614 Ga0068856_100171728 Ga0068856_1001717281 358
162 3300009093 Ga0105240_10241397 Ga0105240_102413972 358
163 3300009551 Ga0105238_10034105 Ga0105238_100341052 358
164 3300013104 Ga0157370_10009778 Ga0157370_100097789 358
165 3300014968 Ga0157379_10058679 Ga0157379_100586793 358
166 3300015262 Ga0182007_10010679 Ga0182007_100106792 358
167 3300020082 Ga0206353_11071570 Ga0206353_110715702 358
168 3300025904 Ga0207647_10002322 Ga0207647_1000232212 358
169 3300025909 Ga0207705_10001071 Ga0207705_100010717 358
170 3300025912 Ga0207707_10000230 Ga0207707_1000023041 358
171 3300025912 Ga0207707_10000245 Ga0207707_1000024540 358
172 3300025913 Ga0207695_10014719 Ga0207695_100147197 358
173 3300025917 Ga0207660_10000084 Ga0207660_1000008417 358
174 3300025919 Ga0207657_10007064 Ga0207657_100070648 358
175 3300025920 Ga0207649_10012746 Ga0207649_100127463 358
176 3300025921 Ga0207652_10000318 Ga0207652_1000031817 358
177 3300025928 Ga0207700_10009061 Ga0207700_100090614 358
178 3300025932 Ga0207690_10003291 Ga0207690_100032918 358
179 3300025933 Ga0207706_10041359 Ga0207706_100413593 358
180 3300025944 Ga0207661_10004766 Ga0207661_100047668 358
181 3300025945 Ga0207679_10015863 Ga0207679_100158632 358
182 3300025949 Ga0207667_10001418 Ga0207667_1000141813 358
183 3300025981 Ga0207640_10004459 Ga0207640_100044597 358
184 3300026041 Ga0207639_10002310 Ga0207639_100023108 358
185 3300026067 Ga0207678_10002307 Ga0207678_1000230713 358
186 3300026078 Ga0207702_10013999 Ga0207702_100139991 358
187 3300026116 Ga0207674_10001010 Ga0207674_1000101018 358
188 3300026142 Ga0207698_10110762 Ga0207698_101107622 358
189 3300038443 Ga0395901_0121038 Ga0395901_0121038_437_1600 358
190 3300039447 Ga0436361_1067608 Ga0436361_1067608_1543_2709 358
191 3300042156 Ga0439446_0018704 Ga0439446_0018704_539_1705 358
192 3300046507 Ga0495606_0032493 Ga0495606_0032493_1773_2939 358
193 3300049744 Ga0501083_0007218 Ga0501083_0007218_6383_7552 358
194 3300049822 Ga0501035_0007879 Ga0501035_0007879_6442_7605 358
195 3300001979 JGI24740J21852_10003893 JGI24740J21852_100038936 359
196 3300001990 JGI24737J22298_10002520 JGI24737J22298_100025205 359
197 3300002067 JGI24735J21928_10013053 JGI24735J21928_100130532 359
198 3300003215 JGI25153J46596_10005179 JGI25153J46596_100051792 359
199 3300003320 rootH2_10011229 rootH2_1001122928 359
200 3300003578 Ga0006562J51391_1010474 Ga0006562J51391_10104742 359
201 3300003578 Ga0006562J51391_1010475 Ga0006562J51391_10104755 359
202 3300005435 Ga0070714_100042401 Ga0070714_1000424013 359
203 3300005455 Ga0070663_100010241 Ga0070663_1000102413 359
204 3300005547 Ga0070693_100005142 Ga0070693_1000051423 359
205 3300005563 Ga0068855_100007860 Ga0068855_1000078603 359
206 3300005563 Ga0068855_100011206 Ga0068855_1000112066 359
207 3300005577 Ga0068857_100001009 Ga0068857_10000100911 359
208 3300005616 Ga0068852_100116843 Ga0068852_1001168433 359
209 3300005834 Ga0068851_10023732 Ga0068851_100237323 359
210 3300009093 Ga0105240_10010177 Ga0105240_100101775 359
211 3300009093 Ga0105240_10198859 Ga0105240_101988592 359
212 3300009174 Ga0105241_10053604 Ga0105241_100536042 359
213 3300009545 Ga0105237_10000011 Ga0105237_10000011167 359
214 3300010375 Ga0105239_10021558 Ga0105239_100215583 359
215 3300012500 Ga0157314_1000231 Ga0157314_10002312 359
216 3300013105 Ga0157369_10003874 Ga0157369_100038746 359
217 3300013307 Ga0157372_10129150 Ga0157372_101291502 359
218 3300014497 Ga0182008_10021481 Ga0182008_100214812 359
219 3300025258 Ga0209129_1004673 Ga0209129_10046734 359
220 3300025297 Ga0209758_1002225 Ga0209758_100222512 359
221 3300025321 Ga0207656_10025795 Ga0207656_100257952 359
222 3300025904 Ga0207647_10041012 Ga0207647_100410123 359
223 3300025913 Ga0207695_10002388 Ga0207695_100023886 359
224 3300025914 Ga0207671_10000011 Ga0207671_10000011164 359
225 3300025949 Ga0207667_10000240 Ga0207667_1000024039 359
226 3300026116 Ga0207674_10000055 Ga0207674_100000559 359
227 3300026142 Ga0207698_10003633 Ga0207698_100036331 359
228 3300048921 Ga0496118_0145705 Ga0496118_0145705_187_1350 359
229 3300048924 Ga0496121_0013832 Ga0496121_0013832_3923_5086 359
230 3300048928 Ga0496125_0000118 Ga0496125_0000118_133030_134193 359
231 3300049579 Ga0501043_0032578 Ga0501043_0032578_742_1887 359
232 3300049586 Ga0501070_0184247 Ga0501070_0184247_331_1494 359
233 3300049590 Ga0501074_0007914 Ga0501074_0007914_6380_7543 359
234 3300002741 JGI25157J39369_1001598 JGI25157J39369_10015987 360
235 3300005364 Ga0070673_100188302 Ga0070673_1001883022 360
236 3300006175 Ga0070712_100188060 Ga0070712_1001880602 360
237 3300025226 Ga0209674_101279 Ga0209674_1012792 360
238 3300025250 Ga0209026_1000017 Ga0209026_1000017173 360
239 3300025256 Ga0209759_1012258 Ga0209759_10122581 360
240 3300025960 Ga0207651_10021204 Ga0207651_100212043 360
241 3300031665 Ga0316575_10055344 Ga0316575_100553441 360
242 3300035398 Ga0316574_0028022 Ga0316574_0028022_742_1896 360
243 3300048903 Ga0496100_0097421 Ga0496100_0097421_135_1301 360
244 iso_pu_bacteria 2886848708 2886850251 360
245 3300042006 Ga0439432_018054 Ga0439432_018054_767_1933 361
246 3300048920 Ga0496117_0038598 Ga0496117_0038598_57_1217 361
247 3300048921 Ga0496118_0000081 Ga0496118_0000081_87655_88815 361
248 3300005262 Ga0065165_1001585 Ga0065165_100158519 362
249 3300053136 Ga0500559_0009650 Ga0500559_0009650_1210_2376 363
250 3300001989 JGI24739J22299_10000815 JGI24739J22299_100008154 364
251 3300005331 Ga0070670_100049297 Ga0070670_1000492971 364
252 3300005548 Ga0070665_100408206 Ga0070665_1004082062 364
253 3300013105 Ga0157369_10110398 Ga0157369_101103983 364
254 3300037471 Ga0395905_0147273 Ga0395905_0147273_581_1747 364
255 3300041460 Ga0451802_0710763 Ga0451802_0710763_1475_2635 364
256 3300044735 Ga0466968_0049671 Ga0466968_0049671_59_1222 364
257 3300049590 Ga0501074_0000967 Ga0501074_0000967_1713_2876 364
258 3300049822 Ga0501035_0005645 Ga0501035_0005645_942_2105 364
259 3300049823 Ga0501044_0001170 Ga0501044_0001170_20733_21896 364
260 3300003322 rootL2_10043721 rootL2_100437215 365
261 3300005577 Ga0068857_100008043 Ga0068857_1000080434 365
262 3300005618 Ga0068864_100000276 Ga0068864_10000027646 365
263 3300005841 Ga0068863_100073031 Ga0068863_1000730312 365
264 3300025912 Ga0207707_10345262 Ga0207707_103452621 365
265 3300026078 Ga0207702_10272894 Ga0207702_102728941 365
266 3300026088 Ga0207641_10009763 Ga0207641_100097634 365
267 3300026116 Ga0207674_10155643 Ga0207674_101556432 365
268 3300041486 Ga0451807_0955740 Ga0451807_0955740_91_1260 365
269 3300048912 Ga0496109_0091283 Ga0496109_0091283_75_1241 365
270 3300048915 Ga0496112_0301098 Ga0496112_0301098_199_1365 365
271 3300048922 Ga0496119_0056719 Ga0496119_0056719_389_1552 365
272 3300048923 Ga0496120_0000282 Ga0496120_0000282_55224_56387 365
273 3300005344 Ga0070661_100059230 Ga0070661_1000592302 366
274 3300005563 Ga0068855_100103461 Ga0068855_1001034612 366
275 3300005578 Ga0068854_100054870 Ga0068854_1000548702 366
276 3300005614 Ga0068856_100004361 Ga0068856_10000436110 366
277 3300005616 Ga0068852_100023590 Ga0068852_1000235903 366
278 3300009093 Ga0105240_10049970 Ga0105240_100499702 366
279 3300009174 Ga0105241_10024431 Ga0105241_100244312 366
280 3300009545 Ga0105237_10020257 Ga0105237_100202572 366
281 3300009551 Ga0105238_10018511 Ga0105238_100185116 366
282 3300010375 Ga0105239_10001667 Ga0105239_1000166718 366
283 3300013105 Ga0157369_10046210 Ga0157369_100462104 366
284 3300013307 Ga0157372_10003468 Ga0157372_100034686 366
285 3300025911 Ga0207654_10104133 Ga0207654_101041332 366
286 3300025913 Ga0207695_10002199 Ga0207695_1000219923 366
287 3300025914 Ga0207671_10021933 Ga0207671_100219332 366
288 3300025920 Ga0207649_10007325 Ga0207649_100073252 366
289 3300025924 Ga0207694_10031103 Ga0207694_100311034 366
290 3300025949 Ga0207667_10010505 Ga0207667_100105052 366
291 3300025981 Ga0207640_10012552 Ga0207640_100125523 366
292 3300026078 Ga0207702_10026144 Ga0207702_100261443 366
293 3300026142 Ga0207698_10259261 Ga0207698_102592611 366
294 3300049822 Ga0501035_0203588 Ga0501035_0203588_124_1287 366
295 3300003775 Ga0055524_1001969 Ga0055524_10019698 367
296 3300003775 Ga0055524_1003647 Ga0055524_10036472 367
297 3300003792 Ga0055540_1010072 Ga0055540_10100723 367
298 3300003794 Ga0055531_10005579 Ga0055531_100055792 367
299 3300005331 Ga0070670_100142388 Ga0070670_1001423882 367
300 3300005355 Ga0070671_100091014 Ga0070671_1000910142 367
301 3300005563 Ga0068855_100054604 Ga0068855_1000546043 367
302 3300005834 Ga0068851_10032900 Ga0068851_100329002 367
303 3300005983 Ga0081540_1021127 Ga0081540_10211272 367
304 3300006237 Ga0097621_100089013 Ga0097621_1000890133 367
305 3300006237 Ga0097621_100114496 Ga0097621_1001144962 367
306 3300006358 Ga0068871_100140078 Ga0068871_1001400781 367
307 3300006881 Ga0068865_100033866 Ga0068865_1000338662 367
308 3300006944 Ga0099823_1000163 Ga0099823_100016311 367
309 3300009148 Ga0105243_10008438 Ga0105243_100084389 367
310 3300012497 Ga0157319_1000003 Ga0157319_1000003326 367
311 3300013296 Ga0157374_10148198 Ga0157374_101481982 367
312 3300025299 Ga0209256_1000675 Ga0209256_10006756 367
313 3300025299 Ga0209256_1004060 Ga0209256_10040607 367
314 3300025303 Ga0209051_1000981 Ga0209051_100098126 367
315 3300025304 Ga0209257_1002753 Ga0209257_10027538 367
316 3300025304 Ga0209257_1003470 Ga0209257_10034709 367
317 3300025935 Ga0207709_10008092 Ga0207709_100080923 367
318 3300025938 Ga0207704_10100432 Ga0207704_101004321 367
319 3300025940 Ga0207691_10049500 Ga0207691_100495002 367
320 3300025942 Ga0207689_10191357 Ga0207689_101913572 367
321 3300025945 Ga0207679_10163727 Ga0207679_101637272 367
322 3300026023 Ga0207677_10168668 Ga0207677_101686682 367
323 3300026041 Ga0207639_10191486 Ga0207639_101914862 367
324 3300026116 Ga0207674_10067033 Ga0207674_100670332 367
325 3300031548 Ga0307408_100106860 Ga0307408_1001068602 367
326 3300042127 Ga0450890_002413 Ga0450890_002413_859_2028 367
327 3300042438 Ga0439459_0000956 Ga0439459_0000956_1799_2968 367
328 3300046452 Ga0495617_001199 Ga0495617_001199_6306_7472 367
329 3300046460 Ga0495638_0001285 Ga0495638_0001285_2178_3344 367
330 3300046501 Ga0495607_0000029 Ga0495607_0000029_24685_25851 367
331 3300046506 Ga0495583_0016839 Ga0495583_0016839_189_1355 367
332 3300046513 Ga0495616_0003416 Ga0495616_0003416_3008_4174 367
333 3300046520 Ga0495637_0005239 Ga0495637_0005239_5249_6415 367
334 3300046538 Ga0495609_0002356 Ga0495609_0002356_3525_4691 367
335 3300046648 Ga0495611_0000003 Ga0495611_0000003_63553_64719 367
336 3300046660 Ga0495625_0000019 Ga0495625_0000019_241931_243097 367
337 3300046692 Ga0495671_0000549 Ga0495671_0000549_11859_13025 367
338 3300046794 Ga0495589_0000018 Ga0495589_0000018_179017_180183 367
339 3300046810 Ga0495660_0000122 Ga0495660_0000122_53993_55159 367
340 3300047446 Ga0495679_000017 Ga0495679_000017_198494_199660 367
341 3300047469 Ga0495673_0001611 Ga0495673_0001611_10045_11211 367
342 3300049459 Ga0495678_000210 Ga0495678_000210_24658_25824 367
343 3300049460 Ga0495682_0026578 Ga0495682_0026578_588_1754 367
344 3300049568 Ga0501031_0064295 Ga0501031_0064295_490_1659 367
345 3300049576 Ga0501040_0056164 Ga0501040_0056164_902_2071 367
346 3300049579 Ga0501043_0254424 Ga0501043_0254424_70_1239 367
347 3300049580 Ga0501046_0038270 Ga0501046_0038270_1796_2965 367
348 3300049586 Ga0501070_0034335 Ga0501070_0034335_2642_3805 367
349 3300049590 Ga0501074_0107767 Ga0501074_0107767_403_1572 367
350 3300049743 Ga0501081_0030435 Ga0501081_0030435_803_1972 367
351 3300049822 Ga0501035_0169767 Ga0501035_0169767_462_1631 367
352 3300049823 Ga0501044_0094745 Ga0501044_0094745_1657_2826 367
353 3300053087 Ga0500643_000029 Ga0500643_000029_63476_64642 367
354 3300053103 Ga0500555_000067 Ga0500555_000067_13120_14286 367
355 3300060353 Ga0501082_0115329 Ga0501082_0115329_809_1978 367
356 3300005337 Ga0070682_100155219 Ga0070682_1001552191 368
357 3300005434 Ga0070709_10001289 Ga0070709_100012894 368
358 3300005439 Ga0070711_100167624 Ga0070711_1001676241 368
359 3300005518 Ga0070699_100028126 Ga0070699_1000281262 368
360 3300005545 Ga0070695_100008161 Ga0070695_1000081614 368
361 3300013104 Ga0157370_10221136 Ga0157370_102211362 368
362 3300025906 Ga0207699_10001222 Ga0207699_100012222 368
363 3300025916 Ga0207663_10101765 Ga0207663_101017652 368
364 3300037418 Ga0395900_0000690 Ga0395900_0000690_20935_22101 368
365 3300037466 Ga0395898_0001044 Ga0395898_0001044_16667_17833 368
366 3300048918 Ga0496115_0159181 Ga0496115_0159181_592_1785 368
367 3300053078 Ga0495612_0046153 Ga0495612_0046153_345_1508 368
368 3300003578 Ga0006562J51391_1030224 Ga0006562J51391_10302243 369
369 3300003578 Ga0006562J51391_1030226 Ga0006562J51391_10302262 369
370 3300005455 Ga0070663_100020804 Ga0070663_1000208043 369
371 3300005548 Ga0070665_100046608 Ga0070665_1000466082 369
372 3300005563 Ga0068855_100084433 Ga0068855_1000844332 369
373 3300005841 Ga0068863_100040304 Ga0068863_1000403043 369
374 3300025914 Ga0207671_10074315 Ga0207671_100743152 369
375 3300025949 Ga0207667_10009556 Ga0207667_1000955612 369
376 3300026041 Ga0207639_10006186 Ga0207639_100061862 369
377 3300026067 Ga0207678_10074092 Ga0207678_100740923 369
378 3300037471 Ga0395905_0000071 Ga0395905_0000071_48628_49797 369
379 3300005539 Ga0068853_100012791 Ga0068853_1000127917 370
380 3300006353 Ga0075370_10024323 Ga0075370_100243233 370
381 3300025912 Ga0207707_10159737 Ga0207707_101597371 370
382 3300046471 Ga0495650_0000838 Ga0495650_0000838_32470_33627 370
383 3300046507 Ga0495606_0120429 Ga0495606_0120429_71_1228 370
384 3300046512 Ga0495610_0018926 Ga0495610_0018926_2026_3183 370
385 3300046515 Ga0495620_0009426 Ga0495620_0009426_3128_4285 370
386 3300046518 Ga0495631_0000098 Ga0495631_0000098_2677_3834 370
387 3300046524 Ga0495648_0029108 Ga0495648_0029108_2038_3195 370
388 3300047469 Ga0495673_0000347 Ga0495673_0000347_42792_43949 370
389 3300053160 Ga0500633_0000757 Ga0500633_0000757_3346_4503 370
390 3300017792 Ga0163161_10119818 Ga0163161_101198182 371
391 3300037418 Ga0395900_0000256 Ga0395900_0000256_10723_11889 371
392 3300048903 Ga0496100_0031843 Ga0496100_0031843_1646_2812 371
393 3300048904 Ga0496101_0001464 Ga0496101_0001464_1494_2660 371
394 3300049742 Ga0501080_0020342 Ga0501080_0020342_3593_4762 371
395 3300005337 Ga0070682_100003845 Ga0070682_1000038452 372
396 3300005366 Ga0070659_100014938 Ga0070659_1000149384 372
397 3300005539 Ga0068853_100003065 Ga0068853_1000030657 372
398 3300005546 Ga0070696_100220267 Ga0070696_1002202671 372
399 3300005834 Ga0068851_10109103 Ga0068851_101091032 372
400 3300009545 Ga0105237_10411328 Ga0105237_104113282 372
401 3300009551 Ga0105238_10008158 Ga0105238_100081587 372
402 3300013100 Ga0157373_10050414 Ga0157373_100504142 372
403 3300013102 Ga0157371_10042939 Ga0157371_100429393 372
404 3300013307 Ga0157372_10007233 Ga0157372_100072337 372
405 3300025949 Ga0207667_10006504 Ga0207667_100065046 372
406 3300026041 Ga0207639_10027516 Ga0207639_100275163 372
407 3300044672 Ga0466982_0000083 Ga0466982_0000083_3432_4598 372
408 3300046501 Ga0495607_0000061 Ga0495607_0000061_17872_19038 372
409 3300046507 Ga0495606_0019997 Ga0495606_0019997_2105_3271 372
410 3300048924 Ga0496121_0000708 Ga0496121_0000708_10981_12147 372
411 3300048929 Ga0496126_0159567 Ga0496126_0159567_111_1277 372
412 3300005335 Ga0070666_10001529 Ga0070666_1000152916 373
413 3300005336 Ga0070680_100147204 Ga0070680_1001472042 373
414 3300005344 Ga0070661_100006668 Ga0070661_1000066685 373
415 3300005347 Ga0070668_100191115 Ga0070668_1001911151 373
416 3300005435 Ga0070714_100000780 Ga0070714_1000007808 373
417 3300005530 Ga0070679_100191741 Ga0070679_1001917412 373
418 3300005548 Ga0070665_100344440 Ga0070665_1003444402 373
419 3300005842 Ga0068858_100119235 Ga0068858_1001192353 373
420 3300005842 Ga0068858_100205979 Ga0068858_1002059792 373
421 3300006175 Ga0070712_100045432 Ga0070712_1000454323 373
422 3300009093 Ga0105240_10185660 Ga0105240_101856601 373
423 3300009101 Ga0105247_10006880 Ga0105247_100068805 373
424 3300009174 Ga0105241_10022178 Ga0105241_100221783 373
425 3300009545 Ga0105237_10009281 Ga0105237_100092813 373
426 3300009551 Ga0105238_10002060 Ga0105238_100020603 373
427 3300009553 Ga0105249_10234227 Ga0105249_102342272 373
428 3300010375 Ga0105239_10017601 Ga0105239_100176012 373
429 3300013102 Ga0157371_10196539 Ga0157371_101965392 373
430 3300013104 Ga0157370_10011339 Ga0157370_100113399 373
431 3300013105 Ga0157369_10000318 Ga0157369_1000031825 373
432 3300013306 Ga0163162_10563793 Ga0163162_105637931 373
433 3300014968 Ga0157379_10038541 Ga0157379_100385413 373
434 3300015261 Ga0182006_1000556 Ga0182006_10005566 373
435 3300015261 Ga0182006_1000731 Ga0182006_100073124 373
436 3300015262 Ga0182007_10008118 Ga0182007_100081182 373
437 3300015262 Ga0182007_10026907 Ga0182007_100269072 373
438 3300015265 Ga0182005_1002812 Ga0182005_10028125 373
439 3300025903 Ga0207680_10000002 Ga0207680_10000002148 373
440 3300025906 Ga0207699_10134903 Ga0207699_101349032 373
441 3300025913 Ga0207695_10003102 Ga0207695_100031026 373
442 3300025914 Ga0207671_10053665 Ga0207671_100536652 373
443 3300025920 Ga0207649_10009430 Ga0207649_100094305 373
444 3300025924 Ga0207694_10000253 Ga0207694_100002532 373
445 3300025924 Ga0207694_10002841 Ga0207694_1000284113 373
446 3300025929 Ga0207664_10000358 Ga0207664_1000035810 373
447 3300025961 Ga0207712_10013249 Ga0207712_100132495 373
448 3300025972 Ga0207668_10069939 Ga0207668_100699392 373
449 3300026035 Ga0207703_10080414 Ga0207703_100804143 373
450 3300026035 Ga0207703_10198375 Ga0207703_101983752 373
451 3300028379 Ga0268266_10000004 Ga0268266_10000004155 373
452 3300031911 Ga0307412_10006311 Ga0307412_100063116 373
453 3300033180 Ga0307510_10003563 Ga0307510_1000356315 373
454 3300037418 Ga0395900_0015207 Ga0395900_0015207_3545_4708 373
455 3300037418 Ga0395900_0136531 Ga0395900_0136531_1320_2486 373
456 3300041404 Ga0439436_0000007 Ga0439436_0000007_66210_67376 373
457 3300046471 Ga0495650_0000074 Ga0495650_0000074_156706_157872 373
458 3300046512 Ga0495610_0000944 Ga0495610_0000944_14973_16139 373
459 3300046519 Ga0495632_0016317 Ga0495632_0016317_19_1185 373
460 3300046616 Ga0495668_0009921 Ga0495668_0009921_4141_5307 373
461 3300046660 Ga0495625_0126058 Ga0495625_0126058_415_1581 373
462 3300046694 Ga0495649_0001665 Ga0495649_0001665_6200_7366 373
463 3300046810 Ga0495660_0000585 Ga0495660_0000585_4195_5361 373
464 3300047443 Ga0495687_011305 Ga0495687_011305_1531_2697 373
465 3300047469 Ga0495673_0000004 Ga0495673_0000004_898591_899757 373
466 3300048924 Ga0496121_0093178 Ga0496121_0093178_1128_2294 373
467 3300053134 Ga0500658_0003351 Ga0500658_0003351_342_1508 373
468 3300002075 JGI24738J21930_10000426 JGI24738J21930_100004264 374
469 3300025258 Ga0209129_1000697 Ga0209129_10006977 374
470 3300025297 Ga0209758_1005359 Ga0209758_10053595 374
471 3300025299 Ga0209256_1010216 Ga0209256_10102162 374
472 3300041413 Ga0439465_0001319 Ga0439465_0001319_947_2113 374
473 3300046501 Ga0495607_0084794 Ga0495607_0084794_124_1281 374
474 3300046691 Ga0495670_0000482 Ga0495670_0000482_14020_15186 374
475 3300049823 Ga0501044_0194674 Ga0501044_0194674_286_1455 374
476 3300053139 Ga0500568_0003657 Ga0500568_0003657_1539_2708 374
477 3300060353 Ga0501082_0000234 Ga0501082_0000234_2888_4057 374
478 3300003781 Ga0055536_1000126 Ga0055536_100012634 375
479 3300003791 Ga0055530_10000132 Ga0055530_1000013234 375
480 3300003794 Ga0055531_10000296 Ga0055531_1000029620 375
481 3300009093 Ga0105240_10008373 Ga0105240_100083736 375
482 3300009174 Ga0105241_10179605 Ga0105241_101796052 375
483 3300025254 Ga0209148_1001448 Ga0209148_100144812 375
484 3300025292 Ga0209676_1000011 Ga0209676_1000011348 375
485 3300025298 Ga0209050_1000032 Ga0209050_1000032227 375
486 3300025303 Ga0209051_1000382 Ga0209051_10003827 375
487 3300025304 Ga0209257_1000014 Ga0209257_1000014407 375
488 3300027378 Ga0209981_1003695 Ga0209981_10036952 375
489 3300027543 Ga0209999_1000340 Ga0209999_10003401 375
490 3300027665 Ga0209983_1003433 Ga0209983_10034333 375
491 3300027682 Ga0209971_1001679 Ga0209971_10016793 375
492 3300027876 Ga0209974_10020661 Ga0209974_100206613 375
493 3300035086 Ga0373934_0008452 Ga0373934_0008452_696_1862 375
494 3300037471 Ga0395905_0000126 Ga0395905_0000126_96855_98021 375
495 3300048927 Ga0496124_0016949 Ga0496124_0016949_3986_5143 375
496 3300003759 Ga0055525_1000038 Ga0055525_100003834 376
497 3300005344 Ga0070661_100024987 Ga0070661_1000249872 376
498 3300021361 Ga0213872_10009785 Ga0213872_100097852 376
499 3300025230 Ga0209563_100005 Ga0209563_1000051238 376
500 3300025920 Ga0207649_10010983 Ga0207649_100109834 376
501 3300026089 Ga0207648_10027795 Ga0207648_100277952 376
502 3300037418 Ga0395900_0095385 Ga0395900_0095385_1429_2595 376
503 3300037471 Ga0395905_0029445 Ga0395905_0029445_2967_4133 376
504 3300038443 Ga0395901_0033337 Ga0395901_0033337_3026_4192 376
505 3300046460 Ga0495638_0000071 Ga0495638_0000071_144050_145216 376
506 3300046491 Ga0495584_0021179 Ga0495584_0021179_147_1313 376
507 3300046492 Ga0495585_0006782 Ga0495585_0006782_5416_6582 376
508 3300046507 Ga0495606_0000546 Ga0495606_0000546_32438_33604 376
509 3300046513 Ga0495616_0000128 Ga0495616_0000128_26857_28023 376
510 3300046691 Ga0495670_0001847 Ga0495670_0001847_8560_9726 376
511 3300047323 Ga0495683_0042707 Ga0495683_0042707_871_2037 376
512 3300047472 Ga0495686_0018839 Ga0495686_0018839_1599_2765 376
513 3300047472 Ga0495686_0025591 Ga0495686_0025591_2499_3665 376
514 3300048909 Ga0496106_0001770 Ga0496106_0001770_11809_12975 376
515 3300048924 Ga0496121_0001959 Ga0496121_0001959_4819_5985 376
516 3300048924 Ga0496121_0034748 Ga0496121_0034748_471_1637 376
517 3300048927 Ga0496124_0019749 Ga0496124_0019749_1685_2851 376
518 3300005262 Ga0065165_1003978 Ga0065165_10039786 377
519 3300005466 Ga0070685_10000386 Ga0070685_1000038613 377
520 3300009093 Ga0105240_10000453 Ga0105240_1000045322 377
521 3300009545 Ga0105237_10012473 Ga0105237_100124733 377
522 3300010375 Ga0105239_10176769 Ga0105239_101767692 377
523 3300013306 Ga0163162_10051376 Ga0163162_100513762 377
524 3300025226 Ga0209674_100556 Ga0209674_10055612 377
525 3300025233 Ga0209437_102792 Ga0209437_1027923 377
526 3300032004 Ga0307414_10017415 Ga0307414_100174154 377
527 3300046452 Ga0495617_000149 Ga0495617_000149_24728_25894 377
528 3300046515 Ga0495620_0000274 Ga0495620_0000274_6275_7441 377
529 3300049568 Ga0501031_0200034 Ga0501031_0200034_41_1207 377
530 3300049569 Ga0501032_0094424 Ga0501032_0094424_292_1458 377
531 3300049570 Ga0501033_0025850 Ga0501033_0025850_1465_2631 377
532 3300049579 Ga0501043_0004817 Ga0501043_0004817_7481_8647 377
533 3300049586 Ga0501070_0151240 Ga0501070_0151240_251_1417 377
534 3300049822 Ga0501035_0073532 Ga0501035_0073532_1246_2412 377
535 3300049823 Ga0501044_0079869 Ga0501044_0079869_177_1343 377
536 3300005331 Ga0070670_100017151 Ga0070670_1000171515 378
537 3300009177 Ga0105248_10006636 Ga0105248_1000663616 378
538 3300010375 Ga0105239_10020796 Ga0105239_100207962 378
539 3300013104 Ga0157370_10000045 Ga0157370_1000004579 378
540 3300015265 Ga0182005_1000113 Ga0182005_100011329 378
541 3300025297 Ga0209758_1023075 Ga0209758_10230753 378
542 3300025911 Ga0207654_10000251 Ga0207654_1000025118 378
543 3300025913 Ga0207695_10000172 Ga0207695_10000172145 378
544 3300025924 Ga0207694_10008890 Ga0207694_100088906 378
545 3300025941 Ga0207711_10031060 Ga0207711_100310603 378
546 3300028563 Ga0265319_1010847 Ga0265319_10108472 378
547 3300028573 Ga0265334_10000127 Ga0265334_1000012718 378
548 3300028577 Ga0265318_10000024 Ga0265318_1000002448 378
549 3300028800 Ga0265338_10015683 Ga0265338_100156833 378
550 3300031235 Ga0265330_10004503 Ga0265330_100045037 378
551 3300031238 Ga0265332_10009553 Ga0265332_100095532 378
552 3300031239 Ga0265328_10004240 Ga0265328_100042407 378
553 3300031240 Ga0265320_10030607 Ga0265320_100306073 378
554 3300031241 Ga0265325_10021155 Ga0265325_100211553 378
555 3300031242 Ga0265329_10001926 Ga0265329_100019268 378
556 3300031250 Ga0265331_10015495 Ga0265331_100154954 378
557 3300031344 Ga0265316_10004022 Ga0265316_100040226 378
558 3300031595 Ga0265313_10001194 Ga0265313_1000119414 378
559 3300031711 Ga0265314_10001695 Ga0265314_1000169527 378
560 3300031712 Ga0265342_10010591 Ga0265342_100105912 378
561 3300039438 Ga0436360_0478772 Ga0436360_0478772_427_1590 378
562 3300042184 Ga0450908_000033 Ga0450908_000033_3468_4634 378
563 3300046473 Ga0495582_0055081 Ga0495582_0055081_186_1349 378
564 3300046492 Ga0495585_0000063 Ga0495585_0000063_104908_106074 378
565 3300046501 Ga0495607_0004279 Ga0495607_0004279_6230_7396 378
566 3300046518 Ga0495631_0000749 Ga0495631_0000749_3438_4604 378
567 3300046524 Ga0495648_0000643 Ga0495648_0000643_3556_4722 378
568 3300046665 Ga0495661_0000703 Ga0495661_0000703_3513_4679 378
569 3300048907 Ga0496104_0033408 Ga0496104_0033408_1379_2545 378
570 3300048908 Ga0496105_0169066 Ga0496105_0169066_10_1176 378
571 3300048911 Ga0496108_0067336 Ga0496108_0067336_705_1871 378
572 3300048912 Ga0496109_0117634 Ga0496109_0117634_336_1502 378
573 3300048915 Ga0496112_0127012 Ga0496112_0127012_245_1411 378
574 3300048916 Ga0496113_0165710 Ga0496113_0165710_492_1658 378
575 3300048920 Ga0496117_0057035 Ga0496117_0057035_1510_2670 378
576 3300048921 Ga0496118_0006022 Ga0496118_0006022_5997_7157 378
577 3300048925 Ga0496122_0009488 Ga0496122_0009488_2729_3895 378
578 3300048926 Ga0496123_0011106 Ga0496123_0011106_298_1464 378
579 3300049570 Ga0501033_0097146 Ga0501033_0097146_934_2091 378
580 3300053730 Ga0500645_004295 Ga0500645_004295_3455_4621 378
581 3300002737 JGI25162J39368_1004448 JGI25162J39368_10044482 379
582 3300002772 JGI25164J39214_1002185 JGI25164J39214_10021852 379
583 3300003214 JGI25165J46597_1001869 JGI25165J46597_10018698 379
584 3300025231 Ga0207427_100285 Ga0207427_1002858 379
585 3300025233 Ga0209437_100303 Ga0209437_10030360 379
586 3300025261 Ga0209233_1000273 Ga0209233_100027341 379
587 3300025961 Ga0207712_10179214 Ga0207712_101792142 379
588 3300031616 Ga0307508_10263730 Ga0307508_102637302 379
589 3300037312 Ga0395899_0112654 Ga0395899_0112654_146_1312 379
590 3300037466 Ga0395898_0021645 Ga0395898_0021645_2362_3528 379
591 3300038443 Ga0395901_0056054 Ga0395901_0056054_1706_2872 379
592 3300048905 Ga0496102_0097922 Ga0496102_0097922_260_1420 379
593 3300048921 Ga0496118_0064638 Ga0496118_0064638_76_1236 379
594 3300049570 Ga0501033_0001111 Ga0501033_0001111_5268_6431 380
595 3300049586 Ga0501070_0061295 Ga0501070_0061295_737_1900 380
596 iso_pu_bacteria 2537561836 2538833564 380
597 iso_pu_bacteria 2643221562 2643829212 380
598 iso_pu_bacteria 2842780639 2842782576 380
599 iso_pu_bacteria 2895395659 2895396162 380
600 iso_pu_bacteria 2939611941 2939613048 380
601 3300005617 Ga0068859_100145275 Ga0068859_1001452752 381
602 3300006931 Ga0097620_100145276 Ga0097620_1001452762 381
603 3300048929 Ga0496126_0007774 Ga0496126_0007774_6460_7626 381
604 iso_pu_bacteria 2643221695 2644528206 381
605 3300039437 Ga0436365_0770231 Ga0436365_0770231_665_1819 382
606 iso_pu_bacteria 2643221544 2643743895 382
607 iso_pu_bacteria 2643221577 2643896397 382
608 iso_pu_bacteria 2643221585 2643933063 382
609 iso_pu_bacteria 2643221593 2643973362 382
610 iso_pu_bacteria 2643221639 2644217205 382
611 iso_pu_bacteria 2643221646 2644259025 382
612 iso_pu_bacteria 2643221656 2644314312 382
613 iso_pu_bacteria 2643221685 2644478842 382
614 iso_pu_bacteria 2687453130 2687584480 382
615 iso_pu_bacteria 2738541337 2739055763 382
616 iso_pu_bacteria 2739367700 2739732603 382
617 iso_pu_bacteria 2831864461 2831866099 382
618 iso_pu_bacteria 2884411467 2884414890 382
619 iso_pu_bacteria 2894414249 2894414268 382
620 iso_pu_bacteria 2895498888 2895501792 382
621 iso_pu_bacteria 2895511927 2895517658 382
622 iso_pu_bacteria 2895522137 2895525222 382
623 iso_pu_bacteria 2895525241 2895526166 382
624 iso_pu_bacteria 2928963466 2928965321 382
625 iso_pu_bacteria 2995948881 2995949641 382
626 iso_pu_bacteria 8002869464 8002870956 382
627 3300005841 Ga0068863_100004765 Ga0068863_1000047653 383
628 3300005842 Ga0068858_100249985 Ga0068858_1002499852 383
629 3300026088 Ga0207641_10001904 Ga0207641_1000190412 383
630 3300003214 JGI25165J46597_1008766 JGI25165J46597_10087661 384
631 3300005331 Ga0070670_100035638 Ga0070670_1000356383 384
632 3300005338 Ga0068868_100086379 Ga0068868_1000863793 384
633 3300005435 Ga0070714_100000119 Ga0070714_10000011921 384
634 3300005455 Ga0070663_100005144 Ga0070663_1000051443 384
635 3300005457 Ga0070662_100009973 Ga0070662_1000099732 384
636 3300005459 Ga0068867_100067147 Ga0068867_1000671472 384
637 3300005548 Ga0070665_100000242 Ga0070665_10000024246 384
638 3300005563 Ga0068855_100087391 Ga0068855_1000873912 384
639 3300005563 Ga0068855_100169237 Ga0068855_1001692372 384
640 3300005577 Ga0068857_100114194 Ga0068857_1001141942 384
641 3300005578 Ga0068854_100081684 Ga0068854_1000816842 384
642 3300005616 Ga0068852_100029651 Ga0068852_1000296513 384
643 3300005834 Ga0068851_10009023 Ga0068851_100090234 384
644 3300005842 Ga0068858_100012181 Ga0068858_1000121816 384
645 3300009174 Ga0105241_10059418 Ga0105241_100594183 384
646 3300009545 Ga0105237_10096591 Ga0105237_100965912 384
647 3300009545 Ga0105237_10297984 Ga0105237_102979842 384
648 3300009551 Ga0105238_10087813 Ga0105238_100878134 384
649 3300009553 Ga0105249_10052034 Ga0105249_100520343 384
650 3300010375 Ga0105239_10012342 Ga0105239_100123421 384
651 3300013100 Ga0157373_10005386 Ga0157373_100053865 384
652 3300013100 Ga0157373_10211176 Ga0157373_102111762 384
653 3300013102 Ga0157371_10027073 Ga0157371_100270734 384
654 3300013105 Ga0157369_10105608 Ga0157369_101056082 384
655 3300013296 Ga0157374_10329169 Ga0157374_103291692 384
656 3300013307 Ga0157372_10122834 Ga0157372_101228342 384
657 3300013307 Ga0157372_10280541 Ga0157372_102805412 384
658 3300013308 Ga0157375_10014123 Ga0157375_100141233 384
659 3300025261 Ga0209233_1005102 Ga0209233_10051025 384
660 3300025321 Ga0207656_10003708 Ga0207656_100037084 384
661 3300025904 Ga0207647_10000066 Ga0207647_1000006648 384
662 3300025909 Ga0207705_10056409 Ga0207705_100564092 384
663 3300025913 Ga0207695_10012023 Ga0207695_1001202311 384
664 3300025914 Ga0207671_10224729 Ga0207671_102247291 384
665 3300025919 Ga0207657_10073706 Ga0207657_100737061 384
666 3300025924 Ga0207694_10000308 Ga0207694_1000030821 384
667 3300025924 Ga0207694_10188381 Ga0207694_101883812 384
668 3300025925 Ga0207650_10048590 Ga0207650_100485903 384
669 3300025929 Ga0207664_10000090 Ga0207664_1000009042 384
670 3300025932 Ga0207690_10002773 Ga0207690_100027738 384
671 3300025932 Ga0207690_10005359 Ga0207690_100053593 384
672 3300025933 Ga0207706_10012788 Ga0207706_100127886 384
673 3300025933 Ga0207706_10037330 Ga0207706_100373302 384
674 3300025934 Ga0207686_10057224 Ga0207686_100572243 384
675 3300025949 Ga0207667_10014602 Ga0207667_100146028 384
676 3300025949 Ga0207667_10137843 Ga0207667_101378433 384
677 3300025961 Ga0207712_10000589 Ga0207712_1000058922 384
678 3300025981 Ga0207640_10005333 Ga0207640_100053336 384
679 3300026023 Ga0207677_10218693 Ga0207677_102186932 384
680 3300026035 Ga0207703_10057766 Ga0207703_100577663 384
681 3300026041 Ga0207639_10001885 Ga0207639_100018853 384
682 3300026067 Ga0207678_10000577 Ga0207678_100005778 384
683 3300026078 Ga0207702_10018943 Ga0207702_100189433 384
684 3300026078 Ga0207702_10071028 Ga0207702_100710282 384
685 3300026089 Ga0207648_10047957 Ga0207648_100479573 384
686 3300026116 Ga0207674_10063368 Ga0207674_100633682 384
687 3300026116 Ga0207674_10068046 Ga0207674_100680462 384
688 3300028379 Ga0268266_10000008 Ga0268266_10000008960 384
689 3300042006 Ga0439432_008708 Ga0439432_008708_1726_2886 384
690 3300042007 Ga0439449_0026676 Ga0439449_0026676_293_1450 384
691 3300048918 Ga0496115_0000043 Ga0496115_0000043_45989_47149 384
692 3300048927 Ga0496124_0000006 Ga0496124_0000006_374471_375631 384
693 3300048929 Ga0496126_0000087 Ga0496126_0000087_69561_70721 384
694 iso_pu_bacteria 2593339238 2595447738 384
695 iso_pu_bacteria 2593339239 2595450297 384
696 iso_pu_bacteria 2718218334 2721025808 384
697 iso_pu_bacteria 2734482264 2735834225 384
698 iso_pu_bacteria 2738543009 2739225639 384
699 iso_pu_bacteria 2818991440 2819566289 384
700 iso_pu_bacteria 2842914999 2842917093 384
701 iso_pu_bacteria 2842918807 2842920650 384
702 iso_pu_bacteria 2884338543 2884339144 384
703 iso_pu_bacteria 2904463128 2904466565 384
704 iso_pu_bacteria 2919085039 2919086180 384
705 iso_pu_bacteria 2919404418 2919406843 384
706 iso_pu_bacteria 2941471342 2941471933 384
707 iso_pu_bacteria 2953994433 2953995929 384
708 3300002705 JGI25156J39149_1001496 JGI25156J39149_10014962 385
709 3300002737 JGI25162J39368_1001953 JGI25162J39368_10019532 385
710 3300002741 JGI25157J39369_1001381 JGI25157J39369_10013819 385
711 3300002772 JGI25164J39214_1000024 JGI25164J39214_1000024150 385
712 3300003214 JGI25165J46597_1000162 JGI25165J46597_100016290 385
713 3300003756 Ga0055533_1003406 Ga0055533_10034063 385
714 3300003759 Ga0055525_1000055 Ga0055525_100005590 385
715 3300003760 Ga0055527_1000137 Ga0055527_100013726 385
716 3300003760 Ga0055527_1000145 Ga0055527_100014515 385
717 3300003760 Ga0055527_1000889 Ga0055527_10008895 385
718 3300003761 Ga0055535_1000112 Ga0055535_100011226 385
719 3300003761 Ga0055535_1000301 Ga0055535_100030115 385
720 3300003761 Ga0055535_1000471 Ga0055535_10004717 385
721 3300003761 Ga0055535_1000475 Ga0055535_100047510 385
722 3300003762 Ga0055542_1000154 Ga0055542_100015426 385
723 3300003762 Ga0055542_1000157 Ga0055542_100015729 385
724 3300003762 Ga0055542_1000332 Ga0055542_100033215 385
725 3300003762 Ga0055542_1000440 Ga0055542_100044015 385
726 3300003763 Ga0055529_1000120 Ga0055529_1000120101 385
727 3300003763 Ga0055529_1000244 Ga0055529_100024448 385
728 3300003763 Ga0055529_1000389 Ga0055529_100038920 385
729 3300003794 Ga0055531_10003901 Ga0055531_100039013 385
730 3300005293 Ga0065715_10032017 Ga0065715_100320172 385
731 3300005347 Ga0070668_100029459 Ga0070668_1000294593 385
732 3300005367 Ga0070667_100003453 Ga0070667_1000034535 385
733 3300005367 Ga0070667_100050353 Ga0070667_1000503533 385
734 3300005455 Ga0070663_100057779 Ga0070663_1000577791 385
735 3300005539 Ga0068853_100014349 Ga0068853_1000143492 385
736 3300005548 Ga0070665_100000636 Ga0070665_10000063640 385
737 3300005578 Ga0068854_100001314 Ga0068854_10000131410 385
738 3300005614 Ga0068856_100004925 Ga0068856_10000492513 385
739 3300005617 Ga0068859_100000453 Ga0068859_10000045341 385
740 3300005618 Ga0068864_100083722 Ga0068864_1000837222 385
741 3300005841 Ga0068863_100095066 Ga0068863_1000950663 385
742 3300005844 Ga0068862_100000674 Ga0068862_1000006742 385
743 3300006931 Ga0097620_100000453 Ga0097620_10000045341 385
744 3300009093 Ga0105240_10000868 Ga0105240_1000086819 385
745 3300009093 Ga0105240_10001058 Ga0105240_1000105820 385
746 3300009101 Ga0105247_10087478 Ga0105247_100874782 385
747 3300009177 Ga0105248_10422093 Ga0105248_104220932 385
748 3300009545 Ga0105237_10081936 Ga0105237_100819363 385
749 3300010375 Ga0105239_10000027 Ga0105239_10000027132 385
750 3300010375 Ga0105239_10029600 Ga0105239_100296006 385
751 3300012512 Ga0157327_1000119 Ga0157327_10001192 385
752 3300013104 Ga0157370_10014570 Ga0157370_100145705 385
753 3300013308 Ga0157375_10293910 Ga0157375_102939102 385
754 3300013308 Ga0157375_10462636 Ga0157375_104626362 385
755 3300014326 Ga0157380_10199059 Ga0157380_101990592 385
756 3300025226 Ga0209674_100077 Ga0209674_100077195 385
757 3300025228 Ga0209672_100004 Ga0209672_1000041076 385
758 3300025228 Ga0209672_100022 Ga0209672_100022183 385
759 3300025228 Ga0209672_100118 Ga0209672_10011856 385
760 3300025228 Ga0209672_105512 Ga0209672_1055122 385
761 3300025230 Ga0209563_100076 Ga0209563_10007690 385
762 3300025231 Ga0207427_100058 Ga0207427_10005843 385
763 3300025233 Ga0209437_100142 Ga0209437_100142148 385
764 3300025242 Ga0209258_100003 Ga0209258_1000031076 385
765 3300025242 Ga0209258_100004 Ga0209258_100004197 385
766 3300025242 Ga0209258_100122 Ga0209258_10012282 385
767 3300025242 Ga0209258_100158 Ga0209258_10015829 385
768 3300025246 Ga0209646_1002061 Ga0209646_10020613 385
769 3300025250 Ga0209026_1000671 Ga0209026_10006718 385
770 3300025253 Ga0209677_103496 Ga0209677_1034963 385
771 3300025254 Ga0209148_1000025 Ga0209148_1000025380 385
772 3300025254 Ga0209148_1000062 Ga0209148_1000062226 385
773 3300025254 Ga0209148_1000083 Ga0209148_100008359 385
774 3300025254 Ga0209148_1000092 Ga0209148_1000092143 385
775 3300025256 Ga0209759_1000299 Ga0209759_100029915 385
776 3300025261 Ga0209233_1000141 Ga0209233_100014143 385
777 3300025272 Ga0209455_1000004 Ga0209455_10000041076 385
778 3300025272 Ga0209455_1000040 Ga0209455_1000040233 385
779 3300025272 Ga0209455_1000084 Ga0209455_100008459 385
780 3300025292 Ga0209676_1004340 Ga0209676_10043402 385
781 3300025294 Ga0209025_1011481 Ga0209025_10114815 385
782 3300025298 Ga0209050_1006165 Ga0209050_10061656 385
783 3300025304 Ga0209257_1000414 Ga0209257_100041411 385
784 3300025913 Ga0207695_10000441 Ga0207695_1000044122 385
785 3300025913 Ga0207695_10000743 Ga0207695_1000074319 385
786 3300025949 Ga0207667_10000224 Ga0207667_1000022461 385
787 3300025972 Ga0207668_10176337 Ga0207668_101763372 385
788 3300025981 Ga0207640_10000115 Ga0207640_100001156 385
789 3300025986 Ga0207658_10008954 Ga0207658_100089546 385
790 3300026067 Ga0207678_10081182 Ga0207678_100811822 385
791 3300026078 Ga0207702_10001870 Ga0207702_1000187020 385
792 3300026095 Ga0207676_10141543 Ga0207676_101415432 385
793 3300027876 Ga0209974_10012587 Ga0209974_100125873 385
794 3300028379 Ga0268266_10000001 Ga0268266_10000001816 385
795 3300028379 Ga0268266_10343754 Ga0268266_103437542 385
796 3300028380 Ga0268265_10000539 Ga0268265_100005392 385
797 3300028381 Ga0268264_10265542 Ga0268264_102655422 385
798 3300031711 Ga0265314_10011218 Ga0265314_100112186 385
799 3300031731 Ga0307405_10145699 Ga0307405_101456992 385
800 3300032005 Ga0307411_10035548 Ga0307411_100355482 385
801 3300037418 Ga0395900_0009320 Ga0395900_0009320_459_1619 385
802 3300037471 Ga0395905_0002192 Ga0395905_0002192_9458_10618 385
803 3300037471 Ga0395905_0015602 Ga0395905_0015602_5775_6935 385
804 3300042006 Ga0439432_002019 Ga0439432_002019_304_1464 385
805 3300042007 Ga0439449_0032110 Ga0439449_0032110_392_1552 385
806 3300044656 Ga0466969_0003393 Ga0466969_0003393_288_1457 385
807 3300044656 Ga0466969_0069861 Ga0466969_0069861_478_1641 385
808 3300044672 Ga0466982_0000001 Ga0466982_0000001_13455_14618 385
809 3300044684 Ga0466966_0021980 Ga0466966_0021980_691_1854 385
810 3300044693 Ga0466961_0000391 Ga0466961_0000391_11019_12188 385
811 3300044694 Ga0466963_0142660 Ga0466963_0142660_77_1246 385
812 3300044706 Ga0466964_0014757 Ga0466964_0014757_1560_2723 385
813 3300044719 Ga0466971_0000637 Ga0466971_0000637_1045_2208 385
814 3300044765 Ga0466970_0009866 Ga0466970_0009866_3551_4714 385
815 3300044901 Ga0466960_0033971 Ga0466960_0033971_758_1921 385
816 3300045049 Ga0466959_0049203 Ga0466959_0049203_1115_2284 385
817 3300045836 Ga0466958_0034855 Ga0466958_0034855_619_1788 385
818 3300045836 Ga0466958_0166523 Ga0466958_0166523_195_1355 385
819 3300045976 Ga0466967_0023893 Ga0466967_0023893_2551_3720 385
820 3300046525 Ga0495663_0018500 Ga0495663_0018500_645_1805 385
821 3300046525 Ga0495663_0028092 Ga0495663_0028092_33_1193 385
822 3300046537 Ga0495598_0001101 Ga0495598_0001101_161_1321 385
823 3300046539 Ga0495621_0014733 Ga0495621_0014733_617_1777 385
824 3300046615 Ga0495656_0003555 Ga0495656_0003555_3997_5157 385
825 3300046616 Ga0495668_0023691 Ga0495668_0023691_842_2002 385
826 3300046648 Ga0495611_0000014 Ga0495611_0000014_90754_91911 385
827 3300047318 Ga0495636_0004489 Ga0495636_0004489_3101_4261 385
828 3300047318 Ga0495636_0022908 Ga0495636_0022908_1349_2509 385
829 3300048904 Ga0496101_0004029 Ga0496101_0004029_1676_2839 385
830 3300048907 Ga0496104_0017116 Ga0496104_0017116_4822_5985 385
831 3300048908 Ga0496105_0030457 Ga0496105_0030457_194_1357 385
832 3300048910 Ga0496107_0246978 Ga0496107_0246978_121_1284 385
833 3300048911 Ga0496108_0125251 Ga0496108_0125251_131_1291 385
834 3300048913 Ga0496110_0184289 Ga0496110_0184289_204_1364 385
835 3300048918 Ga0496115_0017672 Ga0496115_0017672_1048_2520 385
836 3300048920 Ga0496117_0005621 Ga0496117_0005621_232_1395 385
837 3300048921 Ga0496118_0002106 Ga0496118_0002106_22892_24055 385
838 3300048921 Ga0496118_0003206 Ga0496118_0003206_3429_4592 385
839 3300048922 Ga0496119_0000235 Ga0496119_0000235_44964_46127 385
840 3300048923 Ga0496120_0000208 Ga0496120_0000208_53969_55132 385
841 3300048924 Ga0496121_0000480 Ga0496121_0000480_46713_47876 385
842 3300048924 Ga0496121_0041518 Ga0496121_0041518_69_1232 385
843 3300048929 Ga0496126_0001680 Ga0496126_0001680_18365_19528 385
844 3300049571 Ga0501034_0003143 Ga0501034_0003143_2192_3352 385
845 3300049571 Ga0501034_0114928 Ga0501034_0114928_1065_2228 385
846 3300049572 Ga0501036_0082697 Ga0501036_0082697_236_1396 385
847 3300049572 Ga0501036_0239297 Ga0501036_0239297_175_1344 385
848 3300049574 Ga0501038_0171471 Ga0501038_0171471_187_1347 385
849 3300049579 Ga0501043_0025027 Ga0501043_0025027_1818_2978 385
850 3300049580 Ga0501046_0007434 Ga0501046_0007434_3731_4894 385
851 3300049580 Ga0501046_0007779 Ga0501046_0007779_1491_2651 385
852 3300049580 Ga0501046_0022598 Ga0501046_0022598_2455_3615 385
853 3300049581 Ga0501047_0000492 Ga0501047_0000492_3804_4964 385
854 3300049581 Ga0501047_0001924 Ga0501047_0001924_3955_5115 385
855 3300049586 Ga0501070_0006408 Ga0501070_0006408_4823_5983 385
856 3300049586 Ga0501070_0006453 Ga0501070_0006453_7873_9033 385
857 3300049589 Ga0501073_0018962 Ga0501073_0018962_3317_4477 385
858 3300049590 Ga0501074_0024898 Ga0501074_0024898_1441_2601 385
859 3300049590 Ga0501074_0028997 Ga0501074_0028997_344_1504 385
860 3300049741 Ga0501079_0031442 Ga0501079_0031442_252_1412 385
861 3300049742 Ga0501080_0000381 Ga0501080_0000381_8050_9210 385
862 3300049742 Ga0501080_0001633 Ga0501080_0001633_13800_14960 385
863 3300049822 Ga0501035_0022978 Ga0501035_0022978_2616_3776 385
864 3300053093 Ga0500651_0000166 Ga0500651_0000166_27925_29088 385
865 3300053093 Ga0500651_0074795 Ga0500651_0074795_764_1933 385
866 3300060353 Ga0501082_0077129 Ga0501082_0077129_144_1304 385
867 3300061719 Ga0466962_0000447 Ga0466962_0000447_12754_13917 385
868 3300002705 JGI25156J39149_1000042 JGI25156J39149_100004262 386
869 3300002705 JGI25156J39149_1003775 JGI25156J39149_10037752 386
870 3300002737 JGI25162J39368_1000360 JGI25162J39368_100036013 386
871 3300002737 JGI25162J39368_1004638 JGI25162J39368_10046382 386
872 3300002738 JGI25154J39366_1006572 JGI25154J39366_10065721 386
873 3300002741 JGI25157J39369_1000261 JGI25157J39369_100026113 386
874 3300002741 JGI25157J39369_1002080 JGI25157J39369_10020804 386
875 3300002771 JGI25163J39215_1000788 JGI25163J39215_10007882 386
876 3300002772 JGI25164J39214_1000238 JGI25164J39214_100023824 386
877 3300002772 JGI25164J39214_1003814 JGI25164J39214_10038142 386
878 3300002773 JGI25152J39213_1002091 JGI25152J39213_10020912 386
879 3300003214 JGI25165J46597_1000301 JGI25165J46597_100030143 386
880 3300003215 JGI25153J46596_10018263 JGI25153J46596_100182633 386
881 3300003316 rootH1_10001043 rootH1_100010432 386
882 3300003320 rootH2_10011597 rootH2_1001159711 386
883 3300003320 rootH2_10098227 rootH2_100982275 386
884 3300003322 rootL2_10007947 rootL2_100079478 386
885 3300003751 Ga0055538_1000543 Ga0055538_10005433 386
886 3300003756 Ga0055533_1000449 Ga0055533_10004493 386
887 3300003761 Ga0055535_1000434 Ga0055535_100043413 386
888 3300003761 Ga0055535_1003984 Ga0055535_10039842 386
889 3300003761 Ga0055535_1012683 Ga0055535_10126831 386
890 3300003762 Ga0055542_1000213 Ga0055542_100021347 386
891 3300003762 Ga0055542_1000453 Ga0055542_100045313 386
892 3300003763 Ga0055529_1000268 Ga0055529_100026813 386
893 3300003771 Ga0055526_1002801 Ga0055526_10028018 386
894 3300003791 Ga0055530_10011347 Ga0055530_100113472 386
895 3300003794 Ga0055531_10000043 Ga0055531_1000004363 386
896 3300005262 Ga0065165_1000390 Ga0065165_100039055 386
897 3300005327 Ga0070658_10021209 Ga0070658_100212092 386
898 3300005327 Ga0070658_10041437 Ga0070658_100414372 386
899 3300005336 Ga0070680_100005739 Ga0070680_1000057394 386
900 3300005336 Ga0070680_100201847 Ga0070680_1002018472 386
901 3300005338 Ga0068868_100003427 Ga0068868_1000034274 386
902 3300005338 Ga0068868_100219334 Ga0068868_1002193341 386
903 3300005339 Ga0070660_100002464 Ga0070660_10000246416 386
904 3300005339 Ga0070660_100059049 Ga0070660_1000590491 386
905 3300005339 Ga0070660_100115769 Ga0070660_1001157692 386
906 3300005340 Ga0070689_100001481 Ga0070689_1000014812 386
907 3300005344 Ga0070661_100141296 Ga0070661_1001412961 386
908 3300005366 Ga0070659_100004826 Ga0070659_1000048268 386
909 3300005366 Ga0070659_100012735 Ga0070659_1000127355 386
910 3300005366 Ga0070659_100052813 Ga0070659_1000528132 386
911 3300005366 Ga0070659_100232269 Ga0070659_1002322691 386
912 3300005367 Ga0070667_100211434 Ga0070667_1002114342 386
913 3300005455 Ga0070663_100010925 Ga0070663_1000109254 386
914 3300005455 Ga0070663_100014972 Ga0070663_1000149722 386
915 3300005456 Ga0070678_100204557 Ga0070678_1002045572 386
916 3300005457 Ga0070662_100105637 Ga0070662_1001056372 386
917 3300005458 Ga0070681_10000006 Ga0070681_1000000655 386
918 3300005458 Ga0070681_10000114 Ga0070681_1000011452 386
919 3300005458 Ga0070681_10036274 Ga0070681_100362743 386
920 3300005467 Ga0070706_100000246 Ga0070706_10000024653 386
921 3300005471 Ga0070698_100024453 Ga0070698_1000244534 386
922 3300005530 Ga0070679_100000375 Ga0070679_1000003754 386
923 3300005539 Ga0068853_100353114 Ga0068853_1003531141 386
924 3300005546 Ga0070696_100037414 Ga0070696_1000374142 386
925 3300005563 Ga0068855_100026162 Ga0068855_1000261624 386
926 3300005563 Ga0068855_100055439 Ga0068855_1000554392 386
927 3300005563 Ga0068855_100098855 Ga0068855_1000988553 386
928 3300005578 Ga0068854_100075522 Ga0068854_1000755222 386
929 3300005614 Ga0068856_100000524 Ga0068856_10000052417 386
930 3300006195 Ga0075366_10016201 Ga0075366_100162012 386
931 3300006353 Ga0075370_10012781 Ga0075370_100127813 386
932 3300006353 Ga0075370_10080959 Ga0075370_100809592 386
933 3300007788 Ga0099795_10000001 Ga0099795_10000001100 386
934 3300009093 Ga0105240_10023924 Ga0105240_100239248 386
935 3300009093 Ga0105240_10181414 Ga0105240_101814142 386
936 3300009174 Ga0105241_10116216 Ga0105241_101162162 386
937 3300009545 Ga0105237_10000036 Ga0105237_10000036122 386
938 3300009551 Ga0105238_10018070 Ga0105238_100180707 386
939 3300009551 Ga0105238_10029729 Ga0105238_100297293 386
940 3300009551 Ga0105238_10083391 Ga0105238_100833913 386
941 3300009551 Ga0105238_10355216 Ga0105238_103552162 386
942 3300010159 Ga0099796_10000001 Ga0099796_1000000185 386
943 3300013100 Ga0157373_10017594 Ga0157373_100175942 386
944 3300013102 Ga0157371_10111704 Ga0157371_101117042 386
945 3300013104 Ga0157370_10046561 Ga0157370_100465614 386
946 3300013104 Ga0157370_10139004 Ga0157370_101390042 386
947 3300013105 Ga0157369_10031828 Ga0157369_100318283 386
948 3300013105 Ga0157369_10093848 Ga0157369_100938482 386
949 3300013306 Ga0163162_10228414 Ga0163162_102284142 386
950 3300013307 Ga0157372_10050379 Ga0157372_100503793 386
951 3300013307 Ga0157372_10369738 Ga0157372_103697382 386
952 3300014497 Ga0182008_10023024 Ga0182008_100230242 386
953 3300015685 Ga0183369_1004 Ga0183369_100433 386
954 3300015687 Ga0183368_1003 Ga0183368_1003127 386
955 3300021361 Ga0213872_10000044 Ga0213872_100000442 386
956 3300021361 Ga0213872_10000125 Ga0213872_1000012521 386
957 3300021361 Ga0213872_10000284 Ga0213872_1000028417 386
958 3300021361 Ga0213872_10001189 Ga0213872_100011894 386
959 3300021361 Ga0213872_10018969 Ga0213872_100189693 386
960 3300025207 Ga0209760_100341 Ga0209760_10034111 386
961 3300025224 Ga0209784_100156 Ga0209784_10015613 386
962 3300025226 Ga0209674_100033 Ga0209674_100033138 386
963 3300025228 Ga0209672_100204 Ga0209672_10020422 386
964 3300025231 Ga0207427_100070 Ga0207427_10007099 386
965 3300025231 Ga0207427_102685 Ga0207427_1026853 386
966 3300025231 Ga0207427_102846 Ga0207427_1028464 386
967 3300025233 Ga0209437_100059 Ga0209437_100059157 386
968 3300025233 Ga0209437_100141 Ga0209437_10014131 386
969 3300025233 Ga0209437_104557 Ga0209437_1045572 386
970 3300025242 Ga0209258_100034 Ga0209258_10003444 386
971 3300025242 Ga0209258_100564 Ga0209258_10056417 386
972 3300025242 Ga0209258_101959 Ga0209258_1019593 386
973 3300025246 Ga0209646_1002602 Ga0209646_10026023 386
974 3300025246 Ga0209646_1003394 Ga0209646_10033942 386
975 3300025246 Ga0209646_1005145 Ga0209646_10051452 386
976 3300025250 Ga0209026_1000269 Ga0209026_100026943 386
977 3300025250 Ga0209026_1000944 Ga0209026_100094412 386
978 3300025254 Ga0209148_1000001 Ga0209148_1000001660 386
979 3300025254 Ga0209148_1000002 Ga0209148_1000002749 386
980 3300025256 Ga0209759_1000915 Ga0209759_10009157 386
981 3300025256 Ga0209759_1002563 Ga0209759_10025633 386
982 3300025256 Ga0209759_1012781 Ga0209759_10127812 386
983 3300025261 Ga0209233_1000002 Ga0209233_10000021571 386
984 3300025272 Ga0209455_1000054 Ga0209455_100005413 386
985 3300025272 Ga0209455_1000318 Ga0209455_100031833 386
986 3300025273 Ga0209673_1008915 Ga0209673_10089153 386
987 3300025295 Ga0209564_1000051 Ga0209564_1000051125 386
988 3300025297 Ga0209758_1000096 Ga0209758_100009675 386
989 3300025298 Ga0209050_1001300 Ga0209050_10013008 386
990 3300025303 Ga0209051_1004799 Ga0209051_10047995 386
991 3300025304 Ga0209257_1000182 Ga0209257_100018254 386
992 3300025904 Ga0207647_10047939 Ga0207647_100479392 386
993 3300025904 Ga0207647_10088879 Ga0207647_100888792 386
994 3300025907 Ga0207645_10036201 Ga0207645_100362012 386
995 3300025909 Ga0207705_10007229 Ga0207705_100072297 386
996 3300025910 Ga0207684_10002337 Ga0207684_100023375 386
997 3300025912 Ga0207707_10000095 Ga0207707_1000009576 386
998 3300025912 Ga0207707_10000869 Ga0207707_1000086920 386
999 3300025912 Ga0207707_10017761 Ga0207707_100177613 386
1000 3300025912 Ga0207707_10301994 Ga0207707_103019941 386
1001 3300025913 Ga0207695_10000938 Ga0207695_100009383 386
1002 3300025913 Ga0207695_10137445 Ga0207695_101374452 386
1003 3300025914 Ga0207671_10001404 Ga0207671_100014049 386
1004 3300025919 Ga0207657_10040416 Ga0207657_100404162 386
1005 3300025919 Ga0207657_10054162 Ga0207657_100541623 386
1006 3300025919 Ga0207657_10063548 Ga0207657_100635482 386
1007 3300025921 Ga0207652_10000560 Ga0207652_1000056034 386
1008 3300025924 Ga0207694_10041392 Ga0207694_100413922 386
1009 3300025932 Ga0207690_10011576 Ga0207690_100115763 386
1010 3300025932 Ga0207690_10015169 Ga0207690_100151693 386
1011 3300025932 Ga0207690_10029644 Ga0207690_100296442 386
1012 3300025933 Ga0207706_10038523 Ga0207706_100385233 386
1013 3300025933 Ga0207706_10135429 Ga0207706_101354292 386
1014 3300025936 Ga0207670_10083824 Ga0207670_100838242 386
1015 3300025949 Ga0207667_10032547 Ga0207667_100325473 386
1016 3300025949 Ga0207667_10039237 Ga0207667_100392374 386
1017 3300025949 Ga0207667_10058768 Ga0207667_100587681 386
1018 3300025949 Ga0207667_10167675 Ga0207667_101676752 386
1019 3300025981 Ga0207640_10043090 Ga0207640_100430902 386
1020 3300026041 Ga0207639_10119391 Ga0207639_101193912 386
1021 3300026067 Ga0207678_10000643 Ga0207678_1000064325 386
1022 3300026067 Ga0207678_10026314 Ga0207678_100263143 386
1023 3300026078 Ga0207702_10000717 Ga0207702_1000071718 386
1024 3300026078 Ga0207702_10187910 Ga0207702_101879101 386
1025 3300026116 Ga0207674_10203879 Ga0207674_102038792 386
1026 3300027512 Ga0209179_1000006 Ga0209179_100000648 386
1027 3300028794 Ga0307515_10000066 Ga0307515_10000066117 386
1028 3300028794 Ga0307515_10006088 Ga0307515_1000608822 386
1029 3300028794 Ga0307515_10091298 Ga0307515_100912983 386
1030 3300031250 Ga0265331_10002534 Ga0265331_100025346 386
1031 3300031251 Ga0265327_10000028 Ga0265327_10000028178 386
1032 3300031548 Ga0307408_100161390 Ga0307408_1001613902 386
1033 3300031649 Ga0307514_10020148 Ga0307514_100201482 386
1034 3300031665 Ga0316575_10035503 Ga0316575_100355032 386
1035 3300031730 Ga0307516_10000109 Ga0307516_100001095 386
1036 3300032002 Ga0307416_100363264 Ga0307416_1003632642 386
1037 3300035114 Ga0373939_0000033 Ga0373939_0000033_21476_22645 386
1038 3300035121 Ga0373960_0008484 Ga0373960_0008484_535_1704 386
1039 3300037466 Ga0395898_0035555 Ga0395898_0035555_2080_3246 386
1040 3300037471 Ga0395905_0001072 Ga0395905_0001072_14602_15768 386
1041 3300037471 Ga0395905_0020334 Ga0395905_0020334_1789_2958 386
1042 3300037471 Ga0395905_0103718 Ga0395905_0103718_1455_2621 386
1043 3300037471 Ga0395905_0113959 Ga0395905_0113959_1253_2419 386
1044 3300038443 Ga0395901_0003311 Ga0395901_0003311_1813_2979 386
1045 3300038443 Ga0395901_0051425 Ga0395901_0051425_524_1690 386
1046 3300039447 Ga0436361_0117093 Ga0436361_0117093_2121_3287 386
1047 3300039447 Ga0436361_0181855 Ga0436361_0181855_7949_9115 386
1048 3300039447 Ga0436361_0285207 Ga0436361_0285207_25374_26540 386
1049 3300039447 Ga0436361_0332176 Ga0436361_0332176_14368_15534 386
1050 3300039447 Ga0436361_0549178 Ga0436361_0549178_3494_4660 386
1051 3300039447 Ga0436361_0886712 Ga0436361_0886712_1806_2975 386
1052 3300039447 Ga0436361_1071853 Ga0436361_1071853_433_1599 386
1053 3300041407 Ga0439447_002843 Ga0439447_002843_996_2162 386
1054 3300041459 Ga0451800_0725589 Ga0451800_0725589_523_1689 386
1055 3300041462 Ga0451806_572563 Ga0451806_572563_1654_2820 386
1056 3300042126 Ga0450888_000128 Ga0450888_000128_3238_4407 386
1057 3300042127 Ga0450890_001491 Ga0450890_001491_487_1656 386
1058 3300042130 Ga0450892_000486 Ga0450892_000486_2178_3347 386
1059 3300042144 Ga0450889_000377 Ga0450889_000377_1152_2321 386
1060 3300042532 Ga0450893_0001034 Ga0450893_0001034_839_2008 386
1061 3300044656 Ga0466969_0005020 Ga0466969_0005020_991_2157 386
1062 3300044658 Ga0466972_0000761 Ga0466972_0000761_6777_7943 386
1063 3300044683 Ga0466965_0003924 Ga0466965_0003924_4825_5991 386
1064 3300044684 Ga0466966_0018259 Ga0466966_0018259_2404_3570 386
1065 3300044684 Ga0466966_0077877 Ga0466966_0077877_279_1445 386
1066 3300044693 Ga0466961_0007752 Ga0466961_0007752_2151_3317 386
1067 3300044693 Ga0466961_0013754 Ga0466961_0013754_938_2104 386
1068 3300044693 Ga0466961_0054799 Ga0466961_0054799_1316_2482 386
1069 3300044694 Ga0466963_0229597 Ga0466963_0229597_110_1276 386
1070 3300044706 Ga0466964_0001887 Ga0466964_0001887_162_1328 386
1071 3300044719 Ga0466971_0008613 Ga0466971_0008613_2765_3931 386
1072 3300044719 Ga0466971_0014458 Ga0466971_0014458_121_1287 386
1073 3300044765 Ga0466970_0054849 Ga0466970_0054849_434_1600 386
1074 3300044842 Ga0466957_0055839 Ga0466957_0055839_710_1876 386
1075 3300044842 Ga0466957_0066255 Ga0466957_0066255_786_1952 386
1076 3300044901 Ga0466960_0017957 Ga0466960_0017957_273_1439 386
1077 3300045049 Ga0466959_0000132 Ga0466959_0000132_32120_33286 386
1078 3300045049 Ga0466959_0036023 Ga0466959_0036023_2396_3562 386
1079 3300045836 Ga0466958_0041201 Ga0466958_0041201_1309_2475 386
1080 3300045976 Ga0466967_0116785 Ga0466967_0116785_729_1895 386
1081 3300046460 Ga0495638_0000152 Ga0495638_0000152_61034_62200 386
1082 3300046460 Ga0495638_0000378 Ga0495638_0000378_26970_28136 386
1083 3300046471 Ga0495650_0000112 Ga0495650_0000112_26945_28111 386
1084 3300046471 Ga0495650_0015578 Ga0495650_0015578_1067_2233 386
1085 3300046507 Ga0495606_0000749 Ga0495606_0000749_1846_3012 386
1086 3300046542 Ga0495597_0006722 Ga0495597_0006722_1922_3088 386
1087 3300046557 Ga0495622_0009004 Ga0495622_0009004_899_2065 386
1088 3300046616 Ga0495668_0001831 Ga0495668_0001831_8067_9233 386
1089 3300046660 Ga0495625_0122019 Ga0495625_0122019_230_1396 386
1090 3300046691 Ga0495670_0039847 Ga0495670_0039847_237_1406 386
1091 3300046694 Ga0495649_0000594 Ga0495649_0000594_10503_11669 386
1092 3300047443 Ga0495687_000248 Ga0495687_000248_23371_24537 386
1093 3300047673 Ga0495593_0012401 Ga0495593_0012401_2269_3438 386
1094 3300048909 Ga0496106_0187888 Ga0496106_0187888_132_1298 386
1095 3300048916 Ga0496113_0004524 Ga0496113_0004524_6024_7190 386
1096 3300048918 Ga0496115_0000008 Ga0496115_0000008_186182_187348 386
1097 3300048918 Ga0496115_0000474 Ga0496115_0000474_4901_6067 386
1098 3300048918 Ga0496115_0039836 Ga0496115_0039836_627_1793 386
1099 3300048920 Ga0496117_0014937 Ga0496117_0014937_2307_3473 386
1100 3300048921 Ga0496118_0005866 Ga0496118_0005866_7517_8683 386
1101 3300048929 Ga0496126_0008899 Ga0496126_0008899_5144_6310 386
1102 3300048929 Ga0496126_0301082 Ga0496126_0301082_60_1229 386
1103 3300049568 Ga0501031_0032185 Ga0501031_0032185_1317_2480 386
1104 3300049568 Ga0501031_0080818 Ga0501031_0080818_80_1246 386
1105 3300049569 Ga0501032_0001872 Ga0501032_0001872_10148_11314 386
1106 3300049570 Ga0501033_0054178 Ga0501033_0054178_782_1945 386
1107 3300049571 Ga0501034_0003634 Ga0501034_0003634_8294_9460 386
1108 3300049571 Ga0501034_0005592 Ga0501034_0005592_2921_4087 386
1109 3300049571 Ga0501034_0048973 Ga0501034_0048973_2386_3549 386
1110 3300049572 Ga0501036_0095052 Ga0501036_0095052_294_1457 386
1111 3300049573 Ga0501037_0032551 Ga0501037_0032551_2663_3826 386
1112 3300049575 Ga0501039_0099173 Ga0501039_0099173_426_1592 386
1113 3300049579 Ga0501043_0094542 Ga0501043_0094542_720_1886 386
1114 3300049580 Ga0501046_0071888 Ga0501046_0071888_107_1270 386
1115 3300049580 Ga0501046_0173733 Ga0501046_0173733_40_1206 386
1116 3300049581 Ga0501047_0000904 Ga0501047_0000904_5359_6525 386
1117 3300049581 Ga0501047_0010764 Ga0501047_0010764_2590_3753 386
1118 3300049582 Ga0501048_0081261 Ga0501048_0081261_1086_2249 386
1119 3300049583 Ga0501067_0000426 Ga0501067_0000426_18959_20125 386
1120 3300049585 Ga0501069_0002407 Ga0501069_0002407_6965_8131 386
1121 3300049586 Ga0501070_0001125 Ga0501070_0001125_17545_18708 386
1122 3300049586 Ga0501070_0003048 Ga0501070_0003048_4582_5748 386
1123 3300049586 Ga0501070_0003914 Ga0501070_0003914_8601_9767 386
1124 3300049586 Ga0501070_0050466 Ga0501070_0050466_2264_3424 386
1125 3300049586 Ga0501070_0055108 Ga0501070_0055108_1565_2728 386
1126 3300049587 Ga0501071_0002518 Ga0501071_0002518_8168_9331 386
1127 3300049588 Ga0501072_0001604 Ga0501072_0001604_8454_9620 386
1128 3300049589 Ga0501073_0000557 Ga0501073_0000557_16283_17446 386
1129 3300049589 Ga0501073_0000757 Ga0501073_0000757_21282_22448 386
1130 3300049589 Ga0501073_0090310 Ga0501073_0090310_69_1232 386
1131 3300049590 Ga0501074_0000162 Ga0501074_0000162_1772_2935 386
1132 3300049590 Ga0501074_0001529 Ga0501074_0001529_8018_9184 386
1133 3300049590 Ga0501074_0078312 Ga0501074_0078312_83_1246 386
1134 3300049661 Ga0501217_032436 Ga0501217_032436_68_1237 386
1135 3300049662 Ga0501222_003405 Ga0501222_003405_489_1658 386
1136 3300049665 Ga0501227_013967 Ga0501227_013967_479_1648 386
1137 3300049668 Ga0501233_026477 Ga0501233_026477_37_1206 386
1138 3300049687 Ga0501258_000331 Ga0501258_000331_1532_2701 386
1139 3300049704 Ga0501221_001217 Ga0501221_001217_183_1352 386
1140 3300049706 Ga0501229_000077 Ga0501229_000077_2560_3729 386
1141 3300049741 Ga0501079_0018533 Ga0501079_0018533_826_1992 386
1142 3300049742 Ga0501080_0000997 Ga0501080_0000997_17232_18398 386
1143 3300049742 Ga0501080_0004536 Ga0501080_0004536_2373_3536 386
1144 3300049742 Ga0501080_0011327 Ga0501080_0011327_724_1890 386
1145 3300049742 Ga0501080_0017413 Ga0501080_0017413_1007_2170 386
1146 3300049742 Ga0501080_0133574 Ga0501080_0133574_462_1622 386
1147 3300049744 Ga0501083_0001097 Ga0501083_0001097_14672_15838 386
1148 3300049764 Ga0501267_001243 Ga0501267_001243_546_1715 386
1149 3300049778 Ga0501282_003805 Ga0501282_003805_402_1571 386
1150 3300049822 Ga0501035_0055098 Ga0501035_0055098_2299_3465 386
1151 3300049822 Ga0501035_0180379 Ga0501035_0180379_603_1763 386
1152 3300049823 Ga0501044_0003235 Ga0501044_0003235_263_1426 386
1153 3300049823 Ga0501044_0007762 Ga0501044_0007762_5182_6348 386
1154 3300049823 Ga0501044_0320591 Ga0501044_0320591_212_1378 386
1155 3300050489 nmdc:mga03683_2992_c1 nmdc:mga03683_2992_c1_3459_4625 386
1156 3300050493 nmdc:mga0k408_10407_c1 nmdc:mga0k408_10407_c1_1502_2668 386
1157 3300050493 nmdc:mga0k408_10582_c1 nmdc:mga0k408_10582_c1_1522_2688 386
1158 3300050493 nmdc:mga0k408_20025_c1 nmdc:mga0k408_20025_c1_212_1378 386
1159 3300050494 nmdc:mga06z11_37238_c1 nmdc:mga06z11_37238_c1_1222_2388 386
1160 3300050496 nmdc:mga07m45_10280_c1 nmdc:mga07m45_10280_c1_2217_3383 386
1161 3300050496 nmdc:mga07m45_44945_c1 nmdc:mga07m45_44945_c1_677_1843 386
1162 3300053086 Ga0500578_0000075 Ga0500578_0000075_40630_41796 386
1163 3300053148 Ga0500590_005767 Ga0500590_005767_381_1547 386
1164 3300053156 Ga0500622_0003844 Ga0500622_0003844_49_1218 386
1165 3300059421 Ga0590071_001475 Ga0590071_001475_2901_4067 386
1166 3300060353 Ga0501082_0005091 Ga0501082_0005091_3817_4983 386
1167 3300061719 Ga0466962_0006825 Ga0466962_0006825_1366_2532 386
1168 3300001904 JGI24736J21556_1002726 JGI24736J21556_10027262 388
1169 3300005262 Ga0065165_1000913 Ga0065165_100091326 388
1170 3300013105 Ga0157369_10006716 Ga0157369_100067167 388
1171 3300025229 Ga0209147_105652 Ga0209147_1056522 388
1172 3300025302 Ga0207426_1023974 Ga0207426_10239743 388
1173 3300025303 Ga0209051_1004509 Ga0209051_10045096 388
1174 3300025904 Ga0207647_10000015 Ga0207647_1000001584 388
1175 3300046507 Ga0495606_0000301 Ga0495606_0000301_57474_58640 388
1176 3300047472 Ga0495686_0000024 Ga0495686_0000024_328200_329366 388
1177 3300047472 Ga0495686_0000409 Ga0495686_0000409_37207_38373 388
1178 3300048920 Ga0496117_0038495 Ga0496117_0038495_1047_2213 388
1179 3300048921 Ga0496118_0001013 Ga0496118_0001013_5211_6377 388
1180 3300048921 Ga0496118_0001137 Ga0496118_0001137_184_1350 388
1181 3300048924 Ga0496121_0000109 Ga0496121_0000109_42264_43430 388
1182 3300048925 Ga0496122_0051113 Ga0496122_0051113_1304_2470 388
1183 3300048926 Ga0496123_0021372 Ga0496123_0021372_3497_4663 388
1184 3300048928 Ga0496125_0007510 Ga0496125_0007510_4047_5213 388

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02687

FtsX

FtsX-like permease family

258

380

0.88

PF12704

MacB_PCD

MacB-like periplasmic core domain

18

231

0.72

Structural Annotation

Top 5 Hits

ID Description Score Start End
7w7c-assembly1.cif.gz_B-2 heme exporter in the unliganded form 0.7616 263 385
7oat-assembly1.cif.gz_B structural basis for targeted p97 remodelling by aspl as prerequisite for p97 trimethylation by mettl21d 0.7091 129 199
5f9q-assembly1.cif.gz_A crystal structure of the extracellular domain of noncanonic abc-type transporter yknz from gram-positive bacteria 0.7038 53 244
8tzj-assembly1.cif.gz_D cryo-em structure of vibrio cholerae ftse/ftsx complex 0.6973 247 381
5f9q-assembly1.cif.gz_A crystal structure of the extracellular domain of noncanonic abc-type transporter yknz from gram-positive bacteria 0.6969 53 244
ID Description Score Start End Superfamily
2b0gA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.7213 208 244 3.30.70.330
af_Q21322_125_206_3.30.70.330 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.718 210 244 3.30.70.330
af_Q8I3T1_44_150_3.30.70.330 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.7147 206 252 3.30.70.330
af_Q54HN5_852_956_3.30.70.330 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.7068 207 244 3.30.70.330
af_Q5AGV4_31_131_3.30.70.330 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.7038 207 250 3.30.70.330
ID Description Score Start End GO Terms
AF-A0A1B5DAU1-F1-model_v4 ABC3 transporter permease C-terminal domain-containing protein 0.9081 2 378 GO:0005886
AF-A0A1B5DAU1-F1-model_v4 ABC3 transporter permease C-terminal domain-containing protein 0.89 2 378 GO:0005886
AF-A0A6L7N2S5-F1-model_v4 FtsX-like permease family protein 0.8835 1 388 GO:0005886
AF-A0A6L7XSH9-F1-model_v4 ABC transporter permease 0.8785 59 388 GO:0005886
AF-A0A368C7Z6-F1-model_v4 ABC3 transporter permease C-terminal domain-containing protein 0.876 3 388 GO:0005886

Feature Viewer

pLDDT pTM Quality
85.37 0.68 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map