F491300

General Info

Members Datasets Scaffolds Average Seq Length
1180 673 946 306

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|8019638758|8019640110
Length 342
Sequence TESKKRDVALVVDDSPETLRLLTDALDSAGMTVMVALDGAAAMRIVDQITPDIVLLDAVMPGMDGFETCRRLKRDAGLANVPVIFMTGLAETEHIVRGLEAGGVDYVTKPIVIEEMLARIRVHLGNARLTQSARAALDVSGRFLFAVNRQGKLLWATPQAQKLLADHHGAQADDDFVLPVSLLQWLEQAKGKGSSKSQAASLPDNPQLRLYYMGETAPNEFLLRLSRESGTAPPPEFTSELGLTTREGEVLAWLSKGKTNRDIAQILGLSPRTVDKHLEQIYSKLGSREPDRGCGDCNECDKKEFVVLLRVSWDVTQHTVSSRRRPGPITPGSDLAKTSRSD

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
5 2511231221 Azospirillum lipoferum 4B Isolate Rhizosphere
6 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
7 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
8 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
9 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
10 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
11 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
12 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
13 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
14 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
15 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
16 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
17 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
18 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
19 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
20 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
21 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
22 2595698237 Methylobacterium sp. UNCCL125 Isolate Unclassified
23 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
24 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
25 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
26 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
27 2643221569 Achromobacter sp. Root565 Isolate Unclassified
28 2643221594 Achromobacter sp. Root170 Isolate Unclassified
29 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
30 2643221717 Acidovorax sp. Root267 Isolate Unclassified
31 2643221718 Rhizobium sp. Root268 Isolate Unclassified
32 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
33 2671180139 Chelativorans sp. A52C2 Isolate Unclassified
34 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
35 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
36 2738541281 Methylobacterium sp. GV094 Isolate Unclassified
37 2738543032 Methylobacterium sp. GV104 Isolate Unclassified
38 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
39 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
40 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
41 2791355199
42 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
43 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
44 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
45 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
46 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
47 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
48 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
49 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
50 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
51 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
52 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
53 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
54 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
55 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
56 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
57 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
58 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
59 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
60 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
61 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
62 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
63 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
64 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
65 2829745981 Methylorubrum rhodinum DSM 2163 Isolate Rhizosphere
66 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
67 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
68 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
69 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
70 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
71 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
72 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
73 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
74 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
75 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
76 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
77 2842698319 Methylobacterium sp. R-72139 Isolate Unclassified
78 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
79 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
80 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
81 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
82 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
83 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
84 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
85 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
86 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
87 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
88 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
89 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
90 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
91 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
92 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
93 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
94 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
95 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
96 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
97 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
98 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
99 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
100 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
101 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
102 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
103 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
104 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
105 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
106 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
107 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
108 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
109 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
110 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
111 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
112 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
113 2897803580 Azospirillum doebereinerae GSF71 Isolate Unclassified
114 2902330777 Methylobacterium sp. 2A Isolate Unclassified
115 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
116 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
117 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
118 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
119 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
120 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
121 2904699407
122 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
123 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
124 2906610324
125 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
126 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
127 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
128 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
129 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
130 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
131 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
132 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
133 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
134 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
135 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
136 2922368715
137 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
138 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
139 2922425934
140 2928125067 Methylobacterium sp. 1973 Isolate Unclassified
141 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
142 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
143 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
144 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
145 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
146 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
147 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
148 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
149 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
150 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
151 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
152 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
153 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
154 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
155 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
156 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
157 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
158 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
159 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
160 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
161 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
162 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
163 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
164 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
165 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
166 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
167 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
168 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
169 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
170 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
171 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
172 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
173 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
174 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
175 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
176 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
177 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
178 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
179 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
180 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
181 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
182 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
183 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
184 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
185 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
186 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
187 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
188 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
189 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
190 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
191 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
192 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
193 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
194 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
195 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
196 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
197 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
198 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
199 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
200 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
201 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
202 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
203 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
204 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
205 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
206 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
207 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
208 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
209 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
210 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
211 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
212 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
213 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
214 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
215 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
216 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
217 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
218 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
219 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
220 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
221 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
222 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
223 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
224 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
225 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
226 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
227 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
228 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
229 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
230 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
231 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
232 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
233 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
234 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
235 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
236 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
237 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
238 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
239 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
240 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
241 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
242 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
243 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
244 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
245 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
246 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
247 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
248 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
249 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
250 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
251 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
252 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
253 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
254 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
255 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
256 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
257 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
258 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
259 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
260 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
261 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
262 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
263 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
264 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
265 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
266 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
267 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
268 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
269 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
270 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
271 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
272 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
273 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
274 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
275 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
276 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
277 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
278 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
279 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
280 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
281 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
282 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
283 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
284 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
285 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
286 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
287 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
288 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
289 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
290 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
291 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
292 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
293 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
294 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
295 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
296 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
297 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
298 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
299 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
300 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
301 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
302 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
303 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
304 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
305 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
306 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
307 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
308 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
309 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
310 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
311 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
312 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
313 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
314 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
315 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
316 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
317 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
318 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
319 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
320 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
321 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
322 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
323 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
324 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
325 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
326 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
327 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
328 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
329 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
330 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
331 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
332 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
333 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
334 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
335 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
336 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
337 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
338 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
339 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
340 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
341 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
342 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
343 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
344 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
345 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
346 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
347 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
348 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
349 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
350 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
351 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
352 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
353 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
354 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
355 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
356 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
357 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
358 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
359 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
360 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
361 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
362 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
363 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
364 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
365 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
366 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
367 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
368 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
369 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
370 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
371 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
372 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
373 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
374 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
375 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
376 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
377 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
378 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
379 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
380 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
381 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
382 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
383 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
384 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
385 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
386 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
387 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
388 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
389 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
390 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
391 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
392 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
393 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
394 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
395 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
396 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
397 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
398 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
399 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
400 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
401 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
402 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
403 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
404 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
405 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
406 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
407 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
408 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
409 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
410 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
411 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
412 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
413 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
414 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
415 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
416 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
417 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
418 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
419 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
420 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
421 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
422 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
423 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
424 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
425 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
426 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
427 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
428 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
429 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
430 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
431 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
432 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
433 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
434 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
435 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
436 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
437 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
438 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
439 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
440 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
441 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
442 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
443 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
444 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
445 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
446 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
447 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
448 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
449 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
450 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
451 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
452 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
453 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
454 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
455 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
456 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
457 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
458 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
459 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
460 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
461 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
462 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
463 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
464 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
465 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
466 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
467 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
468 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
469 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
470 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
471 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
472 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
473 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
474 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
475 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
476 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
477 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
478 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
479 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
480 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
481 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
482 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
483 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
484 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
485 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
486 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
487 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
488 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
489 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
490 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
491 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
492 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
493 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
494 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
495 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
496 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
497 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
498 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
499 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
500 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
501 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
502 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
503 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
504 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
505 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
506 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
507 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
508 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
509 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
510 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
511 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
512 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
513 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
514 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
515 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
516 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
517 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
518 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
519 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
520 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
521 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
522 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
523 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
524 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
525 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
526 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
527 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
528 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
529 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
530 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
531 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
532 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
533 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
534 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
535 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
536 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
537 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
538 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
539 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
540 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
541 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
542 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
543 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
544 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
545 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
546 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
547 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
548 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
549 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
550 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
551 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
552 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
553 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
554 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
555 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
556 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
557 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
558 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
559 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
560 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
561 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
562 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
563 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
564 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
565 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
566 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
567 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
568 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
569 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
570 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
571 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
572 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
573 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
574 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
575 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
576 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
577 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
578 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
579 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
580 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
581 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
582 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
583 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
584 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
585 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
586 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
587 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
588 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
589 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
590 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
591 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
592 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
593 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
594 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
595 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
596 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
597 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
598 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
599 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
600 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
601 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
602 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
603 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
604 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
605 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
606 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
607 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
608 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
609 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
610 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
611 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
612 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
613 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
614 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
615 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
616 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
617 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
618 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
619 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
620 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
621 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
622 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
623 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
624 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
625 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
626 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
627 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
628 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
629 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
630 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
631 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
632 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
633 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
634 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
635 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
636 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
637 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
638 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
639 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
640 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
641 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
642 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
643 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
644 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
645 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
646 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
647 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
648 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
649 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
650 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
651 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
652 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
653 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
654 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
655 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
656 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
657 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
658 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
659 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
660 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
661 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
662 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
663 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
664 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
665 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
666 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
667 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
668 8054002106 Azospirillum lipoferum 59b Isolate Unclassified
669 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
670 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
671 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
672 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
673 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 80.51
Metatranscriptomes 0
Isolates 19.49

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.85
Nodule 13.22
Rhizoplane 4.15
Rhizosphere 52.03
Stem 0
Stem Tuber 0
Unclassified 14.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1000003 3300001904 Bacteria 60801
2 JGI24741J21665_1006315 3300001915 Bacteria 2387
3 JGI24752J21851_1000802 3300001976 Bacteria 4238
4 JGI24740J21852_10000141 3300001979 Bacteria 27562
5 JGI24739J22299_10003603 3300001989 Bacteria 5911
6 JGI24739J22299_10035135 3300001989 Bacteria 1701
7 JGI24737J22298_10000271 3300001990 Bacteria 17105
8 JGI24735J21928_10000163 3300002067 Bacteria 23719
9 JGI24750J21931_1002983 3300002070 Bacteria 2026
10 JGI24748J21848_1000111 3300002074 Bacteria 17189
11 JGI24738J21930_10000122 3300002075 Bacteria 18615
12 JGI24738J21930_10004075 3300002075 Bacteria 3613
13 JGI24034J26672_10000089 3300002239 Bacteria 17189
14 JGI24742J22300_10003440 3300002244 Bacteria 2567
15 JGI24742J22300_10003919 3300002244 Bacteria 2423
16 JGI25406J46586_10005494 3300003203 Bacteria 5877
17 JGI25153J46596_10000105 3300003215 Bacteria 95783
18 JGI25153J46596_10002599 3300003215 Bacteria 10345
19 JGI25153J46596_10003262 3300003215 Bacteria 9120
20 JGI25153J46596_10004844 3300003215 Bacteria 7170
21 JGI25153J46596_10007823 3300003215 Bacteria 5191
22 rootL2_10065592 3300003322 Bacteria 2088
23 rootL2_10191799 3300003322 Bacteria 3363
24 rootH1_10157539 3300003323 Bacteria 3206
25 JGI25160J50197_1000241 3300003354 Bacteria 42434
26 JGI25404J52841_10000119 3300003659 Bacteria 8037
27 JGI25404J52841_10003540 3300003659 Bacteria 3097
28 JGI25404J52841_10010582 3300003659 Bacteria 1983
29 JGI25404J52841_10023826 3300003659 Bacteria 1320
30 Ga0055539_1002679 3300003752 Bacteria 2643
31 Ga0055539_1002682 3300003752 Bacteria 2642
32 Ga0055542_1004966 3300003762 Bacteria 3093
33 Ga0055531_10025464 3300003794 Bacteria 2147
34 Ga0055543_1017737 3300004625 Bacteria 1335
35 Ga0055543_1025103 3300004625 Bacteria 1066
36 Ga0065165_1002115 3300005262 Bacteria 18118
37 Ga0065165_1003507 3300005262 Bacteria 10899
38 Ga0065165_1021992 3300005262 Bacteria 2200
39 Ga0065707_10081846 3300005295 Bacteria 34057
40 Ga0070658_10065777 3300005327 Bacteria 2960
41 Ga0070690_100000341 3300005330 Bacteria 23942
42 Ga0070670_100145966 3300005331 Bacteria 2047
43 Ga0070666_10001085 3300005335 Bacteria 16621
44 Ga0070682_100034163 3300005337 Bacteria 3095
45 Ga0068868_100208670 3300005338 Bacteria 1632
46 Ga0070660_100006161 3300005339 Bacteria 8299
47 Ga0070660_100352667 3300005339 Bacteria 1212
48 Ga0070660_100376074 3300005339 Bacteria 1172
49 Ga0070661_100003163 3300005344 Bacteria 11333
50 Ga0070668_100025763 3300005347 Bacteria 4460
51 Ga0070668_100098907 3300005347 Bacteria 2309
52 Ga0070668_100148041 3300005347 Bacteria 1896
53 Ga0070668_100361795 3300005347 Bacteria 1230
54 Ga0070668_100419586 3300005347 Bacteria 1145
55 Ga0070669_100051420 3300005353 Bacteria 3012
56 Ga0070671_100001700 3300005355 Bacteria 16701
57 Ga0070671_100013653 3300005355 Bacteria 6550
58 Ga0070674_100023622 3300005356 Bacteria 3981
59 Ga0070659_100357816 3300005366 Bacteria 1226
60 Ga0070667_100002314 3300005367 Bacteria 16701
61 Ga0070667_100137643 3300005367 Bacteria 2135
62 Ga0070709_10007052 3300005434 Bacteria 6144
63 Ga0070709_10008434 3300005434 Bacteria 5664
64 Ga0070709_10035454 3300005434 Bacteria 3032
65 Ga0070709_10093647 3300005434 Bacteria 1986
66 Ga0070714_100002875 3300005435 Bacteria 12739
67 Ga0070714_100096779 3300005435 Bacteria 2594
68 Ga0070714_100152727 3300005435 Bacteria 2082
69 Ga0070713_100009905 3300005436 Bacteria 6857
70 Ga0070713_100046001 3300005436 Bacteria 3579
71 Ga0070713_100056750 3300005436 Bacteria 3257
72 Ga0070713_100085089 3300005436 Bacteria 2708
73 Ga0070713_100409784 3300005436 Bacteria 1267
74 Ga0070710_10000878 3300005437 Bacteria 14395
75 Ga0070710_10008549 3300005437 Bacteria 4983
76 Ga0070710_10016869 3300005437 Bacteria 3727
77 Ga0070701_10046931 3300005438 Bacteria 2223
78 Ga0070711_100001277 3300005439 Bacteria 13671
79 Ga0070711_100003170 3300005439 Bacteria 9548
80 Ga0070711_100009993 3300005439 Bacteria 5855
81 Ga0070711_100011213 3300005439 Bacteria 5559
82 Ga0070663_100016609 3300005455 Bacteria 4787
83 Ga0070663_100021666 3300005455 Bacteria 4279
84 Ga0070663_100030652 3300005455 Bacteria 3689
85 Ga0070663_100289667 3300005455 Bacteria 1307
86 Ga0070663_100336048 3300005455 Bacteria 1219
87 Ga0070678_100058738 3300005456 Bacteria 2824
88 Ga0070678_100131877 3300005456 Bacteria 1986
89 Ga0070662_100000370 3300005457 Bacteria 26837
90 Ga0068867_100023770 3300005459 Bacteria 4389
91 Ga0070698_100097422 3300005471 Bacteria 2917
92 Ga0068853_100184776 3300005539 Bacteria 1892
93 Ga0070672_100121473 3300005543 Bacteria 2138
94 Ga0070672_100156878 3300005543 Bacteria 1885
95 Ga0070686_100000951 3300005544 Bacteria 16701
96 Ga0070693_100224813 3300005547 Bacteria 1232
97 Ga0070665_100106479 3300005548 Bacteria 2806
98 Ga0070665_100316990 3300005548 Bacteria 1563
99 Ga0070665_100502665 3300005548 Bacteria 1223
100 Ga0068855_100059671 3300005563 Bacteria 4463
101 Ga0068855_100438626 3300005563 Bacteria 1427
102 Ga0070664_100003613 3300005564 Bacteria 12460
103 Ga0068857_100036297 3300005577 Bacteria 4368
104 Ga0068857_100117647 3300005577 Bacteria 2392
105 Ga0068854_100003709 3300005578 Bacteria 9553
106 Ga0068854_100366959 3300005578 Bacteria 1183
107 Ga0068856_100000565 3300005614 Bacteria 40600
108 Ga0068856_100104952 3300005614 Bacteria 2820
109 Ga0068856_100163427 3300005614 Bacteria 2237
110 Ga0070702_100032203 3300005615 Bacteria 2876
111 Ga0068859_100055772 3300005617 Bacteria 3976
112 Ga0068859_100112738 3300005617 Bacteria 2783
113 Ga0068859_100139361 3300005617 Bacteria 2499
114 Ga0068864_100002032 3300005618 Bacteria 16701
115 Ga0068864_100081408 3300005618 Bacteria 2838
116 Ga0068861_100004465 3300005719 Bacteria 9391
117 Ga0068861_100037464 3300005719 Bacteria 3605
118 Ga0068851_10008565 3300005834 Bacteria 4733
119 Ga0068863_100034336 3300005841 Bacteria 4832
120 Ga0068863_100224197 3300005841 Bacteria 1812
121 Ga0068858_100178582 3300005842 Bacteria 2004
122 Ga0068858_100504140 3300005842 Bacteria 1169
123 Ga0068860_100003263 3300005843 Bacteria 16701
124 Ga0068860_100114294 3300005843 Bacteria 2581
125 Ga0068860_100409619 3300005843 Bacteria 1342
126 Ga0068862_100004021 3300005844 Bacteria 12469
127 Ga0068862_100142878 3300005844 Bacteria 2125
128 Ga0068862_100185624 3300005844 Bacteria 1868
129 Ga0068862_100382196 3300005844 Bacteria 1313
130 Ga0081455_10009013 3300005937 Bacteria 10299
131 Ga0081455_10016971 3300005937 Bacteria 6998
132 Ga0081455_10030272 3300005937 Bacteria 4920
133 Ga0081455_10070447 3300005937 Bacteria 2903
134 Ga0081455_10144890 3300005937 Bacteria 1839
135 Ga0081538_10005891 3300005981 Bacteria 10920
136 Ga0081540_1004703 3300005983 Bacteria 10329
137 Ga0081540_1005662 3300005983 Bacteria 9288
138 Ga0081540_1006548 3300005983 Bacteria 8459
139 Ga0081540_1009656 3300005983 Bacteria 6631
140 Ga0081540_1014475 3300005983 Bacteria 5050
141 Ga0081540_1020027 3300005983 Bacteria 4040
142 Ga0081540_1024577 3300005983 Bacteria 3494
143 Ga0081540_1028489 3300005983 Bacteria 3136
144 Ga0081540_1031146 3300005983 Bacteria 2940
145 Ga0081540_1044102 3300005983 Bacteria 2280
146 Ga0081540_1054592 3300005983 Bacteria 1951
147 Ga0081540_1066793 3300005983 Bacteria 1683
148 Ga0081540_1069407 3300005983 Bacteria 1638
149 Ga0081540_1073066 3300005983 Bacteria 1577
150 Ga0081539_10000617 3300005985 Bacteria 72003
151 Ga0070717_10003746 3300006028 Bacteria 10919
152 Ga0070717_10022548 3300006028 Bacteria 4977
153 Ga0070717_10186877 3300006028 Bacteria 1809
154 Ga0075365_10034809 3300006038 Bacteria 3254
155 Ga0075365_10068991 3300006038 Bacteria 2376
156 Ga0075365_10098482 3300006038 Bacteria 2000
157 Ga0075365_10142938 3300006038 Bacteria 1661
158 Ga0075365_10214282 3300006038 Bacteria 1350
159 Ga0075365_10261915 3300006038 Bacteria 1216
160 Ga0075365_10332914 3300006038 Bacteria 1070
161 Ga0075368_10005099 3300006042 Bacteria 4497
162 Ga0075363_100002208 3300006048 Bacteria 7854
163 Ga0075364_10022409 3300006051 Bacteria 3988
164 Ga0075364_10031298 3300006051 Bacteria 3418
165 Ga0075364_10048273 3300006051 Bacteria 2774
166 Ga0075364_10087117 3300006051 Bacteria 2069
167 Ga0075364_10089456 3300006051 Bacteria 2042
168 Ga0070716_100053095 3300006173 Bacteria 2310
169 Ga0070716_100059332 3300006173 Bacteria 2205
170 Ga0070716_100270183 3300006173 Bacteria 1168
171 Ga0070712_100002086 3300006175 Bacteria 12280
172 Ga0070712_100009781 3300006175 Bacteria 6042
173 Ga0070712_100090744 3300006175 Bacteria 2237
174 Ga0075362_10107814 3300006177 Bacteria 1308
175 Ga0075362_10116617 3300006177 Bacteria 1261
176 Ga0075362_10120813 3300006177 Bacteria 1240
177 Ga0075367_10004480 3300006178 Bacteria 6827
178 Ga0075367_10032084 3300006178 Bacteria 3019
179 Ga0075367_10033297 3300006178 Bacteria 2969
180 Ga0075367_10048405 3300006178 Bacteria 2504
181 Ga0075369_10025069 3300006186 Bacteria 2477
182 Ga0075366_10043484 3300006195 Bacteria 2661
183 Ga0075366_10116860 3300006195 Bacteria 1606
184 Ga0075366_10146737 3300006195 Bacteria 1428
185 Ga0075366_10165260 3300006195 Bacteria 1342
186 Ga0075370_10015615 3300006353 Bacteria 4069
187 Ga0075370_10022744 3300006353 Bacteria 3446
188 Ga0075370_10062777 3300006353 Bacteria 2117
189 Ga0075370_10086232 3300006353 Bacteria 1808
190 Ga0075370_10215602 3300006353 Bacteria 1134
191 Ga0075428_100196462 3300006844 Bacteria 2182
192 Ga0068865_100041530 3300006881 Bacteria 3130
193 Ga0068865_100042363 3300006881 Bacteria 3104
194 Ga0097620_100055772 3300006931 Bacteria 3976
195 Ga0097620_100112736 3300006931 Bacteria 2783
196 Ga0097620_100139343 3300006931 Bacteria 2499
197 Ga0099825_1022855 3300006941 Bacteria 3946
198 Ga0099794_10041987 3300007265 Bacteria 2179
199 Ga0099795_10000656 3300007788 Bacteria 6653
200 Ga0099795_10005394 3300007788 Bacteria 3396
201 Ga0099795_10026186 3300007788 Bacteria 1963
202 Ga0105240_10001377 3300009093 Bacteria 41807
203 Ga0105240_10132998 3300009093 Bacteria 2981
204 Ga0105240_10224642 3300009093 Bacteria 2185
205 Ga0105240_10350311 3300009093 Bacteria 1675
206 Ga0105245_10048730 3300009098 Bacteria 3790
207 Ga0105245_10050199 3300009098 Bacteria 3738
208 Ga0105245_10054965 3300009098 Bacteria 3576
209 Ga0105247_10031063 3300009101 Bacteria 3240
210 Ga0105247_10032869 3300009101 Bacteria 3153
211 Ga0105247_10081077 3300009101 Bacteria 2045
212 Ga0105247_10272479 3300009101 Bacteria 1165
213 Ga0114129_10064167 3300009147 Bacteria 5125
214 Ga0105241_10065494 3300009174 Bacteria 2808
215 Ga0105242_10102997 3300009176 Bacteria 2421
216 Ga0105248_10029163 3300009177 Bacteria 6154
217 Ga0105248_10164887 3300009177 Bacteria 2498
218 Ga0105237_10001208 3300009545 Bacteria 34549
219 Ga0105237_10031595 3300009545 Bacteria 5365
220 Ga0105237_10119254 3300009545 Bacteria 2632
221 Ga0105238_10301637 3300009551 Bacteria 1585
222 Ga0105238_10424344 3300009551 Bacteria 1325
223 Ga0105249_10002201 3300009553 Bacteria 16890
224 Ga0105249_10065267 3300009553 Bacteria 3349
225 Ga0099796_10009702 3300010159 Bacteria 2615
226 Ga0105239_10120787 3300010375 Bacteria 2909
227 Ga0105239_10145846 3300010375 Bacteria 2639
228 Ga0105239_10150181 3300010375 Bacteria 2600
229 Ga0105239_10276648 3300010375 Bacteria 1889
230 Ga0105239_10528410 3300010375 Bacteria 1342
231 Ga0105246_10128923 3300011119 Bacteria 1886
232 Ga0157370_10009206 3300013104 Bacteria 10587
233 Ga0157369_10040582 3300013105 Bacteria 5080
234 Ga0157374_10034735 3300013296 Bacteria 4608
235 Ga0157374_10097110 3300013296 Bacteria 2819
236 Ga0157378_10036359 3300013297 Bacteria 4358
237 Ga0157378_10051368 3300013297 Bacteria 3669
238 Ga0157378_10477016 3300013297 Bacteria 1242
239 Ga0163162_10002433 3300013306 Bacteria 17545
240 Ga0163162_10021948 3300013306 Bacteria 6289
241 Ga0163162_10123584 3300013306 Bacteria 2694
242 Ga0163162_10215813 3300013306 Bacteria 2049
243 Ga0157375_10015134 3300013308 Bacteria 6900
244 Ga0157375_10080746 3300013308 Bacteria 3291
245 Ga0163163_10002363 3300014325 Bacteria 15969
246 Ga0163163_10112880 3300014325 Bacteria 2747
247 Ga0157380_10011189 3300014326 Bacteria 6476
248 Ga0157380_10018244 3300014326 Bacteria 5206
249 Ga0157380_10246052 3300014326 Bacteria 1615
250 Ga0157377_10103273 3300014745 Bacteria 1702
251 Ga0157379_10089399 3300014968 Bacteria 2763
252 Ga0157379_10311060 3300014968 Bacteria 1437
253 Ga0157376_10024381 3300014969 Bacteria 4748
254 Ga0157376_10154755 3300014969 Bacteria 2071
255 Ga0163161_10001564 3300017792 Bacteria 16890
256 Ga0214544_1000003 3300021320 Bacteria 643752
257 Ga0214542_1000003 3300021321 Bacteria 435700
258 Ga0214545_1000004 3300021324 Bacteria 453352
259 Ga0214543_1000007 3300021327 Bacteria 414744
260 Ga0213872_10021002 3300021361 Bacteria 3007
261 Ga0213872_10063966 3300021361 Bacteria 1662
262 Ga0213876_10003521 3300021384 Bacteria 8929
263 Ga0213871_10001177 3300021441 Bacteria 4203
264 Ga0213871_10023929 3300021441 Bacteria 1542
265 Ga0207672_1000291 3300025223 Bacteria 6802
266 Ga0209563_102362 3300025230 Bacteria 4312
267 Ga0209677_100691 3300025253 Bacteria 17234
268 Ga0209677_102123 3300025253 Bacteria 7779
269 Ga0209148_1000334 3300025254 Bacteria 64148
270 Ga0209148_1000409 3300025254 Bacteria 49427
271 Ga0209148_1004493 3300025254 Bacteria 3425
272 Ga0209233_1003186 3300025261 Bacteria 5815
273 Ga0209233_1004082 3300025261 Bacteria 5036
274 Ga0209233_1004834 3300025261 Bacteria 4537
275 Ga0209233_1013772 3300025261 Bacteria 2301
276 Ga0209455_1001057 3300025272 Bacteria 13627
277 Ga0209455_1001295 3300025272 Bacteria 11666
278 Ga0209455_1001915 3300025272 Bacteria 8611
279 Ga0209455_1006216 3300025272 Bacteria 3559
280 Ga0209564_1000792 3300025295 Bacteria 43539
281 Ga0209564_1004214 3300025295 Bacteria 8959
282 Ga0209758_1000015 3300025297 Bacteria 851943
283 Ga0209758_1000224 3300025297 Bacteria 121530
284 Ga0209758_1000279 3300025297 Bacteria 101326
285 Ga0209758_1001476 3300025297 Bacteria 27510
286 Ga0209758_1001947 3300025297 Bacteria 22346
287 Ga0209758_1004240 3300025297 Bacteria 12132
288 Ga0209758_1009765 3300025297 Bacteria 5886
289 Ga0209758_1013773 3300025297 Bacteria 4373
290 Ga0209758_1014240 3300025297 Bacteria 4249
291 Ga0209758_1054243 3300025297 Bacteria 1370
292 Ga0209256_1002302 3300025299 Bacteria 16014
293 Ga0207426_1000613 3300025302 Bacteria 46040
294 Ga0207426_1000942 3300025302 Bacteria 28876
295 Ga0207426_1007986 3300025302 Bacteria 4347
296 Ga0209257_1000296 3300025304 Bacteria 109517
297 Ga0209257_1001187 3300025304 Bacteria 32795
298 Ga0209257_1028445 3300025304 Bacteria 1839
299 Ga0207697_10059802 3300025315 Bacteria 1584
300 Ga0207697_10115558 3300025315 Bacteria 1152
301 Ga0207656_10002794 3300025321 Bacteria 5932
302 Ga0207692_10000970 3300025898 Bacteria 10440
303 Ga0207692_10034089 3300025898 Bacteria 2462
304 Ga0207710_10108566 3300025900 Bacteria 1316
305 Ga0207688_10051004 3300025901 Bacteria 2317
306 Ga0207688_10109715 3300025901 Bacteria 1600
307 Ga0207680_10000608 3300025903 Bacteria 16898
308 Ga0207647_10000885 3300025904 Bacteria 23242
309 Ga0207647_10011348 3300025904 Bacteria 6253
310 Ga0207699_10000882 3300025906 Bacteria 14319
311 Ga0207699_10010703 3300025906 Bacteria 4613
312 Ga0207699_10108324 3300025906 Bacteria 1776
313 Ga0207699_10194122 3300025906 Bacteria 1372
314 Ga0207645_10076729 3300025907 Bacteria 2140
315 Ga0207705_10011230 3300025909 Bacteria 6492
316 Ga0207654_10001250 3300025911 Bacteria 13535
317 Ga0207654_10041269 3300025911 Bacteria 2604
318 Ga0207695_10000062 3300025913 Bacteria 351979
319 Ga0207695_10013483 3300025913 Bacteria 9746
320 Ga0207695_10082984 3300025913 Bacteria 3238
321 Ga0207671_10004455 3300025914 Bacteria 13386
322 Ga0207671_10005186 3300025914 Bacteria 12114
323 Ga0207671_10030621 3300025914 Bacteria 4012
324 Ga0207693_10006903 3300025915 Bacteria 9377
325 Ga0207693_10012697 3300025915 Bacteria 6802
326 Ga0207693_10023028 3300025915 Bacteria 4946
327 Ga0207693_10053133 3300025915 Bacteria 3179
328 Ga0207663_10006825 3300025916 Bacteria 5876
329 Ga0207663_10110225 3300025916 Bacteria 1866
330 Ga0207663_10133416 3300025916 Bacteria 1719
331 Ga0207662_10054009 3300025918 Bacteria 2394
332 Ga0207657_10007886 3300025919 Bacteria 10862
333 Ga0207657_10099048 3300025919 Bacteria 2421
334 Ga0207649_10009737 3300025920 Bacteria 5263
335 Ga0207646_10171029 3300025922 Bacteria 1962
336 Ga0207681_10272009 3300025923 Bacteria 1330
337 Ga0207694_10001025 3300025924 Bacteria 24369
338 Ga0207694_10239942 3300025924 Bacteria 1481
339 Ga0207650_10114824 3300025925 Bacteria 2089
340 Ga0207687_10067922 3300025927 Bacteria 2538
341 Ga0207687_10228250 3300025927 Bacteria 1470
342 Ga0207700_10005941 3300025928 Bacteria 7343
343 Ga0207700_10010828 3300025928 Bacteria 5785
344 Ga0207700_10013065 3300025928 Bacteria 5388
345 Ga0207700_10122782 3300025928 Bacteria 2108
346 Ga0207664_10036433 3300025929 Bacteria 3803
347 Ga0207664_10133704 3300025929 Bacteria 2091
348 Ga0207664_10231022 3300025929 Bacteria 1608
349 Ga0207664_10332861 3300025929 Bacteria 1341
350 Ga0207644_10001158 3300025931 Bacteria 16898
351 Ga0207644_10324036 3300025931 Bacteria 1246
352 Ga0207644_10373351 3300025931 Bacteria 1162
353 Ga0207706_10001157 3300025933 Bacteria 26820
354 Ga0207706_10029163 3300025933 Bacteria 4927
355 Ga0207706_10474433 3300025933 Bacteria 1081
356 Ga0207686_10047401 3300025934 Bacteria 2656
357 Ga0207670_10133935 3300025936 Bacteria 1819
358 Ga0207669_10123761 3300025937 Bacteria 1761
359 Ga0207704_10091011 3300025938 Bacteria 2004
360 Ga0207689_10093502 3300025942 Bacteria 2470
361 Ga0207689_10169943 3300025942 Bacteria 1797
362 Ga0207679_10028262 3300025945 Bacteria 3889
363 Ga0207667_10002524 3300025949 Bacteria 22795
364 Ga0207667_10070874 3300025949 Bacteria 3627
365 Ga0207667_10446021 3300025949 Bacteria 1315
366 Ga0207667_10454193 3300025949 Bacteria 1302
367 Ga0207712_10001334 3300025961 Bacteria 16898
368 Ga0207712_10241889 3300025961 Bacteria 1454
369 Ga0207668_10097434 3300025972 Bacteria 2176
370 Ga0207668_10195303 3300025972 Bacteria 1607
371 Ga0207668_10215469 3300025972 Bacteria 1538
372 Ga0207640_10102737 3300025981 Bacteria 2008
373 Ga0207640_10316069 3300025981 Bacteria 1241
374 Ga0207658_10000550 3300025986 Bacteria 33998
375 Ga0207658_10497775 3300025986 Bacteria 1085
376 Ga0207703_10121259 3300026035 Bacteria 2245
377 Ga0207703_10197343 3300026035 Bacteria 1786
378 Ga0207639_10002001 3300026041 Bacteria 13739
379 Ga0207678_10004067 3300026067 Bacteria 13161
380 Ga0207678_10023870 3300026067 Bacteria 5348
381 Ga0207678_10031834 3300026067 Bacteria 4599
382 Ga0207678_10091219 3300026067 Bacteria 2604
383 Ga0207678_10166924 3300026067 Bacteria 1880
384 Ga0207678_10219447 3300026067 Bacteria 1627
385 Ga0207708_10109280 3300026075 Bacteria 2145
386 Ga0207702_10000056 3300026078 Bacteria 131186
387 Ga0207702_10012102 3300026078 Bacteria 7176
388 Ga0207702_10115580 3300026078 Bacteria 2393
389 Ga0207641_10000820 3300026088 Bacteria 33016
390 Ga0207641_10219942 3300026088 Bacteria 1761
391 Ga0207641_10287269 3300026088 Bacteria 1549
392 Ga0207648_10031888 3300026089 Bacteria 4656
393 Ga0207648_10032951 3300026089 Bacteria 4572
394 Ga0207676_10000112 3300026095 Bacteria 73166
395 Ga0207676_10021216 3300026095 Bacteria 4765
396 Ga0207676_10276423 3300026095 Bacteria 1523
397 Ga0207674_10002655 3300026116 Bacteria 22334
398 Ga0207675_100004219 3300026118 Bacteria 13909
399 Ga0207675_100108249 3300026118 Bacteria 2621
400 Ga0207683_10036663 3300026121 Bacteria 4271
401 Ga0207683_10042257 3300026121 Bacteria 3981
402 Ga0207683_10075803 3300026121 Bacteria 2978
403 Ga0207698_10087601 3300026142 Bacteria 2536
404 Ga0207698_10097054 3300026142 Bacteria 2431
405 Ga0209389_1000064 3300027296 Bacteria 102177
406 Ga0209389_1060420 3300027296 Bacteria 2352
407 Ga0209589_1000001 3300027357 Bacteria 794224
408 Ga0209589_1000012 3300027357 Bacteria 229451
409 Ga0209589_1000013 3300027357 Bacteria 229273
410 Ga0209489_100001 3300027361 Bacteria 794224
411 Ga0209489_100013 3300027361 Bacteria 229831
412 Ga0209700_100001 3300027363 Bacteria 794224
413 Ga0209700_100014 3300027363 Bacteria 299349
414 Ga0209970_1000575 3300027614 Bacteria 6376
415 Ga0209588_1004023 3300027671 Bacteria 4115
416 Ga0268266_10002834 3300028379 Bacteria 18070
417 Ga0268266_10074808 3300028379 Bacteria 2941
418 Ga0268266_10225684 3300028379 Bacteria 1723
419 Ga0268266_10403154 3300028379 Bacteria 1293
420 Ga0268265_10005306 3300028380 Bacteria 8831
421 Ga0268265_10037996 3300028380 Bacteria 3538
422 Ga0268265_10057458 3300028380 Bacteria 2965
423 Ga0268265_10164066 3300028380 Bacteria 1891
424 Ga0268265_10313870 3300028380 Bacteria 1417
425 Ga0268264_10000427 3300028381 Bacteria 58342
426 Ga0268264_10002306 3300028381 Bacteria 16898
427 Ga0268264_10285351 3300028381 Bacteria 1548
428 Ga0265337_1005134 3300028556 Bacteria 5268
429 Ga0265326_10006639 3300028558 Bacteria 3578
430 Ga0265319_1001952 3300028563 Bacteria 11674
431 Ga0265334_10000603 3300028573 Bacteria 18160
432 Ga0265318_10009675 3300028577 Bacteria 4229
433 Ga0265323_10000037 3300028653 Bacteria 71088
434 Ga0265336_10000392 3300028666 Bacteria 27552
435 Ga0307517_10000386 3300028786 Bacteria 75442
436 Ga0307517_10217944 3300028786 Bacteria 1164
437 Ga0307515_10052963 3300028794 Bacteria 6002
438 Ga0265338_10000024 3300028800 Bacteria 297778
439 Ga0265324_10003350 3300029957 Bacteria 7675
440 Ga0265330_10010015 3300031235 Bacteria 4485
441 Ga0265329_10061615 3300031242 Bacteria 1188
442 Ga0265340_10015257 3300031247 Bacteria 3996
443 Ga0265331_10014277 3300031250 Bacteria 4236
444 Ga0307513_10040069 3300031456 Bacteria 5184
445 Ga0307509_10008331 3300031507 Bacteria 13242
446 Ga0307408_100301599 3300031548 Bacteria 1342
447 Ga0307508_10000005 3300031616 Bacteria 286511
448 Ga0265314_10014228 3300031711 Bacteria 6380
449 Ga0265314_10018659 3300031711 Bacteria 5401
450 Ga0265342_10010476 3300031712 Bacteria 6425
451 Ga0265342_10091265 3300031712 Bacteria 1746
452 Ga0316576_10003954 3300031727 Bacteria 8804
453 Ga0316578_10105503 3300031728 Bacteria 1691
454 Ga0307516_10003162 3300031730 Bacteria 21427
455 Ga0307412_10000109 3300031911 Bacteria 64548
456 Ga0307412_10063280 3300031911 Bacteria 2495
457 Ga0307412_10258062 3300031911 Bacteria 1357
458 Ga0307409_100448569 3300031995 Bacteria 1244
459 Ga0307416_100376692 3300032002 Bacteria 1448
460 Ga0307411_10168016 3300032005 Bacteria 1651
461 Ga0307510_10005064 3300033180 Bacteria 15634
462 Ga0307510_10036874 3300033180 Bacteria 5436
463 Ga0315911_1000002 3300033442 Bacteria 926833
464 Ga0316215_1003066 3300033544 Bacteria 1586
465 Ga0373934_0015429 3300035086 Bacteria 2898
466 Ga0373934_0036408 3300035086 Bacteria 1939
467 Ga0373944_0018322 3300035089 Bacteria 1998
468 Ga0373923_0008351 3300035111 Bacteria 3687
469 Ga0373936_0009582 3300035113 Bacteria 3649
470 Ga0373936_0017441 3300035113 Bacteria 2764
471 Ga0373954_0000220 3300035118 Bacteria 20868
472 Ga0373954_0160337 3300035118 Bacteria 1100
473 Ga0373956_0000306 3300035119 Bacteria 19826
474 Ga0373957_0002434 3300035120 Bacteria 5308
475 Ga0373943_0006156 3300035170 Bacteria 5385
476 Ga0373955_0002760 3300035172 Bacteria 7702
477 Ga0373955_0129489 3300035172 Bacteria 1472
478 Ga0373924_0024809 3300035410 Bacteria 2365
479 Ga0373924_0081022 3300035410 Bacteria 1381
480 Ga0373935_0001272 3300035692 Bacteria 13897
481 Ga0373935_0040080 3300035692 Bacteria 2939
482 Ga0373935_0218646 3300035692 Bacteria 1322
483 Ga0373935_0282203 3300035692 Bacteria 1169
484 Ga0373927_0000935 3300035695 Bacteria 22188
485 Ga0373927_0019055 3300035695 Bacteria 4500
486 Ga0373927_0138444 3300035695 Bacteria 1591
487 Ga0373933_0000164 3300035724 Bacteria 43241
488 Ga0373933_0006353 3300035724 Bacteria 6433
489 Ga0373933_0016181 3300035724 Bacteria 4168
490 Ga0373947_0000207 3300035725 Bacteria 32930
491 Ga0373937_0038226 3300036401 Bacteria 4374
492 Ga0373937_0066563 3300036401 Bacteria 3318
493 Ga0373937_0252271 3300036401 Bacteria 1663
494 Ga0316582_0051018 3300036647 Bacteria 2624
495 Ga0316584_0060834 3300036712 Bacteria 2829
496 Ga0373925_0052374 3300037068 Bacteria 3049
497 Ga0373925_0057191 3300037068 Bacteria 2922
498 Ga0395899_0102768 3300037312 Bacteria 2062
499 Ga0395905_0002017 3300037471 Bacteria 23212
500 Ga0395905_0070014 3300037471 Bacteria 3286
501 Ga0395905_0443304 3300037471 Bacteria 1196
502 Ga0395901_0244397 3300038443 Bacteria 1871
503 Ga0436365_0483596 3300039437 Bacteria 1381
504 Ga0436365_0548581 3300039437 Bacteria 4554
505 Ga0436365_0954239 3300039437 Bacteria 40865
506 Ga0436365_1083476 3300039437 Bacteria 2192
507 Ga0436365_1266449 3300039437 Bacteria 3708
508 Ga0436360_1017435 3300039438 Bacteria 2479
509 Ga0436361_0429826 3300039447 Bacteria 3466
510 Ga0436361_1109572 3300039447 Bacteria 6637
511 Ga0451807_2024239 3300041486 Bacteria 1872
512 Ga0466972_0000379 3300044658 Bacteria 23860
513 Ga0466972_0010137 3300044658 Bacteria 4734
514 Ga0466965_0007271 3300044683 Bacteria 5076
515 Ga0466966_0002334 3300044684 Bacteria 12382
516 Ga0466966_0015387 3300044684 Bacteria 5057
517 Ga0466966_0066402 3300044684 Bacteria 2267
518 Ga0466961_0001110 3300044693 Bacteria 16566
519 Ga0466963_0106116 3300044694 Bacteria 1926
520 Ga0466968_0116457 3300044735 Bacteria 1206
521 Ga0466970_0062594 3300044765 Bacteria 1995
522 Ga0466957_0120968 3300044842 Bacteria 1669
523 Ga0466959_0001504 3300045049 Bacteria 14293
524 Ga0466959_0008358 3300045049 Bacteria 7314
525 Ga0466959_0071705 3300045049 Bacteria 2508
526 Ga0466959_0167464 3300045049 Bacteria 1542
527 Ga0495617_011389 3300046452 Bacteria 3034
528 Ga0495627_054474 3300046453 Bacteria 1196
529 Ga0495592_0004993 3300046454 Bacteria 9766
530 Ga0495603_0000032 3300046455 Bacteria 59469
531 Ga0495603_0005706 3300046455 Bacteria 7440
532 Ga0495603_0091537 3300046455 Bacteria 1778
533 Ga0495603_0095918 3300046455 Bacteria 1733
534 Ga0495590_0032236 3300046457 Bacteria 1832
535 Ga0495629_0000094 3300046459 Bacteria 77297
536 Ga0495629_0000114 3300046459 Bacteria 72778
537 Ga0495629_0009642 3300046459 Bacteria 7053
538 Ga0495638_0007148 3300046460 Bacteria 8042
539 Ga0495638_0009289 3300046460 Bacteria 6910
540 Ga0495638_0011434 3300046460 Bacteria 6115
541 Ga0495638_0179132 3300046460 Bacteria 1210
542 Ga0495641_0002565 3300046461 Bacteria 14274
543 Ga0495641_0024733 3300046461 Bacteria 2959
544 Ga0495651_0009075 3300046462 Bacteria 7633
545 Ga0495651_0011197 3300046462 Bacteria 6894
546 Ga0495651_0209969 3300046462 Bacteria 1356
547 Ga0495653_0003100 3300046463 Bacteria 13312
548 Ga0495653_0078002 3300046463 Bacteria 2458
549 Ga0495580_0004156 3300046472 Bacteria 12178
550 Ga0495582_0000030 3300046473 Bacteria 77594
551 Ga0495582_0048994 3300046473 Bacteria 2326
552 Ga0495605_0053154 3300046474 Bacteria 1966
553 Ga0495605_0095462 3300046474 Bacteria 1372
554 Ga0495639_0000003 3300046475 Bacteria 118479
555 Ga0495639_0005148 3300046475 Bacteria 5617
556 Ga0495662_0000008 3300046476 Bacteria 71128
557 Ga0495662_0070165 3300046476 Bacteria 1698
558 Ga0495662_0159227 3300046476 Bacteria 1112
559 Ga0495584_0074180 3300046491 Bacteria 1710
560 Ga0495594_0000249 3300046499 Bacteria 26130
561 Ga0495596_0065457 3300046500 Bacteria 1414
562 Ga0495606_0012187 3300046507 Bacteria 6928
563 Ga0495606_0020843 3300046507 Bacteria 4817
564 Ga0495606_0096551 3300046507 Bacteria 1807
565 Ga0495606_0163391 3300046507 Bacteria 1297
566 Ga0495608_0051466 3300046511 Bacteria 2729
567 Ga0495608_0109310 3300046511 Bacteria 1778
568 Ga0495610_0112751 3300046512 Bacteria 1202
569 Ga0495616_0095415 3300046513 Bacteria 1402
570 Ga0495618_0014438 3300046514 Bacteria 4812
571 Ga0495618_0106675 3300046514 Bacteria 1794
572 Ga0495618_0149403 3300046514 Bacteria 1493
573 Ga0495620_0059664 3300046515 Bacteria 1594
574 Ga0495628_0004817 3300046516 Bacteria 11872
575 Ga0495628_0061546 3300046516 Bacteria 2944
576 Ga0495628_0065385 3300046516 Bacteria 2845
577 Ga0495628_0150930 3300046516 Bacteria 1770
578 Ga0495630_0018007 3300046517 Bacteria 5183
579 Ga0495630_0131423 3300046517 Bacteria 1901
580 Ga0495630_0316155 3300046517 Bacteria 1194
581 Ga0495631_0096063 3300046518 Bacteria 1275
582 Ga0495632_0068042 3300046519 Bacteria 1717
583 Ga0495643_0100003 3300046522 Bacteria 1487
584 Ga0495644_0034992 3300046523 Bacteria 1896
585 Ga0495648_0000325 3300046524 Bacteria 52966
586 Ga0495648_0018141 3300046524 Bacteria 5000
587 Ga0495648_0023128 3300046524 Bacteria 4263
588 Ga0495648_0040083 3300046524 Bacteria 2974
589 Ga0495648_0070682 3300046524 Bacteria 2027
590 Ga0495663_0006202 3300046525 Bacteria 3301
591 Ga0495666_0031350 3300046526 Bacteria 2605
592 Ga0495666_0049611 3300046526 Bacteria 2019
593 Ga0495642_0014387 3300046528 Bacteria 3065
594 Ga0495652_0029126 3300046529 Bacteria 4851
595 Ga0495652_0173645 3300046529 Bacteria 1661
596 Ga0495652_0193133 3300046529 Bacteria 1552
597 Ga0495652_0322496 3300046529 Bacteria 1115
598 Ga0495654_0008175 3300046530 Bacteria 5794
599 Ga0495654_0082409 3300046530 Bacteria 1505
600 Ga0495665_0000001 3300046531 Bacteria 156121
601 Ga0495665_0049412 3300046531 Bacteria 2230
602 Ga0495640_0011846 3300046533 Bacteria 6689
603 Ga0495640_0012771 3300046533 Bacteria 6410
604 Ga0495640_0042783 3300046533 Bacteria 3158
605 Ga0495640_0054820 3300046533 Bacteria 2729
606 Ga0495586_0252912 3300046535 Bacteria 1005
607 Ga0495587_0185187 3300046536 Bacteria 1179
608 Ga0495609_0035426 3300046538 Bacteria 2259
609 Ga0495609_0095844 3300046538 Bacteria 1287
610 Ga0495645_0043602 3300046543 Bacteria 3272
611 Ga0495645_0071672 3300046543 Bacteria 2498
612 Ga0495622_0004414 3300046557 Bacteria 6537
613 Ga0495622_0020192 3300046557 Bacteria 3103
614 Ga0495622_0067036 3300046557 Bacteria 1658
615 Ga0495622_0071010 3300046557 Bacteria 1607
616 Ga0495633_0002918 3300046558 Bacteria 11727
617 Ga0495633_0026394 3300046558 Bacteria 2851
618 Ga0495633_0120241 3300046558 Bacteria 1217
619 Ga0495667_0035228 3300046559 Bacteria 3346
620 Ga0495667_0047807 3300046559 Bacteria 2825
621 Ga0495656_0009498 3300046615 Bacteria 3498
622 Ga0495656_0053651 3300046615 Bacteria 1733
623 Ga0495668_0006900 3300046616 Bacteria 7355
624 Ga0495668_0011250 3300046616 Bacteria 5370
625 Ga0495668_0023978 3300046616 Bacteria 3473
626 Ga0495634_0003282 3300046642 Bacteria 13051
627 Ga0495634_0005378 3300046642 Bacteria 9865
628 Ga0495634_0021233 3300046642 Bacteria 4592
629 Ga0495634_0021715 3300046642 Bacteria 4532
630 Ga0495611_0028249 3300046648 Bacteria 2455
631 Ga0495611_0041248 3300046648 Bacteria 2058
632 Ga0495611_0061777 3300046648 Bacteria 1703
633 Ga0495625_0227519 3300046660 Bacteria 1219
634 Ga0495635_0002364 3300046663 Bacteria 12839
635 Ga0495635_0002589 3300046663 Bacteria 12378
636 Ga0495635_0004842 3300046663 Bacteria 9365
637 Ga0495661_0028475 3300046665 Bacteria 3576
638 Ga0495588_0002455 3300046674 Bacteria 7937
639 Ga0495588_0041708 3300046674 Bacteria 2344
640 Ga0495588_0125435 3300046674 Bacteria 1354
641 Ga0495657_0011053 3300046675 Bacteria 6770
642 Ga0495657_0048554 3300046675 Bacteria 2862
643 Ga0495599_0000800 3300046678 Bacteria 17670
644 Ga0495623_0008330 3300046679 Bacteria 6741
645 Ga0495646_0000456 3300046680 Bacteria 21662
646 Ga0495646_0045629 3300046680 Bacteria 2676
647 Ga0495646_0101682 3300046680 Bacteria 1647
648 Ga0495647_0000736 3300046681 Bacteria 9691
649 Ga0495647_0076288 3300046681 Bacteria 1351
650 Ga0495658_0000285 3300046683 Bacteria 28523
651 Ga0495658_0053649 3300046683 Bacteria 2290
652 Ga0495613_0005014 3300046689 Bacteria 9947
653 Ga0495613_0033921 3300046689 Bacteria 3791
654 Ga0495624_0000193 3300046690 Bacteria 46434
655 Ga0495624_0047370 3300046690 Bacteria 2731
656 Ga0495624_0050832 3300046690 Bacteria 2625
657 Ga0495670_0135766 3300046691 Bacteria 1284
658 Ga0495671_0130999 3300046692 Bacteria 1223
659 Ga0495649_0069464 3300046694 Bacteria 1889
660 Ga0495649_0127110 3300046694 Bacteria 1346
661 Ga0495589_0109607 3300046794 Bacteria 1333
662 Ga0495600_0011609 3300046809 Bacteria 5492
663 Ga0495600_0048122 3300046809 Bacteria 2781
664 Ga0495660_0039967 3300046810 Bacteria 2602
665 Ga0495581_0000110 3300047315 Bacteria 34511
666 Ga0495581_0203964 3300047315 Bacteria 1156
667 Ga0495604_0006962 3300047317 Bacteria 8961
668 Ga0495604_0019089 3300047317 Bacteria 5490
669 Ga0495604_0250197 3300047317 Bacteria 1208
670 Ga0495674_0000031 3300047319 Bacteria 115867
671 Ga0495674_0020552 3300047319 Bacteria 6111
672 Ga0495672_0124714 3300047320 Bacteria 1364
673 Ga0495672_0174014 3300047320 Bacteria 1095
674 Ga0495672_0226463 3300047320 Bacteria 920
675 Ga0495676_0017501 3300047321 Bacteria 6336
676 Ga0495676_0066462 3300047321 Bacteria 2794
677 Ga0495680_0236903 3300047322 Bacteria 1297
678 Ga0495680_0284009 3300047322 Bacteria 1166
679 Ga0495683_0005882 3300047323 Bacteria 6740
680 Ga0495683_0091545 3300047323 Bacteria 1473
681 Ga0495683_0118852 3300047323 Bacteria 1256
682 Ga0495687_051820 3300047443 Bacteria 1739
683 Ga0495673_0019972 3300047469 Bacteria 3345
684 Ga0495673_0051837 3300047469 Bacteria 1795
685 Ga0495673_0076645 3300047469 Bacteria 1394
686 Ga0495673_0102340 3300047469 Bacteria 1156
687 Ga0495684_0000739 3300047471 Bacteria 26356
688 Ga0495684_0180978 3300047471 Bacteria 1562
689 Ga0495686_0044421 3300047472 Bacteria 2813
690 Ga0495686_0109670 3300047472 Bacteria 1656
691 Ga0495686_0176683 3300047472 Bacteria 1239
692 Ga0495593_0000468 3300047673 Bacteria 22697
693 Ga0495593_0002910 3300047673 Bacteria 10321
694 Ga0495593_0015375 3300047673 Bacteria 4337
695 Ga0495593_0075965 3300047673 Bacteria 1741
696 Ga0495602_0025670 3300048088 Bacteria 5698
697 Ga0495602_0099797 3300048088 Bacteria 2386
698 Ga0495602_0130673 3300048088 Bacteria 2004
699 Ga0495602_0357906 3300048088 Bacteria 1051
700 Ga0495626_0060495 3300048091 Bacteria 1725
701 Ga0496100_0027909 3300048903 Bacteria 3476
702 Ga0496101_0065211 3300048904 Bacteria 2655
703 Ga0496101_0102901 3300048904 Bacteria 2140
704 Ga0496102_0000555 3300048905 Bacteria 40031
705 Ga0496102_0010375 3300048905 Bacteria 8015
706 Ga0496102_0179739 3300048905 Bacteria 1993
707 Ga0496102_0269156 3300048905 Bacteria 1606
708 Ga0496102_0542151 3300048905 Bacteria 1086
709 Ga0496103_0000557 3300048906 Bacteria 29704
710 Ga0496103_0042314 3300048906 Bacteria 2802
711 Ga0496104_0009643 3300048907 Bacteria 8598
712 Ga0496104_0096355 3300048907 Bacteria 2830
713 Ga0496104_0173252 3300048907 Bacteria 2068
714 Ga0496104_0255338 3300048907 Bacteria 1666
715 Ga0496105_0001282 3300048908 Bacteria 17583
716 Ga0496105_0021873 3300048908 Bacteria 5176
717 Ga0496105_0047703 3300048908 Bacteria 3535
718 Ga0496106_0004573 3300048909 Bacteria 10262
719 Ga0496106_0050055 3300048909 Bacteria 3148
720 Ga0496106_0057238 3300048909 Bacteria 2948
721 Ga0496106_0136665 3300048909 Bacteria 1926
722 Ga0496107_0026752 3300048910 Bacteria 4092
723 Ga0496107_0121175 3300048910 Bacteria 1927
724 Ga0496108_0014136 3300048911 Bacteria 6513
725 Ga0496108_0220864 3300048911 Bacteria 1646
726 Ga0496108_0263919 3300048911 Bacteria 1499
727 Ga0496108_0295265 3300048911 Bacteria 1411
728 Ga0496109_0018596 3300048912 Bacteria 6105
729 Ga0496109_0329235 3300048912 Bacteria 1442
730 Ga0496109_0363933 3300048912 Bacteria 1366
731 Ga0496109_0559708 3300048912 Bacteria 1078
732 Ga0496110_0022638 3300048913 Bacteria 5338
733 Ga0496111_0051917 3300048914 Bacteria 2961
734 Ga0496112_0094296 3300048915 Bacteria 2963
735 Ga0496112_0356293 3300048915 Bacteria 1405
736 Ga0496112_0579863 3300048915 Bacteria 1054
737 Ga0496113_0042679 3300048916 Bacteria 3352
738 Ga0496113_0106656 3300048916 Bacteria 2176
739 Ga0496113_0174494 3300048916 Bacteria 1703
740 Ga0496114_0130263 3300048917 Bacteria 2172
741 Ga0496114_0160893 3300048917 Bacteria 1952
742 Ga0496114_0208638 3300048917 Bacteria 1713
743 Ga0496115_0023575 3300048918 Bacteria 4776
744 Ga0496115_0033388 3300048918 Bacteria 4063
745 Ga0496115_0051013 3300048918 Bacteria 3317
746 Ga0496116_0001007 3300048919 Bacteria 34381
747 Ga0496116_0005676 3300048919 Bacteria 11487
748 Ga0496117_0002434 3300048920 Bacteria 23501
749 Ga0496117_0016833 3300048920 Bacteria 6142
750 Ga0496117_0022077 3300048920 Bacteria 5115
751 Ga0496117_0032945 3300048920 Bacteria 3926
752 Ga0496117_0178615 3300048920 Bacteria 1223
753 Ga0496118_0003880 3300048921 Bacteria 18355
754 Ga0496118_0009370 3300048921 Bacteria 9913
755 Ga0496118_0014928 3300048921 Bacteria 7229
756 Ga0496118_0018348 3300048921 Bacteria 6317
757 Ga0496118_0025163 3300048921 Bacteria 5114
758 Ga0496118_0027761 3300048921 Bacteria 4782
759 Ga0496118_0103167 3300048921 Bacteria 1919
760 Ga0496118_0121932 3300048921 Bacteria 1697
761 Ga0496118_0128202 3300048921 Bacteria 1635
762 Ga0496118_0129820 3300048921 Bacteria 1621
763 Ga0496119_0050984 3300048922 Bacteria 2547
764 Ga0496119_0053547 3300048922 Bacteria 2464
765 Ga0496119_0069337 3300048922 Bacteria 2072
766 Ga0496119_0090613 3300048922 Bacteria 1738
767 Ga0496120_0023478 3300048923 Bacteria 3861
768 Ga0496120_0113736 3300048923 Bacteria 1410
769 Ga0496121_0000230 3300048924 Bacteria 120616
770 Ga0496121_0002110 3300048924 Bacteria 31261
771 Ga0496121_0007387 3300048924 Bacteria 13280
772 Ga0496121_0019469 3300048924 Bacteria 6784
773 Ga0496121_0024693 3300048924 Bacteria 5736
774 Ga0496121_0027675 3300048924 Bacteria 5299
775 Ga0496121_0034792 3300048924 Bacteria 4527
776 Ga0496121_0039679 3300048924 Bacteria 4143
777 Ga0496121_0047342 3300048924 Bacteria 3670
778 Ga0496121_0068250 3300048924 Bacteria 2877
779 Ga0496121_0159771 3300048924 Bacteria 1649
780 Ga0496121_0181524 3300048924 Bacteria 1518
781 Ga0496121_0192408 3300048924 Bacteria 1461
782 Ga0496121_0203141 3300048924 Bacteria 1411
783 Ga0496121_0238559 3300048924 Bacteria 1269
784 Ga0496121_0239198 3300048924 Bacteria 1266
785 Ga0496121_0264715 3300048924 Bacteria 1185
786 Ga0496122_0075629 3300048925 Bacteria 2374
787 Ga0496122_0101586 3300048925 Bacteria 1920
788 Ga0496123_0007052 3300048926 Bacteria 10693
789 Ga0496124_0001208 3300048927 Bacteria 40031
790 Ga0496124_0009342 3300048927 Bacteria 10103
791 Ga0496124_0027280 3300048927 Bacteria 5130
792 Ga0496124_0128971 3300048927 Bacteria 2012
793 Ga0496124_0138668 3300048927 Bacteria 1922
794 Ga0496125_0000763 3300048928 Bacteria 52688
795 Ga0496125_0000796 3300048928 Bacteria 51436
796 Ga0496125_0002440 3300048928 Bacteria 24147
797 Ga0496125_0014089 3300048928 Bacteria 7811
798 Ga0496125_0032119 3300048928 Bacteria 4667
799 Ga0496125_0054903 3300048928 Bacteria 3252
800 Ga0496125_0154710 3300048928 Bacteria 1568
801 Ga0496126_0003388 3300048929 Bacteria 20179
802 Ga0496126_0011936 3300048929 Bacteria 8929
803 Ga0496126_0015175 3300048929 Bacteria 7757
804 Ga0496126_0015619 3300048929 Bacteria 7629
805 Ga0496126_0043220 3300048929 Bacteria 4158
806 Ga0496126_0058324 3300048929 Bacteria 3480
807 Ga0496126_0061127 3300048929 Bacteria 3385
808 Ga0496126_0066910 3300048929 Bacteria 3211
809 Ga0496126_0072771 3300048929 Bacteria 3057
810 Ga0496126_0131194 3300048929 Bacteria 2165
811 Ga0496126_0136815 3300048929 Bacteria 2112
812 Ga0496126_0217990 3300048929 Bacteria 1604
813 Ga0496126_0309918 3300048929 Bacteria 1300
814 Ga0496126_0326321 3300048929 Bacteria 1261
815 Ga0496126_0384818 3300048929 Bacteria 1141
816 Ga0495678_019364 3300049459 Bacteria 3038
817 Ga0495682_0064865 3300049460 Bacteria 1317
818 Ga0495682_0081205 3300049460 Bacteria 1166
819 Ga0501033_0024478 3300049570 Bacteria 4554
820 Ga0501038_0351885 3300049574 Bacteria 1147
821 Ga0501039_0192388 3300049575 Bacteria 1604
822 Ga0501039_0586890 3300049575 Bacteria 874
823 Ga0501041_0204906 3300049577 Bacteria 1237
824 Ga0501043_0184323 3300049579 Bacteria 1626
825 Ga0501046_0158373 3300049580 Bacteria 1704
826 Ga0501073_0022793 3300049589 Bacteria 4505
827 Ga0501077_0072184 3300049593 Bacteria 2187
828 Ga0501079_0111175 3300049741 Bacteria 2129
829 Ga0501080_0016647 3300049742 Bacteria 6790
830 Ga0501081_0039630 3300049743 Bacteria 3225
831 Ga0501081_0296556 3300049743 Bacteria 1186
832 Ga0501044_0023791 3300049823 Bacteria 6513
833 Ga0501044_0067293 3300049823 Bacteria 3650
834 Ga0501045_0222520 3300049824 Bacteria 1405
835 nmdc:mga03683_65802_c1 3300050489 Bacteria 1540
836 nmdc:mga00v17_42456_c1 3300050491 Bacteria 2735
837 nmdc:mga00v17_50405_c1 3300050491 Bacteria 2529
838 nmdc:mga0yw44_286352_c1 3300050492 Bacteria 1102
839 nmdc:mga0yw44_3568_c1 3300050492 Bacteria 5749
840 nmdc:mga0yw44_49759_c1 3300050492 Bacteria 2531
841 nmdc:mga0yw44_90003_c1 3300050492 Bacteria 1938
842 nmdc:mga0k408_153964_c1 3300050493 Bacteria 1369
843 nmdc:mga06z11_116659_c1 3300050494 Bacteria 1485
844 nmdc:mga06z11_28127_c1 3300050494 Bacteria 2694
845 nmdc:mga06z11_4743_c1 3300050494 Bacteria 5377
846 nmdc:mga06z11_80678_c1 3300050494 Bacteria 1745
847 nmdc:mga04h51_30296_c1 3300050495 Bacteria 1702
848 nmdc:mga07m45_175948_c1 3300050496 Bacteria 1244
849 nmdc:mga07m45_207352_c1 3300050496 Bacteria 1140
850 nmdc:mga07m45_24585_c1 3300050496 Bacteria 3302
851 nmdc:mga07m45_28678_c1 3300050496 Bacteria 3072
852 nmdc:mga05p37_44591_c1 3300050507 Bacteria 5455
853 nmdc:mga0a205_159553_c1 3300050515 Bacteria 2152
854 nmdc:mga0sz30_105157_c1 3300050516 Bacteria 1235
855 nmdc:mga0sz30_26917_c1 3300050516 Bacteria 2360
856 nmdc:mga0sz30_27654_c1 3300050516 Bacteria 2009
857 nmdc:mga0sz30_6834_c1 3300050516 Bacteria 4257
858 nmdc:mga0sz30_90495_c1 3300050516 Bacteria 1331
859 Ga0500610_0124829 3300053079 Bacteria 1314
860 Ga0500635_0093259 3300053080 Bacteria 1098
861 Ga0495595_0000846 3300053084 Bacteria 11723
862 Ga0495619_0000641 3300053085 Bacteria 23059
863 Ga0500578_0060593 3300053086 Bacteria 2417
864 Ga0500578_0135632 3300053086 Bacteria 1541
865 Ga0500643_000062 3300053087 Bacteria 122407
866 Ga0500644_0026428 3300053088 Bacteria 1796
867 Ga0500646_0063354 3300053090 Bacteria 1093
868 Ga0500647_0004251 3300053091 Bacteria 5736
869 Ga0500651_0002427 3300053093 Bacteria 9840
870 Ga0500651_0026539 3300053093 Bacteria 3642
871 Ga0500651_0092785 3300053093 Bacteria 1857
872 Ga0500651_0117077 3300053093 Bacteria 1620
873 Ga0500651_0193814 3300053093 Bacteria 1202
874 Ga0500566_0000535 3300053094 Bacteria 21307
875 Ga0500566_0000789 3300053094 Bacteria 17984
876 Ga0500566_0002570 3300053094 Bacteria 10806
877 Ga0500566_0037243 3300053094 Bacteria 2819
878 Ga0500566_0162376 3300053094 Bacteria 1163
879 Ga0500641_0027000 3300053096 Bacteria 2233
880 Ga0500650_0000946 3300053098 Bacteria 8188
881 Ga0500554_004318 3300053102 Bacteria 3002
882 Ga0500555_010172 3300053103 Bacteria 2693
883 Ga0500555_014393 3300053103 Bacteria 2281
884 Ga0500556_0000015 3300053104 Bacteria 202598
885 Ga0500557_000158 3300053105 Bacteria 15084
886 Ga0500562_039345 3300053108 Bacteria 1256
887 Ga0500562_052525 3300053108 Bacteria 1091
888 Ga0500569_002085 3300053109 Bacteria 3895
889 Ga0500569_002666 3300053109 Bacteria 3554
890 Ga0500569_004768 3300053109 Bacteria 2874
891 Ga0500572_001690 3300053111 Bacteria 5763
892 Ga0500572_006575 3300053111 Bacteria 2667
893 Ga0500591_056421 3300053115 Bacteria 1824
894 Ga0500592_000131 3300053116 Bacteria 16085
895 Ga0500592_001525 3300053116 Bacteria 3752
896 Ga0500593_065947 3300053117 Bacteria 1582
897 Ga0500594_0072310 3300053118 Bacteria 1016
898 Ga0500595_001746 3300053119 Bacteria 11337
899 Ga0500595_004600 3300053119 Bacteria 6155
900 Ga0500595_004632 3300053119 Bacteria 6132
901 Ga0500595_009010 3300053119 Bacteria 4053
902 Ga0500595_025647 3300053119 Bacteria 2040
903 Ga0500595_038197 3300053119 Bacteria 1562
904 Ga0500608_013258 3300053122 Bacteria 3648
905 Ga0500608_033083 3300053122 Bacteria 2459
906 Ga0500608_046559 3300053122 Bacteria 2083
907 Ga0500617_044767 3300053124 Bacteria 1978
908 Ga0500618_007080 3300053125 Bacteria 3231
909 Ga0500626_114729 3300053128 Bacteria 1159
910 Ga0500642_0000044 3300053130 Bacteria 82877
911 Ga0500642_0000350 3300053130 Bacteria 15587
912 Ga0500642_0001189 3300053130 Bacteria 7459
913 Ga0500652_000638 3300053131 Bacteria 11977
914 Ga0500559_0000130 3300053136 Bacteria 58494
915 Ga0500559_0011384 3300053136 Bacteria 3801
916 Ga0500559_0032191 3300053136 Bacteria 2252
917 Ga0500568_0000661 3300053139 Bacteria 24893
918 Ga0500568_0027897 3300053139 Bacteria 2358
919 Ga0500568_0053418 3300053139 Bacteria 1583
920 Ga0500577_0000893 3300053142 Bacteria 7713
921 Ga0500586_001145 3300053145 Bacteria 5500
922 Ga0500588_0009637 3300053146 Bacteria 2304
923 Ga0500604_0001929 3300053151 Bacteria 5758
924 Ga0500604_0002650 3300053151 Bacteria 4870
925 Ga0500604_0003770 3300053151 Bacteria 4056
926 Ga0500604_0009113 3300053151 Bacteria 2641
927 Ga0500604_0088393 3300053151 Bacteria 1009
928 Ga0500616_0000041 3300053153 Bacteria 359328
929 Ga0500616_0000666 3300053153 Bacteria 40719
930 Ga0500616_0100401 3300053153 Bacteria 1415
931 Ga0500619_040921 3300053154 Bacteria 1463
932 Ga0500620_005953 3300053155 Bacteria 2874
933 Ga0500622_0000700 3300053156 Bacteria 29484
934 Ga0500622_0030723 3300053156 Bacteria 2819
935 Ga0500627_0001099 3300053158 Bacteria 7394
936 Ga0500630_029223 3300053159 Bacteria 2714
937 Ga0500639_017207 3300053163 Bacteria 3813
938 Ga0500636_0000323 3300053177 Bacteria 26381
939 Ga0500636_0001687 3300053177 Bacteria 12092
940 Ga0500636_0064500 3300053177 Bacteria 2133
941 Ga0500637_0000231 3300053178 Bacteria 20786
942 Ga0500625_000845 3300053729 Bacteria 9398
943 Ga0500645_009075 3300053730 Bacteria 3358
944 Ga0500609_001511 3300053731 Bacteria 3405
945 Ga0500601_000485 3300053737 Bacteria 6190
946 Ga0500661_001742 3300055283 Bacteria 4101

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049575 Ga0501039_0586890 Ga0501039_0586890_93_860 239
2 3300046530 Ga0495654_0082409 Ga0495654_0082409_13_840 264
3 3300003203 JGI25406J46586_10005494 JGI25406J46586_100054944 265
4 3300005985 Ga0081539_10000617 Ga0081539_1000061763 265
5 3300044735 Ga0466968_0116457 Ga0466968_0116457_164_1084 265
6 3300046681 Ga0495647_0076288 Ga0495647_0076288_90_920 265
7 3300047320 Ga0495672_0226463 Ga0495672_0226463_10_837 265
8 3300046692 Ga0495671_0130999 Ga0495671_0130999_16_849 266
9 3300046558 Ga0495633_0002918 Ga0495633_0002918_4742_5626 267
10 3300049570 Ga0501033_0024478 Ga0501033_0024478_3043_3969 268
11 3300049823 Ga0501044_0023791 Ga0501044_0023791_1601_2527 268
12 3300049574 Ga0501038_0351885 Ga0501038_0351885_86_1117 269
13 3300005937 Ga0081455_10144890 Ga0081455_101448902 271
14 3300005983 Ga0081540_1069407 Ga0081540_10694072 271
15 3300006038 Ga0075365_10142938 Ga0075365_101429381 271
16 3300007788 Ga0099795_10000656 Ga0099795_100006562 271
17 3300010159 Ga0099796_10009702 Ga0099796_100097023 271
18 3300047320 Ga0495672_0174014 Ga0495672_0174014_37_933 273
19 3300031727 Ga0316576_10003954 Ga0316576_100039544 274
20 3300031728 Ga0316578_10105503 Ga0316578_101055032 274
21 3300004625 Ga0055543_1017737 Ga0055543_10177372 275
22 3300005262 Ga0065165_1002115 Ga0065165_10021159 275
23 3300006195 Ga0075366_10165260 Ga0075366_101652602 275
24 3300035695 Ga0373927_0138444 Ga0373927_0138444_489_1418 275
25 3300048917 Ga0496114_0130263 Ga0496114_0130263_1027_1953 275
26 3300050494 nmdc:mga06z11_80678_c1 nmdc:mga06z11_80678_c1_304_1230 275
27 3300048929 Ga0496126_0072771 Ga0496126_0072771_1224_2153 276
28 iso_pu_bacteria 2837678835 2837680049 277
29 3300048929 Ga0496126_0384818 Ga0496126_0384818_13_879 278
30 3300044658 Ga0466972_0010137 Ga0466972_0010137_3401_4321 279
31 iso_pu_bacteria 2842698319 2842701352 279
32 3300005434 Ga0070709_10093647 Ga0070709_100936472 280
33 3300005435 Ga0070714_100152727 Ga0070714_1001527272 280
34 3300025929 Ga0207664_10133704 Ga0207664_101337041 280
35 iso_pu_bacteria 2643221637 2644208029 280
36 iso_pu_bacteria 2643221718 2644651431 280
37 iso_pu_bacteria 2595698237 2596374003 281
38 iso_pu_bacteria 2599185292 2599902713 281
39 iso_pu_bacteria 2643221569 2643861558 281
40 iso_pu_bacteria 2643221594 2643980142 281
41 iso_pu_bacteria 2738541281 2738746157 281
42 iso_pu_bacteria 2738543032 2739355387 281
43 iso_pu_bacteria 2808606395 2809033067 281
44 iso_pu_bacteria 2902330777 2902335828 281
45 iso_pu_bacteria 2902405164 2902409056 281
46 iso_pu_bacteria 2919704043 2919708135 281
47 iso_pu_bacteria 2928125067 2928129397 281
48 3300027614 Ga0209970_1000575 Ga0209970_10005752 282
49 3300031911 Ga0307412_10000109 Ga0307412_1000010936 282
50 3300048924 Ga0496121_0039679 Ga0496121_0039679_2072_2995 282
51 iso_pu_bacteria 2829745981 2829748830 282
52 iso_pu_bacteria 2889306138 2889308264 282
53 3300025261 Ga0209233_1004082 Ga0209233_10040822 283
54 3300025295 Ga0209564_1000792 Ga0209564_100079234 283
55 3300036647 Ga0316582_0051018 Ga0316582_0051018_1271_2194 283
56 3300036712 Ga0316584_0060834 Ga0316584_0060834_848_1771 283
57 3300048929 Ga0496126_0003388 Ga0496126_0003388_2179_3108 283
58 iso_pu_bacteria 2643221717 2644646581 283
59 iso_pu_bacteria 2842333319 2842334284 283
60 iso_pu_bacteria 2671180139 2671695233 284
61 3300003659 JGI25404J52841_10010582 JGI25404J52841_100105821 285
62 3300005937 Ga0081455_10030272 Ga0081455_100302722 285
63 3300005983 Ga0081540_1004703 Ga0081540_10047032 285
64 3300005983 Ga0081540_1009656 Ga0081540_10096565 285
65 3300005983 Ga0081540_1028489 Ga0081540_10284892 285
66 3300032002 Ga0307416_100376692 Ga0307416_1003766922 285
67 3300046615 Ga0495656_0053651 Ga0495656_0053651_217_1143 285
68 3300003659 JGI25404J52841_10000119 JGI25404J52841_100001197 286
69 3300003659 JGI25404J52841_10003540 JGI25404J52841_100035402 286
70 3300005937 Ga0081455_10070447 Ga0081455_100704472 286
71 3300005983 Ga0081540_1005662 Ga0081540_10056629 286
72 3300005983 Ga0081540_1020027 Ga0081540_10200272 286
73 iso_pu_bacteria 2513237102 2513704542 286
74 iso_pu_bacteria 2517093001 2517102338 286
75 iso_pu_bacteria 2824600985 2824602623 286
76 iso_pu_bacteria 2824609381 2824612597 286
77 iso_pu_bacteria 2824617872 2824621060 286
78 iso_pu_bacteria 2824626560 2824630067 286
79 iso_pu_bacteria 2824635225 2824637917 286
80 iso_pu_bacteria 2824644064 2824646370 286
81 iso_pu_bacteria 2824679649 2824682086 286
82 iso_pu_bacteria 2824714736 2824718729 286
83 iso_pu_bacteria 2824723954 2824726346 286
84 iso_pu_bacteria 2841957949 2841964795 286
85 iso_pu_bacteria 2842038055 2842043831 286
86 iso_pu_bacteria 2842045827 2842052179 286
87 iso_pu_bacteria 2874612657 2874617713 286
88 iso_pu_bacteria 2879099564 2879107275 286
89 iso_pu_bacteria 2881364244 2881370955 286
90 iso_pu_bacteria 2881665667 2881665742 286
91 iso_pu_bacteria 2885366525 2885371354 286
92 iso_pu_bacteria 2906626472 2906633485 286
93 iso_pu_bacteria 2906643746 2906649064 286
94 iso_pu_bacteria 2917554339 2917556174 286
95 iso_pu_bacteria 2922368715 2922378297 286
96 iso_pu_bacteria 8016583857 8016586734 286
97 3300005844 Ga0068862_100004021 Ga0068862_1000040215 287
98 3300025297 Ga0209758_1013773 Ga0209758_10137732 287
99 3300025304 Ga0209257_1000296 Ga0209257_10002969 287
100 3300028380 Ga0268265_10005306 Ga0268265_100053063 287
101 3300049575 Ga0501039_0192388 Ga0501039_0192388_219_1145 287
102 3300049593 Ga0501077_0072184 Ga0501077_0072184_1134_2060 287
103 3300049741 Ga0501079_0111175 Ga0501079_0111175_525_1451 287
104 3300049743 Ga0501081_0039630 Ga0501081_0039630_2235_3161 287
105 3300049824 Ga0501045_0222520 Ga0501045_0222520_128_1054 287
106 3300053103 Ga0500555_014393 Ga0500555_014393_154_1083 287
107 3300053731 Ga0500609_001511 Ga0500609_001511_2457_3386 287
108 iso_pu_bacteria 2511231028 2511398349 287
109 iso_pu_bacteria 2513237092 2513626715 287
110 iso_pu_bacteria 2513237094 2513639599 287
111 iso_pu_bacteria 2513237095 2513647915 287
112 iso_pu_bacteria 2513237139 2513873862 287
113 iso_pu_bacteria 2513237161 2514012833 287
114 iso_pu_bacteria 2528768022 2528851638 287
115 iso_pu_bacteria 2602042107 2603860757 287
116 iso_pu_bacteria 2617270735 2617351755 287
117 iso_pu_bacteria 2617270741 2617374069 287
118 iso_pu_bacteria 2791355196 2793063065 287
119 iso_pu_bacteria 2802429603 2805915945 287
120 iso_pu_bacteria 2816332527 2818237327 287
121 iso_pu_bacteria 2824653114 2824654412 287
122 iso_pu_bacteria 2824661429 2824664779 287
123 iso_pu_bacteria 2824671348 2824676740 287
124 iso_pu_bacteria 2824687955 2824692957 287
125 iso_pu_bacteria 2824696289 2824697600 287
126 iso_pu_bacteria 2824732956 2824735348 287
127 iso_pu_bacteria 2824746037 2824749105 287
128 iso_pu_bacteria 2824773399 2824774890 287
129 iso_pu_bacteria 2838122688 2838124167 287
130 iso_pu_bacteria 2841941048 2841944515 287
131 iso_pu_bacteria 2841949485 2841951653 287
132 iso_pu_bacteria 2841966195 2841969291 287
133 iso_pu_bacteria 2841974524 2841980310 287
134 iso_pu_bacteria 2841983080 2841985562 287
135 iso_pu_bacteria 2844315083 2844321871 287
136 iso_pu_bacteria 2847930680 2847931422 287
137 iso_pu_bacteria 2847939898 2847941805 287
138 iso_pu_bacteria 2849076700 2849082722 287
139 iso_pu_bacteria 2857509624 2857511617 287
140 iso_pu_bacteria 2857524615 2857524804 287
141 iso_pu_bacteria 2874620515 2874624467 287
142 iso_pu_bacteria 2874628541 2874636758 287
143 iso_pu_bacteria 2876761206 2876768996 287
144 iso_pu_bacteria 2879083081 2879087542 287
145 iso_pu_bacteria 2888378607 2888379916 287
146 iso_pu_bacteria 2888419890 2888420723 287
147 iso_pu_bacteria 2893066018 2893069318 287
148 iso_pu_bacteria 2903727486 2903727579 287
149 iso_pu_bacteria 2904666416 2904672194 287
150 iso_pu_bacteria 2906602504 2906602931 287
151 iso_pu_bacteria 2908775508 2908776546 287
152 iso_pu_bacteria 2919073203 2919078690 287
153 iso_pu_bacteria 2922393267 2922396622 287
154 iso_pu_bacteria 2929615660 2929622601 287
155 iso_pu_bacteria 2929624759 2929631181 287
156 iso_pu_bacteria 2932784394 2932786396 287
157 iso_pu_bacteria 2932794094 2932794639 287
158 iso_pu_bacteria 2932801729 2932806920 287
159 iso_pu_bacteria 2932809354 2932812529 287
160 iso_pu_bacteria 2932818245 2932822891 287
161 iso_pu_bacteria 2932828146 2932829634 287
162 iso_pu_bacteria 2933577622 2933584320 287
163 iso_pu_bacteria 2935616580 2935618152 287
164 iso_pu_bacteria 2935638405 2935641450 287
165 iso_pu_bacteria 2935665750 2935669492 287
166 iso_pu_bacteria 2935675223 2935677910 287
167 iso_pu_bacteria 2935684952 2935689641 287
168 iso_pu_bacteria 2935694250 2935698177 287
169 iso_pu_bacteria 2935703347 2935707317 287
170 iso_pu_bacteria 2935713505 2935717161 287
171 iso_pu_bacteria 2935722832 2935730005 287
172 iso_pu_bacteria 2935732158 2935738576 287
173 iso_pu_bacteria 2935741537 2935749176 287
174 iso_pu_bacteria 2935750917 2935756995 287
175 iso_pu_bacteria 2935760218 2935764394 287
176 iso_pu_bacteria 2935801545 2935804304 287
177 iso_pu_bacteria 2935810662 2935815388 287
178 iso_pu_bacteria 2935827899 2935831181 287
179 iso_pu_bacteria 2935837841 2935841790 287
180 iso_pu_bacteria 2935855204 2935856349 287
181 iso_pu_bacteria 2935864058 2935866319 287
182 iso_pu_bacteria 2935873716 2935874625 287
183 iso_pu_bacteria 2935883170 2935890332 287
184 iso_pu_bacteria 2935992306 2935994086 287
185 iso_pu_bacteria 2936002035 2936004903 287
186 iso_pu_bacteria 2936037263 2936045043 287
187 iso_pu_bacteria 2940556831 2940562909 287
188 iso_pu_bacteria 2941538514 2941543863 287
189 iso_pu_bacteria 3005483717 3005487328 287
190 iso_pu_bacteria 3005506211 3005509496 287
191 iso_pu_bacteria 3005587118 3005589486 287
192 iso_pu_bacteria 3005594810 3005597653 287
193 iso_pu_bacteria 8016511872 8016518569 287
194 iso_pu_bacteria 8017057580 8017058096 287
195 iso_pu_bacteria 8019576017 8019577635 287
196 iso_pu_bacteria 8019586578 8019595730 287
197 iso_pu_bacteria 8019597564 8019606030 287
198 iso_pu_bacteria 8019608314 8019612501 287
199 iso_pu_bacteria 8019648815 8019652827 287
200 iso_pu_bacteria 8054002106 8054003241 287
201 iso_pu_bacteria 8055742211 8055751052 287
202 iso_pu_bacteria 8056967851 8056970966 287
203 3300003322 rootL2_10191799 rootL2_101917992 288
204 3300003323 rootH1_10157539 rootH1_101575391 288
205 3300005353 Ga0070669_100051420 Ga0070669_1000514202 288
206 3300005356 Ga0070674_100023622 Ga0070674_1000236222 288
207 3300005434 Ga0070709_10007052 Ga0070709_100070522 288
208 3300005436 Ga0070713_100056750 Ga0070713_1000567502 288
209 3300005439 Ga0070711_100001277 Ga0070711_1000012778 288
210 3300005617 Ga0068859_100112738 Ga0068859_1001127382 288
211 3300005842 Ga0068858_100178582 Ga0068858_1001785822 288
212 3300005981 Ga0081538_10005891 Ga0081538_1000589110 288
213 3300006881 Ga0068865_100042363 Ga0068865_1000423632 288
214 3300006931 Ga0097620_100112736 Ga0097620_1001127362 288
215 3300009101 Ga0105247_10032869 Ga0105247_100328692 288
216 3300009551 Ga0105238_10301637 Ga0105238_103016372 288
217 3300014326 Ga0157380_10011189 Ga0157380_100111893 288
218 3300025906 Ga0207699_10108324 Ga0207699_101083242 288
219 3300025928 Ga0207700_10013065 Ga0207700_100130652 288
220 3300026088 Ga0207641_10219942 Ga0207641_102199422 288
221 3300028556 Ga0265337_1005134 Ga0265337_10051342 288
222 3300028558 Ga0265326_10006639 Ga0265326_100066391 288
223 3300028563 Ga0265319_1001952 Ga0265319_10019525 288
224 3300028573 Ga0265334_10000603 Ga0265334_100006036 288
225 3300028577 Ga0265318_10009675 Ga0265318_100096752 288
226 3300028653 Ga0265323_10000037 Ga0265323_1000003721 288
227 3300028666 Ga0265336_10000392 Ga0265336_100003927 288
228 3300028800 Ga0265338_10000024 Ga0265338_1000002454 288
229 3300029957 Ga0265324_10003350 Ga0265324_100033503 288
230 3300053087 Ga0500643_000062 Ga0500643_000062_20357_21274 288
231 iso_pu_bacteria 2507262055 2507504891 288
232 iso_pu_bacteria 2508501009 2508546244 288
233 iso_pu_bacteria 2508501042 2508695176 288
234 iso_pu_bacteria 2515154112 2515625815 288
235 iso_pu_bacteria 2728368998 2728754839 288
236 iso_pu_bacteria 2791355199 2793082888 288
237 iso_pu_bacteria 2874590934 2874596885 288
238 iso_pu_bacteria 2874645413 2874648690 288
239 iso_pu_bacteria 2876771140 2876777349 288
240 iso_pu_bacteria 2876818435 2876825431 288
241 iso_pu_bacteria 2879074833 2879077680 288
242 iso_pu_bacteria 2879127579 2879128655 288
243 iso_pu_bacteria 2879142872 2879143995 288
244 iso_pu_bacteria 2885409591 2885418344 288
245 iso_pu_bacteria 2888388044 2888390990 288
246 iso_pu_bacteria 2889033259 2889037867 288
247 iso_pu_bacteria 2897803580 2897806340 288
248 iso_pu_bacteria 2922386360 2922386945 288
249 iso_pu_bacteria 2935608549 2935614911 288
250 iso_pu_bacteria 2935648319 2935652939 288
251 iso_pu_bacteria 2935656913 2935661522 288
252 iso_pu_bacteria 2935819856 2935826049 288
253 iso_pu_bacteria 2935847175 2935851668 288
254 iso_pu_bacteria 2935908558 2935910310 288
255 iso_pu_bacteria 2935916978 2935918404 288
256 iso_pu_bacteria 2935926038 2935927779 288
257 iso_pu_bacteria 2935934488 2935936349 288
258 iso_pu_bacteria 2935942939 2935944098 288
259 iso_pu_bacteria 2935951376 2935952535 288
260 iso_pu_bacteria 2935959822 2935962328 288
261 iso_pu_bacteria 2935967501 2935969375 288
262 iso_pu_bacteria 2935975950 2935977857 288
263 iso_pu_bacteria 2935984226 2935984837 288
264 iso_pu_bacteria 2936011229 2936015749 288
265 iso_pu_bacteria 2936019824 2936024383 288
266 iso_pu_bacteria 2936028420 2936031730 288
267 iso_pu_bacteria 2936046547 2936051552 288
268 iso_pu_bacteria 2936055302 2936056008 288
269 iso_pu_bacteria 8006926726 8006932717 288
270 iso_pu_bacteria 8006984368 8006984749 288
271 iso_pu_bacteria 8019619141 8019622610 288
272 iso_pu_bacteria 8019629233 8019630499 288
273 iso_pu_bacteria 8019659431 8019667328 288
274 iso_pu_bacteria 8019668869 8019677099 288
275 iso_pu_bacteria 8056673599 8056680970 288
276 3300001989 JGI24739J22299_10035135 JGI24739J22299_100351352 289
277 3300003215 JGI25153J46596_10002599 JGI25153J46596_100025999 289
278 3300003762 Ga0055542_1004966 Ga0055542_10049662 289
279 3300004625 Ga0055543_1025103 Ga0055543_10251031 289
280 3300005262 Ga0065165_1003507 Ga0065165_10035077 289
281 3300005262 Ga0065165_1021992 Ga0065165_10219921 289
282 3300005331 Ga0070670_100145966 Ga0070670_1001459662 289
283 3300005338 Ga0068868_100208670 Ga0068868_1002086702 289
284 3300005339 Ga0070660_100352667 Ga0070660_1003526671 289
285 3300005355 Ga0070671_100013653 Ga0070671_1000136534 289
286 3300005366 Ga0070659_100357816 Ga0070659_1003578162 289
287 3300005455 Ga0070663_100030652 Ga0070663_1000306522 289
288 3300005455 Ga0070663_100289667 Ga0070663_1002896671 289
289 3300005563 Ga0068855_100438626 Ga0068855_1004386261 289
290 3300005614 Ga0068856_100163427 Ga0068856_1001634272 289
291 3300006038 Ga0075365_10034809 Ga0075365_100348093 289
292 3300006042 Ga0075368_10005099 Ga0075368_100050992 289
293 3300006051 Ga0075364_10031298 Ga0075364_100312982 289
294 3300006177 Ga0075362_10120813 Ga0075362_101208132 289
295 3300006195 Ga0075366_10043484 Ga0075366_100434841 289
296 3300006195 Ga0075366_10116860 Ga0075366_101168602 289
297 3300006941 Ga0099825_1022855 Ga0099825_10228552 289
298 3300009093 Ga0105240_10350311 Ga0105240_103503112 289
299 3300009101 Ga0105247_10081077 Ga0105247_100810772 289
300 3300009101 Ga0105247_10272479 Ga0105247_102724792 289
301 3300009177 Ga0105248_10029163 Ga0105248_100291632 289
302 3300009553 Ga0105249_10065267 Ga0105249_100652672 289
303 3300011119 Ga0105246_10128923 Ga0105246_101289231 289
304 3300013296 Ga0157374_10097110 Ga0157374_100971101 289
305 3300013308 Ga0157375_10080746 Ga0157375_100807461 289
306 3300014325 Ga0163163_10112880 Ga0163163_101128801 289
307 3300021320 Ga0214544_1000003 Ga0214544_100000376 289
308 3300021321 Ga0214542_1000003 Ga0214542_100000366 289
309 3300021324 Ga0214545_1000004 Ga0214545_100000479 289
310 3300021327 Ga0214543_1000007 Ga0214543_1000007338 289
311 3300021361 Ga0213872_10021002 Ga0213872_100210022 289
312 3300021361 Ga0213872_10063966 Ga0213872_100639662 289
313 3300021441 Ga0213871_10001177 Ga0213871_100011772 289
314 3300025254 Ga0209148_1000334 Ga0209148_100033438 289
315 3300025261 Ga0209233_1003186 Ga0209233_10031862 289
316 3300025261 Ga0209233_1004834 Ga0209233_10048342 289
317 3300025272 Ga0209455_1001915 Ga0209455_10019153 289
318 3300025272 Ga0209455_1006216 Ga0209455_10062163 289
319 3300025297 Ga0209758_1000015 Ga0209758_1000015122 289
320 3300025297 Ga0209758_1000224 Ga0209758_100022427 289
321 3300025297 Ga0209758_1001476 Ga0209758_100147625 289
322 3300025297 Ga0209758_1054243 Ga0209758_10542432 289
323 3300025299 Ga0209256_1002302 Ga0209256_100230212 289
324 3300025302 Ga0207426_1000942 Ga0207426_100094219 289
325 3300025302 Ga0207426_1007986 Ga0207426_10079862 289
326 3300025304 Ga0209257_1001187 Ga0209257_100118717 289
327 3300025315 Ga0207697_10059802 Ga0207697_100598022 289
328 3300025901 Ga0207688_10109715 Ga0207688_101097151 289
329 3300025904 Ga0207647_10011348 Ga0207647_100113484 289
330 3300025913 Ga0207695_10082984 Ga0207695_100829842 289
331 3300025925 Ga0207650_10114824 Ga0207650_101148242 289
332 3300025942 Ga0207689_10093502 Ga0207689_100935022 289
333 3300025949 Ga0207667_10446021 Ga0207667_104460211 289
334 3300025949 Ga0207667_10454193 Ga0207667_104541931 289
335 3300025961 Ga0207712_10241889 Ga0207712_102418891 289
336 3300025972 Ga0207668_10097434 Ga0207668_100974342 289
337 3300025986 Ga0207658_10497775 Ga0207658_104977751 289
338 3300026035 Ga0207703_10197343 Ga0207703_101973431 289
339 3300026067 Ga0207678_10091219 Ga0207678_100912192 289
340 3300026089 Ga0207648_10031888 Ga0207648_100318882 289
341 3300026095 Ga0207676_10276423 Ga0207676_102764232 289
342 3300027296 Ga0209389_1000064 Ga0209389_100006422 289
343 3300027296 Ga0209389_1060420 Ga0209389_10604202 289
344 3300027357 Ga0209589_1000012 Ga0209589_1000012101 289
345 3300027357 Ga0209589_1000013 Ga0209589_1000013105 289
346 3300027361 Ga0209489_100013 Ga0209489_100013102 289
347 3300027363 Ga0209700_100014 Ga0209700_100014147 289
348 3300028379 Ga0268266_10225684 Ga0268266_102256842 289
349 3300028381 Ga0268264_10000427 Ga0268264_1000042724 289
350 3300031507 Ga0307509_10008331 Ga0307509_100083318 289
351 3300031730 Ga0307516_10003162 Ga0307516_100031624 289
352 3300035692 Ga0373935_0282203 Ga0373935_0282203_194_1114 289
353 3300037471 Ga0395905_0002017 Ga0395905_0002017_9674_10600 289
354 3300038443 Ga0395901_0244397 Ga0395901_0244397_700_1626 289
355 3300039438 Ga0436360_1017435 Ga0436360_1017435_571_1491 289
356 3300039447 Ga0436361_1109572 Ga0436361_1109572_2988_3908 289
357 3300044658 Ga0466972_0000379 Ga0466972_0000379_13906_14826 289
358 3300044683 Ga0466965_0007271 Ga0466965_0007271_4088_5014 289
359 3300044684 Ga0466966_0066402 Ga0466966_0066402_1327_2247 289
360 3300044765 Ga0466970_0062594 Ga0466970_0062594_127_1047 289
361 3300045049 Ga0466959_0167464 Ga0466959_0167464_538_1458 289
362 3300046459 Ga0495629_0009642 Ga0495629_0009642_6051_6971 289
363 3300046461 Ga0495641_0024733 Ga0495641_0024733_1717_2637 289
364 3300046462 Ga0495651_0009075 Ga0495651_0009075_2913_3833 289
365 3300046474 Ga0495605_0053154 Ga0495605_0053154_145_1071 289
366 3300046474 Ga0495605_0095462 Ga0495605_0095462_277_1203 289
367 3300046476 Ga0495662_0070165 Ga0495662_0070165_764_1684 289
368 3300046507 Ga0495606_0012187 Ga0495606_0012187_5377_6297 289
369 3300046507 Ga0495606_0096551 Ga0495606_0096551_180_1106 289
370 3300046507 Ga0495606_0163391 Ga0495606_0163391_278_1204 289
371 3300046511 Ga0495608_0109310 Ga0495608_0109310_791_1711 289
372 3300046512 Ga0495610_0112751 Ga0495610_0112751_262_1188 289
373 3300046514 Ga0495618_0149403 Ga0495618_0149403_380_1300 289
374 3300046515 Ga0495620_0059664 Ga0495620_0059664_626_1552 289
375 3300046516 Ga0495628_0065385 Ga0495628_0065385_1571_2491 289
376 3300046519 Ga0495632_0068042 Ga0495632_0068042_625_1545 289
377 3300046524 Ga0495648_0018141 Ga0495648_0018141_96_1016 289
378 3300046529 Ga0495652_0029126 Ga0495652_0029126_2564_3484 289
379 3300046557 Ga0495622_0067036 Ga0495622_0067036_124_1044 289
380 3300046616 Ga0495668_0023978 Ga0495668_0023978_335_1261 289
381 3300046642 Ga0495634_0021715 Ga0495634_0021715_46_966 289
382 3300046648 Ga0495611_0061777 Ga0495611_0061777_76_1002 289
383 3300046660 Ga0495625_0227519 Ga0495625_0227519_88_1014 289
384 3300046663 Ga0495635_0004842 Ga0495635_0004842_5871_6791 289
385 3300046674 Ga0495588_0041708 Ga0495588_0041708_1306_2232 289
386 3300046675 Ga0495657_0011053 Ga0495657_0011053_98_1018 289
387 3300046689 Ga0495613_0033921 Ga0495613_0033921_148_1068 289
388 3300046690 Ga0495624_0047370 Ga0495624_0047370_545_1465 289
389 3300046694 Ga0495649_0069464 Ga0495649_0069464_391_1311 289
390 3300046694 Ga0495649_0127110 Ga0495649_0127110_164_1090 289
391 3300046794 Ga0495589_0109607 Ga0495589_0109607_325_1251 289
392 3300047317 Ga0495604_0250197 Ga0495604_0250197_144_1064 289
393 3300047321 Ga0495676_0066462 Ga0495676_0066462_54_974 289
394 3300047323 Ga0495683_0091545 Ga0495683_0091545_361_1281 289
395 3300047323 Ga0495683_0118852 Ga0495683_0118852_164_1090 289
396 3300047443 Ga0495687_051820 Ga0495687_051820_530_1450 289
397 3300047469 Ga0495673_0076645 Ga0495673_0076645_71_991 289
398 3300047472 Ga0495686_0176683 Ga0495686_0176683_196_1116 289
399 3300047673 Ga0495593_0015375 Ga0495593_0015375_3323_4243 289
400 3300048088 Ga0495602_0099797 Ga0495602_0099797_210_1130 289
401 3300048905 Ga0496102_0010375 Ga0496102_0010375_710_1636 289
402 3300048905 Ga0496102_0542151 Ga0496102_0542151_14_934 289
403 3300048906 Ga0496103_0042314 Ga0496103_0042314_1609_2535 289
404 3300048907 Ga0496104_0009643 Ga0496104_0009643_2831_3751 289
405 3300048907 Ga0496104_0096355 Ga0496104_0096355_1080_2006 289
406 3300048907 Ga0496104_0173252 Ga0496104_0173252_31_957 289
407 3300048908 Ga0496105_0001282 Ga0496105_0001282_14517_15437 289
408 3300048908 Ga0496105_0021873 Ga0496105_0021873_3999_4925 289
409 3300048909 Ga0496106_0004573 Ga0496106_0004573_6055_6975 289
410 3300048910 Ga0496107_0121175 Ga0496107_0121175_600_1526 289
411 3300048911 Ga0496108_0014136 Ga0496108_0014136_31_957 289
412 3300048911 Ga0496108_0295265 Ga0496108_0295265_357_1277 289
413 3300048912 Ga0496109_0559708 Ga0496109_0559708_110_1036 289
414 3300048915 Ga0496112_0094296 Ga0496112_0094296_257_1183 289
415 3300048915 Ga0496112_0356293 Ga0496112_0356293_395_1321 289
416 3300048915 Ga0496112_0579863 Ga0496112_0579863_47_967 289
417 3300048916 Ga0496113_0042679 Ga0496113_0042679_702_1628 289
418 3300048916 Ga0496113_0106656 Ga0496113_0106656_909_1829 289
419 3300048917 Ga0496114_0160893 Ga0496114_0160893_876_1802 289
420 3300048918 Ga0496115_0023575 Ga0496115_0023575_1500_2420 289
421 3300048920 Ga0496117_0022077 Ga0496117_0022077_3684_4604 289
422 3300048920 Ga0496117_0032945 Ga0496117_0032945_2136_3062 289
423 3300048920 Ga0496117_0178615 Ga0496117_0178615_109_1032 289
424 3300048921 Ga0496118_0009370 Ga0496118_0009370_5405_6325 289
425 3300048921 Ga0496118_0025163 Ga0496118_0025163_4146_5072 289
426 3300048921 Ga0496118_0027761 Ga0496118_0027761_1781_2707 289
427 3300048921 Ga0496118_0121932 Ga0496118_0121932_683_1603 289
428 3300048924 Ga0496121_0007387 Ga0496121_0007387_3612_4532 289
429 3300048924 Ga0496121_0034792 Ga0496121_0034792_119_1045 289
430 3300048927 Ga0496124_0009342 Ga0496124_0009342_5587_6507 289
431 3300048927 Ga0496124_0128971 Ga0496124_0128971_484_1407 289
432 3300048927 Ga0496124_0138668 Ga0496124_0138668_942_1868 289
433 3300048928 Ga0496125_0032119 Ga0496125_0032119_3600_4520 289
434 3300048928 Ga0496125_0054903 Ga0496125_0054903_1294_2220 289
435 3300048928 Ga0496125_0154710 Ga0496125_0154710_350_1270 289
436 3300048929 Ga0496126_0131194 Ga0496126_0131194_720_1640 289
437 3300049460 Ga0495682_0064865 Ga0495682_0064865_26_946 289
438 3300049460 Ga0495682_0081205 Ga0495682_0081205_56_976 289
439 3300050489 nmdc:mga03683_65802_c1 nmdc:mga03683_65802_c1_465_1391 289
440 3300050491 nmdc:mga00v17_42456_c1 nmdc:mga00v17_42456_c1_1749_2675 289
441 3300050492 nmdc:mga0yw44_49759_c1 nmdc:mga0yw44_49759_c1_159_1085 289
442 3300050495 nmdc:mga04h51_30296_c1 nmdc:mga04h51_30296_c1_80_1006 289
443 3300050516 nmdc:mga0sz30_27654_c1 nmdc:mga0sz30_27654_c1_373_1299 289
444 3300053079 Ga0500610_0124829 Ga0500610_0124829_95_1015 289
445 3300053093 Ga0500651_0092785 Ga0500651_0092785_74_994 289
446 3300053109 Ga0500569_002085 Ga0500569_002085_950_1870 289
447 3300053111 Ga0500572_001690 Ga0500572_001690_807_1727 289
448 3300053119 Ga0500595_038197 Ga0500595_038197_53_973 289
449 3300053122 Ga0500608_046559 Ga0500608_046559_726_1646 289
450 3300053136 Ga0500559_0032191 Ga0500559_0032191_1088_2008 289
451 3300053146 Ga0500588_0009637 Ga0500588_0009637_537_1457 289
452 3300053154 Ga0500619_040921 Ga0500619_040921_459_1379 289
453 3300053155 Ga0500620_005953 Ga0500620_005953_1163_2083 289
454 3300053177 Ga0500636_0001687 Ga0500636_0001687_4927_5847 289
455 3300053737 Ga0500601_000485 Ga0500601_000485_316_1236 289
456 iso_pu_bacteria 2513237096 2513653734 289
457 iso_pu_bacteria 2513237098 2513672618 289
458 iso_pu_bacteria 2513237101 2513693667 289
459 iso_pu_bacteria 2513237137 2513856174 289
460 iso_pu_bacteria 2513237145 2513918074 289
461 iso_pu_bacteria 2517572143 2517891686 289
462 iso_pu_bacteria 2524023210 2524468782 289
463 iso_pu_bacteria 2667528175 2671118544 289
464 iso_pu_bacteria 2721755755 2723843561 289
465 iso_pu_bacteria 2744054633 2745076455 289
466 iso_pu_bacteria 2791355197 2793067060 289
467 iso_pu_bacteria 2824704595 2824707081 289
468 iso_pu_bacteria 2824753945 2824756454 289
469 iso_pu_bacteria 2824763712 2824765948 289
470 iso_pu_bacteria 2848858292 2848861632 289
471 iso_pu_bacteria 2874604998 2874611530 289
472 iso_pu_bacteria 2876808645 2876816589 289
473 iso_pu_bacteria 2879110137 2879114975 289
474 iso_pu_bacteria 2885374607 2885381016 289
475 iso_pu_bacteria 2885383462 2885387775 289
476 iso_pu_bacteria 2897803580 2897806596 289
477 iso_pu_bacteria 2903748898 2903755394 289
478 iso_pu_bacteria 2903768456 2903768493 289
479 iso_pu_bacteria 2904690495 2904698503 289
480 iso_pu_bacteria 2904699407 2904704558 289
481 iso_pu_bacteria 2904711408 2904715321 289
482 iso_pu_bacteria 2906610324 2906616861 289
483 iso_pu_bacteria 2906635258 2906642900 289
484 iso_pu_bacteria 2906660503 2906667190 289
485 iso_pu_bacteria 2908739725 2908742048 289
486 iso_pu_bacteria 2908756301 2908762485 289
487 iso_pu_bacteria 2922361189 2922361817 289
488 iso_pu_bacteria 2922425934 2922431066 289
489 iso_pu_bacteria 2935630451 2935636938 289
490 iso_pu_bacteria 2941507105 2941513606 289
491 iso_pu_bacteria 2941515067 2941521538 289
492 iso_pu_bacteria 2941523033 2941529292 289
493 iso_pu_bacteria 3005474847 3005480889 289
494 iso_pu_bacteria 3005710791 3005717975 289
495 iso_pu_bacteria 8006933436 8006939829 289
496 iso_pu_bacteria 8006964411 8006966927 289
497 iso_pu_bacteria 8006973647 8006979598 289
498 iso_pu_bacteria 8006994254 8006994564 289
499 iso_pu_bacteria 8019555841 8019565729 289
500 iso_pu_bacteria 8019565922 8019575819 289
501 iso_pu_bacteria 8056681323 8056687279 289
502 iso_pu_bacteria 8056689827 8056690656 289
503 3300003215 JGI25153J46596_10000105 JGI25153J46596_1000010529 290
504 3300003215 JGI25153J46596_10007823 JGI25153J46596_100078233 290
505 3300003752 Ga0055539_1002679 Ga0055539_10026792 290
506 3300003752 Ga0055539_1002682 Ga0055539_10026822 290
507 3300003794 Ga0055531_10025464 Ga0055531_100254642 290
508 3300005339 Ga0070660_100376074 Ga0070660_1003760741 290
509 3300005436 Ga0070713_100046001 Ga0070713_1000460012 290
510 3300005547 Ga0070693_100224813 Ga0070693_1002248131 290
511 3300006028 Ga0070717_10022548 Ga0070717_100225482 290
512 3300006038 Ga0075365_10098482 Ga0075365_100984822 290
513 3300006038 Ga0075365_10261915 Ga0075365_102619152 290
514 3300006051 Ga0075364_10087117 Ga0075364_100871172 290
515 3300006178 Ga0075367_10048405 Ga0075367_100484052 290
516 3300006353 Ga0075370_10062777 Ga0075370_100627772 290
517 3300009093 Ga0105240_10001377 Ga0105240_1000137712 290
518 3300009174 Ga0105241_10065494 Ga0105241_100654942 290
519 3300009545 Ga0105237_10001208 Ga0105237_1000120817 290
520 3300010375 Ga0105239_10145846 Ga0105239_101458462 290
521 3300010375 Ga0105239_10276648 Ga0105239_102766482 290
522 3300014969 Ga0157376_10154755 Ga0157376_101547552 290
523 3300025230 Ga0209563_102362 Ga0209563_1023622 290
524 3300025253 Ga0209677_100691 Ga0209677_1006918 290
525 3300025253 Ga0209677_102123 Ga0209677_1021234 290
526 3300025254 Ga0209148_1004493 Ga0209148_10044932 290
527 3300025272 Ga0209455_1001057 Ga0209455_10010573 290
528 3300025297 Ga0209758_1000279 Ga0209758_100027963 290
529 3300025297 Ga0209758_1009765 Ga0209758_10097653 290
530 3300025911 Ga0207654_10041269 Ga0207654_100412692 290
531 3300025913 Ga0207695_10000062 Ga0207695_1000006212 290
532 3300025914 Ga0207671_10005186 Ga0207671_100051868 290
533 3300025919 Ga0207657_10099048 Ga0207657_100990482 290
534 3300025928 Ga0207700_10005941 Ga0207700_100059415 290
535 3300025929 Ga0207664_10036433 Ga0207664_100364332 290
536 3300026142 Ga0207698_10097054 Ga0207698_100970542 290
537 3300031456 Ga0307513_10040069 Ga0307513_100400692 290
538 3300031616 Ga0307508_10000005 Ga0307508_10000005172 290
539 3300031911 Ga0307412_10063280 Ga0307412_100632802 290
540 3300031911 Ga0307412_10258062 Ga0307412_102580622 290
541 3300033180 Ga0307510_10005064 Ga0307510_1000506411 290
542 3300033544 Ga0316215_1003066 Ga0316215_10030662 290
543 3300039437 Ga0436365_0483596 Ga0436365_0483596_345_1268 290
544 3300039437 Ga0436365_0548581 Ga0436365_0548581_816_1739 290
545 3300039437 Ga0436365_1083476 Ga0436365_1083476_1105_2028 290
546 3300039437 Ga0436365_1266449 Ga0436365_1266449_81_1004 290
547 3300044842 Ga0466957_0120968 Ga0466957_0120968_431_1354 290
548 3300046460 Ga0495638_0007148 Ga0495638_0007148_4881_5804 290
549 3300046460 Ga0495638_0009289 Ga0495638_0009289_991_1914 290
550 3300046460 Ga0495638_0011434 Ga0495638_0011434_1405_2328 290
551 3300046462 Ga0495651_0011197 Ga0495651_0011197_1048_1971 290
552 3300046500 Ga0495596_0065457 Ga0495596_0065457_383_1306 290
553 3300046516 Ga0495628_0061546 Ga0495628_0061546_1412_2335 290
554 3300046522 Ga0495643_0100003 Ga0495643_0100003_396_1319 290
555 3300046533 Ga0495640_0054820 Ga0495640_0054820_1345_2268 290
556 3300046543 Ga0495645_0071672 Ga0495645_0071672_92_1015 290
557 3300046558 Ga0495633_0120241 Ga0495633_0120241_90_1013 290
558 3300046665 Ga0495661_0028475 Ga0495661_0028475_1288_2211 290
559 3300046674 Ga0495588_0125435 Ga0495588_0125435_61_984 290
560 3300046675 Ga0495657_0048554 Ga0495657_0048554_747_1670 290
561 3300046809 Ga0495600_0048122 Ga0495600_0048122_442_1365 290
562 3300046810 Ga0495660_0039967 Ga0495660_0039967_333_1256 290
563 3300047317 Ga0495604_0006962 Ga0495604_0006962_2235_3158 290
564 3300047472 Ga0495686_0044421 Ga0495686_0044421_1282_2205 290
565 3300048088 Ga0495602_0025670 Ga0495602_0025670_1187_2110 290
566 3300048909 Ga0496106_0136665 Ga0496106_0136665_987_1910 290
567 3300048911 Ga0496108_0263919 Ga0496108_0263919_253_1176 290
568 3300048919 Ga0496116_0005676 Ga0496116_0005676_3055_3978 290
569 3300048920 Ga0496117_0016833 Ga0496117_0016833_4329_5252 290
570 3300048921 Ga0496118_0018348 Ga0496118_0018348_4172_5095 290
571 3300048921 Ga0496118_0103167 Ga0496118_0103167_274_1197 290
572 3300048921 Ga0496118_0128202 Ga0496118_0128202_202_1125 290
573 3300048922 Ga0496119_0053547 Ga0496119_0053547_472_1395 290
574 3300048922 Ga0496119_0090613 Ga0496119_0090613_385_1308 290
575 3300048924 Ga0496121_0019469 Ga0496121_0019469_705_1628 290
576 3300048924 Ga0496121_0024693 Ga0496121_0024693_4624_5547 290
577 3300048924 Ga0496121_0047342 Ga0496121_0047342_2647_3567 290
578 3300048924 Ga0496121_0159771 Ga0496121_0159771_532_1455 290
579 3300048924 Ga0496121_0192408 Ga0496121_0192408_190_1113 290
580 3300048924 Ga0496121_0239198 Ga0496121_0239198_176_1099 290
581 3300048925 Ga0496122_0101586 Ga0496122_0101586_310_1233 290
582 3300048926 Ga0496123_0007052 Ga0496123_0007052_4041_4964 290
583 3300048927 Ga0496124_0027280 Ga0496124_0027280_3853_4776 290
584 3300048928 Ga0496125_0002440 Ga0496125_0002440_1908_2831 290
585 3300048929 Ga0496126_0136815 Ga0496126_0136815_177_1100 290
586 3300048929 Ga0496126_0309918 Ga0496126_0309918_102_1022 290
587 3300050492 nmdc:mga0yw44_3568_c1 nmdc:mga0yw44_3568_c1_2171_3094 290
588 3300050494 nmdc:mga06z11_28127_c1 nmdc:mga06z11_28127_c1_359_1282 290
589 3300050496 nmdc:mga07m45_28678_c1 nmdc:mga07m45_28678_c1_662_1585 290
590 3300050516 nmdc:mga0sz30_6834_c1 nmdc:mga0sz30_6834_c1_3041_3964 290
591 3300053086 Ga0500578_0060593 Ga0500578_0060593_453_1376 290
592 3300053086 Ga0500578_0135632 Ga0500578_0135632_300_1223 290
593 3300053088 Ga0500644_0026428 Ga0500644_0026428_66_989 290
594 3300053090 Ga0500646_0063354 Ga0500646_0063354_42_965 290
595 3300053091 Ga0500647_0004251 Ga0500647_0004251_3586_4509 290
596 3300053093 Ga0500651_0026539 Ga0500651_0026539_1473_2396 290
597 3300053093 Ga0500651_0117077 Ga0500651_0117077_360_1283 290
598 3300053094 Ga0500566_0000535 Ga0500566_0000535_16334_17257 290
599 3300053094 Ga0500566_0000789 Ga0500566_0000789_15406_16329 290
600 3300053094 Ga0500566_0162376 Ga0500566_0162376_48_971 290
601 3300053098 Ga0500650_0000946 Ga0500650_0000946_6623_7546 290
602 3300053103 Ga0500555_010172 Ga0500555_010172_573_1496 290
603 3300053104 Ga0500556_0000015 Ga0500556_0000015_43589_44512 290
604 3300053105 Ga0500557_000158 Ga0500557_000158_4941_5864 290
605 3300053108 Ga0500562_052525 Ga0500562_052525_55_978 290
606 3300053109 Ga0500569_004768 Ga0500569_004768_171_1094 290
607 3300053116 Ga0500592_001525 Ga0500592_001525_365_1288 290
608 3300053117 Ga0500593_065947 Ga0500593_065947_154_1077 290
609 3300053118 Ga0500594_0072310 Ga0500594_0072310_52_975 290
610 3300053122 Ga0500608_013258 Ga0500608_013258_2653_3576 290
611 3300053125 Ga0500618_007080 Ga0500618_007080_1018_1941 290
612 3300053128 Ga0500626_114729 Ga0500626_114729_175_1098 290
613 3300053130 Ga0500642_0000044 Ga0500642_0000044_42836_43759 290
614 3300053130 Ga0500642_0000350 Ga0500642_0000350_3594_4517 290
615 3300053130 Ga0500642_0001189 Ga0500642_0001189_1573_2529 290
616 3300053131 Ga0500652_000638 Ga0500652_000638_9323_10246 290
617 3300053136 Ga0500559_0000130 Ga0500559_0000130_45119_46042 290
618 3300053136 Ga0500559_0011384 Ga0500559_0011384_1434_2357 290
619 3300053139 Ga0500568_0000661 Ga0500568_0000661_6003_6926 290
620 3300053139 Ga0500568_0053418 Ga0500568_0053418_252_1208 290
621 3300053145 Ga0500586_001145 Ga0500586_001145_1878_2801 290
622 3300053151 Ga0500604_0001929 Ga0500604_0001929_3220_4143 290
623 3300053151 Ga0500604_0003770 Ga0500604_0003770_1220_2176 290
624 3300053151 Ga0500604_0009113 Ga0500604_0009113_417_1340 290
625 3300053153 Ga0500616_0000041 Ga0500616_0000041_185817_186740 290
626 3300053153 Ga0500616_0000666 Ga0500616_0000666_12952_13908 290
627 3300053153 Ga0500616_0100401 Ga0500616_0100401_333_1256 290
628 3300053156 Ga0500622_0000700 Ga0500622_0000700_11342_12265 290
629 3300053156 Ga0500622_0030723 Ga0500622_0030723_769_1692 290
630 3300053177 Ga0500636_0000323 Ga0500636_0000323_21362_22285 290
631 3300053729 Ga0500625_000845 Ga0500625_000845_4530_5453 290
632 iso_pu_bacteria 8019638758 8019640110 290
633 3300003215 JGI25153J46596_10003262 JGI25153J46596_100032626 291
634 3300003659 JGI25404J52841_10023826 JGI25404J52841_100238261 291
635 3300005347 Ga0070668_100361795 Ga0070668_1003617952 291
636 3300005347 Ga0070668_100419586 Ga0070668_1004195862 291
637 3300005434 Ga0070709_10008434 Ga0070709_100084347 291
638 3300005434 Ga0070709_10035454 Ga0070709_100354542 291
639 3300005435 Ga0070714_100002875 Ga0070714_1000028752 291
640 3300005435 Ga0070714_100096779 Ga0070714_1000967792 291
641 3300005436 Ga0070713_100009905 Ga0070713_1000099052 291
642 3300005436 Ga0070713_100085089 Ga0070713_1000850892 291
643 3300005436 Ga0070713_100409784 Ga0070713_1004097842 291
644 3300005437 Ga0070710_10000878 Ga0070710_1000087811 291
645 3300005437 Ga0070710_10008549 Ga0070710_100085492 291
646 3300005437 Ga0070710_10016869 Ga0070710_100168692 291
647 3300005439 Ga0070711_100003170 Ga0070711_1000031704 291
648 3300005439 Ga0070711_100011213 Ga0070711_1000112138 291
649 3300005455 Ga0070663_100016609 Ga0070663_1000166092 291
650 3300005456 Ga0070678_100058738 Ga0070678_1000587382 291
651 3300005614 Ga0068856_100000565 Ga0068856_10000056539 291
652 3300005617 Ga0068859_100055772 Ga0068859_1000557722 291
653 3300005843 Ga0068860_100409619 Ga0068860_1004096191 291
654 3300005937 Ga0081455_10009013 Ga0081455_100090137 291
655 3300005937 Ga0081455_10016971 Ga0081455_100169712 291
656 3300005983 Ga0081540_1006548 Ga0081540_10065487 291
657 3300005983 Ga0081540_1014475 Ga0081540_10144752 291
658 3300005983 Ga0081540_1024577 Ga0081540_10245774 291
659 3300005983 Ga0081540_1054592 Ga0081540_10545922 291
660 3300005983 Ga0081540_1066793 Ga0081540_10667931 291
661 3300006028 Ga0070717_10003746 Ga0070717_100037462 291
662 3300006028 Ga0070717_10186877 Ga0070717_101868772 291
663 3300006048 Ga0075363_100002208 Ga0075363_1000022082 291
664 3300006051 Ga0075364_10089456 Ga0075364_100894562 291
665 3300006173 Ga0070716_100053095 Ga0070716_1000530953 291
666 3300006173 Ga0070716_100059332 Ga0070716_1000593321 291
667 3300006173 Ga0070716_100270183 Ga0070716_1002701831 291
668 3300006175 Ga0070712_100002086 Ga0070712_1000020864 291
669 3300006175 Ga0070712_100009781 Ga0070712_1000097814 291
670 3300006177 Ga0075362_10116617 Ga0075362_101166171 291
671 3300006178 Ga0075367_10004480 Ga0075367_100044803 291
672 3300006195 Ga0075366_10146737 Ga0075366_101467371 291
673 3300006353 Ga0075370_10022744 Ga0075370_100227442 291
674 3300006353 Ga0075370_10215602 Ga0075370_102156022 291
675 3300006931 Ga0097620_100055772 Ga0097620_1000557722 291
676 3300009101 Ga0105247_10031063 Ga0105247_100310632 291
677 3300009545 Ga0105237_10119254 Ga0105237_101192542 291
678 3300009551 Ga0105238_10424344 Ga0105238_104243442 291
679 3300013297 Ga0157378_10477016 Ga0157378_104770161 291
680 3300021384 Ga0213876_10003521 Ga0213876_100035212 291
681 3300025254 Ga0209148_1000409 Ga0209148_100040931 291
682 3300025272 Ga0209455_1001295 Ga0209455_10012957 291
683 3300025297 Ga0209758_1014240 Ga0209758_10142402 291
684 3300025898 Ga0207692_10000970 Ga0207692_100009706 291
685 3300025898 Ga0207692_10034089 Ga0207692_100340891 291
686 3300025900 Ga0207710_10108566 Ga0207710_101085661 291
687 3300025906 Ga0207699_10000882 Ga0207699_100008825 291
688 3300025906 Ga0207699_10010703 Ga0207699_100107032 291
689 3300025906 Ga0207699_10194122 Ga0207699_101941221 291
690 3300025907 Ga0207645_10076729 Ga0207645_100767292 291
691 3300025914 Ga0207671_10030621 Ga0207671_100306212 291
692 3300025915 Ga0207693_10006903 Ga0207693_100069037 291
693 3300025915 Ga0207693_10012697 Ga0207693_100126976 291
694 3300025915 Ga0207693_10023028 Ga0207693_100230282 291
695 3300025916 Ga0207663_10006825 Ga0207663_100068258 291
696 3300025916 Ga0207663_10110225 Ga0207663_101102252 291
697 3300025916 Ga0207663_10133416 Ga0207663_101334162 291
698 3300025923 Ga0207681_10272009 Ga0207681_102720091 291
699 3300025924 Ga0207694_10239942 Ga0207694_102399422 291
700 3300025928 Ga0207700_10010828 Ga0207700_100108283 291
701 3300025928 Ga0207700_10122782 Ga0207700_101227822 291
702 3300025929 Ga0207664_10231022 Ga0207664_102310222 291
703 3300025929 Ga0207664_10332861 Ga0207664_103328612 291
704 3300025931 Ga0207644_10373351 Ga0207644_103733511 291
705 3300026067 Ga0207678_10031834 Ga0207678_100318342 291
706 3300026067 Ga0207678_10166924 Ga0207678_101669242 291
707 3300026078 Ga0207702_10000056 Ga0207702_1000005670 291
708 3300026121 Ga0207683_10036663 Ga0207683_100366632 291
709 3300028379 Ga0268266_10002834 Ga0268266_1000283410 291
710 3300031250 Ga0265331_10014277 Ga0265331_100142773 291
711 3300031711 Ga0265314_10014228 Ga0265314_100142284 291
712 3300031712 Ga0265342_10010476 Ga0265342_100104763 291
713 3300035086 Ga0373934_0036408 Ga0373934_0036408_958_1884 291
714 3300035089 Ga0373944_0018322 Ga0373944_0018322_1022_1948 291
715 3300035113 Ga0373936_0017441 Ga0373936_0017441_106_1032 291
716 3300035410 Ga0373924_0024809 Ga0373924_0024809_584_1510 291
717 3300035692 Ga0373935_0218646 Ga0373935_0218646_353_1279 291
718 3300035695 Ga0373927_0019055 Ga0373927_0019055_1790_2716 291
719 3300035724 Ga0373933_0016181 Ga0373933_0016181_2808_3734 291
720 3300036401 Ga0373937_0066563 Ga0373937_0066563_488_1414 291
721 3300037068 Ga0373925_0052374 Ga0373925_0052374_1962_2888 291
722 3300037312 Ga0395899_0102768 Ga0395899_0102768_915_1838 291
723 3300037471 Ga0395905_0070014 Ga0395905_0070014_1102_2025 291
724 3300039437 Ga0436365_0954239 Ga0436365_0954239_28100_29026 291
725 3300044684 Ga0466966_0015387 Ga0466966_0015387_1774_2700 291
726 3300044694 Ga0466963_0106116 Ga0466963_0106116_789_1715 291
727 3300045049 Ga0466959_0071705 Ga0466959_0071705_1009_1935 291
728 3300046455 Ga0495603_0091537 Ga0495603_0091537_819_1745 291
729 3300046462 Ga0495651_0209969 Ga0495651_0209969_59_985 291
730 3300046473 Ga0495582_0048994 Ga0495582_0048994_68_994 291
731 3300046475 Ga0495639_0005148 Ga0495639_0005148_341_1267 291
732 3300046476 Ga0495662_0159227 Ga0495662_0159227_35_961 291
733 3300046514 Ga0495618_0014438 Ga0495618_0014438_400_1326 291
734 3300046517 Ga0495630_0131423 Ga0495630_0131423_496_1422 291
735 3300046524 Ga0495648_0000325 Ga0495648_0000325_14054_14980 291
736 3300046526 Ga0495666_0031350 Ga0495666_0031350_355_1281 291
737 3300046529 Ga0495652_0173645 Ga0495652_0173645_520_1446 291
738 3300046531 Ga0495665_0049412 Ga0495665_0049412_632_1558 291
739 3300046533 Ga0495640_0042783 Ga0495640_0042783_1488_2414 291
740 3300046535 Ga0495586_0252912 Ga0495586_0252912_19_945 291
741 3300046642 Ga0495634_0021233 Ga0495634_0021233_3086_4012 291
742 3300046680 Ga0495646_0045629 Ga0495646_0045629_1716_2642 291
743 3300046683 Ga0495658_0053649 Ga0495658_0053649_171_1097 291
744 3300046690 Ga0495624_0050832 Ga0495624_0050832_1361_2287 291
745 3300047315 Ga0495581_0203964 Ga0495581_0203964_216_1142 291
746 3300047317 Ga0495604_0019089 Ga0495604_0019089_3201_4127 291
747 3300047471 Ga0495684_0180978 Ga0495684_0180978_383_1309 291
748 3300047673 Ga0495593_0075965 Ga0495593_0075965_457_1383 291
749 3300048088 Ga0495602_0130673 Ga0495602_0130673_550_1476 291
750 3300048929 Ga0496126_0015619 Ga0496126_0015619_5841_6767 291
751 3300048929 Ga0496126_0043220 Ga0496126_0043220_2842_3768 291
752 3300048929 Ga0496126_0217990 Ga0496126_0217990_644_1570 291
753 3300049579 Ga0501043_0184323 Ga0501043_0184323_608_1537 291
754 3300049580 Ga0501046_0158373 Ga0501046_0158373_627_1556 291
755 3300049589 Ga0501073_0022793 Ga0501073_0022793_478_1407 291
756 3300049742 Ga0501080_0016647 Ga0501080_0016647_5830_6759 291
757 3300049823 Ga0501044_0067293 Ga0501044_0067293_34_963 291
758 3300050493 nmdc:mga0k408_153964_c1 nmdc:mga0k408_153964_c1_128_1054 291
759 3300050494 nmdc:mga06z11_4743_c1 nmdc:mga06z11_4743_c1_1863_2789 291
760 3300050496 nmdc:mga07m45_207352_c1 nmdc:mga07m45_207352_c1_169_1095 291
761 3300050496 nmdc:mga07m45_24585_c1 nmdc:mga07m45_24585_c1_1291_2217 291
762 3300050516 nmdc:mga0sz30_90495_c1 nmdc:mga0sz30_90495_c1_387_1313 291
763 3300053080 Ga0500635_0093259 Ga0500635_0093259_151_1077 291
764 3300053094 Ga0500566_0002570 Ga0500566_0002570_5550_6476 291
765 3300053111 Ga0500572_006575 Ga0500572_006575_1515_2441 291
766 3300053115 Ga0500591_056421 Ga0500591_056421_738_1664 291
767 3300053122 Ga0500608_033083 Ga0500608_033083_141_1067 291
768 3300053159 Ga0500630_029223 Ga0500630_029223_1224_2150 291
769 3300053163 Ga0500639_017207 Ga0500639_017207_969_1895 291
770 3300053177 Ga0500636_0064500 Ga0500636_0064500_1091_2029 291
771 3300003215 JGI25153J46596_10004844 JGI25153J46596_100048445 292
772 3300003322 rootL2_10065592 rootL2_100655923 292
773 3300003354 JGI25160J50197_1000241 JGI25160J50197_100024113 292
774 3300005337 Ga0070682_100034163 Ga0070682_1000341632 292
775 3300005347 Ga0070668_100098907 Ga0070668_1000989072 292
776 3300005347 Ga0070668_100148041 Ga0070668_1001480412 292
777 3300005367 Ga0070667_100137643 Ga0070667_1001376432 292
778 3300005438 Ga0070701_10046931 Ga0070701_100469311 292
779 3300005439 Ga0070711_100009993 Ga0070711_1000099933 292
780 3300005455 Ga0070663_100336048 Ga0070663_1003360481 292
781 3300005456 Ga0070678_100131877 Ga0070678_1001318772 292
782 3300005459 Ga0068867_100023770 Ga0068867_1000237702 292
783 3300005471 Ga0070698_100097422 Ga0070698_1000974222 292
784 3300005539 Ga0068853_100184776 Ga0068853_1001847762 292
785 3300005543 Ga0070672_100121473 Ga0070672_1001214732 292
786 3300005543 Ga0070672_100156878 Ga0070672_1001568782 292
787 3300005548 Ga0070665_100106479 Ga0070665_1001064792 292
788 3300005548 Ga0070665_100316990 Ga0070665_1003169902 292
789 3300005548 Ga0070665_100502665 Ga0070665_1005026651 292
790 3300005563 Ga0068855_100059671 Ga0068855_1000596714 292
791 3300005577 Ga0068857_100117647 Ga0068857_1001176473 292
792 3300005578 Ga0068854_100366959 Ga0068854_1003669592 292
793 3300005614 Ga0068856_100104952 Ga0068856_1001049523 292
794 3300005615 Ga0070702_100032203 Ga0070702_1000322032 292
795 3300005617 Ga0068859_100139361 Ga0068859_1001393612 292
796 3300005618 Ga0068864_100081408 Ga0068864_1000814081 292
797 3300005719 Ga0068861_100037464 Ga0068861_1000374643 292
798 3300005841 Ga0068863_100224197 Ga0068863_1002241972 292
799 3300005842 Ga0068858_100504140 Ga0068858_1005041401 292
800 3300005843 Ga0068860_100114294 Ga0068860_1001142942 292
801 3300005844 Ga0068862_100142878 Ga0068862_1001428781 292
802 3300005844 Ga0068862_100185624 Ga0068862_1001856242 292
803 3300005844 Ga0068862_100382196 Ga0068862_1003821962 292
804 3300005983 Ga0081540_1044102 Ga0081540_10441021 292
805 3300005983 Ga0081540_1073066 Ga0081540_10730662 292
806 3300006038 Ga0075365_10068991 Ga0075365_100689912 292
807 3300006038 Ga0075365_10214282 Ga0075365_102142822 292
808 3300006038 Ga0075365_10332914 Ga0075365_103329141 292
809 3300006051 Ga0075364_10022409 Ga0075364_100224092 292
810 3300006051 Ga0075364_10048273 Ga0075364_100482732 292
811 3300006175 Ga0070712_100090744 Ga0070712_1000907442 292
812 3300006177 Ga0075362_10107814 Ga0075362_101078142 292
813 3300006178 Ga0075367_10032084 Ga0075367_100320842 292
814 3300006178 Ga0075367_10033297 Ga0075367_100332973 292
815 3300006186 Ga0075369_10025069 Ga0075369_100250692 292
816 3300006353 Ga0075370_10015615 Ga0075370_100156153 292
817 3300006353 Ga0075370_10086232 Ga0075370_100862322 292
818 3300006844 Ga0075428_100196462 Ga0075428_1001964622 292
819 3300006881 Ga0068865_100041530 Ga0068865_1000415302 292
820 3300006931 Ga0097620_100139343 Ga0097620_1001393432 292
821 3300007265 Ga0099794_10041987 Ga0099794_100419872 292
822 3300007788 Ga0099795_10005394 Ga0099795_100053942 292
823 3300007788 Ga0099795_10026186 Ga0099795_100261862 292
824 3300009093 Ga0105240_10224642 Ga0105240_102246422 292
825 3300009098 Ga0105245_10048730 Ga0105245_100487302 292
826 3300009098 Ga0105245_10050199 Ga0105245_100501992 292
827 3300009098 Ga0105245_10054965 Ga0105245_100549652 292
828 3300009147 Ga0114129_10064167 Ga0114129_100641672 292
829 3300009176 Ga0105242_10102997 Ga0105242_101029972 292
830 3300009177 Ga0105248_10164887 Ga0105248_101648873 292
831 3300010375 Ga0105239_10150181 Ga0105239_101501812 292
832 3300013296 Ga0157374_10034735 Ga0157374_100347354 292
833 3300013297 Ga0157378_10036359 Ga0157378_100363592 292
834 3300013297 Ga0157378_10051368 Ga0157378_100513683 292
835 3300013306 Ga0163162_10002433 Ga0163162_100024333 292
836 3300013306 Ga0163162_10123584 Ga0163162_101235842 292
837 3300013308 Ga0157375_10015134 Ga0157375_100151344 292
838 3300014325 Ga0163163_10002363 Ga0163163_1000236313 292
839 3300014326 Ga0157380_10246052 Ga0157380_102460522 292
840 3300014745 Ga0157377_10103273 Ga0157377_101032732 292
841 3300014968 Ga0157379_10311060 Ga0157379_103110602 292
842 3300014969 Ga0157376_10024381 Ga0157376_100243812 292
843 3300021441 Ga0213871_10023929 Ga0213871_100239292 292
844 3300025261 Ga0209233_1013772 Ga0209233_10137722 292
845 3300025295 Ga0209564_1004214 Ga0209564_10042144 292
846 3300025297 Ga0209758_1001947 Ga0209758_100194717 292
847 3300025297 Ga0209758_1004240 Ga0209758_10042408 292
848 3300025302 Ga0207426_1000613 Ga0207426_100061313 292
849 3300025304 Ga0209257_1028445 Ga0209257_10284452 292
850 3300025315 Ga0207697_10115558 Ga0207697_101155581 292
851 3300025901 Ga0207688_10051004 Ga0207688_100510041 292
852 3300025915 Ga0207693_10053133 Ga0207693_100531333 292
853 3300025918 Ga0207662_10054009 Ga0207662_100540092 292
854 3300025922 Ga0207646_10171029 Ga0207646_101710292 292
855 3300025927 Ga0207687_10067922 Ga0207687_100679223 292
856 3300025927 Ga0207687_10228250 Ga0207687_102282502 292
857 3300025931 Ga0207644_10324036 Ga0207644_103240362 292
858 3300025933 Ga0207706_10029163 Ga0207706_100291632 292
859 3300025933 Ga0207706_10474433 Ga0207706_104744332 292
860 3300025934 Ga0207686_10047401 Ga0207686_100474012 292
861 3300025936 Ga0207670_10133935 Ga0207670_101339352 292
862 3300025937 Ga0207669_10123761 Ga0207669_101237612 292
863 3300025938 Ga0207704_10091011 Ga0207704_100910112 292
864 3300025942 Ga0207689_10169943 Ga0207689_101699432 292
865 3300025949 Ga0207667_10070874 Ga0207667_100708744 292
866 3300025972 Ga0207668_10215469 Ga0207668_102154692 292
867 3300025981 Ga0207640_10316069 Ga0207640_103160692 292
868 3300026035 Ga0207703_10121259 Ga0207703_101212592 292
869 3300026067 Ga0207678_10023870 Ga0207678_100238703 292
870 3300026067 Ga0207678_10219447 Ga0207678_102194472 292
871 3300026075 Ga0207708_10109280 Ga0207708_101092802 292
872 3300026078 Ga0207702_10115580 Ga0207702_101155802 292
873 3300026088 Ga0207641_10287269 Ga0207641_102872691 292
874 3300026089 Ga0207648_10032951 Ga0207648_100329512 292
875 3300026095 Ga0207676_10021216 Ga0207676_100212163 292
876 3300026118 Ga0207675_100108249 Ga0207675_1001082492 292
877 3300026121 Ga0207683_10042257 Ga0207683_100422572 292
878 3300026121 Ga0207683_10075803 Ga0207683_100758032 292
879 3300026142 Ga0207698_10087601 Ga0207698_100876012 292
880 3300027357 Ga0209589_1000001 Ga0209589_1000001435 292
881 3300027361 Ga0209489_100001 Ga0209489_100001435 292
882 3300027363 Ga0209700_100001 Ga0209700_100001435 292
883 3300027671 Ga0209588_1004023 Ga0209588_10040232 292
884 3300028379 Ga0268266_10074808 Ga0268266_100748083 292
885 3300028379 Ga0268266_10403154 Ga0268266_104031542 292
886 3300028380 Ga0268265_10037996 Ga0268265_100379964 292
887 3300028380 Ga0268265_10057458 Ga0268265_100574583 292
888 3300028380 Ga0268265_10164066 Ga0268265_101640662 292
889 3300028380 Ga0268265_10313870 Ga0268265_103138702 292
890 3300028381 Ga0268264_10285351 Ga0268264_102853512 292
891 3300028786 Ga0307517_10000386 Ga0307517_1000038627 292
892 3300028786 Ga0307517_10217944 Ga0307517_102179442 292
893 3300028794 Ga0307515_10052963 Ga0307515_100529633 292
894 3300031235 Ga0265330_10010015 Ga0265330_100100152 292
895 3300031242 Ga0265329_10061615 Ga0265329_100616152 292
896 3300031247 Ga0265340_10015257 Ga0265340_100152572 292
897 3300031548 Ga0307408_100301599 Ga0307408_1003015992 292
898 3300031712 Ga0265342_10091265 Ga0265342_100912652 292
899 3300031995 Ga0307409_100448569 Ga0307409_1004485692 292
900 3300032005 Ga0307411_10168016 Ga0307411_101680161 292
901 3300033180 Ga0307510_10036874 Ga0307510_100368743 292
902 3300033442 Ga0315911_1000002 Ga0315911_1000002491 292
903 3300035086 Ga0373934_0015429 Ga0373934_0015429_1643_2572 292
904 3300035111 Ga0373923_0008351 Ga0373923_0008351_2147_3076 292
905 3300035113 Ga0373936_0009582 Ga0373936_0009582_2376_3305 292
906 3300035118 Ga0373954_0000220 Ga0373954_0000220_3462_4391 292
907 3300035118 Ga0373954_0160337 Ga0373954_0160337_137_1066 292
908 3300035119 Ga0373956_0000306 Ga0373956_0000306_4460_5389 292
909 3300035120 Ga0373957_0002434 Ga0373957_0002434_957_1886 292
910 3300035170 Ga0373943_0006156 Ga0373943_0006156_3074_4003 292
911 3300035172 Ga0373955_0002760 Ga0373955_0002760_5109_6038 292
912 3300035172 Ga0373955_0129489 Ga0373955_0129489_92_1021 292
913 3300035410 Ga0373924_0081022 Ga0373924_0081022_122_1051 292
914 3300035692 Ga0373935_0001272 Ga0373935_0001272_3971_4900 292
915 3300035692 Ga0373935_0040080 Ga0373935_0040080_1997_2926 292
916 3300035695 Ga0373927_0000935 Ga0373927_0000935_4292_5221 292
917 3300035724 Ga0373933_0000164 Ga0373933_0000164_605_1534 292
918 3300035724 Ga0373933_0006353 Ga0373933_0006353_14_943 292
919 3300035725 Ga0373947_0000207 Ga0373947_0000207_23055_23984 292
920 3300036401 Ga0373937_0038226 Ga0373937_0038226_103_1032 292
921 3300036401 Ga0373937_0252271 Ga0373937_0252271_718_1647 292
922 3300037068 Ga0373925_0057191 Ga0373925_0057191_422_1351 292
923 3300037471 Ga0395905_0443304 Ga0395905_0443304_224_1150 292
924 3300039447 Ga0436361_0429826 Ga0436361_0429826_2348_3277 292
925 3300041486 Ga0451807_2024239 Ga0451807_2024239_96_1025 292
926 3300044684 Ga0466966_0002334 Ga0466966_0002334_7939_8862 292
927 3300044693 Ga0466961_0001110 Ga0466961_0001110_15558_16481 292
928 3300045049 Ga0466959_0001504 Ga0466959_0001504_1507_2430 292
929 3300045049 Ga0466959_0008358 Ga0466959_0008358_5412_6341 292
930 3300046452 Ga0495617_011389 Ga0495617_011389_73_1002 292
931 3300046453 Ga0495627_054474 Ga0495627_054474_23_952 292
932 3300046454 Ga0495592_0004993 Ga0495592_0004993_1150_2079 292
933 3300046455 Ga0495603_0000032 Ga0495603_0000032_898_1827 292
934 3300046455 Ga0495603_0005706 Ga0495603_0005706_3236_4165 292
935 3300046455 Ga0495603_0095918 Ga0495603_0095918_422_1351 292
936 3300046457 Ga0495590_0032236 Ga0495590_0032236_767_1696 292
937 3300046459 Ga0495629_0000094 Ga0495629_0000094_65451_66380 292
938 3300046459 Ga0495629_0000114 Ga0495629_0000114_34246_35175 292
939 3300046460 Ga0495638_0179132 Ga0495638_0179132_48_977 292
940 3300046461 Ga0495641_0002565 Ga0495641_0002565_9466_10395 292
941 3300046463 Ga0495653_0003100 Ga0495653_0003100_20_949 292
942 3300046463 Ga0495653_0078002 Ga0495653_0078002_664_1593 292
943 3300046472 Ga0495580_0004156 Ga0495580_0004156_3866_4795 292
944 3300046473 Ga0495582_0000030 Ga0495582_0000030_9176_10105 292
945 3300046475 Ga0495639_0000003 Ga0495639_0000003_97986_98915 292
946 3300046476 Ga0495662_0000008 Ga0495662_0000008_69588_70517 292
947 3300046491 Ga0495584_0074180 Ga0495584_0074180_289_1218 292
948 3300046499 Ga0495594_0000249 Ga0495594_0000249_885_1814 292
949 3300046507 Ga0495606_0020843 Ga0495606_0020843_464_1393 292
950 3300046511 Ga0495608_0051466 Ga0495608_0051466_898_1827 292
951 3300046513 Ga0495616_0095415 Ga0495616_0095415_90_1019 292
952 3300046514 Ga0495618_0106675 Ga0495618_0106675_356_1285 292
953 3300046516 Ga0495628_0004817 Ga0495628_0004817_9277_10206 292
954 3300046516 Ga0495628_0150930 Ga0495628_0150930_354_1283 292
955 3300046517 Ga0495630_0018007 Ga0495630_0018007_3924_4853 292
956 3300046517 Ga0495630_0316155 Ga0495630_0316155_217_1146 292
957 3300046518 Ga0495631_0096063 Ga0495631_0096063_209_1138 292
958 3300046523 Ga0495644_0034992 Ga0495644_0034992_411_1340 292
959 3300046524 Ga0495648_0023128 Ga0495648_0023128_1126_2055 292
960 3300046524 Ga0495648_0040083 Ga0495648_0040083_1773_2702 292
961 3300046524 Ga0495648_0070682 Ga0495648_0070682_237_1166 292
962 3300046526 Ga0495666_0049611 Ga0495666_0049611_693_1622 292
963 3300046528 Ga0495642_0014387 Ga0495642_0014387_1367_2296 292
964 3300046529 Ga0495652_0193133 Ga0495652_0193133_471_1400 292
965 3300046529 Ga0495652_0322496 Ga0495652_0322496_20_949 292
966 3300046531 Ga0495665_0000001 Ga0495665_0000001_91229_92158 292
967 3300046533 Ga0495640_0011846 Ga0495640_0011846_3436_4365 292
968 3300046533 Ga0495640_0012771 Ga0495640_0012771_3949_4878 292
969 3300046536 Ga0495587_0185187 Ga0495587_0185187_148_1077 292
970 3300046538 Ga0495609_0035426 Ga0495609_0035426_459_1388 292
971 3300046538 Ga0495609_0095844 Ga0495609_0095844_164_1093 292
972 3300046543 Ga0495645_0043602 Ga0495645_0043602_1886_2815 292
973 3300046557 Ga0495622_0004414 Ga0495622_0004414_4529_5458 292
974 3300046557 Ga0495622_0020192 Ga0495622_0020192_1052_1981 292
975 3300046557 Ga0495622_0071010 Ga0495622_0071010_635_1564 292
976 3300046558 Ga0495633_0026394 Ga0495633_0026394_728_1657 292
977 3300046559 Ga0495667_0035228 Ga0495667_0035228_49_978 292
978 3300046559 Ga0495667_0047807 Ga0495667_0047807_349_1278 292
979 3300046615 Ga0495656_0009498 Ga0495656_0009498_1519_2448 292
980 3300046642 Ga0495634_0003282 Ga0495634_0003282_9300_10229 292
981 3300046642 Ga0495634_0005378 Ga0495634_0005378_1748_2677 292
982 3300046648 Ga0495611_0028249 Ga0495611_0028249_1098_2027 292
983 3300046648 Ga0495611_0041248 Ga0495611_0041248_932_1861 292
984 3300046663 Ga0495635_0002364 Ga0495635_0002364_7697_8626 292
985 3300046663 Ga0495635_0002589 Ga0495635_0002589_5868_6797 292
986 3300046674 Ga0495588_0002455 Ga0495588_0002455_3238_4167 292
987 3300046678 Ga0495599_0000800 Ga0495599_0000800_12522_13451 292
988 3300046679 Ga0495623_0008330 Ga0495623_0008330_103_1032 292
989 3300046680 Ga0495646_0000456 Ga0495646_0000456_5879_6808 292
990 3300046680 Ga0495646_0101682 Ga0495646_0101682_649_1578 292
991 3300046681 Ga0495647_0000736 Ga0495647_0000736_5041_5970 292
992 3300046683 Ga0495658_0000285 Ga0495658_0000285_25560_26489 292
993 3300046689 Ga0495613_0005014 Ga0495613_0005014_4018_4947 292
994 3300046690 Ga0495624_0000193 Ga0495624_0000193_40172_41101 292
995 3300046691 Ga0495670_0135766 Ga0495670_0135766_270_1199 292
996 3300046809 Ga0495600_0011609 Ga0495600_0011609_103_1032 292
997 3300047315 Ga0495581_0000110 Ga0495581_0000110_15592_16521 292
998 3300047319 Ga0495674_0000031 Ga0495674_0000031_58837_59766 292
999 3300047319 Ga0495674_0020552 Ga0495674_0020552_2668_3597 292
1000 3300047320 Ga0495672_0124714 Ga0495672_0124714_44_973 292
1001 3300047321 Ga0495676_0017501 Ga0495676_0017501_4304_5233 292
1002 3300047322 Ga0495680_0236903 Ga0495680_0236903_20_949 292
1003 3300047322 Ga0495680_0284009 Ga0495680_0284009_35_964 292
1004 3300047323 Ga0495683_0005882 Ga0495683_0005882_2485_3414 292
1005 3300047469 Ga0495673_0019972 Ga0495673_0019972_87_1016 292
1006 3300047469 Ga0495673_0051837 Ga0495673_0051837_234_1163 292
1007 3300047469 Ga0495673_0102340 Ga0495673_0102340_143_1072 292
1008 3300047471 Ga0495684_0000739 Ga0495684_0000739_14343_15272 292
1009 3300047472 Ga0495686_0109670 Ga0495686_0109670_82_1011 292
1010 3300047673 Ga0495593_0000468 Ga0495593_0000468_2875_3804 292
1011 3300047673 Ga0495593_0002910 Ga0495593_0002910_6037_6966 292
1012 3300048088 Ga0495602_0357906 Ga0495602_0357906_103_1032 292
1013 3300048091 Ga0495626_0060495 Ga0495626_0060495_266_1195 292
1014 3300048903 Ga0496100_0027909 Ga0496100_0027909_105_1034 292
1015 3300048904 Ga0496101_0065211 Ga0496101_0065211_701_1630 292
1016 3300048904 Ga0496101_0102901 Ga0496101_0102901_1127_2056 292
1017 3300048905 Ga0496102_0179739 Ga0496102_0179739_174_1103 292
1018 3300048905 Ga0496102_0269156 Ga0496102_0269156_582_1511 292
1019 3300048907 Ga0496104_0255338 Ga0496104_0255338_520_1449 292
1020 3300048908 Ga0496105_0047703 Ga0496105_0047703_582_1511 292
1021 3300048909 Ga0496106_0050055 Ga0496106_0050055_2200_3129 292
1022 3300048909 Ga0496106_0057238 Ga0496106_0057238_1776_2705 292
1023 3300048910 Ga0496107_0026752 Ga0496107_0026752_2272_3204 292
1024 3300048911 Ga0496108_0220864 Ga0496108_0220864_100_1029 292
1025 3300048912 Ga0496109_0018596 Ga0496109_0018596_544_1473 292
1026 3300048912 Ga0496109_0329235 Ga0496109_0329235_90_1019 292
1027 3300048912 Ga0496109_0363933 Ga0496109_0363933_316_1245 292
1028 3300048913 Ga0496110_0022638 Ga0496110_0022638_3346_4275 292
1029 3300048914 Ga0496111_0051917 Ga0496111_0051917_405_1334 292
1030 3300048916 Ga0496113_0174494 Ga0496113_0174494_460_1389 292
1031 3300048917 Ga0496114_0208638 Ga0496114_0208638_89_1018 292
1032 3300048918 Ga0496115_0033388 Ga0496115_0033388_2953_3882 292
1033 3300048918 Ga0496115_0051013 Ga0496115_0051013_149_1078 292
1034 3300048921 Ga0496118_0014928 Ga0496118_0014928_2336_3280 292
1035 3300048921 Ga0496118_0129820 Ga0496118_0129820_165_1097 292
1036 3300048922 Ga0496119_0050984 Ga0496119_0050984_218_1147 292
1037 3300048923 Ga0496120_0113736 Ga0496120_0113736_37_966 292
1038 3300048924 Ga0496121_0000230 Ga0496121_0000230_32427_33356 292
1039 3300048924 Ga0496121_0002110 Ga0496121_0002110_26893_27825 292
1040 3300048924 Ga0496121_0027675 Ga0496121_0027675_37_969 292
1041 3300048924 Ga0496121_0181524 Ga0496121_0181524_438_1367 292
1042 3300048924 Ga0496121_0203141 Ga0496121_0203141_21_950 292
1043 3300048924 Ga0496121_0238559 Ga0496121_0238559_246_1175 292
1044 3300048924 Ga0496121_0264715 Ga0496121_0264715_110_1036 292
1045 3300048928 Ga0496125_0000763 Ga0496125_0000763_40769_41698 292
1046 3300048928 Ga0496125_0000796 Ga0496125_0000796_31413_32342 292
1047 3300048928 Ga0496125_0014089 Ga0496125_0014089_3912_4841 292
1048 3300048929 Ga0496126_0011936 Ga0496126_0011936_4138_5067 292
1049 3300048929 Ga0496126_0015175 Ga0496126_0015175_6381_7310 292
1050 3300048929 Ga0496126_0058324 Ga0496126_0058324_2307_3239 292
1051 3300048929 Ga0496126_0061127 Ga0496126_0061127_261_1190 292
1052 3300048929 Ga0496126_0066910 Ga0496126_0066910_191_1120 292
1053 3300048929 Ga0496126_0326321 Ga0496126_0326321_76_1005 292
1054 3300049577 Ga0501041_0204906 Ga0501041_0204906_123_1052 292
1055 3300049743 Ga0501081_0296556 Ga0501081_0296556_219_1148 292
1056 3300050491 nmdc:mga00v17_50405_c1 nmdc:mga00v17_50405_c1_681_1610 292
1057 3300050492 nmdc:mga0yw44_90003_c1 nmdc:mga0yw44_90003_c1_254_1183 292
1058 3300050494 nmdc:mga06z11_116659_c1 nmdc:mga06z11_116659_c1_341_1270 292
1059 3300050496 nmdc:mga07m45_175948_c1 nmdc:mga07m45_175948_c1_274_1203 292
1060 3300050507 nmdc:mga05p37_44591_c1 nmdc:mga05p37_44591_c1_2996_3925 292
1061 3300050515 nmdc:mga0a205_159553_c1 nmdc:mga0a205_159553_c1_591_1520 292
1062 3300050516 nmdc:mga0sz30_105157_c1 nmdc:mga0sz30_105157_c1_82_1011 292
1063 3300050516 nmdc:mga0sz30_26917_c1 nmdc:mga0sz30_26917_c1_750_1679 292
1064 3300053084 Ga0495595_0000846 Ga0495595_0000846_812_1741 292
1065 3300053085 Ga0495619_0000641 Ga0495619_0000641_14682_15611 292
1066 3300053093 Ga0500651_0002427 Ga0500651_0002427_381_1310 292
1067 3300053093 Ga0500651_0193814 Ga0500651_0193814_236_1165 292
1068 3300053094 Ga0500566_0037243 Ga0500566_0037243_1785_2714 292
1069 3300053096 Ga0500641_0027000 Ga0500641_0027000_357_1286 292
1070 3300053102 Ga0500554_004318 Ga0500554_004318_1983_2912 292
1071 3300053108 Ga0500562_039345 Ga0500562_039345_61_990 292
1072 3300053109 Ga0500569_002666 Ga0500569_002666_1348_2277 292
1073 3300053119 Ga0500595_001746 Ga0500595_001746_4521_5450 292
1074 3300053119 Ga0500595_004600 Ga0500595_004600_1072_2001 292
1075 3300053119 Ga0500595_004632 Ga0500595_004632_3480_4409 292
1076 3300053119 Ga0500595_009010 Ga0500595_009010_219_1148 292
1077 3300053119 Ga0500595_025647 Ga0500595_025647_178_1107 292
1078 3300053124 Ga0500617_044767 Ga0500617_044767_136_1065 292
1079 3300053139 Ga0500568_0027897 Ga0500568_0027897_181_1110 292
1080 3300053142 Ga0500577_0000893 Ga0500577_0000893_3927_4856 292
1081 3300053178 Ga0500637_0000231 Ga0500637_0000231_1629_2558 292
1082 3300053730 Ga0500645_009075 Ga0500645_009075_617_1546 292
1083 3300055283 Ga0500661_001742 Ga0500661_001742_1059_1988 292
1084 iso_pu_bacteria 2511231221 2512037083 292
1085 3300005983 Ga0081540_1031146 Ga0081540_10311462 293
1086 3300013306 Ga0163162_10215813 Ga0163162_102158131 293
1087 3300031711 Ga0265314_10018659 Ga0265314_100186591 293
1088 3300048925 Ga0496122_0075629 Ga0496122_0075629_1105_2055 293
1089 iso_pu_bacteria 8054002106 8054008702 293
1090 3300050492 nmdc:mga0yw44_286352_c1 nmdc:mga0yw44_286352_c1_115_1056 294
1091 3300001904 JGI24736J21556_1000003 JGI24736J21556_100000339 299
1092 3300001915 JGI24741J21665_1006315 JGI24741J21665_10063152 299
1093 3300001976 JGI24752J21851_1000802 JGI24752J21851_10008021 299
1094 3300001979 JGI24740J21852_10000141 JGI24740J21852_1000014119 299
1095 3300001989 JGI24739J22299_10003603 JGI24739J22299_100036032 299
1096 3300001990 JGI24737J22298_10000271 JGI24737J22298_1000027112 299
1097 3300002067 JGI24735J21928_10000163 JGI24735J21928_1000016313 299
1098 3300002070 JGI24750J21931_1002983 JGI24750J21931_10029832 299
1099 3300002074 JGI24748J21848_1000111 JGI24748J21848_10001112 299
1100 3300002075 JGI24738J21930_10000122 JGI24738J21930_100001222 299
1101 3300002075 JGI24738J21930_10004075 JGI24738J21930_100040752 299
1102 3300002239 JGI24034J26672_10000089 JGI24034J26672_1000008917 299
1103 3300002244 JGI24742J22300_10003440 JGI24742J22300_100034402 299
1104 3300002244 JGI24742J22300_10003919 JGI24742J22300_100039192 299
1105 3300005295 Ga0065707_10081846 Ga0065707_1008184628 299
1106 3300005327 Ga0070658_10065777 Ga0070658_100657772 299
1107 3300005330 Ga0070690_100000341 Ga0070690_1000003417 299
1108 3300005335 Ga0070666_10001085 Ga0070666_100010851 299
1109 3300005339 Ga0070660_100006161 Ga0070660_1000061616 299
1110 3300005344 Ga0070661_100003163 Ga0070661_1000031632 299
1111 3300005347 Ga0070668_100025763 Ga0070668_1000257631 299
1112 3300005355 Ga0070671_100001700 Ga0070671_1000017001 299
1113 3300005367 Ga0070667_100002314 Ga0070667_1000023141 299
1114 3300005455 Ga0070663_100021666 Ga0070663_1000216662 299
1115 3300005457 Ga0070662_100000370 Ga0070662_10000037011 299
1116 3300005544 Ga0070686_100000951 Ga0070686_1000009511 299
1117 3300005564 Ga0070664_100003613 Ga0070664_10000361310 299
1118 3300005577 Ga0068857_100036297 Ga0068857_1000362973 299
1119 3300005578 Ga0068854_100003709 Ga0068854_10000370910 299
1120 3300005618 Ga0068864_100002032 Ga0068864_1000020321 299
1121 3300005719 Ga0068861_100004465 Ga0068861_10000446510 299
1122 3300005834 Ga0068851_10008565 Ga0068851_100085652 299
1123 3300005841 Ga0068863_100034336 Ga0068863_1000343362 299
1124 3300005843 Ga0068860_100003263 Ga0068860_1000032631 299
1125 3300009093 Ga0105240_10132998 Ga0105240_101329982 299
1126 3300009545 Ga0105237_10031595 Ga0105237_100315954 299
1127 3300009553 Ga0105249_10002201 Ga0105249_100022011 299
1128 3300010375 Ga0105239_10120787 Ga0105239_101207872 299
1129 3300010375 Ga0105239_10528410 Ga0105239_105284102 299
1130 3300013104 Ga0157370_10009206 Ga0157370_100092068 299
1131 3300013105 Ga0157369_10040582 Ga0157369_100405822 299
1132 3300013306 Ga0163162_10021948 Ga0163162_100219485 299
1133 3300014326 Ga0157380_10018244 Ga0157380_100182444 299
1134 3300014968 Ga0157379_10089399 Ga0157379_100893992 299
1135 3300017792 Ga0163161_10001564 Ga0163161_100015641 299
1136 3300025223 Ga0207672_1000291 Ga0207672_10002915 299
1137 3300025321 Ga0207656_10002794 Ga0207656_100027942 299
1138 3300025903 Ga0207680_10000608 Ga0207680_100006081 299
1139 3300025904 Ga0207647_10000885 Ga0207647_1000088517 299
1140 3300025909 Ga0207705_10011230 Ga0207705_100112304 299
1141 3300025911 Ga0207654_10001250 Ga0207654_100012504 299
1142 3300025913 Ga0207695_10013483 Ga0207695_100134832 299
1143 3300025914 Ga0207671_10004455 Ga0207671_100044554 299
1144 3300025919 Ga0207657_10007886 Ga0207657_100078868 299
1145 3300025920 Ga0207649_10009737 Ga0207649_100097374 299
1146 3300025924 Ga0207694_10001025 Ga0207694_1000102516 299
1147 3300025931 Ga0207644_10001158 Ga0207644_100011581 299
1148 3300025933 Ga0207706_10001157 Ga0207706_1000115711 299
1149 3300025945 Ga0207679_10028262 Ga0207679_100282622 299
1150 3300025949 Ga0207667_10002524 Ga0207667_1000252417 299
1151 3300025961 Ga0207712_10001334 Ga0207712_100013341 299
1152 3300025972 Ga0207668_10195303 Ga0207668_101953032 299
1153 3300025981 Ga0207640_10102737 Ga0207640_101027372 299
1154 3300025986 Ga0207658_10000550 Ga0207658_1000055037 299
1155 3300026041 Ga0207639_10002001 Ga0207639_1000200110 299
1156 3300026067 Ga0207678_10004067 Ga0207678_100040676 299
1157 3300026078 Ga0207702_10012102 Ga0207702_100121024 299
1158 3300026088 Ga0207641_10000820 Ga0207641_1000082016 299
1159 3300026095 Ga0207676_10000112 Ga0207676_1000011266 299
1160 3300026116 Ga0207674_10002655 Ga0207674_100026556 299
1161 3300026118 Ga0207675_100004219 Ga0207675_1000042195 299
1162 3300028381 Ga0268264_10002306 Ga0268264_100023061 299
1163 3300046525 Ga0495663_0006202 Ga0495663_0006202_1269_2168 299
1164 3300046530 Ga0495654_0008175 Ga0495654_0008175_1243_2142 299
1165 3300046616 Ga0495668_0006900 Ga0495668_0006900_3231_4130 299
1166 3300046616 Ga0495668_0011250 Ga0495668_0011250_972_1871 299
1167 3300048905 Ga0496102_0000555 Ga0496102_0000555_23099_23998 299
1168 3300048906 Ga0496103_0000557 Ga0496103_0000557_19438_20337 299
1169 3300048919 Ga0496116_0001007 Ga0496116_0001007_22570_23469 299
1170 3300048920 Ga0496117_0002434 Ga0496117_0002434_16034_16933 299
1171 3300048921 Ga0496118_0003880 Ga0496118_0003880_16034_16933 299
1172 3300048922 Ga0496119_0069337 Ga0496119_0069337_583_1482 299
1173 3300048923 Ga0496120_0023478 Ga0496120_0023478_2206_3105 299
1174 3300048924 Ga0496121_0068250 Ga0496121_0068250_1171_2070 299
1175 3300048927 Ga0496124_0001208 Ga0496124_0001208_23099_23998 299
1176 3300049459 Ga0495678_019364 Ga0495678_019364_504_1403 299
1177 3300053116 Ga0500592_000131 Ga0500592_000131_13495_14394 299
1178 3300053151 Ga0500604_0002650 Ga0500604_0002650_3623_4522 299
1179 3300053151 Ga0500604_0088393 Ga0500604_0088393_80_979 299
1180 3300053158 Ga0500627_0001099 Ga0500627_0001099_4277_5176 299

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

9

121

0.98

PF00196

GerE

Bacterial regulatory proteins, luxR family

241

289

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
6rh1-assembly1.cif.gz_C revisiting ph-gated conformational switch. complex hk853-rr468 d53a ph 7 0.9748 2 120
6rfv-assembly1.cif.gz_C revisiting ph-gated conformational switch. complex hk853-rr468 ph 7 0.9699 2 120
4jav-assembly1.cif.gz_D structural basis of a rationally rewired protein-protein interface (hk853wt and rr468mutant v13p, l14i, i17m and n21v) 0.9694 2 120
1nxx-assembly1.cif.gz_A-2 micarec ph 5.5 0.9693 4 122
2qzj-assembly5.cif.gz_E crystal structure of a two-component response regulator from clostridium difficile 0.9678 2 120
ID Description Score Start End Superfamily
4ja2A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9775 2 121 3.40.50.2300
af_O53213_1064_1134_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9754 236 293 1.10.10.10
af_P9WGM1_5_87_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9666 1 81 3.40.50.2300
af_P14375_1_129_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9665 2 126 3.40.50.2300
2qzjA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9661 2 120 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A0F9CXP9-F1-model_v4 Response regulatory domain-containing protein 0.9928 2 126 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0010181
GO:0032993
AF-A0A2V9CED2-F1-model_v4 Response regulatory domain-containing protein 0.9871 2 118 GO:0000160
AF-A0A355CD79-F1-model_v4 Response regulator 0.9865 3 136 GO:0000160
AF-A0A838VU44-F1-model_v4 histidine kinase (EC 2.7.13.3) 0.9861 3 121 GO:0000155
AF-A0A496YFC6-F1-model_v4 DNA-binding response regulator 0.9791 1 120 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993

Feature Viewer

pLDDT pTM Quality
89.82 0.73 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map