F491300
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1180 | 673 | 946 | 306 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|8019638758|8019640110 |
| Length | 342 |
| Sequence | TESKKRDVALVVDDSPETLRLLTDALDSAGMTVMVALDGAAAMRIVDQITPDIVLLDAVMPGMDGFETCRRLKRDAGLANVPVIFMTGLAETEHIVRGLEAGGVDYVTKPIVIEEMLARIRVHLGNARLTQSARAALDVSGRFLFAVNRQGKLLWATPQAQKLLADHHGAQADDDFVLPVSLLQWLEQAKGKGSSKSQAASLPDNPQLRLYYMGETAPNEFLLRLSRESGTAPPPEFTSELGLTTREGEVLAWLSKGKTNRDIAQILGLSPRTVDKHLEQIYSKLGSREPDRGCGDCNECDKKEFVVLLRVSWDVTQHTVSSRRRPGPITPGSDLAKTSRSD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 2 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 3 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 4 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 5 | 2511231221 | Azospirillum lipoferum 4B | Isolate | Rhizosphere |
| 6 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 7 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 8 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 9 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 10 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 11 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 12 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 13 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 14 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 15 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 16 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 17 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 18 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 19 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 20 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 21 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 22 | 2595698237 | Methylobacterium sp. UNCCL125 | Isolate | Unclassified |
| 23 | 2599185292 | Achromobacter sp. NFACC18-2 | Isolate | Rhizoplane |
| 24 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 25 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 26 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 27 | 2643221569 | Achromobacter sp. Root565 | Isolate | Unclassified |
| 28 | 2643221594 | Achromobacter sp. Root170 | Isolate | Unclassified |
| 29 | 2643221637 | Rhizobium sp. Root1212 | Isolate | Unclassified |
| 30 | 2643221717 | Acidovorax sp. Root267 | Isolate | Unclassified |
| 31 | 2643221718 | Rhizobium sp. Root268 | Isolate | Unclassified |
| 32 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 33 | 2671180139 | Chelativorans sp. A52C2 | Isolate | Unclassified |
| 34 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 35 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 36 | 2738541281 | Methylobacterium sp. GV094 | Isolate | Unclassified |
| 37 | 2738543032 | Methylobacterium sp. GV104 | Isolate | Unclassified |
| 38 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 39 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 40 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 41 | 2791355199 | |||
| 42 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 43 | 2808606395 | Achromobacter sp. SLBN-14 | Isolate | Unclassified |
| 44 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 45 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 46 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 47 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 48 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 49 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 50 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 51 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 52 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 53 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 54 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 55 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 56 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 57 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 58 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 59 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 60 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 61 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 62 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 63 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 64 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 65 | 2829745981 | Methylorubrum rhodinum DSM 2163 | Isolate | Rhizosphere |
| 66 | 2837678835 | Jiella endophytica CBS5Q-3 | Isolate | Unclassified |
| 67 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 68 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 69 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 70 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 71 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 72 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 73 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 74 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 75 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 76 | 2842333319 | Skermanella aerolata SEMIA 4010 | Isolate | Nodule |
| 77 | 2842698319 | Methylobacterium sp. R-72139 | Isolate | Unclassified |
| 78 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 79 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 80 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 81 | 2848858292 | Azospirillum brasilense Az39 | Isolate | Unclassified |
| 82 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 83 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 84 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 85 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 86 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 87 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 88 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 89 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 90 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 91 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 92 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 93 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 94 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 95 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 96 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 97 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 98 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 99 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 100 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 101 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 102 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 103 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 104 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 105 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 106 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 107 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 108 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 109 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 110 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 111 | 2889306138 | Methylobacterium sp. PvR107 | Isolate | Rhizosphere |
| 112 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 113 | 2897803580 | Azospirillum doebereinerae GSF71 | Isolate | Unclassified |
| 114 | 2902330777 | Methylobacterium sp. 2A | Isolate | Unclassified |
| 115 | 2902405164 | Methylobacterium sp. P1-11 | Isolate | Unclassified |
| 116 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 117 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 118 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 119 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 120 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 121 | 2904699407 | |||
| 122 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 123 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 124 | 2906610324 | |||
| 125 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 126 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 127 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 128 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 129 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 130 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 131 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 132 | 2917554339 | Chthonobacter rhizosphaerae yh7-1 | Isolate | Rhizosphere |
| 133 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 134 | 2919704043 | Hydrogenophaga palleronii 4249 | Isolate | Unclassified |
| 135 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 136 | 2922368715 | |||
| 137 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 138 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 139 | 2922425934 | |||
| 140 | 2928125067 | Methylobacterium sp. 1973 | Isolate | Unclassified |
| 141 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 142 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 143 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 144 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 145 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 146 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 147 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 148 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 149 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 150 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 151 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 152 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 153 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 154 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 155 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 156 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 157 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 158 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 159 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 160 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 161 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 162 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 163 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 164 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 165 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 166 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 167 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 168 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 169 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 170 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 171 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 172 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 173 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 174 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 175 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 176 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 177 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 178 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 179 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 180 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 181 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 182 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 183 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 184 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 185 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 186 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 187 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 188 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 189 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 190 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 191 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 192 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 193 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 194 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 195 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 196 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 197 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 198 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 199 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 200 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 201 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 202 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 203 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 204 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 205 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 206 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 207 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 208 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 209 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 210 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 211 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 212 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 213 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 214 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 215 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 216 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 217 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 218 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 219 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 220 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 221 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 222 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 223 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 224 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 225 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 226 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 227 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 228 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 229 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 230 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 231 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 232 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 233 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 234 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 235 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 236 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 237 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 238 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 239 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 240 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 241 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 242 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 243 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 244 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 245 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 246 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 247 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 248 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 249 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 250 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 251 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 252 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 253 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 254 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 255 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 256 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 257 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 258 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 259 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 260 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 261 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 262 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 263 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 264 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 265 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 266 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 267 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 268 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 269 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 270 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 271 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 272 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 273 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 274 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 275 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 276 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 277 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 278 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 279 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 280 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 281 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 282 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 283 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 284 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 285 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 286 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 287 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 288 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 289 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 290 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 291 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 292 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 293 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 294 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 295 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 296 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 297 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 298 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 299 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 300 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 301 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 302 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 303 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 304 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 305 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 306 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 307 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 308 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 309 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 310 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 311 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 312 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 313 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 314 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 315 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 316 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 317 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 318 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 319 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 320 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 321 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 322 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 323 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 324 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 325 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 326 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 327 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 328 | 3300025223 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 329 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 330 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 331 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 332 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 333 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 334 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 335 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 336 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 337 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 338 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 339 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 340 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 341 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 342 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 343 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 344 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 345 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 346 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 347 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 348 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 349 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 350 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 351 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 352 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 353 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 354 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 355 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 356 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 357 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 358 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 359 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 360 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 361 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 362 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 363 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 364 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 365 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 366 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 367 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 368 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 369 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 370 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 371 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 372 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 373 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 374 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 375 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 376 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 377 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 378 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 379 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 380 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 381 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 382 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 383 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 384 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 385 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 386 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 387 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 388 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 389 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 390 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 391 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 392 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 393 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 394 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 395 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 396 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 397 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 398 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 399 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 400 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 401 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 402 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 403 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 404 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 405 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 406 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 407 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 408 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 409 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 410 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 411 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 412 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 413 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 414 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 415 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 416 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 417 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 418 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 419 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 420 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 421 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 422 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 423 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 424 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 425 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 426 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 427 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 428 | 3300033544 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 | Metagenome | Unclassified |
| 429 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 430 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 431 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 432 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 433 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 434 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 435 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 436 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 437 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 438 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 439 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 440 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 441 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 442 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 443 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 444 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 445 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 446 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 447 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 448 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 449 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 450 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 451 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 452 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 453 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 454 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 455 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 456 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 457 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 458 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 459 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 460 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 461 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 462 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 463 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 464 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 465 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 466 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 467 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 468 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 469 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 470 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 471 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 472 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 473 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 474 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 475 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 476 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 477 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 478 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 479 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 480 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 481 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 482 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 483 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 484 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 485 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 486 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 487 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 488 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 489 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 490 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 491 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 492 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 493 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 494 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 495 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 496 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 497 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 498 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 499 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 500 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 501 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 502 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 503 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 504 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 505 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 506 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 507 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 508 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 509 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 510 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 511 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 512 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 513 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 514 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 515 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 516 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 517 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 518 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 519 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 520 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 521 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 522 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 523 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 524 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 525 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 526 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 527 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 528 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 529 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 530 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 531 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 532 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 533 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 534 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 535 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 536 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 537 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 538 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 539 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 540 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 541 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 542 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 543 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 544 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 545 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 546 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 547 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 548 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 549 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 550 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 551 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 552 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 553 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 554 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 555 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 556 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 557 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 558 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 559 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 560 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 561 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 562 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 563 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 564 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 565 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 566 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 567 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 568 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 569 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 570 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 571 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 572 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 573 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 574 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 575 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 576 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 577 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 578 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 579 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 580 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 581 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 582 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 583 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 584 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 585 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 586 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 587 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 588 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 589 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 590 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 591 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 592 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 593 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 594 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 595 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 596 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 597 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 598 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 599 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 600 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 601 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 602 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 603 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 604 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 605 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 606 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 607 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 608 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 609 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 610 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 611 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 612 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 613 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 614 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 615 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 616 | 3300053115 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere | Metagenome | Endosphere |
| 617 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 618 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 619 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 620 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 621 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 622 | 3300053124 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere | Metagenome | Endosphere |
| 623 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 624 | 3300053128 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere | Metagenome | Endosphere |
| 625 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 626 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 627 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 628 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 629 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 630 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 631 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 632 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 633 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 634 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 635 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 636 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 637 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 638 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 639 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 640 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 641 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 642 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 643 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 644 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 645 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 646 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 647 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 648 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 649 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 650 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 651 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 652 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 653 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 654 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 655 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 656 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 657 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 658 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 659 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 660 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 661 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 662 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 663 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 664 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 665 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 666 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 667 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 668 | 8054002106 | Azospirillum lipoferum 59b | Isolate | Unclassified |
| 669 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 670 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 671 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 672 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 673 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 80.51 |
| Metatranscriptomes | 0 |
| Isolates | 19.49 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 15.85 |
| Nodule | 13.22 |
| Rhizoplane | 4.15 |
| Rhizosphere | 52.03 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 14.75 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1000003 | 3300001904 | Bacteria | 60801 |
| 2 | JGI24741J21665_1006315 | 3300001915 | Bacteria | 2387 |
| 3 | JGI24752J21851_1000802 | 3300001976 | Bacteria | 4238 |
| 4 | JGI24740J21852_10000141 | 3300001979 | Bacteria | 27562 |
| 5 | JGI24739J22299_10003603 | 3300001989 | Bacteria | 5911 |
| 6 | JGI24739J22299_10035135 | 3300001989 | Bacteria | 1701 |
| 7 | JGI24737J22298_10000271 | 3300001990 | Bacteria | 17105 |
| 8 | JGI24735J21928_10000163 | 3300002067 | Bacteria | 23719 |
| 9 | JGI24750J21931_1002983 | 3300002070 | Bacteria | 2026 |
| 10 | JGI24748J21848_1000111 | 3300002074 | Bacteria | 17189 |
| 11 | JGI24738J21930_10000122 | 3300002075 | Bacteria | 18615 |
| 12 | JGI24738J21930_10004075 | 3300002075 | Bacteria | 3613 |
| 13 | JGI24034J26672_10000089 | 3300002239 | Bacteria | 17189 |
| 14 | JGI24742J22300_10003440 | 3300002244 | Bacteria | 2567 |
| 15 | JGI24742J22300_10003919 | 3300002244 | Bacteria | 2423 |
| 16 | JGI25406J46586_10005494 | 3300003203 | Bacteria | 5877 |
| 17 | JGI25153J46596_10000105 | 3300003215 | Bacteria | 95783 |
| 18 | JGI25153J46596_10002599 | 3300003215 | Bacteria | 10345 |
| 19 | JGI25153J46596_10003262 | 3300003215 | Bacteria | 9120 |
| 20 | JGI25153J46596_10004844 | 3300003215 | Bacteria | 7170 |
| 21 | JGI25153J46596_10007823 | 3300003215 | Bacteria | 5191 |
| 22 | rootL2_10065592 | 3300003322 | Bacteria | 2088 |
| 23 | rootL2_10191799 | 3300003322 | Bacteria | 3363 |
| 24 | rootH1_10157539 | 3300003323 | Bacteria | 3206 |
| 25 | JGI25160J50197_1000241 | 3300003354 | Bacteria | 42434 |
| 26 | JGI25404J52841_10000119 | 3300003659 | Bacteria | 8037 |
| 27 | JGI25404J52841_10003540 | 3300003659 | Bacteria | 3097 |
| 28 | JGI25404J52841_10010582 | 3300003659 | Bacteria | 1983 |
| 29 | JGI25404J52841_10023826 | 3300003659 | Bacteria | 1320 |
| 30 | Ga0055539_1002679 | 3300003752 | Bacteria | 2643 |
| 31 | Ga0055539_1002682 | 3300003752 | Bacteria | 2642 |
| 32 | Ga0055542_1004966 | 3300003762 | Bacteria | 3093 |
| 33 | Ga0055531_10025464 | 3300003794 | Bacteria | 2147 |
| 34 | Ga0055543_1017737 | 3300004625 | Bacteria | 1335 |
| 35 | Ga0055543_1025103 | 3300004625 | Bacteria | 1066 |
| 36 | Ga0065165_1002115 | 3300005262 | Bacteria | 18118 |
| 37 | Ga0065165_1003507 | 3300005262 | Bacteria | 10899 |
| 38 | Ga0065165_1021992 | 3300005262 | Bacteria | 2200 |
| 39 | Ga0065707_10081846 | 3300005295 | Bacteria | 34057 |
| 40 | Ga0070658_10065777 | 3300005327 | Bacteria | 2960 |
| 41 | Ga0070690_100000341 | 3300005330 | Bacteria | 23942 |
| 42 | Ga0070670_100145966 | 3300005331 | Bacteria | 2047 |
| 43 | Ga0070666_10001085 | 3300005335 | Bacteria | 16621 |
| 44 | Ga0070682_100034163 | 3300005337 | Bacteria | 3095 |
| 45 | Ga0068868_100208670 | 3300005338 | Bacteria | 1632 |
| 46 | Ga0070660_100006161 | 3300005339 | Bacteria | 8299 |
| 47 | Ga0070660_100352667 | 3300005339 | Bacteria | 1212 |
| 48 | Ga0070660_100376074 | 3300005339 | Bacteria | 1172 |
| 49 | Ga0070661_100003163 | 3300005344 | Bacteria | 11333 |
| 50 | Ga0070668_100025763 | 3300005347 | Bacteria | 4460 |
| 51 | Ga0070668_100098907 | 3300005347 | Bacteria | 2309 |
| 52 | Ga0070668_100148041 | 3300005347 | Bacteria | 1896 |
| 53 | Ga0070668_100361795 | 3300005347 | Bacteria | 1230 |
| 54 | Ga0070668_100419586 | 3300005347 | Bacteria | 1145 |
| 55 | Ga0070669_100051420 | 3300005353 | Bacteria | 3012 |
| 56 | Ga0070671_100001700 | 3300005355 | Bacteria | 16701 |
| 57 | Ga0070671_100013653 | 3300005355 | Bacteria | 6550 |
| 58 | Ga0070674_100023622 | 3300005356 | Bacteria | 3981 |
| 59 | Ga0070659_100357816 | 3300005366 | Bacteria | 1226 |
| 60 | Ga0070667_100002314 | 3300005367 | Bacteria | 16701 |
| 61 | Ga0070667_100137643 | 3300005367 | Bacteria | 2135 |
| 62 | Ga0070709_10007052 | 3300005434 | Bacteria | 6144 |
| 63 | Ga0070709_10008434 | 3300005434 | Bacteria | 5664 |
| 64 | Ga0070709_10035454 | 3300005434 | Bacteria | 3032 |
| 65 | Ga0070709_10093647 | 3300005434 | Bacteria | 1986 |
| 66 | Ga0070714_100002875 | 3300005435 | Bacteria | 12739 |
| 67 | Ga0070714_100096779 | 3300005435 | Bacteria | 2594 |
| 68 | Ga0070714_100152727 | 3300005435 | Bacteria | 2082 |
| 69 | Ga0070713_100009905 | 3300005436 | Bacteria | 6857 |
| 70 | Ga0070713_100046001 | 3300005436 | Bacteria | 3579 |
| 71 | Ga0070713_100056750 | 3300005436 | Bacteria | 3257 |
| 72 | Ga0070713_100085089 | 3300005436 | Bacteria | 2708 |
| 73 | Ga0070713_100409784 | 3300005436 | Bacteria | 1267 |
| 74 | Ga0070710_10000878 | 3300005437 | Bacteria | 14395 |
| 75 | Ga0070710_10008549 | 3300005437 | Bacteria | 4983 |
| 76 | Ga0070710_10016869 | 3300005437 | Bacteria | 3727 |
| 77 | Ga0070701_10046931 | 3300005438 | Bacteria | 2223 |
| 78 | Ga0070711_100001277 | 3300005439 | Bacteria | 13671 |
| 79 | Ga0070711_100003170 | 3300005439 | Bacteria | 9548 |
| 80 | Ga0070711_100009993 | 3300005439 | Bacteria | 5855 |
| 81 | Ga0070711_100011213 | 3300005439 | Bacteria | 5559 |
| 82 | Ga0070663_100016609 | 3300005455 | Bacteria | 4787 |
| 83 | Ga0070663_100021666 | 3300005455 | Bacteria | 4279 |
| 84 | Ga0070663_100030652 | 3300005455 | Bacteria | 3689 |
| 85 | Ga0070663_100289667 | 3300005455 | Bacteria | 1307 |
| 86 | Ga0070663_100336048 | 3300005455 | Bacteria | 1219 |
| 87 | Ga0070678_100058738 | 3300005456 | Bacteria | 2824 |
| 88 | Ga0070678_100131877 | 3300005456 | Bacteria | 1986 |
| 89 | Ga0070662_100000370 | 3300005457 | Bacteria | 26837 |
| 90 | Ga0068867_100023770 | 3300005459 | Bacteria | 4389 |
| 91 | Ga0070698_100097422 | 3300005471 | Bacteria | 2917 |
| 92 | Ga0068853_100184776 | 3300005539 | Bacteria | 1892 |
| 93 | Ga0070672_100121473 | 3300005543 | Bacteria | 2138 |
| 94 | Ga0070672_100156878 | 3300005543 | Bacteria | 1885 |
| 95 | Ga0070686_100000951 | 3300005544 | Bacteria | 16701 |
| 96 | Ga0070693_100224813 | 3300005547 | Bacteria | 1232 |
| 97 | Ga0070665_100106479 | 3300005548 | Bacteria | 2806 |
| 98 | Ga0070665_100316990 | 3300005548 | Bacteria | 1563 |
| 99 | Ga0070665_100502665 | 3300005548 | Bacteria | 1223 |
| 100 | Ga0068855_100059671 | 3300005563 | Bacteria | 4463 |
| 101 | Ga0068855_100438626 | 3300005563 | Bacteria | 1427 |
| 102 | Ga0070664_100003613 | 3300005564 | Bacteria | 12460 |
| 103 | Ga0068857_100036297 | 3300005577 | Bacteria | 4368 |
| 104 | Ga0068857_100117647 | 3300005577 | Bacteria | 2392 |
| 105 | Ga0068854_100003709 | 3300005578 | Bacteria | 9553 |
| 106 | Ga0068854_100366959 | 3300005578 | Bacteria | 1183 |
| 107 | Ga0068856_100000565 | 3300005614 | Bacteria | 40600 |
| 108 | Ga0068856_100104952 | 3300005614 | Bacteria | 2820 |
| 109 | Ga0068856_100163427 | 3300005614 | Bacteria | 2237 |
| 110 | Ga0070702_100032203 | 3300005615 | Bacteria | 2876 |
| 111 | Ga0068859_100055772 | 3300005617 | Bacteria | 3976 |
| 112 | Ga0068859_100112738 | 3300005617 | Bacteria | 2783 |
| 113 | Ga0068859_100139361 | 3300005617 | Bacteria | 2499 |
| 114 | Ga0068864_100002032 | 3300005618 | Bacteria | 16701 |
| 115 | Ga0068864_100081408 | 3300005618 | Bacteria | 2838 |
| 116 | Ga0068861_100004465 | 3300005719 | Bacteria | 9391 |
| 117 | Ga0068861_100037464 | 3300005719 | Bacteria | 3605 |
| 118 | Ga0068851_10008565 | 3300005834 | Bacteria | 4733 |
| 119 | Ga0068863_100034336 | 3300005841 | Bacteria | 4832 |
| 120 | Ga0068863_100224197 | 3300005841 | Bacteria | 1812 |
| 121 | Ga0068858_100178582 | 3300005842 | Bacteria | 2004 |
| 122 | Ga0068858_100504140 | 3300005842 | Bacteria | 1169 |
| 123 | Ga0068860_100003263 | 3300005843 | Bacteria | 16701 |
| 124 | Ga0068860_100114294 | 3300005843 | Bacteria | 2581 |
| 125 | Ga0068860_100409619 | 3300005843 | Bacteria | 1342 |
| 126 | Ga0068862_100004021 | 3300005844 | Bacteria | 12469 |
| 127 | Ga0068862_100142878 | 3300005844 | Bacteria | 2125 |
| 128 | Ga0068862_100185624 | 3300005844 | Bacteria | 1868 |
| 129 | Ga0068862_100382196 | 3300005844 | Bacteria | 1313 |
| 130 | Ga0081455_10009013 | 3300005937 | Bacteria | 10299 |
| 131 | Ga0081455_10016971 | 3300005937 | Bacteria | 6998 |
| 132 | Ga0081455_10030272 | 3300005937 | Bacteria | 4920 |
| 133 | Ga0081455_10070447 | 3300005937 | Bacteria | 2903 |
| 134 | Ga0081455_10144890 | 3300005937 | Bacteria | 1839 |
| 135 | Ga0081538_10005891 | 3300005981 | Bacteria | 10920 |
| 136 | Ga0081540_1004703 | 3300005983 | Bacteria | 10329 |
| 137 | Ga0081540_1005662 | 3300005983 | Bacteria | 9288 |
| 138 | Ga0081540_1006548 | 3300005983 | Bacteria | 8459 |
| 139 | Ga0081540_1009656 | 3300005983 | Bacteria | 6631 |
| 140 | Ga0081540_1014475 | 3300005983 | Bacteria | 5050 |
| 141 | Ga0081540_1020027 | 3300005983 | Bacteria | 4040 |
| 142 | Ga0081540_1024577 | 3300005983 | Bacteria | 3494 |
| 143 | Ga0081540_1028489 | 3300005983 | Bacteria | 3136 |
| 144 | Ga0081540_1031146 | 3300005983 | Bacteria | 2940 |
| 145 | Ga0081540_1044102 | 3300005983 | Bacteria | 2280 |
| 146 | Ga0081540_1054592 | 3300005983 | Bacteria | 1951 |
| 147 | Ga0081540_1066793 | 3300005983 | Bacteria | 1683 |
| 148 | Ga0081540_1069407 | 3300005983 | Bacteria | 1638 |
| 149 | Ga0081540_1073066 | 3300005983 | Bacteria | 1577 |
| 150 | Ga0081539_10000617 | 3300005985 | Bacteria | 72003 |
| 151 | Ga0070717_10003746 | 3300006028 | Bacteria | 10919 |
| 152 | Ga0070717_10022548 | 3300006028 | Bacteria | 4977 |
| 153 | Ga0070717_10186877 | 3300006028 | Bacteria | 1809 |
| 154 | Ga0075365_10034809 | 3300006038 | Bacteria | 3254 |
| 155 | Ga0075365_10068991 | 3300006038 | Bacteria | 2376 |
| 156 | Ga0075365_10098482 | 3300006038 | Bacteria | 2000 |
| 157 | Ga0075365_10142938 | 3300006038 | Bacteria | 1661 |
| 158 | Ga0075365_10214282 | 3300006038 | Bacteria | 1350 |
| 159 | Ga0075365_10261915 | 3300006038 | Bacteria | 1216 |
| 160 | Ga0075365_10332914 | 3300006038 | Bacteria | 1070 |
| 161 | Ga0075368_10005099 | 3300006042 | Bacteria | 4497 |
| 162 | Ga0075363_100002208 | 3300006048 | Bacteria | 7854 |
| 163 | Ga0075364_10022409 | 3300006051 | Bacteria | 3988 |
| 164 | Ga0075364_10031298 | 3300006051 | Bacteria | 3418 |
| 165 | Ga0075364_10048273 | 3300006051 | Bacteria | 2774 |
| 166 | Ga0075364_10087117 | 3300006051 | Bacteria | 2069 |
| 167 | Ga0075364_10089456 | 3300006051 | Bacteria | 2042 |
| 168 | Ga0070716_100053095 | 3300006173 | Bacteria | 2310 |
| 169 | Ga0070716_100059332 | 3300006173 | Bacteria | 2205 |
| 170 | Ga0070716_100270183 | 3300006173 | Bacteria | 1168 |
| 171 | Ga0070712_100002086 | 3300006175 | Bacteria | 12280 |
| 172 | Ga0070712_100009781 | 3300006175 | Bacteria | 6042 |
| 173 | Ga0070712_100090744 | 3300006175 | Bacteria | 2237 |
| 174 | Ga0075362_10107814 | 3300006177 | Bacteria | 1308 |
| 175 | Ga0075362_10116617 | 3300006177 | Bacteria | 1261 |
| 176 | Ga0075362_10120813 | 3300006177 | Bacteria | 1240 |
| 177 | Ga0075367_10004480 | 3300006178 | Bacteria | 6827 |
| 178 | Ga0075367_10032084 | 3300006178 | Bacteria | 3019 |
| 179 | Ga0075367_10033297 | 3300006178 | Bacteria | 2969 |
| 180 | Ga0075367_10048405 | 3300006178 | Bacteria | 2504 |
| 181 | Ga0075369_10025069 | 3300006186 | Bacteria | 2477 |
| 182 | Ga0075366_10043484 | 3300006195 | Bacteria | 2661 |
| 183 | Ga0075366_10116860 | 3300006195 | Bacteria | 1606 |
| 184 | Ga0075366_10146737 | 3300006195 | Bacteria | 1428 |
| 185 | Ga0075366_10165260 | 3300006195 | Bacteria | 1342 |
| 186 | Ga0075370_10015615 | 3300006353 | Bacteria | 4069 |
| 187 | Ga0075370_10022744 | 3300006353 | Bacteria | 3446 |
| 188 | Ga0075370_10062777 | 3300006353 | Bacteria | 2117 |
| 189 | Ga0075370_10086232 | 3300006353 | Bacteria | 1808 |
| 190 | Ga0075370_10215602 | 3300006353 | Bacteria | 1134 |
| 191 | Ga0075428_100196462 | 3300006844 | Bacteria | 2182 |
| 192 | Ga0068865_100041530 | 3300006881 | Bacteria | 3130 |
| 193 | Ga0068865_100042363 | 3300006881 | Bacteria | 3104 |
| 194 | Ga0097620_100055772 | 3300006931 | Bacteria | 3976 |
| 195 | Ga0097620_100112736 | 3300006931 | Bacteria | 2783 |
| 196 | Ga0097620_100139343 | 3300006931 | Bacteria | 2499 |
| 197 | Ga0099825_1022855 | 3300006941 | Bacteria | 3946 |
| 198 | Ga0099794_10041987 | 3300007265 | Bacteria | 2179 |
| 199 | Ga0099795_10000656 | 3300007788 | Bacteria | 6653 |
| 200 | Ga0099795_10005394 | 3300007788 | Bacteria | 3396 |
| 201 | Ga0099795_10026186 | 3300007788 | Bacteria | 1963 |
| 202 | Ga0105240_10001377 | 3300009093 | Bacteria | 41807 |
| 203 | Ga0105240_10132998 | 3300009093 | Bacteria | 2981 |
| 204 | Ga0105240_10224642 | 3300009093 | Bacteria | 2185 |
| 205 | Ga0105240_10350311 | 3300009093 | Bacteria | 1675 |
| 206 | Ga0105245_10048730 | 3300009098 | Bacteria | 3790 |
| 207 | Ga0105245_10050199 | 3300009098 | Bacteria | 3738 |
| 208 | Ga0105245_10054965 | 3300009098 | Bacteria | 3576 |
| 209 | Ga0105247_10031063 | 3300009101 | Bacteria | 3240 |
| 210 | Ga0105247_10032869 | 3300009101 | Bacteria | 3153 |
| 211 | Ga0105247_10081077 | 3300009101 | Bacteria | 2045 |
| 212 | Ga0105247_10272479 | 3300009101 | Bacteria | 1165 |
| 213 | Ga0114129_10064167 | 3300009147 | Bacteria | 5125 |
| 214 | Ga0105241_10065494 | 3300009174 | Bacteria | 2808 |
| 215 | Ga0105242_10102997 | 3300009176 | Bacteria | 2421 |
| 216 | Ga0105248_10029163 | 3300009177 | Bacteria | 6154 |
| 217 | Ga0105248_10164887 | 3300009177 | Bacteria | 2498 |
| 218 | Ga0105237_10001208 | 3300009545 | Bacteria | 34549 |
| 219 | Ga0105237_10031595 | 3300009545 | Bacteria | 5365 |
| 220 | Ga0105237_10119254 | 3300009545 | Bacteria | 2632 |
| 221 | Ga0105238_10301637 | 3300009551 | Bacteria | 1585 |
| 222 | Ga0105238_10424344 | 3300009551 | Bacteria | 1325 |
| 223 | Ga0105249_10002201 | 3300009553 | Bacteria | 16890 |
| 224 | Ga0105249_10065267 | 3300009553 | Bacteria | 3349 |
| 225 | Ga0099796_10009702 | 3300010159 | Bacteria | 2615 |
| 226 | Ga0105239_10120787 | 3300010375 | Bacteria | 2909 |
| 227 | Ga0105239_10145846 | 3300010375 | Bacteria | 2639 |
| 228 | Ga0105239_10150181 | 3300010375 | Bacteria | 2600 |
| 229 | Ga0105239_10276648 | 3300010375 | Bacteria | 1889 |
| 230 | Ga0105239_10528410 | 3300010375 | Bacteria | 1342 |
| 231 | Ga0105246_10128923 | 3300011119 | Bacteria | 1886 |
| 232 | Ga0157370_10009206 | 3300013104 | Bacteria | 10587 |
| 233 | Ga0157369_10040582 | 3300013105 | Bacteria | 5080 |
| 234 | Ga0157374_10034735 | 3300013296 | Bacteria | 4608 |
| 235 | Ga0157374_10097110 | 3300013296 | Bacteria | 2819 |
| 236 | Ga0157378_10036359 | 3300013297 | Bacteria | 4358 |
| 237 | Ga0157378_10051368 | 3300013297 | Bacteria | 3669 |
| 238 | Ga0157378_10477016 | 3300013297 | Bacteria | 1242 |
| 239 | Ga0163162_10002433 | 3300013306 | Bacteria | 17545 |
| 240 | Ga0163162_10021948 | 3300013306 | Bacteria | 6289 |
| 241 | Ga0163162_10123584 | 3300013306 | Bacteria | 2694 |
| 242 | Ga0163162_10215813 | 3300013306 | Bacteria | 2049 |
| 243 | Ga0157375_10015134 | 3300013308 | Bacteria | 6900 |
| 244 | Ga0157375_10080746 | 3300013308 | Bacteria | 3291 |
| 245 | Ga0163163_10002363 | 3300014325 | Bacteria | 15969 |
| 246 | Ga0163163_10112880 | 3300014325 | Bacteria | 2747 |
| 247 | Ga0157380_10011189 | 3300014326 | Bacteria | 6476 |
| 248 | Ga0157380_10018244 | 3300014326 | Bacteria | 5206 |
| 249 | Ga0157380_10246052 | 3300014326 | Bacteria | 1615 |
| 250 | Ga0157377_10103273 | 3300014745 | Bacteria | 1702 |
| 251 | Ga0157379_10089399 | 3300014968 | Bacteria | 2763 |
| 252 | Ga0157379_10311060 | 3300014968 | Bacteria | 1437 |
| 253 | Ga0157376_10024381 | 3300014969 | Bacteria | 4748 |
| 254 | Ga0157376_10154755 | 3300014969 | Bacteria | 2071 |
| 255 | Ga0163161_10001564 | 3300017792 | Bacteria | 16890 |
| 256 | Ga0214544_1000003 | 3300021320 | Bacteria | 643752 |
| 257 | Ga0214542_1000003 | 3300021321 | Bacteria | 435700 |
| 258 | Ga0214545_1000004 | 3300021324 | Bacteria | 453352 |
| 259 | Ga0214543_1000007 | 3300021327 | Bacteria | 414744 |
| 260 | Ga0213872_10021002 | 3300021361 | Bacteria | 3007 |
| 261 | Ga0213872_10063966 | 3300021361 | Bacteria | 1662 |
| 262 | Ga0213876_10003521 | 3300021384 | Bacteria | 8929 |
| 263 | Ga0213871_10001177 | 3300021441 | Bacteria | 4203 |
| 264 | Ga0213871_10023929 | 3300021441 | Bacteria | 1542 |
| 265 | Ga0207672_1000291 | 3300025223 | Bacteria | 6802 |
| 266 | Ga0209563_102362 | 3300025230 | Bacteria | 4312 |
| 267 | Ga0209677_100691 | 3300025253 | Bacteria | 17234 |
| 268 | Ga0209677_102123 | 3300025253 | Bacteria | 7779 |
| 269 | Ga0209148_1000334 | 3300025254 | Bacteria | 64148 |
| 270 | Ga0209148_1000409 | 3300025254 | Bacteria | 49427 |
| 271 | Ga0209148_1004493 | 3300025254 | Bacteria | 3425 |
| 272 | Ga0209233_1003186 | 3300025261 | Bacteria | 5815 |
| 273 | Ga0209233_1004082 | 3300025261 | Bacteria | 5036 |
| 274 | Ga0209233_1004834 | 3300025261 | Bacteria | 4537 |
| 275 | Ga0209233_1013772 | 3300025261 | Bacteria | 2301 |
| 276 | Ga0209455_1001057 | 3300025272 | Bacteria | 13627 |
| 277 | Ga0209455_1001295 | 3300025272 | Bacteria | 11666 |
| 278 | Ga0209455_1001915 | 3300025272 | Bacteria | 8611 |
| 279 | Ga0209455_1006216 | 3300025272 | Bacteria | 3559 |
| 280 | Ga0209564_1000792 | 3300025295 | Bacteria | 43539 |
| 281 | Ga0209564_1004214 | 3300025295 | Bacteria | 8959 |
| 282 | Ga0209758_1000015 | 3300025297 | Bacteria | 851943 |
| 283 | Ga0209758_1000224 | 3300025297 | Bacteria | 121530 |
| 284 | Ga0209758_1000279 | 3300025297 | Bacteria | 101326 |
| 285 | Ga0209758_1001476 | 3300025297 | Bacteria | 27510 |
| 286 | Ga0209758_1001947 | 3300025297 | Bacteria | 22346 |
| 287 | Ga0209758_1004240 | 3300025297 | Bacteria | 12132 |
| 288 | Ga0209758_1009765 | 3300025297 | Bacteria | 5886 |
| 289 | Ga0209758_1013773 | 3300025297 | Bacteria | 4373 |
| 290 | Ga0209758_1014240 | 3300025297 | Bacteria | 4249 |
| 291 | Ga0209758_1054243 | 3300025297 | Bacteria | 1370 |
| 292 | Ga0209256_1002302 | 3300025299 | Bacteria | 16014 |
| 293 | Ga0207426_1000613 | 3300025302 | Bacteria | 46040 |
| 294 | Ga0207426_1000942 | 3300025302 | Bacteria | 28876 |
| 295 | Ga0207426_1007986 | 3300025302 | Bacteria | 4347 |
| 296 | Ga0209257_1000296 | 3300025304 | Bacteria | 109517 |
| 297 | Ga0209257_1001187 | 3300025304 | Bacteria | 32795 |
| 298 | Ga0209257_1028445 | 3300025304 | Bacteria | 1839 |
| 299 | Ga0207697_10059802 | 3300025315 | Bacteria | 1584 |
| 300 | Ga0207697_10115558 | 3300025315 | Bacteria | 1152 |
| 301 | Ga0207656_10002794 | 3300025321 | Bacteria | 5932 |
| 302 | Ga0207692_10000970 | 3300025898 | Bacteria | 10440 |
| 303 | Ga0207692_10034089 | 3300025898 | Bacteria | 2462 |
| 304 | Ga0207710_10108566 | 3300025900 | Bacteria | 1316 |
| 305 | Ga0207688_10051004 | 3300025901 | Bacteria | 2317 |
| 306 | Ga0207688_10109715 | 3300025901 | Bacteria | 1600 |
| 307 | Ga0207680_10000608 | 3300025903 | Bacteria | 16898 |
| 308 | Ga0207647_10000885 | 3300025904 | Bacteria | 23242 |
| 309 | Ga0207647_10011348 | 3300025904 | Bacteria | 6253 |
| 310 | Ga0207699_10000882 | 3300025906 | Bacteria | 14319 |
| 311 | Ga0207699_10010703 | 3300025906 | Bacteria | 4613 |
| 312 | Ga0207699_10108324 | 3300025906 | Bacteria | 1776 |
| 313 | Ga0207699_10194122 | 3300025906 | Bacteria | 1372 |
| 314 | Ga0207645_10076729 | 3300025907 | Bacteria | 2140 |
| 315 | Ga0207705_10011230 | 3300025909 | Bacteria | 6492 |
| 316 | Ga0207654_10001250 | 3300025911 | Bacteria | 13535 |
| 317 | Ga0207654_10041269 | 3300025911 | Bacteria | 2604 |
| 318 | Ga0207695_10000062 | 3300025913 | Bacteria | 351979 |
| 319 | Ga0207695_10013483 | 3300025913 | Bacteria | 9746 |
| 320 | Ga0207695_10082984 | 3300025913 | Bacteria | 3238 |
| 321 | Ga0207671_10004455 | 3300025914 | Bacteria | 13386 |
| 322 | Ga0207671_10005186 | 3300025914 | Bacteria | 12114 |
| 323 | Ga0207671_10030621 | 3300025914 | Bacteria | 4012 |
| 324 | Ga0207693_10006903 | 3300025915 | Bacteria | 9377 |
| 325 | Ga0207693_10012697 | 3300025915 | Bacteria | 6802 |
| 326 | Ga0207693_10023028 | 3300025915 | Bacteria | 4946 |
| 327 | Ga0207693_10053133 | 3300025915 | Bacteria | 3179 |
| 328 | Ga0207663_10006825 | 3300025916 | Bacteria | 5876 |
| 329 | Ga0207663_10110225 | 3300025916 | Bacteria | 1866 |
| 330 | Ga0207663_10133416 | 3300025916 | Bacteria | 1719 |
| 331 | Ga0207662_10054009 | 3300025918 | Bacteria | 2394 |
| 332 | Ga0207657_10007886 | 3300025919 | Bacteria | 10862 |
| 333 | Ga0207657_10099048 | 3300025919 | Bacteria | 2421 |
| 334 | Ga0207649_10009737 | 3300025920 | Bacteria | 5263 |
| 335 | Ga0207646_10171029 | 3300025922 | Bacteria | 1962 |
| 336 | Ga0207681_10272009 | 3300025923 | Bacteria | 1330 |
| 337 | Ga0207694_10001025 | 3300025924 | Bacteria | 24369 |
| 338 | Ga0207694_10239942 | 3300025924 | Bacteria | 1481 |
| 339 | Ga0207650_10114824 | 3300025925 | Bacteria | 2089 |
| 340 | Ga0207687_10067922 | 3300025927 | Bacteria | 2538 |
| 341 | Ga0207687_10228250 | 3300025927 | Bacteria | 1470 |
| 342 | Ga0207700_10005941 | 3300025928 | Bacteria | 7343 |
| 343 | Ga0207700_10010828 | 3300025928 | Bacteria | 5785 |
| 344 | Ga0207700_10013065 | 3300025928 | Bacteria | 5388 |
| 345 | Ga0207700_10122782 | 3300025928 | Bacteria | 2108 |
| 346 | Ga0207664_10036433 | 3300025929 | Bacteria | 3803 |
| 347 | Ga0207664_10133704 | 3300025929 | Bacteria | 2091 |
| 348 | Ga0207664_10231022 | 3300025929 | Bacteria | 1608 |
| 349 | Ga0207664_10332861 | 3300025929 | Bacteria | 1341 |
| 350 | Ga0207644_10001158 | 3300025931 | Bacteria | 16898 |
| 351 | Ga0207644_10324036 | 3300025931 | Bacteria | 1246 |
| 352 | Ga0207644_10373351 | 3300025931 | Bacteria | 1162 |
| 353 | Ga0207706_10001157 | 3300025933 | Bacteria | 26820 |
| 354 | Ga0207706_10029163 | 3300025933 | Bacteria | 4927 |
| 355 | Ga0207706_10474433 | 3300025933 | Bacteria | 1081 |
| 356 | Ga0207686_10047401 | 3300025934 | Bacteria | 2656 |
| 357 | Ga0207670_10133935 | 3300025936 | Bacteria | 1819 |
| 358 | Ga0207669_10123761 | 3300025937 | Bacteria | 1761 |
| 359 | Ga0207704_10091011 | 3300025938 | Bacteria | 2004 |
| 360 | Ga0207689_10093502 | 3300025942 | Bacteria | 2470 |
| 361 | Ga0207689_10169943 | 3300025942 | Bacteria | 1797 |
| 362 | Ga0207679_10028262 | 3300025945 | Bacteria | 3889 |
| 363 | Ga0207667_10002524 | 3300025949 | Bacteria | 22795 |
| 364 | Ga0207667_10070874 | 3300025949 | Bacteria | 3627 |
| 365 | Ga0207667_10446021 | 3300025949 | Bacteria | 1315 |
| 366 | Ga0207667_10454193 | 3300025949 | Bacteria | 1302 |
| 367 | Ga0207712_10001334 | 3300025961 | Bacteria | 16898 |
| 368 | Ga0207712_10241889 | 3300025961 | Bacteria | 1454 |
| 369 | Ga0207668_10097434 | 3300025972 | Bacteria | 2176 |
| 370 | Ga0207668_10195303 | 3300025972 | Bacteria | 1607 |
| 371 | Ga0207668_10215469 | 3300025972 | Bacteria | 1538 |
| 372 | Ga0207640_10102737 | 3300025981 | Bacteria | 2008 |
| 373 | Ga0207640_10316069 | 3300025981 | Bacteria | 1241 |
| 374 | Ga0207658_10000550 | 3300025986 | Bacteria | 33998 |
| 375 | Ga0207658_10497775 | 3300025986 | Bacteria | 1085 |
| 376 | Ga0207703_10121259 | 3300026035 | Bacteria | 2245 |
| 377 | Ga0207703_10197343 | 3300026035 | Bacteria | 1786 |
| 378 | Ga0207639_10002001 | 3300026041 | Bacteria | 13739 |
| 379 | Ga0207678_10004067 | 3300026067 | Bacteria | 13161 |
| 380 | Ga0207678_10023870 | 3300026067 | Bacteria | 5348 |
| 381 | Ga0207678_10031834 | 3300026067 | Bacteria | 4599 |
| 382 | Ga0207678_10091219 | 3300026067 | Bacteria | 2604 |
| 383 | Ga0207678_10166924 | 3300026067 | Bacteria | 1880 |
| 384 | Ga0207678_10219447 | 3300026067 | Bacteria | 1627 |
| 385 | Ga0207708_10109280 | 3300026075 | Bacteria | 2145 |
| 386 | Ga0207702_10000056 | 3300026078 | Bacteria | 131186 |
| 387 | Ga0207702_10012102 | 3300026078 | Bacteria | 7176 |
| 388 | Ga0207702_10115580 | 3300026078 | Bacteria | 2393 |
| 389 | Ga0207641_10000820 | 3300026088 | Bacteria | 33016 |
| 390 | Ga0207641_10219942 | 3300026088 | Bacteria | 1761 |
| 391 | Ga0207641_10287269 | 3300026088 | Bacteria | 1549 |
| 392 | Ga0207648_10031888 | 3300026089 | Bacteria | 4656 |
| 393 | Ga0207648_10032951 | 3300026089 | Bacteria | 4572 |
| 394 | Ga0207676_10000112 | 3300026095 | Bacteria | 73166 |
| 395 | Ga0207676_10021216 | 3300026095 | Bacteria | 4765 |
| 396 | Ga0207676_10276423 | 3300026095 | Bacteria | 1523 |
| 397 | Ga0207674_10002655 | 3300026116 | Bacteria | 22334 |
| 398 | Ga0207675_100004219 | 3300026118 | Bacteria | 13909 |
| 399 | Ga0207675_100108249 | 3300026118 | Bacteria | 2621 |
| 400 | Ga0207683_10036663 | 3300026121 | Bacteria | 4271 |
| 401 | Ga0207683_10042257 | 3300026121 | Bacteria | 3981 |
| 402 | Ga0207683_10075803 | 3300026121 | Bacteria | 2978 |
| 403 | Ga0207698_10087601 | 3300026142 | Bacteria | 2536 |
| 404 | Ga0207698_10097054 | 3300026142 | Bacteria | 2431 |
| 405 | Ga0209389_1000064 | 3300027296 | Bacteria | 102177 |
| 406 | Ga0209389_1060420 | 3300027296 | Bacteria | 2352 |
| 407 | Ga0209589_1000001 | 3300027357 | Bacteria | 794224 |
| 408 | Ga0209589_1000012 | 3300027357 | Bacteria | 229451 |
| 409 | Ga0209589_1000013 | 3300027357 | Bacteria | 229273 |
| 410 | Ga0209489_100001 | 3300027361 | Bacteria | 794224 |
| 411 | Ga0209489_100013 | 3300027361 | Bacteria | 229831 |
| 412 | Ga0209700_100001 | 3300027363 | Bacteria | 794224 |
| 413 | Ga0209700_100014 | 3300027363 | Bacteria | 299349 |
| 414 | Ga0209970_1000575 | 3300027614 | Bacteria | 6376 |
| 415 | Ga0209588_1004023 | 3300027671 | Bacteria | 4115 |
| 416 | Ga0268266_10002834 | 3300028379 | Bacteria | 18070 |
| 417 | Ga0268266_10074808 | 3300028379 | Bacteria | 2941 |
| 418 | Ga0268266_10225684 | 3300028379 | Bacteria | 1723 |
| 419 | Ga0268266_10403154 | 3300028379 | Bacteria | 1293 |
| 420 | Ga0268265_10005306 | 3300028380 | Bacteria | 8831 |
| 421 | Ga0268265_10037996 | 3300028380 | Bacteria | 3538 |
| 422 | Ga0268265_10057458 | 3300028380 | Bacteria | 2965 |
| 423 | Ga0268265_10164066 | 3300028380 | Bacteria | 1891 |
| 424 | Ga0268265_10313870 | 3300028380 | Bacteria | 1417 |
| 425 | Ga0268264_10000427 | 3300028381 | Bacteria | 58342 |
| 426 | Ga0268264_10002306 | 3300028381 | Bacteria | 16898 |
| 427 | Ga0268264_10285351 | 3300028381 | Bacteria | 1548 |
| 428 | Ga0265337_1005134 | 3300028556 | Bacteria | 5268 |
| 429 | Ga0265326_10006639 | 3300028558 | Bacteria | 3578 |
| 430 | Ga0265319_1001952 | 3300028563 | Bacteria | 11674 |
| 431 | Ga0265334_10000603 | 3300028573 | Bacteria | 18160 |
| 432 | Ga0265318_10009675 | 3300028577 | Bacteria | 4229 |
| 433 | Ga0265323_10000037 | 3300028653 | Bacteria | 71088 |
| 434 | Ga0265336_10000392 | 3300028666 | Bacteria | 27552 |
| 435 | Ga0307517_10000386 | 3300028786 | Bacteria | 75442 |
| 436 | Ga0307517_10217944 | 3300028786 | Bacteria | 1164 |
| 437 | Ga0307515_10052963 | 3300028794 | Bacteria | 6002 |
| 438 | Ga0265338_10000024 | 3300028800 | Bacteria | 297778 |
| 439 | Ga0265324_10003350 | 3300029957 | Bacteria | 7675 |
| 440 | Ga0265330_10010015 | 3300031235 | Bacteria | 4485 |
| 441 | Ga0265329_10061615 | 3300031242 | Bacteria | 1188 |
| 442 | Ga0265340_10015257 | 3300031247 | Bacteria | 3996 |
| 443 | Ga0265331_10014277 | 3300031250 | Bacteria | 4236 |
| 444 | Ga0307513_10040069 | 3300031456 | Bacteria | 5184 |
| 445 | Ga0307509_10008331 | 3300031507 | Bacteria | 13242 |
| 446 | Ga0307408_100301599 | 3300031548 | Bacteria | 1342 |
| 447 | Ga0307508_10000005 | 3300031616 | Bacteria | 286511 |
| 448 | Ga0265314_10014228 | 3300031711 | Bacteria | 6380 |
| 449 | Ga0265314_10018659 | 3300031711 | Bacteria | 5401 |
| 450 | Ga0265342_10010476 | 3300031712 | Bacteria | 6425 |
| 451 | Ga0265342_10091265 | 3300031712 | Bacteria | 1746 |
| 452 | Ga0316576_10003954 | 3300031727 | Bacteria | 8804 |
| 453 | Ga0316578_10105503 | 3300031728 | Bacteria | 1691 |
| 454 | Ga0307516_10003162 | 3300031730 | Bacteria | 21427 |
| 455 | Ga0307412_10000109 | 3300031911 | Bacteria | 64548 |
| 456 | Ga0307412_10063280 | 3300031911 | Bacteria | 2495 |
| 457 | Ga0307412_10258062 | 3300031911 | Bacteria | 1357 |
| 458 | Ga0307409_100448569 | 3300031995 | Bacteria | 1244 |
| 459 | Ga0307416_100376692 | 3300032002 | Bacteria | 1448 |
| 460 | Ga0307411_10168016 | 3300032005 | Bacteria | 1651 |
| 461 | Ga0307510_10005064 | 3300033180 | Bacteria | 15634 |
| 462 | Ga0307510_10036874 | 3300033180 | Bacteria | 5436 |
| 463 | Ga0315911_1000002 | 3300033442 | Bacteria | 926833 |
| 464 | Ga0316215_1003066 | 3300033544 | Bacteria | 1586 |
| 465 | Ga0373934_0015429 | 3300035086 | Bacteria | 2898 |
| 466 | Ga0373934_0036408 | 3300035086 | Bacteria | 1939 |
| 467 | Ga0373944_0018322 | 3300035089 | Bacteria | 1998 |
| 468 | Ga0373923_0008351 | 3300035111 | Bacteria | 3687 |
| 469 | Ga0373936_0009582 | 3300035113 | Bacteria | 3649 |
| 470 | Ga0373936_0017441 | 3300035113 | Bacteria | 2764 |
| 471 | Ga0373954_0000220 | 3300035118 | Bacteria | 20868 |
| 472 | Ga0373954_0160337 | 3300035118 | Bacteria | 1100 |
| 473 | Ga0373956_0000306 | 3300035119 | Bacteria | 19826 |
| 474 | Ga0373957_0002434 | 3300035120 | Bacteria | 5308 |
| 475 | Ga0373943_0006156 | 3300035170 | Bacteria | 5385 |
| 476 | Ga0373955_0002760 | 3300035172 | Bacteria | 7702 |
| 477 | Ga0373955_0129489 | 3300035172 | Bacteria | 1472 |
| 478 | Ga0373924_0024809 | 3300035410 | Bacteria | 2365 |
| 479 | Ga0373924_0081022 | 3300035410 | Bacteria | 1381 |
| 480 | Ga0373935_0001272 | 3300035692 | Bacteria | 13897 |
| 481 | Ga0373935_0040080 | 3300035692 | Bacteria | 2939 |
| 482 | Ga0373935_0218646 | 3300035692 | Bacteria | 1322 |
| 483 | Ga0373935_0282203 | 3300035692 | Bacteria | 1169 |
| 484 | Ga0373927_0000935 | 3300035695 | Bacteria | 22188 |
| 485 | Ga0373927_0019055 | 3300035695 | Bacteria | 4500 |
| 486 | Ga0373927_0138444 | 3300035695 | Bacteria | 1591 |
| 487 | Ga0373933_0000164 | 3300035724 | Bacteria | 43241 |
| 488 | Ga0373933_0006353 | 3300035724 | Bacteria | 6433 |
| 489 | Ga0373933_0016181 | 3300035724 | Bacteria | 4168 |
| 490 | Ga0373947_0000207 | 3300035725 | Bacteria | 32930 |
| 491 | Ga0373937_0038226 | 3300036401 | Bacteria | 4374 |
| 492 | Ga0373937_0066563 | 3300036401 | Bacteria | 3318 |
| 493 | Ga0373937_0252271 | 3300036401 | Bacteria | 1663 |
| 494 | Ga0316582_0051018 | 3300036647 | Bacteria | 2624 |
| 495 | Ga0316584_0060834 | 3300036712 | Bacteria | 2829 |
| 496 | Ga0373925_0052374 | 3300037068 | Bacteria | 3049 |
| 497 | Ga0373925_0057191 | 3300037068 | Bacteria | 2922 |
| 498 | Ga0395899_0102768 | 3300037312 | Bacteria | 2062 |
| 499 | Ga0395905_0002017 | 3300037471 | Bacteria | 23212 |
| 500 | Ga0395905_0070014 | 3300037471 | Bacteria | 3286 |
| 501 | Ga0395905_0443304 | 3300037471 | Bacteria | 1196 |
| 502 | Ga0395901_0244397 | 3300038443 | Bacteria | 1871 |
| 503 | Ga0436365_0483596 | 3300039437 | Bacteria | 1381 |
| 504 | Ga0436365_0548581 | 3300039437 | Bacteria | 4554 |
| 505 | Ga0436365_0954239 | 3300039437 | Bacteria | 40865 |
| 506 | Ga0436365_1083476 | 3300039437 | Bacteria | 2192 |
| 507 | Ga0436365_1266449 | 3300039437 | Bacteria | 3708 |
| 508 | Ga0436360_1017435 | 3300039438 | Bacteria | 2479 |
| 509 | Ga0436361_0429826 | 3300039447 | Bacteria | 3466 |
| 510 | Ga0436361_1109572 | 3300039447 | Bacteria | 6637 |
| 511 | Ga0451807_2024239 | 3300041486 | Bacteria | 1872 |
| 512 | Ga0466972_0000379 | 3300044658 | Bacteria | 23860 |
| 513 | Ga0466972_0010137 | 3300044658 | Bacteria | 4734 |
| 514 | Ga0466965_0007271 | 3300044683 | Bacteria | 5076 |
| 515 | Ga0466966_0002334 | 3300044684 | Bacteria | 12382 |
| 516 | Ga0466966_0015387 | 3300044684 | Bacteria | 5057 |
| 517 | Ga0466966_0066402 | 3300044684 | Bacteria | 2267 |
| 518 | Ga0466961_0001110 | 3300044693 | Bacteria | 16566 |
| 519 | Ga0466963_0106116 | 3300044694 | Bacteria | 1926 |
| 520 | Ga0466968_0116457 | 3300044735 | Bacteria | 1206 |
| 521 | Ga0466970_0062594 | 3300044765 | Bacteria | 1995 |
| 522 | Ga0466957_0120968 | 3300044842 | Bacteria | 1669 |
| 523 | Ga0466959_0001504 | 3300045049 | Bacteria | 14293 |
| 524 | Ga0466959_0008358 | 3300045049 | Bacteria | 7314 |
| 525 | Ga0466959_0071705 | 3300045049 | Bacteria | 2508 |
| 526 | Ga0466959_0167464 | 3300045049 | Bacteria | 1542 |
| 527 | Ga0495617_011389 | 3300046452 | Bacteria | 3034 |
| 528 | Ga0495627_054474 | 3300046453 | Bacteria | 1196 |
| 529 | Ga0495592_0004993 | 3300046454 | Bacteria | 9766 |
| 530 | Ga0495603_0000032 | 3300046455 | Bacteria | 59469 |
| 531 | Ga0495603_0005706 | 3300046455 | Bacteria | 7440 |
| 532 | Ga0495603_0091537 | 3300046455 | Bacteria | 1778 |
| 533 | Ga0495603_0095918 | 3300046455 | Bacteria | 1733 |
| 534 | Ga0495590_0032236 | 3300046457 | Bacteria | 1832 |
| 535 | Ga0495629_0000094 | 3300046459 | Bacteria | 77297 |
| 536 | Ga0495629_0000114 | 3300046459 | Bacteria | 72778 |
| 537 | Ga0495629_0009642 | 3300046459 | Bacteria | 7053 |
| 538 | Ga0495638_0007148 | 3300046460 | Bacteria | 8042 |
| 539 | Ga0495638_0009289 | 3300046460 | Bacteria | 6910 |
| 540 | Ga0495638_0011434 | 3300046460 | Bacteria | 6115 |
| 541 | Ga0495638_0179132 | 3300046460 | Bacteria | 1210 |
| 542 | Ga0495641_0002565 | 3300046461 | Bacteria | 14274 |
| 543 | Ga0495641_0024733 | 3300046461 | Bacteria | 2959 |
| 544 | Ga0495651_0009075 | 3300046462 | Bacteria | 7633 |
| 545 | Ga0495651_0011197 | 3300046462 | Bacteria | 6894 |
| 546 | Ga0495651_0209969 | 3300046462 | Bacteria | 1356 |
| 547 | Ga0495653_0003100 | 3300046463 | Bacteria | 13312 |
| 548 | Ga0495653_0078002 | 3300046463 | Bacteria | 2458 |
| 549 | Ga0495580_0004156 | 3300046472 | Bacteria | 12178 |
| 550 | Ga0495582_0000030 | 3300046473 | Bacteria | 77594 |
| 551 | Ga0495582_0048994 | 3300046473 | Bacteria | 2326 |
| 552 | Ga0495605_0053154 | 3300046474 | Bacteria | 1966 |
| 553 | Ga0495605_0095462 | 3300046474 | Bacteria | 1372 |
| 554 | Ga0495639_0000003 | 3300046475 | Bacteria | 118479 |
| 555 | Ga0495639_0005148 | 3300046475 | Bacteria | 5617 |
| 556 | Ga0495662_0000008 | 3300046476 | Bacteria | 71128 |
| 557 | Ga0495662_0070165 | 3300046476 | Bacteria | 1698 |
| 558 | Ga0495662_0159227 | 3300046476 | Bacteria | 1112 |
| 559 | Ga0495584_0074180 | 3300046491 | Bacteria | 1710 |
| 560 | Ga0495594_0000249 | 3300046499 | Bacteria | 26130 |
| 561 | Ga0495596_0065457 | 3300046500 | Bacteria | 1414 |
| 562 | Ga0495606_0012187 | 3300046507 | Bacteria | 6928 |
| 563 | Ga0495606_0020843 | 3300046507 | Bacteria | 4817 |
| 564 | Ga0495606_0096551 | 3300046507 | Bacteria | 1807 |
| 565 | Ga0495606_0163391 | 3300046507 | Bacteria | 1297 |
| 566 | Ga0495608_0051466 | 3300046511 | Bacteria | 2729 |
| 567 | Ga0495608_0109310 | 3300046511 | Bacteria | 1778 |
| 568 | Ga0495610_0112751 | 3300046512 | Bacteria | 1202 |
| 569 | Ga0495616_0095415 | 3300046513 | Bacteria | 1402 |
| 570 | Ga0495618_0014438 | 3300046514 | Bacteria | 4812 |
| 571 | Ga0495618_0106675 | 3300046514 | Bacteria | 1794 |
| 572 | Ga0495618_0149403 | 3300046514 | Bacteria | 1493 |
| 573 | Ga0495620_0059664 | 3300046515 | Bacteria | 1594 |
| 574 | Ga0495628_0004817 | 3300046516 | Bacteria | 11872 |
| 575 | Ga0495628_0061546 | 3300046516 | Bacteria | 2944 |
| 576 | Ga0495628_0065385 | 3300046516 | Bacteria | 2845 |
| 577 | Ga0495628_0150930 | 3300046516 | Bacteria | 1770 |
| 578 | Ga0495630_0018007 | 3300046517 | Bacteria | 5183 |
| 579 | Ga0495630_0131423 | 3300046517 | Bacteria | 1901 |
| 580 | Ga0495630_0316155 | 3300046517 | Bacteria | 1194 |
| 581 | Ga0495631_0096063 | 3300046518 | Bacteria | 1275 |
| 582 | Ga0495632_0068042 | 3300046519 | Bacteria | 1717 |
| 583 | Ga0495643_0100003 | 3300046522 | Bacteria | 1487 |
| 584 | Ga0495644_0034992 | 3300046523 | Bacteria | 1896 |
| 585 | Ga0495648_0000325 | 3300046524 | Bacteria | 52966 |
| 586 | Ga0495648_0018141 | 3300046524 | Bacteria | 5000 |
| 587 | Ga0495648_0023128 | 3300046524 | Bacteria | 4263 |
| 588 | Ga0495648_0040083 | 3300046524 | Bacteria | 2974 |
| 589 | Ga0495648_0070682 | 3300046524 | Bacteria | 2027 |
| 590 | Ga0495663_0006202 | 3300046525 | Bacteria | 3301 |
| 591 | Ga0495666_0031350 | 3300046526 | Bacteria | 2605 |
| 592 | Ga0495666_0049611 | 3300046526 | Bacteria | 2019 |
| 593 | Ga0495642_0014387 | 3300046528 | Bacteria | 3065 |
| 594 | Ga0495652_0029126 | 3300046529 | Bacteria | 4851 |
| 595 | Ga0495652_0173645 | 3300046529 | Bacteria | 1661 |
| 596 | Ga0495652_0193133 | 3300046529 | Bacteria | 1552 |
| 597 | Ga0495652_0322496 | 3300046529 | Bacteria | 1115 |
| 598 | Ga0495654_0008175 | 3300046530 | Bacteria | 5794 |
| 599 | Ga0495654_0082409 | 3300046530 | Bacteria | 1505 |
| 600 | Ga0495665_0000001 | 3300046531 | Bacteria | 156121 |
| 601 | Ga0495665_0049412 | 3300046531 | Bacteria | 2230 |
| 602 | Ga0495640_0011846 | 3300046533 | Bacteria | 6689 |
| 603 | Ga0495640_0012771 | 3300046533 | Bacteria | 6410 |
| 604 | Ga0495640_0042783 | 3300046533 | Bacteria | 3158 |
| 605 | Ga0495640_0054820 | 3300046533 | Bacteria | 2729 |
| 606 | Ga0495586_0252912 | 3300046535 | Bacteria | 1005 |
| 607 | Ga0495587_0185187 | 3300046536 | Bacteria | 1179 |
| 608 | Ga0495609_0035426 | 3300046538 | Bacteria | 2259 |
| 609 | Ga0495609_0095844 | 3300046538 | Bacteria | 1287 |
| 610 | Ga0495645_0043602 | 3300046543 | Bacteria | 3272 |
| 611 | Ga0495645_0071672 | 3300046543 | Bacteria | 2498 |
| 612 | Ga0495622_0004414 | 3300046557 | Bacteria | 6537 |
| 613 | Ga0495622_0020192 | 3300046557 | Bacteria | 3103 |
| 614 | Ga0495622_0067036 | 3300046557 | Bacteria | 1658 |
| 615 | Ga0495622_0071010 | 3300046557 | Bacteria | 1607 |
| 616 | Ga0495633_0002918 | 3300046558 | Bacteria | 11727 |
| 617 | Ga0495633_0026394 | 3300046558 | Bacteria | 2851 |
| 618 | Ga0495633_0120241 | 3300046558 | Bacteria | 1217 |
| 619 | Ga0495667_0035228 | 3300046559 | Bacteria | 3346 |
| 620 | Ga0495667_0047807 | 3300046559 | Bacteria | 2825 |
| 621 | Ga0495656_0009498 | 3300046615 | Bacteria | 3498 |
| 622 | Ga0495656_0053651 | 3300046615 | Bacteria | 1733 |
| 623 | Ga0495668_0006900 | 3300046616 | Bacteria | 7355 |
| 624 | Ga0495668_0011250 | 3300046616 | Bacteria | 5370 |
| 625 | Ga0495668_0023978 | 3300046616 | Bacteria | 3473 |
| 626 | Ga0495634_0003282 | 3300046642 | Bacteria | 13051 |
| 627 | Ga0495634_0005378 | 3300046642 | Bacteria | 9865 |
| 628 | Ga0495634_0021233 | 3300046642 | Bacteria | 4592 |
| 629 | Ga0495634_0021715 | 3300046642 | Bacteria | 4532 |
| 630 | Ga0495611_0028249 | 3300046648 | Bacteria | 2455 |
| 631 | Ga0495611_0041248 | 3300046648 | Bacteria | 2058 |
| 632 | Ga0495611_0061777 | 3300046648 | Bacteria | 1703 |
| 633 | Ga0495625_0227519 | 3300046660 | Bacteria | 1219 |
| 634 | Ga0495635_0002364 | 3300046663 | Bacteria | 12839 |
| 635 | Ga0495635_0002589 | 3300046663 | Bacteria | 12378 |
| 636 | Ga0495635_0004842 | 3300046663 | Bacteria | 9365 |
| 637 | Ga0495661_0028475 | 3300046665 | Bacteria | 3576 |
| 638 | Ga0495588_0002455 | 3300046674 | Bacteria | 7937 |
| 639 | Ga0495588_0041708 | 3300046674 | Bacteria | 2344 |
| 640 | Ga0495588_0125435 | 3300046674 | Bacteria | 1354 |
| 641 | Ga0495657_0011053 | 3300046675 | Bacteria | 6770 |
| 642 | Ga0495657_0048554 | 3300046675 | Bacteria | 2862 |
| 643 | Ga0495599_0000800 | 3300046678 | Bacteria | 17670 |
| 644 | Ga0495623_0008330 | 3300046679 | Bacteria | 6741 |
| 645 | Ga0495646_0000456 | 3300046680 | Bacteria | 21662 |
| 646 | Ga0495646_0045629 | 3300046680 | Bacteria | 2676 |
| 647 | Ga0495646_0101682 | 3300046680 | Bacteria | 1647 |
| 648 | Ga0495647_0000736 | 3300046681 | Bacteria | 9691 |
| 649 | Ga0495647_0076288 | 3300046681 | Bacteria | 1351 |
| 650 | Ga0495658_0000285 | 3300046683 | Bacteria | 28523 |
| 651 | Ga0495658_0053649 | 3300046683 | Bacteria | 2290 |
| 652 | Ga0495613_0005014 | 3300046689 | Bacteria | 9947 |
| 653 | Ga0495613_0033921 | 3300046689 | Bacteria | 3791 |
| 654 | Ga0495624_0000193 | 3300046690 | Bacteria | 46434 |
| 655 | Ga0495624_0047370 | 3300046690 | Bacteria | 2731 |
| 656 | Ga0495624_0050832 | 3300046690 | Bacteria | 2625 |
| 657 | Ga0495670_0135766 | 3300046691 | Bacteria | 1284 |
| 658 | Ga0495671_0130999 | 3300046692 | Bacteria | 1223 |
| 659 | Ga0495649_0069464 | 3300046694 | Bacteria | 1889 |
| 660 | Ga0495649_0127110 | 3300046694 | Bacteria | 1346 |
| 661 | Ga0495589_0109607 | 3300046794 | Bacteria | 1333 |
| 662 | Ga0495600_0011609 | 3300046809 | Bacteria | 5492 |
| 663 | Ga0495600_0048122 | 3300046809 | Bacteria | 2781 |
| 664 | Ga0495660_0039967 | 3300046810 | Bacteria | 2602 |
| 665 | Ga0495581_0000110 | 3300047315 | Bacteria | 34511 |
| 666 | Ga0495581_0203964 | 3300047315 | Bacteria | 1156 |
| 667 | Ga0495604_0006962 | 3300047317 | Bacteria | 8961 |
| 668 | Ga0495604_0019089 | 3300047317 | Bacteria | 5490 |
| 669 | Ga0495604_0250197 | 3300047317 | Bacteria | 1208 |
| 670 | Ga0495674_0000031 | 3300047319 | Bacteria | 115867 |
| 671 | Ga0495674_0020552 | 3300047319 | Bacteria | 6111 |
| 672 | Ga0495672_0124714 | 3300047320 | Bacteria | 1364 |
| 673 | Ga0495672_0174014 | 3300047320 | Bacteria | 1095 |
| 674 | Ga0495672_0226463 | 3300047320 | Bacteria | 920 |
| 675 | Ga0495676_0017501 | 3300047321 | Bacteria | 6336 |
| 676 | Ga0495676_0066462 | 3300047321 | Bacteria | 2794 |
| 677 | Ga0495680_0236903 | 3300047322 | Bacteria | 1297 |
| 678 | Ga0495680_0284009 | 3300047322 | Bacteria | 1166 |
| 679 | Ga0495683_0005882 | 3300047323 | Bacteria | 6740 |
| 680 | Ga0495683_0091545 | 3300047323 | Bacteria | 1473 |
| 681 | Ga0495683_0118852 | 3300047323 | Bacteria | 1256 |
| 682 | Ga0495687_051820 | 3300047443 | Bacteria | 1739 |
| 683 | Ga0495673_0019972 | 3300047469 | Bacteria | 3345 |
| 684 | Ga0495673_0051837 | 3300047469 | Bacteria | 1795 |
| 685 | Ga0495673_0076645 | 3300047469 | Bacteria | 1394 |
| 686 | Ga0495673_0102340 | 3300047469 | Bacteria | 1156 |
| 687 | Ga0495684_0000739 | 3300047471 | Bacteria | 26356 |
| 688 | Ga0495684_0180978 | 3300047471 | Bacteria | 1562 |
| 689 | Ga0495686_0044421 | 3300047472 | Bacteria | 2813 |
| 690 | Ga0495686_0109670 | 3300047472 | Bacteria | 1656 |
| 691 | Ga0495686_0176683 | 3300047472 | Bacteria | 1239 |
| 692 | Ga0495593_0000468 | 3300047673 | Bacteria | 22697 |
| 693 | Ga0495593_0002910 | 3300047673 | Bacteria | 10321 |
| 694 | Ga0495593_0015375 | 3300047673 | Bacteria | 4337 |
| 695 | Ga0495593_0075965 | 3300047673 | Bacteria | 1741 |
| 696 | Ga0495602_0025670 | 3300048088 | Bacteria | 5698 |
| 697 | Ga0495602_0099797 | 3300048088 | Bacteria | 2386 |
| 698 | Ga0495602_0130673 | 3300048088 | Bacteria | 2004 |
| 699 | Ga0495602_0357906 | 3300048088 | Bacteria | 1051 |
| 700 | Ga0495626_0060495 | 3300048091 | Bacteria | 1725 |
| 701 | Ga0496100_0027909 | 3300048903 | Bacteria | 3476 |
| 702 | Ga0496101_0065211 | 3300048904 | Bacteria | 2655 |
| 703 | Ga0496101_0102901 | 3300048904 | Bacteria | 2140 |
| 704 | Ga0496102_0000555 | 3300048905 | Bacteria | 40031 |
| 705 | Ga0496102_0010375 | 3300048905 | Bacteria | 8015 |
| 706 | Ga0496102_0179739 | 3300048905 | Bacteria | 1993 |
| 707 | Ga0496102_0269156 | 3300048905 | Bacteria | 1606 |
| 708 | Ga0496102_0542151 | 3300048905 | Bacteria | 1086 |
| 709 | Ga0496103_0000557 | 3300048906 | Bacteria | 29704 |
| 710 | Ga0496103_0042314 | 3300048906 | Bacteria | 2802 |
| 711 | Ga0496104_0009643 | 3300048907 | Bacteria | 8598 |
| 712 | Ga0496104_0096355 | 3300048907 | Bacteria | 2830 |
| 713 | Ga0496104_0173252 | 3300048907 | Bacteria | 2068 |
| 714 | Ga0496104_0255338 | 3300048907 | Bacteria | 1666 |
| 715 | Ga0496105_0001282 | 3300048908 | Bacteria | 17583 |
| 716 | Ga0496105_0021873 | 3300048908 | Bacteria | 5176 |
| 717 | Ga0496105_0047703 | 3300048908 | Bacteria | 3535 |
| 718 | Ga0496106_0004573 | 3300048909 | Bacteria | 10262 |
| 719 | Ga0496106_0050055 | 3300048909 | Bacteria | 3148 |
| 720 | Ga0496106_0057238 | 3300048909 | Bacteria | 2948 |
| 721 | Ga0496106_0136665 | 3300048909 | Bacteria | 1926 |
| 722 | Ga0496107_0026752 | 3300048910 | Bacteria | 4092 |
| 723 | Ga0496107_0121175 | 3300048910 | Bacteria | 1927 |
| 724 | Ga0496108_0014136 | 3300048911 | Bacteria | 6513 |
| 725 | Ga0496108_0220864 | 3300048911 | Bacteria | 1646 |
| 726 | Ga0496108_0263919 | 3300048911 | Bacteria | 1499 |
| 727 | Ga0496108_0295265 | 3300048911 | Bacteria | 1411 |
| 728 | Ga0496109_0018596 | 3300048912 | Bacteria | 6105 |
| 729 | Ga0496109_0329235 | 3300048912 | Bacteria | 1442 |
| 730 | Ga0496109_0363933 | 3300048912 | Bacteria | 1366 |
| 731 | Ga0496109_0559708 | 3300048912 | Bacteria | 1078 |
| 732 | Ga0496110_0022638 | 3300048913 | Bacteria | 5338 |
| 733 | Ga0496111_0051917 | 3300048914 | Bacteria | 2961 |
| 734 | Ga0496112_0094296 | 3300048915 | Bacteria | 2963 |
| 735 | Ga0496112_0356293 | 3300048915 | Bacteria | 1405 |
| 736 | Ga0496112_0579863 | 3300048915 | Bacteria | 1054 |
| 737 | Ga0496113_0042679 | 3300048916 | Bacteria | 3352 |
| 738 | Ga0496113_0106656 | 3300048916 | Bacteria | 2176 |
| 739 | Ga0496113_0174494 | 3300048916 | Bacteria | 1703 |
| 740 | Ga0496114_0130263 | 3300048917 | Bacteria | 2172 |
| 741 | Ga0496114_0160893 | 3300048917 | Bacteria | 1952 |
| 742 | Ga0496114_0208638 | 3300048917 | Bacteria | 1713 |
| 743 | Ga0496115_0023575 | 3300048918 | Bacteria | 4776 |
| 744 | Ga0496115_0033388 | 3300048918 | Bacteria | 4063 |
| 745 | Ga0496115_0051013 | 3300048918 | Bacteria | 3317 |
| 746 | Ga0496116_0001007 | 3300048919 | Bacteria | 34381 |
| 747 | Ga0496116_0005676 | 3300048919 | Bacteria | 11487 |
| 748 | Ga0496117_0002434 | 3300048920 | Bacteria | 23501 |
| 749 | Ga0496117_0016833 | 3300048920 | Bacteria | 6142 |
| 750 | Ga0496117_0022077 | 3300048920 | Bacteria | 5115 |
| 751 | Ga0496117_0032945 | 3300048920 | Bacteria | 3926 |
| 752 | Ga0496117_0178615 | 3300048920 | Bacteria | 1223 |
| 753 | Ga0496118_0003880 | 3300048921 | Bacteria | 18355 |
| 754 | Ga0496118_0009370 | 3300048921 | Bacteria | 9913 |
| 755 | Ga0496118_0014928 | 3300048921 | Bacteria | 7229 |
| 756 | Ga0496118_0018348 | 3300048921 | Bacteria | 6317 |
| 757 | Ga0496118_0025163 | 3300048921 | Bacteria | 5114 |
| 758 | Ga0496118_0027761 | 3300048921 | Bacteria | 4782 |
| 759 | Ga0496118_0103167 | 3300048921 | Bacteria | 1919 |
| 760 | Ga0496118_0121932 | 3300048921 | Bacteria | 1697 |
| 761 | Ga0496118_0128202 | 3300048921 | Bacteria | 1635 |
| 762 | Ga0496118_0129820 | 3300048921 | Bacteria | 1621 |
| 763 | Ga0496119_0050984 | 3300048922 | Bacteria | 2547 |
| 764 | Ga0496119_0053547 | 3300048922 | Bacteria | 2464 |
| 765 | Ga0496119_0069337 | 3300048922 | Bacteria | 2072 |
| 766 | Ga0496119_0090613 | 3300048922 | Bacteria | 1738 |
| 767 | Ga0496120_0023478 | 3300048923 | Bacteria | 3861 |
| 768 | Ga0496120_0113736 | 3300048923 | Bacteria | 1410 |
| 769 | Ga0496121_0000230 | 3300048924 | Bacteria | 120616 |
| 770 | Ga0496121_0002110 | 3300048924 | Bacteria | 31261 |
| 771 | Ga0496121_0007387 | 3300048924 | Bacteria | 13280 |
| 772 | Ga0496121_0019469 | 3300048924 | Bacteria | 6784 |
| 773 | Ga0496121_0024693 | 3300048924 | Bacteria | 5736 |
| 774 | Ga0496121_0027675 | 3300048924 | Bacteria | 5299 |
| 775 | Ga0496121_0034792 | 3300048924 | Bacteria | 4527 |
| 776 | Ga0496121_0039679 | 3300048924 | Bacteria | 4143 |
| 777 | Ga0496121_0047342 | 3300048924 | Bacteria | 3670 |
| 778 | Ga0496121_0068250 | 3300048924 | Bacteria | 2877 |
| 779 | Ga0496121_0159771 | 3300048924 | Bacteria | 1649 |
| 780 | Ga0496121_0181524 | 3300048924 | Bacteria | 1518 |
| 781 | Ga0496121_0192408 | 3300048924 | Bacteria | 1461 |
| 782 | Ga0496121_0203141 | 3300048924 | Bacteria | 1411 |
| 783 | Ga0496121_0238559 | 3300048924 | Bacteria | 1269 |
| 784 | Ga0496121_0239198 | 3300048924 | Bacteria | 1266 |
| 785 | Ga0496121_0264715 | 3300048924 | Bacteria | 1185 |
| 786 | Ga0496122_0075629 | 3300048925 | Bacteria | 2374 |
| 787 | Ga0496122_0101586 | 3300048925 | Bacteria | 1920 |
| 788 | Ga0496123_0007052 | 3300048926 | Bacteria | 10693 |
| 789 | Ga0496124_0001208 | 3300048927 | Bacteria | 40031 |
| 790 | Ga0496124_0009342 | 3300048927 | Bacteria | 10103 |
| 791 | Ga0496124_0027280 | 3300048927 | Bacteria | 5130 |
| 792 | Ga0496124_0128971 | 3300048927 | Bacteria | 2012 |
| 793 | Ga0496124_0138668 | 3300048927 | Bacteria | 1922 |
| 794 | Ga0496125_0000763 | 3300048928 | Bacteria | 52688 |
| 795 | Ga0496125_0000796 | 3300048928 | Bacteria | 51436 |
| 796 | Ga0496125_0002440 | 3300048928 | Bacteria | 24147 |
| 797 | Ga0496125_0014089 | 3300048928 | Bacteria | 7811 |
| 798 | Ga0496125_0032119 | 3300048928 | Bacteria | 4667 |
| 799 | Ga0496125_0054903 | 3300048928 | Bacteria | 3252 |
| 800 | Ga0496125_0154710 | 3300048928 | Bacteria | 1568 |
| 801 | Ga0496126_0003388 | 3300048929 | Bacteria | 20179 |
| 802 | Ga0496126_0011936 | 3300048929 | Bacteria | 8929 |
| 803 | Ga0496126_0015175 | 3300048929 | Bacteria | 7757 |
| 804 | Ga0496126_0015619 | 3300048929 | Bacteria | 7629 |
| 805 | Ga0496126_0043220 | 3300048929 | Bacteria | 4158 |
| 806 | Ga0496126_0058324 | 3300048929 | Bacteria | 3480 |
| 807 | Ga0496126_0061127 | 3300048929 | Bacteria | 3385 |
| 808 | Ga0496126_0066910 | 3300048929 | Bacteria | 3211 |
| 809 | Ga0496126_0072771 | 3300048929 | Bacteria | 3057 |
| 810 | Ga0496126_0131194 | 3300048929 | Bacteria | 2165 |
| 811 | Ga0496126_0136815 | 3300048929 | Bacteria | 2112 |
| 812 | Ga0496126_0217990 | 3300048929 | Bacteria | 1604 |
| 813 | Ga0496126_0309918 | 3300048929 | Bacteria | 1300 |
| 814 | Ga0496126_0326321 | 3300048929 | Bacteria | 1261 |
| 815 | Ga0496126_0384818 | 3300048929 | Bacteria | 1141 |
| 816 | Ga0495678_019364 | 3300049459 | Bacteria | 3038 |
| 817 | Ga0495682_0064865 | 3300049460 | Bacteria | 1317 |
| 818 | Ga0495682_0081205 | 3300049460 | Bacteria | 1166 |
| 819 | Ga0501033_0024478 | 3300049570 | Bacteria | 4554 |
| 820 | Ga0501038_0351885 | 3300049574 | Bacteria | 1147 |
| 821 | Ga0501039_0192388 | 3300049575 | Bacteria | 1604 |
| 822 | Ga0501039_0586890 | 3300049575 | Bacteria | 874 |
| 823 | Ga0501041_0204906 | 3300049577 | Bacteria | 1237 |
| 824 | Ga0501043_0184323 | 3300049579 | Bacteria | 1626 |
| 825 | Ga0501046_0158373 | 3300049580 | Bacteria | 1704 |
| 826 | Ga0501073_0022793 | 3300049589 | Bacteria | 4505 |
| 827 | Ga0501077_0072184 | 3300049593 | Bacteria | 2187 |
| 828 | Ga0501079_0111175 | 3300049741 | Bacteria | 2129 |
| 829 | Ga0501080_0016647 | 3300049742 | Bacteria | 6790 |
| 830 | Ga0501081_0039630 | 3300049743 | Bacteria | 3225 |
| 831 | Ga0501081_0296556 | 3300049743 | Bacteria | 1186 |
| 832 | Ga0501044_0023791 | 3300049823 | Bacteria | 6513 |
| 833 | Ga0501044_0067293 | 3300049823 | Bacteria | 3650 |
| 834 | Ga0501045_0222520 | 3300049824 | Bacteria | 1405 |
| 835 | nmdc:mga03683_65802_c1 | 3300050489 | Bacteria | 1540 |
| 836 | nmdc:mga00v17_42456_c1 | 3300050491 | Bacteria | 2735 |
| 837 | nmdc:mga00v17_50405_c1 | 3300050491 | Bacteria | 2529 |
| 838 | nmdc:mga0yw44_286352_c1 | 3300050492 | Bacteria | 1102 |
| 839 | nmdc:mga0yw44_3568_c1 | 3300050492 | Bacteria | 5749 |
| 840 | nmdc:mga0yw44_49759_c1 | 3300050492 | Bacteria | 2531 |
| 841 | nmdc:mga0yw44_90003_c1 | 3300050492 | Bacteria | 1938 |
| 842 | nmdc:mga0k408_153964_c1 | 3300050493 | Bacteria | 1369 |
| 843 | nmdc:mga06z11_116659_c1 | 3300050494 | Bacteria | 1485 |
| 844 | nmdc:mga06z11_28127_c1 | 3300050494 | Bacteria | 2694 |
| 845 | nmdc:mga06z11_4743_c1 | 3300050494 | Bacteria | 5377 |
| 846 | nmdc:mga06z11_80678_c1 | 3300050494 | Bacteria | 1745 |
| 847 | nmdc:mga04h51_30296_c1 | 3300050495 | Bacteria | 1702 |
| 848 | nmdc:mga07m45_175948_c1 | 3300050496 | Bacteria | 1244 |
| 849 | nmdc:mga07m45_207352_c1 | 3300050496 | Bacteria | 1140 |
| 850 | nmdc:mga07m45_24585_c1 | 3300050496 | Bacteria | 3302 |
| 851 | nmdc:mga07m45_28678_c1 | 3300050496 | Bacteria | 3072 |
| 852 | nmdc:mga05p37_44591_c1 | 3300050507 | Bacteria | 5455 |
| 853 | nmdc:mga0a205_159553_c1 | 3300050515 | Bacteria | 2152 |
| 854 | nmdc:mga0sz30_105157_c1 | 3300050516 | Bacteria | 1235 |
| 855 | nmdc:mga0sz30_26917_c1 | 3300050516 | Bacteria | 2360 |
| 856 | nmdc:mga0sz30_27654_c1 | 3300050516 | Bacteria | 2009 |
| 857 | nmdc:mga0sz30_6834_c1 | 3300050516 | Bacteria | 4257 |
| 858 | nmdc:mga0sz30_90495_c1 | 3300050516 | Bacteria | 1331 |
| 859 | Ga0500610_0124829 | 3300053079 | Bacteria | 1314 |
| 860 | Ga0500635_0093259 | 3300053080 | Bacteria | 1098 |
| 861 | Ga0495595_0000846 | 3300053084 | Bacteria | 11723 |
| 862 | Ga0495619_0000641 | 3300053085 | Bacteria | 23059 |
| 863 | Ga0500578_0060593 | 3300053086 | Bacteria | 2417 |
| 864 | Ga0500578_0135632 | 3300053086 | Bacteria | 1541 |
| 865 | Ga0500643_000062 | 3300053087 | Bacteria | 122407 |
| 866 | Ga0500644_0026428 | 3300053088 | Bacteria | 1796 |
| 867 | Ga0500646_0063354 | 3300053090 | Bacteria | 1093 |
| 868 | Ga0500647_0004251 | 3300053091 | Bacteria | 5736 |
| 869 | Ga0500651_0002427 | 3300053093 | Bacteria | 9840 |
| 870 | Ga0500651_0026539 | 3300053093 | Bacteria | 3642 |
| 871 | Ga0500651_0092785 | 3300053093 | Bacteria | 1857 |
| 872 | Ga0500651_0117077 | 3300053093 | Bacteria | 1620 |
| 873 | Ga0500651_0193814 | 3300053093 | Bacteria | 1202 |
| 874 | Ga0500566_0000535 | 3300053094 | Bacteria | 21307 |
| 875 | Ga0500566_0000789 | 3300053094 | Bacteria | 17984 |
| 876 | Ga0500566_0002570 | 3300053094 | Bacteria | 10806 |
| 877 | Ga0500566_0037243 | 3300053094 | Bacteria | 2819 |
| 878 | Ga0500566_0162376 | 3300053094 | Bacteria | 1163 |
| 879 | Ga0500641_0027000 | 3300053096 | Bacteria | 2233 |
| 880 | Ga0500650_0000946 | 3300053098 | Bacteria | 8188 |
| 881 | Ga0500554_004318 | 3300053102 | Bacteria | 3002 |
| 882 | Ga0500555_010172 | 3300053103 | Bacteria | 2693 |
| 883 | Ga0500555_014393 | 3300053103 | Bacteria | 2281 |
| 884 | Ga0500556_0000015 | 3300053104 | Bacteria | 202598 |
| 885 | Ga0500557_000158 | 3300053105 | Bacteria | 15084 |
| 886 | Ga0500562_039345 | 3300053108 | Bacteria | 1256 |
| 887 | Ga0500562_052525 | 3300053108 | Bacteria | 1091 |
| 888 | Ga0500569_002085 | 3300053109 | Bacteria | 3895 |
| 889 | Ga0500569_002666 | 3300053109 | Bacteria | 3554 |
| 890 | Ga0500569_004768 | 3300053109 | Bacteria | 2874 |
| 891 | Ga0500572_001690 | 3300053111 | Bacteria | 5763 |
| 892 | Ga0500572_006575 | 3300053111 | Bacteria | 2667 |
| 893 | Ga0500591_056421 | 3300053115 | Bacteria | 1824 |
| 894 | Ga0500592_000131 | 3300053116 | Bacteria | 16085 |
| 895 | Ga0500592_001525 | 3300053116 | Bacteria | 3752 |
| 896 | Ga0500593_065947 | 3300053117 | Bacteria | 1582 |
| 897 | Ga0500594_0072310 | 3300053118 | Bacteria | 1016 |
| 898 | Ga0500595_001746 | 3300053119 | Bacteria | 11337 |
| 899 | Ga0500595_004600 | 3300053119 | Bacteria | 6155 |
| 900 | Ga0500595_004632 | 3300053119 | Bacteria | 6132 |
| 901 | Ga0500595_009010 | 3300053119 | Bacteria | 4053 |
| 902 | Ga0500595_025647 | 3300053119 | Bacteria | 2040 |
| 903 | Ga0500595_038197 | 3300053119 | Bacteria | 1562 |
| 904 | Ga0500608_013258 | 3300053122 | Bacteria | 3648 |
| 905 | Ga0500608_033083 | 3300053122 | Bacteria | 2459 |
| 906 | Ga0500608_046559 | 3300053122 | Bacteria | 2083 |
| 907 | Ga0500617_044767 | 3300053124 | Bacteria | 1978 |
| 908 | Ga0500618_007080 | 3300053125 | Bacteria | 3231 |
| 909 | Ga0500626_114729 | 3300053128 | Bacteria | 1159 |
| 910 | Ga0500642_0000044 | 3300053130 | Bacteria | 82877 |
| 911 | Ga0500642_0000350 | 3300053130 | Bacteria | 15587 |
| 912 | Ga0500642_0001189 | 3300053130 | Bacteria | 7459 |
| 913 | Ga0500652_000638 | 3300053131 | Bacteria | 11977 |
| 914 | Ga0500559_0000130 | 3300053136 | Bacteria | 58494 |
| 915 | Ga0500559_0011384 | 3300053136 | Bacteria | 3801 |
| 916 | Ga0500559_0032191 | 3300053136 | Bacteria | 2252 |
| 917 | Ga0500568_0000661 | 3300053139 | Bacteria | 24893 |
| 918 | Ga0500568_0027897 | 3300053139 | Bacteria | 2358 |
| 919 | Ga0500568_0053418 | 3300053139 | Bacteria | 1583 |
| 920 | Ga0500577_0000893 | 3300053142 | Bacteria | 7713 |
| 921 | Ga0500586_001145 | 3300053145 | Bacteria | 5500 |
| 922 | Ga0500588_0009637 | 3300053146 | Bacteria | 2304 |
| 923 | Ga0500604_0001929 | 3300053151 | Bacteria | 5758 |
| 924 | Ga0500604_0002650 | 3300053151 | Bacteria | 4870 |
| 925 | Ga0500604_0003770 | 3300053151 | Bacteria | 4056 |
| 926 | Ga0500604_0009113 | 3300053151 | Bacteria | 2641 |
| 927 | Ga0500604_0088393 | 3300053151 | Bacteria | 1009 |
| 928 | Ga0500616_0000041 | 3300053153 | Bacteria | 359328 |
| 929 | Ga0500616_0000666 | 3300053153 | Bacteria | 40719 |
| 930 | Ga0500616_0100401 | 3300053153 | Bacteria | 1415 |
| 931 | Ga0500619_040921 | 3300053154 | Bacteria | 1463 |
| 932 | Ga0500620_005953 | 3300053155 | Bacteria | 2874 |
| 933 | Ga0500622_0000700 | 3300053156 | Bacteria | 29484 |
| 934 | Ga0500622_0030723 | 3300053156 | Bacteria | 2819 |
| 935 | Ga0500627_0001099 | 3300053158 | Bacteria | 7394 |
| 936 | Ga0500630_029223 | 3300053159 | Bacteria | 2714 |
| 937 | Ga0500639_017207 | 3300053163 | Bacteria | 3813 |
| 938 | Ga0500636_0000323 | 3300053177 | Bacteria | 26381 |
| 939 | Ga0500636_0001687 | 3300053177 | Bacteria | 12092 |
| 940 | Ga0500636_0064500 | 3300053177 | Bacteria | 2133 |
| 941 | Ga0500637_0000231 | 3300053178 | Bacteria | 20786 |
| 942 | Ga0500625_000845 | 3300053729 | Bacteria | 9398 |
| 943 | Ga0500645_009075 | 3300053730 | Bacteria | 3358 |
| 944 | Ga0500609_001511 | 3300053731 | Bacteria | 3405 |
| 945 | Ga0500601_000485 | 3300053737 | Bacteria | 6190 |
| 946 | Ga0500661_001742 | 3300055283 | Bacteria | 4101 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049575 | Ga0501039_0586890 | Ga0501039_0586890_93_860 | 239 |
| 2 | 3300046530 | Ga0495654_0082409 | Ga0495654_0082409_13_840 | 264 |
| 3 | 3300003203 | JGI25406J46586_10005494 | JGI25406J46586_100054944 | 265 |
| 4 | 3300005985 | Ga0081539_10000617 | Ga0081539_1000061763 | 265 |
| 5 | 3300044735 | Ga0466968_0116457 | Ga0466968_0116457_164_1084 | 265 |
| 6 | 3300046681 | Ga0495647_0076288 | Ga0495647_0076288_90_920 | 265 |
| 7 | 3300047320 | Ga0495672_0226463 | Ga0495672_0226463_10_837 | 265 |
| 8 | 3300046692 | Ga0495671_0130999 | Ga0495671_0130999_16_849 | 266 |
| 9 | 3300046558 | Ga0495633_0002918 | Ga0495633_0002918_4742_5626 | 267 |
| 10 | 3300049570 | Ga0501033_0024478 | Ga0501033_0024478_3043_3969 | 268 |
| 11 | 3300049823 | Ga0501044_0023791 | Ga0501044_0023791_1601_2527 | 268 |
| 12 | 3300049574 | Ga0501038_0351885 | Ga0501038_0351885_86_1117 | 269 |
| 13 | 3300005937 | Ga0081455_10144890 | Ga0081455_101448902 | 271 |
| 14 | 3300005983 | Ga0081540_1069407 | Ga0081540_10694072 | 271 |
| 15 | 3300006038 | Ga0075365_10142938 | Ga0075365_101429381 | 271 |
| 16 | 3300007788 | Ga0099795_10000656 | Ga0099795_100006562 | 271 |
| 17 | 3300010159 | Ga0099796_10009702 | Ga0099796_100097023 | 271 |
| 18 | 3300047320 | Ga0495672_0174014 | Ga0495672_0174014_37_933 | 273 |
| 19 | 3300031727 | Ga0316576_10003954 | Ga0316576_100039544 | 274 |
| 20 | 3300031728 | Ga0316578_10105503 | Ga0316578_101055032 | 274 |
| 21 | 3300004625 | Ga0055543_1017737 | Ga0055543_10177372 | 275 |
| 22 | 3300005262 | Ga0065165_1002115 | Ga0065165_10021159 | 275 |
| 23 | 3300006195 | Ga0075366_10165260 | Ga0075366_101652602 | 275 |
| 24 | 3300035695 | Ga0373927_0138444 | Ga0373927_0138444_489_1418 | 275 |
| 25 | 3300048917 | Ga0496114_0130263 | Ga0496114_0130263_1027_1953 | 275 |
| 26 | 3300050494 | nmdc:mga06z11_80678_c1 | nmdc:mga06z11_80678_c1_304_1230 | 275 |
| 27 | 3300048929 | Ga0496126_0072771 | Ga0496126_0072771_1224_2153 | 276 |
| 28 | iso_pu_bacteria | 2837678835 | 2837680049 | 277 |
| 29 | 3300048929 | Ga0496126_0384818 | Ga0496126_0384818_13_879 | 278 |
| 30 | 3300044658 | Ga0466972_0010137 | Ga0466972_0010137_3401_4321 | 279 |
| 31 | iso_pu_bacteria | 2842698319 | 2842701352 | 279 |
| 32 | 3300005434 | Ga0070709_10093647 | Ga0070709_100936472 | 280 |
| 33 | 3300005435 | Ga0070714_100152727 | Ga0070714_1001527272 | 280 |
| 34 | 3300025929 | Ga0207664_10133704 | Ga0207664_101337041 | 280 |
| 35 | iso_pu_bacteria | 2643221637 | 2644208029 | 280 |
| 36 | iso_pu_bacteria | 2643221718 | 2644651431 | 280 |
| 37 | iso_pu_bacteria | 2595698237 | 2596374003 | 281 |
| 38 | iso_pu_bacteria | 2599185292 | 2599902713 | 281 |
| 39 | iso_pu_bacteria | 2643221569 | 2643861558 | 281 |
| 40 | iso_pu_bacteria | 2643221594 | 2643980142 | 281 |
| 41 | iso_pu_bacteria | 2738541281 | 2738746157 | 281 |
| 42 | iso_pu_bacteria | 2738543032 | 2739355387 | 281 |
| 43 | iso_pu_bacteria | 2808606395 | 2809033067 | 281 |
| 44 | iso_pu_bacteria | 2902330777 | 2902335828 | 281 |
| 45 | iso_pu_bacteria | 2902405164 | 2902409056 | 281 |
| 46 | iso_pu_bacteria | 2919704043 | 2919708135 | 281 |
| 47 | iso_pu_bacteria | 2928125067 | 2928129397 | 281 |
| 48 | 3300027614 | Ga0209970_1000575 | Ga0209970_10005752 | 282 |
| 49 | 3300031911 | Ga0307412_10000109 | Ga0307412_1000010936 | 282 |
| 50 | 3300048924 | Ga0496121_0039679 | Ga0496121_0039679_2072_2995 | 282 |
| 51 | iso_pu_bacteria | 2829745981 | 2829748830 | 282 |
| 52 | iso_pu_bacteria | 2889306138 | 2889308264 | 282 |
| 53 | 3300025261 | Ga0209233_1004082 | Ga0209233_10040822 | 283 |
| 54 | 3300025295 | Ga0209564_1000792 | Ga0209564_100079234 | 283 |
| 55 | 3300036647 | Ga0316582_0051018 | Ga0316582_0051018_1271_2194 | 283 |
| 56 | 3300036712 | Ga0316584_0060834 | Ga0316584_0060834_848_1771 | 283 |
| 57 | 3300048929 | Ga0496126_0003388 | Ga0496126_0003388_2179_3108 | 283 |
| 58 | iso_pu_bacteria | 2643221717 | 2644646581 | 283 |
| 59 | iso_pu_bacteria | 2842333319 | 2842334284 | 283 |
| 60 | iso_pu_bacteria | 2671180139 | 2671695233 | 284 |
| 61 | 3300003659 | JGI25404J52841_10010582 | JGI25404J52841_100105821 | 285 |
| 62 | 3300005937 | Ga0081455_10030272 | Ga0081455_100302722 | 285 |
| 63 | 3300005983 | Ga0081540_1004703 | Ga0081540_10047032 | 285 |
| 64 | 3300005983 | Ga0081540_1009656 | Ga0081540_10096565 | 285 |
| 65 | 3300005983 | Ga0081540_1028489 | Ga0081540_10284892 | 285 |
| 66 | 3300032002 | Ga0307416_100376692 | Ga0307416_1003766922 | 285 |
| 67 | 3300046615 | Ga0495656_0053651 | Ga0495656_0053651_217_1143 | 285 |
| 68 | 3300003659 | JGI25404J52841_10000119 | JGI25404J52841_100001197 | 286 |
| 69 | 3300003659 | JGI25404J52841_10003540 | JGI25404J52841_100035402 | 286 |
| 70 | 3300005937 | Ga0081455_10070447 | Ga0081455_100704472 | 286 |
| 71 | 3300005983 | Ga0081540_1005662 | Ga0081540_10056629 | 286 |
| 72 | 3300005983 | Ga0081540_1020027 | Ga0081540_10200272 | 286 |
| 73 | iso_pu_bacteria | 2513237102 | 2513704542 | 286 |
| 74 | iso_pu_bacteria | 2517093001 | 2517102338 | 286 |
| 75 | iso_pu_bacteria | 2824600985 | 2824602623 | 286 |
| 76 | iso_pu_bacteria | 2824609381 | 2824612597 | 286 |
| 77 | iso_pu_bacteria | 2824617872 | 2824621060 | 286 |
| 78 | iso_pu_bacteria | 2824626560 | 2824630067 | 286 |
| 79 | iso_pu_bacteria | 2824635225 | 2824637917 | 286 |
| 80 | iso_pu_bacteria | 2824644064 | 2824646370 | 286 |
| 81 | iso_pu_bacteria | 2824679649 | 2824682086 | 286 |
| 82 | iso_pu_bacteria | 2824714736 | 2824718729 | 286 |
| 83 | iso_pu_bacteria | 2824723954 | 2824726346 | 286 |
| 84 | iso_pu_bacteria | 2841957949 | 2841964795 | 286 |
| 85 | iso_pu_bacteria | 2842038055 | 2842043831 | 286 |
| 86 | iso_pu_bacteria | 2842045827 | 2842052179 | 286 |
| 87 | iso_pu_bacteria | 2874612657 | 2874617713 | 286 |
| 88 | iso_pu_bacteria | 2879099564 | 2879107275 | 286 |
| 89 | iso_pu_bacteria | 2881364244 | 2881370955 | 286 |
| 90 | iso_pu_bacteria | 2881665667 | 2881665742 | 286 |
| 91 | iso_pu_bacteria | 2885366525 | 2885371354 | 286 |
| 92 | iso_pu_bacteria | 2906626472 | 2906633485 | 286 |
| 93 | iso_pu_bacteria | 2906643746 | 2906649064 | 286 |
| 94 | iso_pu_bacteria | 2917554339 | 2917556174 | 286 |
| 95 | iso_pu_bacteria | 2922368715 | 2922378297 | 286 |
| 96 | iso_pu_bacteria | 8016583857 | 8016586734 | 286 |
| 97 | 3300005844 | Ga0068862_100004021 | Ga0068862_1000040215 | 287 |
| 98 | 3300025297 | Ga0209758_1013773 | Ga0209758_10137732 | 287 |
| 99 | 3300025304 | Ga0209257_1000296 | Ga0209257_10002969 | 287 |
| 100 | 3300028380 | Ga0268265_10005306 | Ga0268265_100053063 | 287 |
| 101 | 3300049575 | Ga0501039_0192388 | Ga0501039_0192388_219_1145 | 287 |
| 102 | 3300049593 | Ga0501077_0072184 | Ga0501077_0072184_1134_2060 | 287 |
| 103 | 3300049741 | Ga0501079_0111175 | Ga0501079_0111175_525_1451 | 287 |
| 104 | 3300049743 | Ga0501081_0039630 | Ga0501081_0039630_2235_3161 | 287 |
| 105 | 3300049824 | Ga0501045_0222520 | Ga0501045_0222520_128_1054 | 287 |
| 106 | 3300053103 | Ga0500555_014393 | Ga0500555_014393_154_1083 | 287 |
| 107 | 3300053731 | Ga0500609_001511 | Ga0500609_001511_2457_3386 | 287 |
| 108 | iso_pu_bacteria | 2511231028 | 2511398349 | 287 |
| 109 | iso_pu_bacteria | 2513237092 | 2513626715 | 287 |
| 110 | iso_pu_bacteria | 2513237094 | 2513639599 | 287 |
| 111 | iso_pu_bacteria | 2513237095 | 2513647915 | 287 |
| 112 | iso_pu_bacteria | 2513237139 | 2513873862 | 287 |
| 113 | iso_pu_bacteria | 2513237161 | 2514012833 | 287 |
| 114 | iso_pu_bacteria | 2528768022 | 2528851638 | 287 |
| 115 | iso_pu_bacteria | 2602042107 | 2603860757 | 287 |
| 116 | iso_pu_bacteria | 2617270735 | 2617351755 | 287 |
| 117 | iso_pu_bacteria | 2617270741 | 2617374069 | 287 |
| 118 | iso_pu_bacteria | 2791355196 | 2793063065 | 287 |
| 119 | iso_pu_bacteria | 2802429603 | 2805915945 | 287 |
| 120 | iso_pu_bacteria | 2816332527 | 2818237327 | 287 |
| 121 | iso_pu_bacteria | 2824653114 | 2824654412 | 287 |
| 122 | iso_pu_bacteria | 2824661429 | 2824664779 | 287 |
| 123 | iso_pu_bacteria | 2824671348 | 2824676740 | 287 |
| 124 | iso_pu_bacteria | 2824687955 | 2824692957 | 287 |
| 125 | iso_pu_bacteria | 2824696289 | 2824697600 | 287 |
| 126 | iso_pu_bacteria | 2824732956 | 2824735348 | 287 |
| 127 | iso_pu_bacteria | 2824746037 | 2824749105 | 287 |
| 128 | iso_pu_bacteria | 2824773399 | 2824774890 | 287 |
| 129 | iso_pu_bacteria | 2838122688 | 2838124167 | 287 |
| 130 | iso_pu_bacteria | 2841941048 | 2841944515 | 287 |
| 131 | iso_pu_bacteria | 2841949485 | 2841951653 | 287 |
| 132 | iso_pu_bacteria | 2841966195 | 2841969291 | 287 |
| 133 | iso_pu_bacteria | 2841974524 | 2841980310 | 287 |
| 134 | iso_pu_bacteria | 2841983080 | 2841985562 | 287 |
| 135 | iso_pu_bacteria | 2844315083 | 2844321871 | 287 |
| 136 | iso_pu_bacteria | 2847930680 | 2847931422 | 287 |
| 137 | iso_pu_bacteria | 2847939898 | 2847941805 | 287 |
| 138 | iso_pu_bacteria | 2849076700 | 2849082722 | 287 |
| 139 | iso_pu_bacteria | 2857509624 | 2857511617 | 287 |
| 140 | iso_pu_bacteria | 2857524615 | 2857524804 | 287 |
| 141 | iso_pu_bacteria | 2874620515 | 2874624467 | 287 |
| 142 | iso_pu_bacteria | 2874628541 | 2874636758 | 287 |
| 143 | iso_pu_bacteria | 2876761206 | 2876768996 | 287 |
| 144 | iso_pu_bacteria | 2879083081 | 2879087542 | 287 |
| 145 | iso_pu_bacteria | 2888378607 | 2888379916 | 287 |
| 146 | iso_pu_bacteria | 2888419890 | 2888420723 | 287 |
| 147 | iso_pu_bacteria | 2893066018 | 2893069318 | 287 |
| 148 | iso_pu_bacteria | 2903727486 | 2903727579 | 287 |
| 149 | iso_pu_bacteria | 2904666416 | 2904672194 | 287 |
| 150 | iso_pu_bacteria | 2906602504 | 2906602931 | 287 |
| 151 | iso_pu_bacteria | 2908775508 | 2908776546 | 287 |
| 152 | iso_pu_bacteria | 2919073203 | 2919078690 | 287 |
| 153 | iso_pu_bacteria | 2922393267 | 2922396622 | 287 |
| 154 | iso_pu_bacteria | 2929615660 | 2929622601 | 287 |
| 155 | iso_pu_bacteria | 2929624759 | 2929631181 | 287 |
| 156 | iso_pu_bacteria | 2932784394 | 2932786396 | 287 |
| 157 | iso_pu_bacteria | 2932794094 | 2932794639 | 287 |
| 158 | iso_pu_bacteria | 2932801729 | 2932806920 | 287 |
| 159 | iso_pu_bacteria | 2932809354 | 2932812529 | 287 |
| 160 | iso_pu_bacteria | 2932818245 | 2932822891 | 287 |
| 161 | iso_pu_bacteria | 2932828146 | 2932829634 | 287 |
| 162 | iso_pu_bacteria | 2933577622 | 2933584320 | 287 |
| 163 | iso_pu_bacteria | 2935616580 | 2935618152 | 287 |
| 164 | iso_pu_bacteria | 2935638405 | 2935641450 | 287 |
| 165 | iso_pu_bacteria | 2935665750 | 2935669492 | 287 |
| 166 | iso_pu_bacteria | 2935675223 | 2935677910 | 287 |
| 167 | iso_pu_bacteria | 2935684952 | 2935689641 | 287 |
| 168 | iso_pu_bacteria | 2935694250 | 2935698177 | 287 |
| 169 | iso_pu_bacteria | 2935703347 | 2935707317 | 287 |
| 170 | iso_pu_bacteria | 2935713505 | 2935717161 | 287 |
| 171 | iso_pu_bacteria | 2935722832 | 2935730005 | 287 |
| 172 | iso_pu_bacteria | 2935732158 | 2935738576 | 287 |
| 173 | iso_pu_bacteria | 2935741537 | 2935749176 | 287 |
| 174 | iso_pu_bacteria | 2935750917 | 2935756995 | 287 |
| 175 | iso_pu_bacteria | 2935760218 | 2935764394 | 287 |
| 176 | iso_pu_bacteria | 2935801545 | 2935804304 | 287 |
| 177 | iso_pu_bacteria | 2935810662 | 2935815388 | 287 |
| 178 | iso_pu_bacteria | 2935827899 | 2935831181 | 287 |
| 179 | iso_pu_bacteria | 2935837841 | 2935841790 | 287 |
| 180 | iso_pu_bacteria | 2935855204 | 2935856349 | 287 |
| 181 | iso_pu_bacteria | 2935864058 | 2935866319 | 287 |
| 182 | iso_pu_bacteria | 2935873716 | 2935874625 | 287 |
| 183 | iso_pu_bacteria | 2935883170 | 2935890332 | 287 |
| 184 | iso_pu_bacteria | 2935992306 | 2935994086 | 287 |
| 185 | iso_pu_bacteria | 2936002035 | 2936004903 | 287 |
| 186 | iso_pu_bacteria | 2936037263 | 2936045043 | 287 |
| 187 | iso_pu_bacteria | 2940556831 | 2940562909 | 287 |
| 188 | iso_pu_bacteria | 2941538514 | 2941543863 | 287 |
| 189 | iso_pu_bacteria | 3005483717 | 3005487328 | 287 |
| 190 | iso_pu_bacteria | 3005506211 | 3005509496 | 287 |
| 191 | iso_pu_bacteria | 3005587118 | 3005589486 | 287 |
| 192 | iso_pu_bacteria | 3005594810 | 3005597653 | 287 |
| 193 | iso_pu_bacteria | 8016511872 | 8016518569 | 287 |
| 194 | iso_pu_bacteria | 8017057580 | 8017058096 | 287 |
| 195 | iso_pu_bacteria | 8019576017 | 8019577635 | 287 |
| 196 | iso_pu_bacteria | 8019586578 | 8019595730 | 287 |
| 197 | iso_pu_bacteria | 8019597564 | 8019606030 | 287 |
| 198 | iso_pu_bacteria | 8019608314 | 8019612501 | 287 |
| 199 | iso_pu_bacteria | 8019648815 | 8019652827 | 287 |
| 200 | iso_pu_bacteria | 8054002106 | 8054003241 | 287 |
| 201 | iso_pu_bacteria | 8055742211 | 8055751052 | 287 |
| 202 | iso_pu_bacteria | 8056967851 | 8056970966 | 287 |
| 203 | 3300003322 | rootL2_10191799 | rootL2_101917992 | 288 |
| 204 | 3300003323 | rootH1_10157539 | rootH1_101575391 | 288 |
| 205 | 3300005353 | Ga0070669_100051420 | Ga0070669_1000514202 | 288 |
| 206 | 3300005356 | Ga0070674_100023622 | Ga0070674_1000236222 | 288 |
| 207 | 3300005434 | Ga0070709_10007052 | Ga0070709_100070522 | 288 |
| 208 | 3300005436 | Ga0070713_100056750 | Ga0070713_1000567502 | 288 |
| 209 | 3300005439 | Ga0070711_100001277 | Ga0070711_1000012778 | 288 |
| 210 | 3300005617 | Ga0068859_100112738 | Ga0068859_1001127382 | 288 |
| 211 | 3300005842 | Ga0068858_100178582 | Ga0068858_1001785822 | 288 |
| 212 | 3300005981 | Ga0081538_10005891 | Ga0081538_1000589110 | 288 |
| 213 | 3300006881 | Ga0068865_100042363 | Ga0068865_1000423632 | 288 |
| 214 | 3300006931 | Ga0097620_100112736 | Ga0097620_1001127362 | 288 |
| 215 | 3300009101 | Ga0105247_10032869 | Ga0105247_100328692 | 288 |
| 216 | 3300009551 | Ga0105238_10301637 | Ga0105238_103016372 | 288 |
| 217 | 3300014326 | Ga0157380_10011189 | Ga0157380_100111893 | 288 |
| 218 | 3300025906 | Ga0207699_10108324 | Ga0207699_101083242 | 288 |
| 219 | 3300025928 | Ga0207700_10013065 | Ga0207700_100130652 | 288 |
| 220 | 3300026088 | Ga0207641_10219942 | Ga0207641_102199422 | 288 |
| 221 | 3300028556 | Ga0265337_1005134 | Ga0265337_10051342 | 288 |
| 222 | 3300028558 | Ga0265326_10006639 | Ga0265326_100066391 | 288 |
| 223 | 3300028563 | Ga0265319_1001952 | Ga0265319_10019525 | 288 |
| 224 | 3300028573 | Ga0265334_10000603 | Ga0265334_100006036 | 288 |
| 225 | 3300028577 | Ga0265318_10009675 | Ga0265318_100096752 | 288 |
| 226 | 3300028653 | Ga0265323_10000037 | Ga0265323_1000003721 | 288 |
| 227 | 3300028666 | Ga0265336_10000392 | Ga0265336_100003927 | 288 |
| 228 | 3300028800 | Ga0265338_10000024 | Ga0265338_1000002454 | 288 |
| 229 | 3300029957 | Ga0265324_10003350 | Ga0265324_100033503 | 288 |
| 230 | 3300053087 | Ga0500643_000062 | Ga0500643_000062_20357_21274 | 288 |
| 231 | iso_pu_bacteria | 2507262055 | 2507504891 | 288 |
| 232 | iso_pu_bacteria | 2508501009 | 2508546244 | 288 |
| 233 | iso_pu_bacteria | 2508501042 | 2508695176 | 288 |
| 234 | iso_pu_bacteria | 2515154112 | 2515625815 | 288 |
| 235 | iso_pu_bacteria | 2728368998 | 2728754839 | 288 |
| 236 | iso_pu_bacteria | 2791355199 | 2793082888 | 288 |
| 237 | iso_pu_bacteria | 2874590934 | 2874596885 | 288 |
| 238 | iso_pu_bacteria | 2874645413 | 2874648690 | 288 |
| 239 | iso_pu_bacteria | 2876771140 | 2876777349 | 288 |
| 240 | iso_pu_bacteria | 2876818435 | 2876825431 | 288 |
| 241 | iso_pu_bacteria | 2879074833 | 2879077680 | 288 |
| 242 | iso_pu_bacteria | 2879127579 | 2879128655 | 288 |
| 243 | iso_pu_bacteria | 2879142872 | 2879143995 | 288 |
| 244 | iso_pu_bacteria | 2885409591 | 2885418344 | 288 |
| 245 | iso_pu_bacteria | 2888388044 | 2888390990 | 288 |
| 246 | iso_pu_bacteria | 2889033259 | 2889037867 | 288 |
| 247 | iso_pu_bacteria | 2897803580 | 2897806340 | 288 |
| 248 | iso_pu_bacteria | 2922386360 | 2922386945 | 288 |
| 249 | iso_pu_bacteria | 2935608549 | 2935614911 | 288 |
| 250 | iso_pu_bacteria | 2935648319 | 2935652939 | 288 |
| 251 | iso_pu_bacteria | 2935656913 | 2935661522 | 288 |
| 252 | iso_pu_bacteria | 2935819856 | 2935826049 | 288 |
| 253 | iso_pu_bacteria | 2935847175 | 2935851668 | 288 |
| 254 | iso_pu_bacteria | 2935908558 | 2935910310 | 288 |
| 255 | iso_pu_bacteria | 2935916978 | 2935918404 | 288 |
| 256 | iso_pu_bacteria | 2935926038 | 2935927779 | 288 |
| 257 | iso_pu_bacteria | 2935934488 | 2935936349 | 288 |
| 258 | iso_pu_bacteria | 2935942939 | 2935944098 | 288 |
| 259 | iso_pu_bacteria | 2935951376 | 2935952535 | 288 |
| 260 | iso_pu_bacteria | 2935959822 | 2935962328 | 288 |
| 261 | iso_pu_bacteria | 2935967501 | 2935969375 | 288 |
| 262 | iso_pu_bacteria | 2935975950 | 2935977857 | 288 |
| 263 | iso_pu_bacteria | 2935984226 | 2935984837 | 288 |
| 264 | iso_pu_bacteria | 2936011229 | 2936015749 | 288 |
| 265 | iso_pu_bacteria | 2936019824 | 2936024383 | 288 |
| 266 | iso_pu_bacteria | 2936028420 | 2936031730 | 288 |
| 267 | iso_pu_bacteria | 2936046547 | 2936051552 | 288 |
| 268 | iso_pu_bacteria | 2936055302 | 2936056008 | 288 |
| 269 | iso_pu_bacteria | 8006926726 | 8006932717 | 288 |
| 270 | iso_pu_bacteria | 8006984368 | 8006984749 | 288 |
| 271 | iso_pu_bacteria | 8019619141 | 8019622610 | 288 |
| 272 | iso_pu_bacteria | 8019629233 | 8019630499 | 288 |
| 273 | iso_pu_bacteria | 8019659431 | 8019667328 | 288 |
| 274 | iso_pu_bacteria | 8019668869 | 8019677099 | 288 |
| 275 | iso_pu_bacteria | 8056673599 | 8056680970 | 288 |
| 276 | 3300001989 | JGI24739J22299_10035135 | JGI24739J22299_100351352 | 289 |
| 277 | 3300003215 | JGI25153J46596_10002599 | JGI25153J46596_100025999 | 289 |
| 278 | 3300003762 | Ga0055542_1004966 | Ga0055542_10049662 | 289 |
| 279 | 3300004625 | Ga0055543_1025103 | Ga0055543_10251031 | 289 |
| 280 | 3300005262 | Ga0065165_1003507 | Ga0065165_10035077 | 289 |
| 281 | 3300005262 | Ga0065165_1021992 | Ga0065165_10219921 | 289 |
| 282 | 3300005331 | Ga0070670_100145966 | Ga0070670_1001459662 | 289 |
| 283 | 3300005338 | Ga0068868_100208670 | Ga0068868_1002086702 | 289 |
| 284 | 3300005339 | Ga0070660_100352667 | Ga0070660_1003526671 | 289 |
| 285 | 3300005355 | Ga0070671_100013653 | Ga0070671_1000136534 | 289 |
| 286 | 3300005366 | Ga0070659_100357816 | Ga0070659_1003578162 | 289 |
| 287 | 3300005455 | Ga0070663_100030652 | Ga0070663_1000306522 | 289 |
| 288 | 3300005455 | Ga0070663_100289667 | Ga0070663_1002896671 | 289 |
| 289 | 3300005563 | Ga0068855_100438626 | Ga0068855_1004386261 | 289 |
| 290 | 3300005614 | Ga0068856_100163427 | Ga0068856_1001634272 | 289 |
| 291 | 3300006038 | Ga0075365_10034809 | Ga0075365_100348093 | 289 |
| 292 | 3300006042 | Ga0075368_10005099 | Ga0075368_100050992 | 289 |
| 293 | 3300006051 | Ga0075364_10031298 | Ga0075364_100312982 | 289 |
| 294 | 3300006177 | Ga0075362_10120813 | Ga0075362_101208132 | 289 |
| 295 | 3300006195 | Ga0075366_10043484 | Ga0075366_100434841 | 289 |
| 296 | 3300006195 | Ga0075366_10116860 | Ga0075366_101168602 | 289 |
| 297 | 3300006941 | Ga0099825_1022855 | Ga0099825_10228552 | 289 |
| 298 | 3300009093 | Ga0105240_10350311 | Ga0105240_103503112 | 289 |
| 299 | 3300009101 | Ga0105247_10081077 | Ga0105247_100810772 | 289 |
| 300 | 3300009101 | Ga0105247_10272479 | Ga0105247_102724792 | 289 |
| 301 | 3300009177 | Ga0105248_10029163 | Ga0105248_100291632 | 289 |
| 302 | 3300009553 | Ga0105249_10065267 | Ga0105249_100652672 | 289 |
| 303 | 3300011119 | Ga0105246_10128923 | Ga0105246_101289231 | 289 |
| 304 | 3300013296 | Ga0157374_10097110 | Ga0157374_100971101 | 289 |
| 305 | 3300013308 | Ga0157375_10080746 | Ga0157375_100807461 | 289 |
| 306 | 3300014325 | Ga0163163_10112880 | Ga0163163_101128801 | 289 |
| 307 | 3300021320 | Ga0214544_1000003 | Ga0214544_100000376 | 289 |
| 308 | 3300021321 | Ga0214542_1000003 | Ga0214542_100000366 | 289 |
| 309 | 3300021324 | Ga0214545_1000004 | Ga0214545_100000479 | 289 |
| 310 | 3300021327 | Ga0214543_1000007 | Ga0214543_1000007338 | 289 |
| 311 | 3300021361 | Ga0213872_10021002 | Ga0213872_100210022 | 289 |
| 312 | 3300021361 | Ga0213872_10063966 | Ga0213872_100639662 | 289 |
| 313 | 3300021441 | Ga0213871_10001177 | Ga0213871_100011772 | 289 |
| 314 | 3300025254 | Ga0209148_1000334 | Ga0209148_100033438 | 289 |
| 315 | 3300025261 | Ga0209233_1003186 | Ga0209233_10031862 | 289 |
| 316 | 3300025261 | Ga0209233_1004834 | Ga0209233_10048342 | 289 |
| 317 | 3300025272 | Ga0209455_1001915 | Ga0209455_10019153 | 289 |
| 318 | 3300025272 | Ga0209455_1006216 | Ga0209455_10062163 | 289 |
| 319 | 3300025297 | Ga0209758_1000015 | Ga0209758_1000015122 | 289 |
| 320 | 3300025297 | Ga0209758_1000224 | Ga0209758_100022427 | 289 |
| 321 | 3300025297 | Ga0209758_1001476 | Ga0209758_100147625 | 289 |
| 322 | 3300025297 | Ga0209758_1054243 | Ga0209758_10542432 | 289 |
| 323 | 3300025299 | Ga0209256_1002302 | Ga0209256_100230212 | 289 |
| 324 | 3300025302 | Ga0207426_1000942 | Ga0207426_100094219 | 289 |
| 325 | 3300025302 | Ga0207426_1007986 | Ga0207426_10079862 | 289 |
| 326 | 3300025304 | Ga0209257_1001187 | Ga0209257_100118717 | 289 |
| 327 | 3300025315 | Ga0207697_10059802 | Ga0207697_100598022 | 289 |
| 328 | 3300025901 | Ga0207688_10109715 | Ga0207688_101097151 | 289 |
| 329 | 3300025904 | Ga0207647_10011348 | Ga0207647_100113484 | 289 |
| 330 | 3300025913 | Ga0207695_10082984 | Ga0207695_100829842 | 289 |
| 331 | 3300025925 | Ga0207650_10114824 | Ga0207650_101148242 | 289 |
| 332 | 3300025942 | Ga0207689_10093502 | Ga0207689_100935022 | 289 |
| 333 | 3300025949 | Ga0207667_10446021 | Ga0207667_104460211 | 289 |
| 334 | 3300025949 | Ga0207667_10454193 | Ga0207667_104541931 | 289 |
| 335 | 3300025961 | Ga0207712_10241889 | Ga0207712_102418891 | 289 |
| 336 | 3300025972 | Ga0207668_10097434 | Ga0207668_100974342 | 289 |
| 337 | 3300025986 | Ga0207658_10497775 | Ga0207658_104977751 | 289 |
| 338 | 3300026035 | Ga0207703_10197343 | Ga0207703_101973431 | 289 |
| 339 | 3300026067 | Ga0207678_10091219 | Ga0207678_100912192 | 289 |
| 340 | 3300026089 | Ga0207648_10031888 | Ga0207648_100318882 | 289 |
| 341 | 3300026095 | Ga0207676_10276423 | Ga0207676_102764232 | 289 |
| 342 | 3300027296 | Ga0209389_1000064 | Ga0209389_100006422 | 289 |
| 343 | 3300027296 | Ga0209389_1060420 | Ga0209389_10604202 | 289 |
| 344 | 3300027357 | Ga0209589_1000012 | Ga0209589_1000012101 | 289 |
| 345 | 3300027357 | Ga0209589_1000013 | Ga0209589_1000013105 | 289 |
| 346 | 3300027361 | Ga0209489_100013 | Ga0209489_100013102 | 289 |
| 347 | 3300027363 | Ga0209700_100014 | Ga0209700_100014147 | 289 |
| 348 | 3300028379 | Ga0268266_10225684 | Ga0268266_102256842 | 289 |
| 349 | 3300028381 | Ga0268264_10000427 | Ga0268264_1000042724 | 289 |
| 350 | 3300031507 | Ga0307509_10008331 | Ga0307509_100083318 | 289 |
| 351 | 3300031730 | Ga0307516_10003162 | Ga0307516_100031624 | 289 |
| 352 | 3300035692 | Ga0373935_0282203 | Ga0373935_0282203_194_1114 | 289 |
| 353 | 3300037471 | Ga0395905_0002017 | Ga0395905_0002017_9674_10600 | 289 |
| 354 | 3300038443 | Ga0395901_0244397 | Ga0395901_0244397_700_1626 | 289 |
| 355 | 3300039438 | Ga0436360_1017435 | Ga0436360_1017435_571_1491 | 289 |
| 356 | 3300039447 | Ga0436361_1109572 | Ga0436361_1109572_2988_3908 | 289 |
| 357 | 3300044658 | Ga0466972_0000379 | Ga0466972_0000379_13906_14826 | 289 |
| 358 | 3300044683 | Ga0466965_0007271 | Ga0466965_0007271_4088_5014 | 289 |
| 359 | 3300044684 | Ga0466966_0066402 | Ga0466966_0066402_1327_2247 | 289 |
| 360 | 3300044765 | Ga0466970_0062594 | Ga0466970_0062594_127_1047 | 289 |
| 361 | 3300045049 | Ga0466959_0167464 | Ga0466959_0167464_538_1458 | 289 |
| 362 | 3300046459 | Ga0495629_0009642 | Ga0495629_0009642_6051_6971 | 289 |
| 363 | 3300046461 | Ga0495641_0024733 | Ga0495641_0024733_1717_2637 | 289 |
| 364 | 3300046462 | Ga0495651_0009075 | Ga0495651_0009075_2913_3833 | 289 |
| 365 | 3300046474 | Ga0495605_0053154 | Ga0495605_0053154_145_1071 | 289 |
| 366 | 3300046474 | Ga0495605_0095462 | Ga0495605_0095462_277_1203 | 289 |
| 367 | 3300046476 | Ga0495662_0070165 | Ga0495662_0070165_764_1684 | 289 |
| 368 | 3300046507 | Ga0495606_0012187 | Ga0495606_0012187_5377_6297 | 289 |
| 369 | 3300046507 | Ga0495606_0096551 | Ga0495606_0096551_180_1106 | 289 |
| 370 | 3300046507 | Ga0495606_0163391 | Ga0495606_0163391_278_1204 | 289 |
| 371 | 3300046511 | Ga0495608_0109310 | Ga0495608_0109310_791_1711 | 289 |
| 372 | 3300046512 | Ga0495610_0112751 | Ga0495610_0112751_262_1188 | 289 |
| 373 | 3300046514 | Ga0495618_0149403 | Ga0495618_0149403_380_1300 | 289 |
| 374 | 3300046515 | Ga0495620_0059664 | Ga0495620_0059664_626_1552 | 289 |
| 375 | 3300046516 | Ga0495628_0065385 | Ga0495628_0065385_1571_2491 | 289 |
| 376 | 3300046519 | Ga0495632_0068042 | Ga0495632_0068042_625_1545 | 289 |
| 377 | 3300046524 | Ga0495648_0018141 | Ga0495648_0018141_96_1016 | 289 |
| 378 | 3300046529 | Ga0495652_0029126 | Ga0495652_0029126_2564_3484 | 289 |
| 379 | 3300046557 | Ga0495622_0067036 | Ga0495622_0067036_124_1044 | 289 |
| 380 | 3300046616 | Ga0495668_0023978 | Ga0495668_0023978_335_1261 | 289 |
| 381 | 3300046642 | Ga0495634_0021715 | Ga0495634_0021715_46_966 | 289 |
| 382 | 3300046648 | Ga0495611_0061777 | Ga0495611_0061777_76_1002 | 289 |
| 383 | 3300046660 | Ga0495625_0227519 | Ga0495625_0227519_88_1014 | 289 |
| 384 | 3300046663 | Ga0495635_0004842 | Ga0495635_0004842_5871_6791 | 289 |
| 385 | 3300046674 | Ga0495588_0041708 | Ga0495588_0041708_1306_2232 | 289 |
| 386 | 3300046675 | Ga0495657_0011053 | Ga0495657_0011053_98_1018 | 289 |
| 387 | 3300046689 | Ga0495613_0033921 | Ga0495613_0033921_148_1068 | 289 |
| 388 | 3300046690 | Ga0495624_0047370 | Ga0495624_0047370_545_1465 | 289 |
| 389 | 3300046694 | Ga0495649_0069464 | Ga0495649_0069464_391_1311 | 289 |
| 390 | 3300046694 | Ga0495649_0127110 | Ga0495649_0127110_164_1090 | 289 |
| 391 | 3300046794 | Ga0495589_0109607 | Ga0495589_0109607_325_1251 | 289 |
| 392 | 3300047317 | Ga0495604_0250197 | Ga0495604_0250197_144_1064 | 289 |
| 393 | 3300047321 | Ga0495676_0066462 | Ga0495676_0066462_54_974 | 289 |
| 394 | 3300047323 | Ga0495683_0091545 | Ga0495683_0091545_361_1281 | 289 |
| 395 | 3300047323 | Ga0495683_0118852 | Ga0495683_0118852_164_1090 | 289 |
| 396 | 3300047443 | Ga0495687_051820 | Ga0495687_051820_530_1450 | 289 |
| 397 | 3300047469 | Ga0495673_0076645 | Ga0495673_0076645_71_991 | 289 |
| 398 | 3300047472 | Ga0495686_0176683 | Ga0495686_0176683_196_1116 | 289 |
| 399 | 3300047673 | Ga0495593_0015375 | Ga0495593_0015375_3323_4243 | 289 |
| 400 | 3300048088 | Ga0495602_0099797 | Ga0495602_0099797_210_1130 | 289 |
| 401 | 3300048905 | Ga0496102_0010375 | Ga0496102_0010375_710_1636 | 289 |
| 402 | 3300048905 | Ga0496102_0542151 | Ga0496102_0542151_14_934 | 289 |
| 403 | 3300048906 | Ga0496103_0042314 | Ga0496103_0042314_1609_2535 | 289 |
| 404 | 3300048907 | Ga0496104_0009643 | Ga0496104_0009643_2831_3751 | 289 |
| 405 | 3300048907 | Ga0496104_0096355 | Ga0496104_0096355_1080_2006 | 289 |
| 406 | 3300048907 | Ga0496104_0173252 | Ga0496104_0173252_31_957 | 289 |
| 407 | 3300048908 | Ga0496105_0001282 | Ga0496105_0001282_14517_15437 | 289 |
| 408 | 3300048908 | Ga0496105_0021873 | Ga0496105_0021873_3999_4925 | 289 |
| 409 | 3300048909 | Ga0496106_0004573 | Ga0496106_0004573_6055_6975 | 289 |
| 410 | 3300048910 | Ga0496107_0121175 | Ga0496107_0121175_600_1526 | 289 |
| 411 | 3300048911 | Ga0496108_0014136 | Ga0496108_0014136_31_957 | 289 |
| 412 | 3300048911 | Ga0496108_0295265 | Ga0496108_0295265_357_1277 | 289 |
| 413 | 3300048912 | Ga0496109_0559708 | Ga0496109_0559708_110_1036 | 289 |
| 414 | 3300048915 | Ga0496112_0094296 | Ga0496112_0094296_257_1183 | 289 |
| 415 | 3300048915 | Ga0496112_0356293 | Ga0496112_0356293_395_1321 | 289 |
| 416 | 3300048915 | Ga0496112_0579863 | Ga0496112_0579863_47_967 | 289 |
| 417 | 3300048916 | Ga0496113_0042679 | Ga0496113_0042679_702_1628 | 289 |
| 418 | 3300048916 | Ga0496113_0106656 | Ga0496113_0106656_909_1829 | 289 |
| 419 | 3300048917 | Ga0496114_0160893 | Ga0496114_0160893_876_1802 | 289 |
| 420 | 3300048918 | Ga0496115_0023575 | Ga0496115_0023575_1500_2420 | 289 |
| 421 | 3300048920 | Ga0496117_0022077 | Ga0496117_0022077_3684_4604 | 289 |
| 422 | 3300048920 | Ga0496117_0032945 | Ga0496117_0032945_2136_3062 | 289 |
| 423 | 3300048920 | Ga0496117_0178615 | Ga0496117_0178615_109_1032 | 289 |
| 424 | 3300048921 | Ga0496118_0009370 | Ga0496118_0009370_5405_6325 | 289 |
| 425 | 3300048921 | Ga0496118_0025163 | Ga0496118_0025163_4146_5072 | 289 |
| 426 | 3300048921 | Ga0496118_0027761 | Ga0496118_0027761_1781_2707 | 289 |
| 427 | 3300048921 | Ga0496118_0121932 | Ga0496118_0121932_683_1603 | 289 |
| 428 | 3300048924 | Ga0496121_0007387 | Ga0496121_0007387_3612_4532 | 289 |
| 429 | 3300048924 | Ga0496121_0034792 | Ga0496121_0034792_119_1045 | 289 |
| 430 | 3300048927 | Ga0496124_0009342 | Ga0496124_0009342_5587_6507 | 289 |
| 431 | 3300048927 | Ga0496124_0128971 | Ga0496124_0128971_484_1407 | 289 |
| 432 | 3300048927 | Ga0496124_0138668 | Ga0496124_0138668_942_1868 | 289 |
| 433 | 3300048928 | Ga0496125_0032119 | Ga0496125_0032119_3600_4520 | 289 |
| 434 | 3300048928 | Ga0496125_0054903 | Ga0496125_0054903_1294_2220 | 289 |
| 435 | 3300048928 | Ga0496125_0154710 | Ga0496125_0154710_350_1270 | 289 |
| 436 | 3300048929 | Ga0496126_0131194 | Ga0496126_0131194_720_1640 | 289 |
| 437 | 3300049460 | Ga0495682_0064865 | Ga0495682_0064865_26_946 | 289 |
| 438 | 3300049460 | Ga0495682_0081205 | Ga0495682_0081205_56_976 | 289 |
| 439 | 3300050489 | nmdc:mga03683_65802_c1 | nmdc:mga03683_65802_c1_465_1391 | 289 |
| 440 | 3300050491 | nmdc:mga00v17_42456_c1 | nmdc:mga00v17_42456_c1_1749_2675 | 289 |
| 441 | 3300050492 | nmdc:mga0yw44_49759_c1 | nmdc:mga0yw44_49759_c1_159_1085 | 289 |
| 442 | 3300050495 | nmdc:mga04h51_30296_c1 | nmdc:mga04h51_30296_c1_80_1006 | 289 |
| 443 | 3300050516 | nmdc:mga0sz30_27654_c1 | nmdc:mga0sz30_27654_c1_373_1299 | 289 |
| 444 | 3300053079 | Ga0500610_0124829 | Ga0500610_0124829_95_1015 | 289 |
| 445 | 3300053093 | Ga0500651_0092785 | Ga0500651_0092785_74_994 | 289 |
| 446 | 3300053109 | Ga0500569_002085 | Ga0500569_002085_950_1870 | 289 |
| 447 | 3300053111 | Ga0500572_001690 | Ga0500572_001690_807_1727 | 289 |
| 448 | 3300053119 | Ga0500595_038197 | Ga0500595_038197_53_973 | 289 |
| 449 | 3300053122 | Ga0500608_046559 | Ga0500608_046559_726_1646 | 289 |
| 450 | 3300053136 | Ga0500559_0032191 | Ga0500559_0032191_1088_2008 | 289 |
| 451 | 3300053146 | Ga0500588_0009637 | Ga0500588_0009637_537_1457 | 289 |
| 452 | 3300053154 | Ga0500619_040921 | Ga0500619_040921_459_1379 | 289 |
| 453 | 3300053155 | Ga0500620_005953 | Ga0500620_005953_1163_2083 | 289 |
| 454 | 3300053177 | Ga0500636_0001687 | Ga0500636_0001687_4927_5847 | 289 |
| 455 | 3300053737 | Ga0500601_000485 | Ga0500601_000485_316_1236 | 289 |
| 456 | iso_pu_bacteria | 2513237096 | 2513653734 | 289 |
| 457 | iso_pu_bacteria | 2513237098 | 2513672618 | 289 |
| 458 | iso_pu_bacteria | 2513237101 | 2513693667 | 289 |
| 459 | iso_pu_bacteria | 2513237137 | 2513856174 | 289 |
| 460 | iso_pu_bacteria | 2513237145 | 2513918074 | 289 |
| 461 | iso_pu_bacteria | 2517572143 | 2517891686 | 289 |
| 462 | iso_pu_bacteria | 2524023210 | 2524468782 | 289 |
| 463 | iso_pu_bacteria | 2667528175 | 2671118544 | 289 |
| 464 | iso_pu_bacteria | 2721755755 | 2723843561 | 289 |
| 465 | iso_pu_bacteria | 2744054633 | 2745076455 | 289 |
| 466 | iso_pu_bacteria | 2791355197 | 2793067060 | 289 |
| 467 | iso_pu_bacteria | 2824704595 | 2824707081 | 289 |
| 468 | iso_pu_bacteria | 2824753945 | 2824756454 | 289 |
| 469 | iso_pu_bacteria | 2824763712 | 2824765948 | 289 |
| 470 | iso_pu_bacteria | 2848858292 | 2848861632 | 289 |
| 471 | iso_pu_bacteria | 2874604998 | 2874611530 | 289 |
| 472 | iso_pu_bacteria | 2876808645 | 2876816589 | 289 |
| 473 | iso_pu_bacteria | 2879110137 | 2879114975 | 289 |
| 474 | iso_pu_bacteria | 2885374607 | 2885381016 | 289 |
| 475 | iso_pu_bacteria | 2885383462 | 2885387775 | 289 |
| 476 | iso_pu_bacteria | 2897803580 | 2897806596 | 289 |
| 477 | iso_pu_bacteria | 2903748898 | 2903755394 | 289 |
| 478 | iso_pu_bacteria | 2903768456 | 2903768493 | 289 |
| 479 | iso_pu_bacteria | 2904690495 | 2904698503 | 289 |
| 480 | iso_pu_bacteria | 2904699407 | 2904704558 | 289 |
| 481 | iso_pu_bacteria | 2904711408 | 2904715321 | 289 |
| 482 | iso_pu_bacteria | 2906610324 | 2906616861 | 289 |
| 483 | iso_pu_bacteria | 2906635258 | 2906642900 | 289 |
| 484 | iso_pu_bacteria | 2906660503 | 2906667190 | 289 |
| 485 | iso_pu_bacteria | 2908739725 | 2908742048 | 289 |
| 486 | iso_pu_bacteria | 2908756301 | 2908762485 | 289 |
| 487 | iso_pu_bacteria | 2922361189 | 2922361817 | 289 |
| 488 | iso_pu_bacteria | 2922425934 | 2922431066 | 289 |
| 489 | iso_pu_bacteria | 2935630451 | 2935636938 | 289 |
| 490 | iso_pu_bacteria | 2941507105 | 2941513606 | 289 |
| 491 | iso_pu_bacteria | 2941515067 | 2941521538 | 289 |
| 492 | iso_pu_bacteria | 2941523033 | 2941529292 | 289 |
| 493 | iso_pu_bacteria | 3005474847 | 3005480889 | 289 |
| 494 | iso_pu_bacteria | 3005710791 | 3005717975 | 289 |
| 495 | iso_pu_bacteria | 8006933436 | 8006939829 | 289 |
| 496 | iso_pu_bacteria | 8006964411 | 8006966927 | 289 |
| 497 | iso_pu_bacteria | 8006973647 | 8006979598 | 289 |
| 498 | iso_pu_bacteria | 8006994254 | 8006994564 | 289 |
| 499 | iso_pu_bacteria | 8019555841 | 8019565729 | 289 |
| 500 | iso_pu_bacteria | 8019565922 | 8019575819 | 289 |
| 501 | iso_pu_bacteria | 8056681323 | 8056687279 | 289 |
| 502 | iso_pu_bacteria | 8056689827 | 8056690656 | 289 |
| 503 | 3300003215 | JGI25153J46596_10000105 | JGI25153J46596_1000010529 | 290 |
| 504 | 3300003215 | JGI25153J46596_10007823 | JGI25153J46596_100078233 | 290 |
| 505 | 3300003752 | Ga0055539_1002679 | Ga0055539_10026792 | 290 |
| 506 | 3300003752 | Ga0055539_1002682 | Ga0055539_10026822 | 290 |
| 507 | 3300003794 | Ga0055531_10025464 | Ga0055531_100254642 | 290 |
| 508 | 3300005339 | Ga0070660_100376074 | Ga0070660_1003760741 | 290 |
| 509 | 3300005436 | Ga0070713_100046001 | Ga0070713_1000460012 | 290 |
| 510 | 3300005547 | Ga0070693_100224813 | Ga0070693_1002248131 | 290 |
| 511 | 3300006028 | Ga0070717_10022548 | Ga0070717_100225482 | 290 |
| 512 | 3300006038 | Ga0075365_10098482 | Ga0075365_100984822 | 290 |
| 513 | 3300006038 | Ga0075365_10261915 | Ga0075365_102619152 | 290 |
| 514 | 3300006051 | Ga0075364_10087117 | Ga0075364_100871172 | 290 |
| 515 | 3300006178 | Ga0075367_10048405 | Ga0075367_100484052 | 290 |
| 516 | 3300006353 | Ga0075370_10062777 | Ga0075370_100627772 | 290 |
| 517 | 3300009093 | Ga0105240_10001377 | Ga0105240_1000137712 | 290 |
| 518 | 3300009174 | Ga0105241_10065494 | Ga0105241_100654942 | 290 |
| 519 | 3300009545 | Ga0105237_10001208 | Ga0105237_1000120817 | 290 |
| 520 | 3300010375 | Ga0105239_10145846 | Ga0105239_101458462 | 290 |
| 521 | 3300010375 | Ga0105239_10276648 | Ga0105239_102766482 | 290 |
| 522 | 3300014969 | Ga0157376_10154755 | Ga0157376_101547552 | 290 |
| 523 | 3300025230 | Ga0209563_102362 | Ga0209563_1023622 | 290 |
| 524 | 3300025253 | Ga0209677_100691 | Ga0209677_1006918 | 290 |
| 525 | 3300025253 | Ga0209677_102123 | Ga0209677_1021234 | 290 |
| 526 | 3300025254 | Ga0209148_1004493 | Ga0209148_10044932 | 290 |
| 527 | 3300025272 | Ga0209455_1001057 | Ga0209455_10010573 | 290 |
| 528 | 3300025297 | Ga0209758_1000279 | Ga0209758_100027963 | 290 |
| 529 | 3300025297 | Ga0209758_1009765 | Ga0209758_10097653 | 290 |
| 530 | 3300025911 | Ga0207654_10041269 | Ga0207654_100412692 | 290 |
| 531 | 3300025913 | Ga0207695_10000062 | Ga0207695_1000006212 | 290 |
| 532 | 3300025914 | Ga0207671_10005186 | Ga0207671_100051868 | 290 |
| 533 | 3300025919 | Ga0207657_10099048 | Ga0207657_100990482 | 290 |
| 534 | 3300025928 | Ga0207700_10005941 | Ga0207700_100059415 | 290 |
| 535 | 3300025929 | Ga0207664_10036433 | Ga0207664_100364332 | 290 |
| 536 | 3300026142 | Ga0207698_10097054 | Ga0207698_100970542 | 290 |
| 537 | 3300031456 | Ga0307513_10040069 | Ga0307513_100400692 | 290 |
| 538 | 3300031616 | Ga0307508_10000005 | Ga0307508_10000005172 | 290 |
| 539 | 3300031911 | Ga0307412_10063280 | Ga0307412_100632802 | 290 |
| 540 | 3300031911 | Ga0307412_10258062 | Ga0307412_102580622 | 290 |
| 541 | 3300033180 | Ga0307510_10005064 | Ga0307510_1000506411 | 290 |
| 542 | 3300033544 | Ga0316215_1003066 | Ga0316215_10030662 | 290 |
| 543 | 3300039437 | Ga0436365_0483596 | Ga0436365_0483596_345_1268 | 290 |
| 544 | 3300039437 | Ga0436365_0548581 | Ga0436365_0548581_816_1739 | 290 |
| 545 | 3300039437 | Ga0436365_1083476 | Ga0436365_1083476_1105_2028 | 290 |
| 546 | 3300039437 | Ga0436365_1266449 | Ga0436365_1266449_81_1004 | 290 |
| 547 | 3300044842 | Ga0466957_0120968 | Ga0466957_0120968_431_1354 | 290 |
| 548 | 3300046460 | Ga0495638_0007148 | Ga0495638_0007148_4881_5804 | 290 |
| 549 | 3300046460 | Ga0495638_0009289 | Ga0495638_0009289_991_1914 | 290 |
| 550 | 3300046460 | Ga0495638_0011434 | Ga0495638_0011434_1405_2328 | 290 |
| 551 | 3300046462 | Ga0495651_0011197 | Ga0495651_0011197_1048_1971 | 290 |
| 552 | 3300046500 | Ga0495596_0065457 | Ga0495596_0065457_383_1306 | 290 |
| 553 | 3300046516 | Ga0495628_0061546 | Ga0495628_0061546_1412_2335 | 290 |
| 554 | 3300046522 | Ga0495643_0100003 | Ga0495643_0100003_396_1319 | 290 |
| 555 | 3300046533 | Ga0495640_0054820 | Ga0495640_0054820_1345_2268 | 290 |
| 556 | 3300046543 | Ga0495645_0071672 | Ga0495645_0071672_92_1015 | 290 |
| 557 | 3300046558 | Ga0495633_0120241 | Ga0495633_0120241_90_1013 | 290 |
| 558 | 3300046665 | Ga0495661_0028475 | Ga0495661_0028475_1288_2211 | 290 |
| 559 | 3300046674 | Ga0495588_0125435 | Ga0495588_0125435_61_984 | 290 |
| 560 | 3300046675 | Ga0495657_0048554 | Ga0495657_0048554_747_1670 | 290 |
| 561 | 3300046809 | Ga0495600_0048122 | Ga0495600_0048122_442_1365 | 290 |
| 562 | 3300046810 | Ga0495660_0039967 | Ga0495660_0039967_333_1256 | 290 |
| 563 | 3300047317 | Ga0495604_0006962 | Ga0495604_0006962_2235_3158 | 290 |
| 564 | 3300047472 | Ga0495686_0044421 | Ga0495686_0044421_1282_2205 | 290 |
| 565 | 3300048088 | Ga0495602_0025670 | Ga0495602_0025670_1187_2110 | 290 |
| 566 | 3300048909 | Ga0496106_0136665 | Ga0496106_0136665_987_1910 | 290 |
| 567 | 3300048911 | Ga0496108_0263919 | Ga0496108_0263919_253_1176 | 290 |
| 568 | 3300048919 | Ga0496116_0005676 | Ga0496116_0005676_3055_3978 | 290 |
| 569 | 3300048920 | Ga0496117_0016833 | Ga0496117_0016833_4329_5252 | 290 |
| 570 | 3300048921 | Ga0496118_0018348 | Ga0496118_0018348_4172_5095 | 290 |
| 571 | 3300048921 | Ga0496118_0103167 | Ga0496118_0103167_274_1197 | 290 |
| 572 | 3300048921 | Ga0496118_0128202 | Ga0496118_0128202_202_1125 | 290 |
| 573 | 3300048922 | Ga0496119_0053547 | Ga0496119_0053547_472_1395 | 290 |
| 574 | 3300048922 | Ga0496119_0090613 | Ga0496119_0090613_385_1308 | 290 |
| 575 | 3300048924 | Ga0496121_0019469 | Ga0496121_0019469_705_1628 | 290 |
| 576 | 3300048924 | Ga0496121_0024693 | Ga0496121_0024693_4624_5547 | 290 |
| 577 | 3300048924 | Ga0496121_0047342 | Ga0496121_0047342_2647_3567 | 290 |
| 578 | 3300048924 | Ga0496121_0159771 | Ga0496121_0159771_532_1455 | 290 |
| 579 | 3300048924 | Ga0496121_0192408 | Ga0496121_0192408_190_1113 | 290 |
| 580 | 3300048924 | Ga0496121_0239198 | Ga0496121_0239198_176_1099 | 290 |
| 581 | 3300048925 | Ga0496122_0101586 | Ga0496122_0101586_310_1233 | 290 |
| 582 | 3300048926 | Ga0496123_0007052 | Ga0496123_0007052_4041_4964 | 290 |
| 583 | 3300048927 | Ga0496124_0027280 | Ga0496124_0027280_3853_4776 | 290 |
| 584 | 3300048928 | Ga0496125_0002440 | Ga0496125_0002440_1908_2831 | 290 |
| 585 | 3300048929 | Ga0496126_0136815 | Ga0496126_0136815_177_1100 | 290 |
| 586 | 3300048929 | Ga0496126_0309918 | Ga0496126_0309918_102_1022 | 290 |
| 587 | 3300050492 | nmdc:mga0yw44_3568_c1 | nmdc:mga0yw44_3568_c1_2171_3094 | 290 |
| 588 | 3300050494 | nmdc:mga06z11_28127_c1 | nmdc:mga06z11_28127_c1_359_1282 | 290 |
| 589 | 3300050496 | nmdc:mga07m45_28678_c1 | nmdc:mga07m45_28678_c1_662_1585 | 290 |
| 590 | 3300050516 | nmdc:mga0sz30_6834_c1 | nmdc:mga0sz30_6834_c1_3041_3964 | 290 |
| 591 | 3300053086 | Ga0500578_0060593 | Ga0500578_0060593_453_1376 | 290 |
| 592 | 3300053086 | Ga0500578_0135632 | Ga0500578_0135632_300_1223 | 290 |
| 593 | 3300053088 | Ga0500644_0026428 | Ga0500644_0026428_66_989 | 290 |
| 594 | 3300053090 | Ga0500646_0063354 | Ga0500646_0063354_42_965 | 290 |
| 595 | 3300053091 | Ga0500647_0004251 | Ga0500647_0004251_3586_4509 | 290 |
| 596 | 3300053093 | Ga0500651_0026539 | Ga0500651_0026539_1473_2396 | 290 |
| 597 | 3300053093 | Ga0500651_0117077 | Ga0500651_0117077_360_1283 | 290 |
| 598 | 3300053094 | Ga0500566_0000535 | Ga0500566_0000535_16334_17257 | 290 |
| 599 | 3300053094 | Ga0500566_0000789 | Ga0500566_0000789_15406_16329 | 290 |
| 600 | 3300053094 | Ga0500566_0162376 | Ga0500566_0162376_48_971 | 290 |
| 601 | 3300053098 | Ga0500650_0000946 | Ga0500650_0000946_6623_7546 | 290 |
| 602 | 3300053103 | Ga0500555_010172 | Ga0500555_010172_573_1496 | 290 |
| 603 | 3300053104 | Ga0500556_0000015 | Ga0500556_0000015_43589_44512 | 290 |
| 604 | 3300053105 | Ga0500557_000158 | Ga0500557_000158_4941_5864 | 290 |
| 605 | 3300053108 | Ga0500562_052525 | Ga0500562_052525_55_978 | 290 |
| 606 | 3300053109 | Ga0500569_004768 | Ga0500569_004768_171_1094 | 290 |
| 607 | 3300053116 | Ga0500592_001525 | Ga0500592_001525_365_1288 | 290 |
| 608 | 3300053117 | Ga0500593_065947 | Ga0500593_065947_154_1077 | 290 |
| 609 | 3300053118 | Ga0500594_0072310 | Ga0500594_0072310_52_975 | 290 |
| 610 | 3300053122 | Ga0500608_013258 | Ga0500608_013258_2653_3576 | 290 |
| 611 | 3300053125 | Ga0500618_007080 | Ga0500618_007080_1018_1941 | 290 |
| 612 | 3300053128 | Ga0500626_114729 | Ga0500626_114729_175_1098 | 290 |
| 613 | 3300053130 | Ga0500642_0000044 | Ga0500642_0000044_42836_43759 | 290 |
| 614 | 3300053130 | Ga0500642_0000350 | Ga0500642_0000350_3594_4517 | 290 |
| 615 | 3300053130 | Ga0500642_0001189 | Ga0500642_0001189_1573_2529 | 290 |
| 616 | 3300053131 | Ga0500652_000638 | Ga0500652_000638_9323_10246 | 290 |
| 617 | 3300053136 | Ga0500559_0000130 | Ga0500559_0000130_45119_46042 | 290 |
| 618 | 3300053136 | Ga0500559_0011384 | Ga0500559_0011384_1434_2357 | 290 |
| 619 | 3300053139 | Ga0500568_0000661 | Ga0500568_0000661_6003_6926 | 290 |
| 620 | 3300053139 | Ga0500568_0053418 | Ga0500568_0053418_252_1208 | 290 |
| 621 | 3300053145 | Ga0500586_001145 | Ga0500586_001145_1878_2801 | 290 |
| 622 | 3300053151 | Ga0500604_0001929 | Ga0500604_0001929_3220_4143 | 290 |
| 623 | 3300053151 | Ga0500604_0003770 | Ga0500604_0003770_1220_2176 | 290 |
| 624 | 3300053151 | Ga0500604_0009113 | Ga0500604_0009113_417_1340 | 290 |
| 625 | 3300053153 | Ga0500616_0000041 | Ga0500616_0000041_185817_186740 | 290 |
| 626 | 3300053153 | Ga0500616_0000666 | Ga0500616_0000666_12952_13908 | 290 |
| 627 | 3300053153 | Ga0500616_0100401 | Ga0500616_0100401_333_1256 | 290 |
| 628 | 3300053156 | Ga0500622_0000700 | Ga0500622_0000700_11342_12265 | 290 |
| 629 | 3300053156 | Ga0500622_0030723 | Ga0500622_0030723_769_1692 | 290 |
| 630 | 3300053177 | Ga0500636_0000323 | Ga0500636_0000323_21362_22285 | 290 |
| 631 | 3300053729 | Ga0500625_000845 | Ga0500625_000845_4530_5453 | 290 |
| 632 | iso_pu_bacteria | 8019638758 | 8019640110 | 290 |
| 633 | 3300003215 | JGI25153J46596_10003262 | JGI25153J46596_100032626 | 291 |
| 634 | 3300003659 | JGI25404J52841_10023826 | JGI25404J52841_100238261 | 291 |
| 635 | 3300005347 | Ga0070668_100361795 | Ga0070668_1003617952 | 291 |
| 636 | 3300005347 | Ga0070668_100419586 | Ga0070668_1004195862 | 291 |
| 637 | 3300005434 | Ga0070709_10008434 | Ga0070709_100084347 | 291 |
| 638 | 3300005434 | Ga0070709_10035454 | Ga0070709_100354542 | 291 |
| 639 | 3300005435 | Ga0070714_100002875 | Ga0070714_1000028752 | 291 |
| 640 | 3300005435 | Ga0070714_100096779 | Ga0070714_1000967792 | 291 |
| 641 | 3300005436 | Ga0070713_100009905 | Ga0070713_1000099052 | 291 |
| 642 | 3300005436 | Ga0070713_100085089 | Ga0070713_1000850892 | 291 |
| 643 | 3300005436 | Ga0070713_100409784 | Ga0070713_1004097842 | 291 |
| 644 | 3300005437 | Ga0070710_10000878 | Ga0070710_1000087811 | 291 |
| 645 | 3300005437 | Ga0070710_10008549 | Ga0070710_100085492 | 291 |
| 646 | 3300005437 | Ga0070710_10016869 | Ga0070710_100168692 | 291 |
| 647 | 3300005439 | Ga0070711_100003170 | Ga0070711_1000031704 | 291 |
| 648 | 3300005439 | Ga0070711_100011213 | Ga0070711_1000112138 | 291 |
| 649 | 3300005455 | Ga0070663_100016609 | Ga0070663_1000166092 | 291 |
| 650 | 3300005456 | Ga0070678_100058738 | Ga0070678_1000587382 | 291 |
| 651 | 3300005614 | Ga0068856_100000565 | Ga0068856_10000056539 | 291 |
| 652 | 3300005617 | Ga0068859_100055772 | Ga0068859_1000557722 | 291 |
| 653 | 3300005843 | Ga0068860_100409619 | Ga0068860_1004096191 | 291 |
| 654 | 3300005937 | Ga0081455_10009013 | Ga0081455_100090137 | 291 |
| 655 | 3300005937 | Ga0081455_10016971 | Ga0081455_100169712 | 291 |
| 656 | 3300005983 | Ga0081540_1006548 | Ga0081540_10065487 | 291 |
| 657 | 3300005983 | Ga0081540_1014475 | Ga0081540_10144752 | 291 |
| 658 | 3300005983 | Ga0081540_1024577 | Ga0081540_10245774 | 291 |
| 659 | 3300005983 | Ga0081540_1054592 | Ga0081540_10545922 | 291 |
| 660 | 3300005983 | Ga0081540_1066793 | Ga0081540_10667931 | 291 |
| 661 | 3300006028 | Ga0070717_10003746 | Ga0070717_100037462 | 291 |
| 662 | 3300006028 | Ga0070717_10186877 | Ga0070717_101868772 | 291 |
| 663 | 3300006048 | Ga0075363_100002208 | Ga0075363_1000022082 | 291 |
| 664 | 3300006051 | Ga0075364_10089456 | Ga0075364_100894562 | 291 |
| 665 | 3300006173 | Ga0070716_100053095 | Ga0070716_1000530953 | 291 |
| 666 | 3300006173 | Ga0070716_100059332 | Ga0070716_1000593321 | 291 |
| 667 | 3300006173 | Ga0070716_100270183 | Ga0070716_1002701831 | 291 |
| 668 | 3300006175 | Ga0070712_100002086 | Ga0070712_1000020864 | 291 |
| 669 | 3300006175 | Ga0070712_100009781 | Ga0070712_1000097814 | 291 |
| 670 | 3300006177 | Ga0075362_10116617 | Ga0075362_101166171 | 291 |
| 671 | 3300006178 | Ga0075367_10004480 | Ga0075367_100044803 | 291 |
| 672 | 3300006195 | Ga0075366_10146737 | Ga0075366_101467371 | 291 |
| 673 | 3300006353 | Ga0075370_10022744 | Ga0075370_100227442 | 291 |
| 674 | 3300006353 | Ga0075370_10215602 | Ga0075370_102156022 | 291 |
| 675 | 3300006931 | Ga0097620_100055772 | Ga0097620_1000557722 | 291 |
| 676 | 3300009101 | Ga0105247_10031063 | Ga0105247_100310632 | 291 |
| 677 | 3300009545 | Ga0105237_10119254 | Ga0105237_101192542 | 291 |
| 678 | 3300009551 | Ga0105238_10424344 | Ga0105238_104243442 | 291 |
| 679 | 3300013297 | Ga0157378_10477016 | Ga0157378_104770161 | 291 |
| 680 | 3300021384 | Ga0213876_10003521 | Ga0213876_100035212 | 291 |
| 681 | 3300025254 | Ga0209148_1000409 | Ga0209148_100040931 | 291 |
| 682 | 3300025272 | Ga0209455_1001295 | Ga0209455_10012957 | 291 |
| 683 | 3300025297 | Ga0209758_1014240 | Ga0209758_10142402 | 291 |
| 684 | 3300025898 | Ga0207692_10000970 | Ga0207692_100009706 | 291 |
| 685 | 3300025898 | Ga0207692_10034089 | Ga0207692_100340891 | 291 |
| 686 | 3300025900 | Ga0207710_10108566 | Ga0207710_101085661 | 291 |
| 687 | 3300025906 | Ga0207699_10000882 | Ga0207699_100008825 | 291 |
| 688 | 3300025906 | Ga0207699_10010703 | Ga0207699_100107032 | 291 |
| 689 | 3300025906 | Ga0207699_10194122 | Ga0207699_101941221 | 291 |
| 690 | 3300025907 | Ga0207645_10076729 | Ga0207645_100767292 | 291 |
| 691 | 3300025914 | Ga0207671_10030621 | Ga0207671_100306212 | 291 |
| 692 | 3300025915 | Ga0207693_10006903 | Ga0207693_100069037 | 291 |
| 693 | 3300025915 | Ga0207693_10012697 | Ga0207693_100126976 | 291 |
| 694 | 3300025915 | Ga0207693_10023028 | Ga0207693_100230282 | 291 |
| 695 | 3300025916 | Ga0207663_10006825 | Ga0207663_100068258 | 291 |
| 696 | 3300025916 | Ga0207663_10110225 | Ga0207663_101102252 | 291 |
| 697 | 3300025916 | Ga0207663_10133416 | Ga0207663_101334162 | 291 |
| 698 | 3300025923 | Ga0207681_10272009 | Ga0207681_102720091 | 291 |
| 699 | 3300025924 | Ga0207694_10239942 | Ga0207694_102399422 | 291 |
| 700 | 3300025928 | Ga0207700_10010828 | Ga0207700_100108283 | 291 |
| 701 | 3300025928 | Ga0207700_10122782 | Ga0207700_101227822 | 291 |
| 702 | 3300025929 | Ga0207664_10231022 | Ga0207664_102310222 | 291 |
| 703 | 3300025929 | Ga0207664_10332861 | Ga0207664_103328612 | 291 |
| 704 | 3300025931 | Ga0207644_10373351 | Ga0207644_103733511 | 291 |
| 705 | 3300026067 | Ga0207678_10031834 | Ga0207678_100318342 | 291 |
| 706 | 3300026067 | Ga0207678_10166924 | Ga0207678_101669242 | 291 |
| 707 | 3300026078 | Ga0207702_10000056 | Ga0207702_1000005670 | 291 |
| 708 | 3300026121 | Ga0207683_10036663 | Ga0207683_100366632 | 291 |
| 709 | 3300028379 | Ga0268266_10002834 | Ga0268266_1000283410 | 291 |
| 710 | 3300031250 | Ga0265331_10014277 | Ga0265331_100142773 | 291 |
| 711 | 3300031711 | Ga0265314_10014228 | Ga0265314_100142284 | 291 |
| 712 | 3300031712 | Ga0265342_10010476 | Ga0265342_100104763 | 291 |
| 713 | 3300035086 | Ga0373934_0036408 | Ga0373934_0036408_958_1884 | 291 |
| 714 | 3300035089 | Ga0373944_0018322 | Ga0373944_0018322_1022_1948 | 291 |
| 715 | 3300035113 | Ga0373936_0017441 | Ga0373936_0017441_106_1032 | 291 |
| 716 | 3300035410 | Ga0373924_0024809 | Ga0373924_0024809_584_1510 | 291 |
| 717 | 3300035692 | Ga0373935_0218646 | Ga0373935_0218646_353_1279 | 291 |
| 718 | 3300035695 | Ga0373927_0019055 | Ga0373927_0019055_1790_2716 | 291 |
| 719 | 3300035724 | Ga0373933_0016181 | Ga0373933_0016181_2808_3734 | 291 |
| 720 | 3300036401 | Ga0373937_0066563 | Ga0373937_0066563_488_1414 | 291 |
| 721 | 3300037068 | Ga0373925_0052374 | Ga0373925_0052374_1962_2888 | 291 |
| 722 | 3300037312 | Ga0395899_0102768 | Ga0395899_0102768_915_1838 | 291 |
| 723 | 3300037471 | Ga0395905_0070014 | Ga0395905_0070014_1102_2025 | 291 |
| 724 | 3300039437 | Ga0436365_0954239 | Ga0436365_0954239_28100_29026 | 291 |
| 725 | 3300044684 | Ga0466966_0015387 | Ga0466966_0015387_1774_2700 | 291 |
| 726 | 3300044694 | Ga0466963_0106116 | Ga0466963_0106116_789_1715 | 291 |
| 727 | 3300045049 | Ga0466959_0071705 | Ga0466959_0071705_1009_1935 | 291 |
| 728 | 3300046455 | Ga0495603_0091537 | Ga0495603_0091537_819_1745 | 291 |
| 729 | 3300046462 | Ga0495651_0209969 | Ga0495651_0209969_59_985 | 291 |
| 730 | 3300046473 | Ga0495582_0048994 | Ga0495582_0048994_68_994 | 291 |
| 731 | 3300046475 | Ga0495639_0005148 | Ga0495639_0005148_341_1267 | 291 |
| 732 | 3300046476 | Ga0495662_0159227 | Ga0495662_0159227_35_961 | 291 |
| 733 | 3300046514 | Ga0495618_0014438 | Ga0495618_0014438_400_1326 | 291 |
| 734 | 3300046517 | Ga0495630_0131423 | Ga0495630_0131423_496_1422 | 291 |
| 735 | 3300046524 | Ga0495648_0000325 | Ga0495648_0000325_14054_14980 | 291 |
| 736 | 3300046526 | Ga0495666_0031350 | Ga0495666_0031350_355_1281 | 291 |
| 737 | 3300046529 | Ga0495652_0173645 | Ga0495652_0173645_520_1446 | 291 |
| 738 | 3300046531 | Ga0495665_0049412 | Ga0495665_0049412_632_1558 | 291 |
| 739 | 3300046533 | Ga0495640_0042783 | Ga0495640_0042783_1488_2414 | 291 |
| 740 | 3300046535 | Ga0495586_0252912 | Ga0495586_0252912_19_945 | 291 |
| 741 | 3300046642 | Ga0495634_0021233 | Ga0495634_0021233_3086_4012 | 291 |
| 742 | 3300046680 | Ga0495646_0045629 | Ga0495646_0045629_1716_2642 | 291 |
| 743 | 3300046683 | Ga0495658_0053649 | Ga0495658_0053649_171_1097 | 291 |
| 744 | 3300046690 | Ga0495624_0050832 | Ga0495624_0050832_1361_2287 | 291 |
| 745 | 3300047315 | Ga0495581_0203964 | Ga0495581_0203964_216_1142 | 291 |
| 746 | 3300047317 | Ga0495604_0019089 | Ga0495604_0019089_3201_4127 | 291 |
| 747 | 3300047471 | Ga0495684_0180978 | Ga0495684_0180978_383_1309 | 291 |
| 748 | 3300047673 | Ga0495593_0075965 | Ga0495593_0075965_457_1383 | 291 |
| 749 | 3300048088 | Ga0495602_0130673 | Ga0495602_0130673_550_1476 | 291 |
| 750 | 3300048929 | Ga0496126_0015619 | Ga0496126_0015619_5841_6767 | 291 |
| 751 | 3300048929 | Ga0496126_0043220 | Ga0496126_0043220_2842_3768 | 291 |
| 752 | 3300048929 | Ga0496126_0217990 | Ga0496126_0217990_644_1570 | 291 |
| 753 | 3300049579 | Ga0501043_0184323 | Ga0501043_0184323_608_1537 | 291 |
| 754 | 3300049580 | Ga0501046_0158373 | Ga0501046_0158373_627_1556 | 291 |
| 755 | 3300049589 | Ga0501073_0022793 | Ga0501073_0022793_478_1407 | 291 |
| 756 | 3300049742 | Ga0501080_0016647 | Ga0501080_0016647_5830_6759 | 291 |
| 757 | 3300049823 | Ga0501044_0067293 | Ga0501044_0067293_34_963 | 291 |
| 758 | 3300050493 | nmdc:mga0k408_153964_c1 | nmdc:mga0k408_153964_c1_128_1054 | 291 |
| 759 | 3300050494 | nmdc:mga06z11_4743_c1 | nmdc:mga06z11_4743_c1_1863_2789 | 291 |
| 760 | 3300050496 | nmdc:mga07m45_207352_c1 | nmdc:mga07m45_207352_c1_169_1095 | 291 |
| 761 | 3300050496 | nmdc:mga07m45_24585_c1 | nmdc:mga07m45_24585_c1_1291_2217 | 291 |
| 762 | 3300050516 | nmdc:mga0sz30_90495_c1 | nmdc:mga0sz30_90495_c1_387_1313 | 291 |
| 763 | 3300053080 | Ga0500635_0093259 | Ga0500635_0093259_151_1077 | 291 |
| 764 | 3300053094 | Ga0500566_0002570 | Ga0500566_0002570_5550_6476 | 291 |
| 765 | 3300053111 | Ga0500572_006575 | Ga0500572_006575_1515_2441 | 291 |
| 766 | 3300053115 | Ga0500591_056421 | Ga0500591_056421_738_1664 | 291 |
| 767 | 3300053122 | Ga0500608_033083 | Ga0500608_033083_141_1067 | 291 |
| 768 | 3300053159 | Ga0500630_029223 | Ga0500630_029223_1224_2150 | 291 |
| 769 | 3300053163 | Ga0500639_017207 | Ga0500639_017207_969_1895 | 291 |
| 770 | 3300053177 | Ga0500636_0064500 | Ga0500636_0064500_1091_2029 | 291 |
| 771 | 3300003215 | JGI25153J46596_10004844 | JGI25153J46596_100048445 | 292 |
| 772 | 3300003322 | rootL2_10065592 | rootL2_100655923 | 292 |
| 773 | 3300003354 | JGI25160J50197_1000241 | JGI25160J50197_100024113 | 292 |
| 774 | 3300005337 | Ga0070682_100034163 | Ga0070682_1000341632 | 292 |
| 775 | 3300005347 | Ga0070668_100098907 | Ga0070668_1000989072 | 292 |
| 776 | 3300005347 | Ga0070668_100148041 | Ga0070668_1001480412 | 292 |
| 777 | 3300005367 | Ga0070667_100137643 | Ga0070667_1001376432 | 292 |
| 778 | 3300005438 | Ga0070701_10046931 | Ga0070701_100469311 | 292 |
| 779 | 3300005439 | Ga0070711_100009993 | Ga0070711_1000099933 | 292 |
| 780 | 3300005455 | Ga0070663_100336048 | Ga0070663_1003360481 | 292 |
| 781 | 3300005456 | Ga0070678_100131877 | Ga0070678_1001318772 | 292 |
| 782 | 3300005459 | Ga0068867_100023770 | Ga0068867_1000237702 | 292 |
| 783 | 3300005471 | Ga0070698_100097422 | Ga0070698_1000974222 | 292 |
| 784 | 3300005539 | Ga0068853_100184776 | Ga0068853_1001847762 | 292 |
| 785 | 3300005543 | Ga0070672_100121473 | Ga0070672_1001214732 | 292 |
| 786 | 3300005543 | Ga0070672_100156878 | Ga0070672_1001568782 | 292 |
| 787 | 3300005548 | Ga0070665_100106479 | Ga0070665_1001064792 | 292 |
| 788 | 3300005548 | Ga0070665_100316990 | Ga0070665_1003169902 | 292 |
| 789 | 3300005548 | Ga0070665_100502665 | Ga0070665_1005026651 | 292 |
| 790 | 3300005563 | Ga0068855_100059671 | Ga0068855_1000596714 | 292 |
| 791 | 3300005577 | Ga0068857_100117647 | Ga0068857_1001176473 | 292 |
| 792 | 3300005578 | Ga0068854_100366959 | Ga0068854_1003669592 | 292 |
| 793 | 3300005614 | Ga0068856_100104952 | Ga0068856_1001049523 | 292 |
| 794 | 3300005615 | Ga0070702_100032203 | Ga0070702_1000322032 | 292 |
| 795 | 3300005617 | Ga0068859_100139361 | Ga0068859_1001393612 | 292 |
| 796 | 3300005618 | Ga0068864_100081408 | Ga0068864_1000814081 | 292 |
| 797 | 3300005719 | Ga0068861_100037464 | Ga0068861_1000374643 | 292 |
| 798 | 3300005841 | Ga0068863_100224197 | Ga0068863_1002241972 | 292 |
| 799 | 3300005842 | Ga0068858_100504140 | Ga0068858_1005041401 | 292 |
| 800 | 3300005843 | Ga0068860_100114294 | Ga0068860_1001142942 | 292 |
| 801 | 3300005844 | Ga0068862_100142878 | Ga0068862_1001428781 | 292 |
| 802 | 3300005844 | Ga0068862_100185624 | Ga0068862_1001856242 | 292 |
| 803 | 3300005844 | Ga0068862_100382196 | Ga0068862_1003821962 | 292 |
| 804 | 3300005983 | Ga0081540_1044102 | Ga0081540_10441021 | 292 |
| 805 | 3300005983 | Ga0081540_1073066 | Ga0081540_10730662 | 292 |
| 806 | 3300006038 | Ga0075365_10068991 | Ga0075365_100689912 | 292 |
| 807 | 3300006038 | Ga0075365_10214282 | Ga0075365_102142822 | 292 |
| 808 | 3300006038 | Ga0075365_10332914 | Ga0075365_103329141 | 292 |
| 809 | 3300006051 | Ga0075364_10022409 | Ga0075364_100224092 | 292 |
| 810 | 3300006051 | Ga0075364_10048273 | Ga0075364_100482732 | 292 |
| 811 | 3300006175 | Ga0070712_100090744 | Ga0070712_1000907442 | 292 |
| 812 | 3300006177 | Ga0075362_10107814 | Ga0075362_101078142 | 292 |
| 813 | 3300006178 | Ga0075367_10032084 | Ga0075367_100320842 | 292 |
| 814 | 3300006178 | Ga0075367_10033297 | Ga0075367_100332973 | 292 |
| 815 | 3300006186 | Ga0075369_10025069 | Ga0075369_100250692 | 292 |
| 816 | 3300006353 | Ga0075370_10015615 | Ga0075370_100156153 | 292 |
| 817 | 3300006353 | Ga0075370_10086232 | Ga0075370_100862322 | 292 |
| 818 | 3300006844 | Ga0075428_100196462 | Ga0075428_1001964622 | 292 |
| 819 | 3300006881 | Ga0068865_100041530 | Ga0068865_1000415302 | 292 |
| 820 | 3300006931 | Ga0097620_100139343 | Ga0097620_1001393432 | 292 |
| 821 | 3300007265 | Ga0099794_10041987 | Ga0099794_100419872 | 292 |
| 822 | 3300007788 | Ga0099795_10005394 | Ga0099795_100053942 | 292 |
| 823 | 3300007788 | Ga0099795_10026186 | Ga0099795_100261862 | 292 |
| 824 | 3300009093 | Ga0105240_10224642 | Ga0105240_102246422 | 292 |
| 825 | 3300009098 | Ga0105245_10048730 | Ga0105245_100487302 | 292 |
| 826 | 3300009098 | Ga0105245_10050199 | Ga0105245_100501992 | 292 |
| 827 | 3300009098 | Ga0105245_10054965 | Ga0105245_100549652 | 292 |
| 828 | 3300009147 | Ga0114129_10064167 | Ga0114129_100641672 | 292 |
| 829 | 3300009176 | Ga0105242_10102997 | Ga0105242_101029972 | 292 |
| 830 | 3300009177 | Ga0105248_10164887 | Ga0105248_101648873 | 292 |
| 831 | 3300010375 | Ga0105239_10150181 | Ga0105239_101501812 | 292 |
| 832 | 3300013296 | Ga0157374_10034735 | Ga0157374_100347354 | 292 |
| 833 | 3300013297 | Ga0157378_10036359 | Ga0157378_100363592 | 292 |
| 834 | 3300013297 | Ga0157378_10051368 | Ga0157378_100513683 | 292 |
| 835 | 3300013306 | Ga0163162_10002433 | Ga0163162_100024333 | 292 |
| 836 | 3300013306 | Ga0163162_10123584 | Ga0163162_101235842 | 292 |
| 837 | 3300013308 | Ga0157375_10015134 | Ga0157375_100151344 | 292 |
| 838 | 3300014325 | Ga0163163_10002363 | Ga0163163_1000236313 | 292 |
| 839 | 3300014326 | Ga0157380_10246052 | Ga0157380_102460522 | 292 |
| 840 | 3300014745 | Ga0157377_10103273 | Ga0157377_101032732 | 292 |
| 841 | 3300014968 | Ga0157379_10311060 | Ga0157379_103110602 | 292 |
| 842 | 3300014969 | Ga0157376_10024381 | Ga0157376_100243812 | 292 |
| 843 | 3300021441 | Ga0213871_10023929 | Ga0213871_100239292 | 292 |
| 844 | 3300025261 | Ga0209233_1013772 | Ga0209233_10137722 | 292 |
| 845 | 3300025295 | Ga0209564_1004214 | Ga0209564_10042144 | 292 |
| 846 | 3300025297 | Ga0209758_1001947 | Ga0209758_100194717 | 292 |
| 847 | 3300025297 | Ga0209758_1004240 | Ga0209758_10042408 | 292 |
| 848 | 3300025302 | Ga0207426_1000613 | Ga0207426_100061313 | 292 |
| 849 | 3300025304 | Ga0209257_1028445 | Ga0209257_10284452 | 292 |
| 850 | 3300025315 | Ga0207697_10115558 | Ga0207697_101155581 | 292 |
| 851 | 3300025901 | Ga0207688_10051004 | Ga0207688_100510041 | 292 |
| 852 | 3300025915 | Ga0207693_10053133 | Ga0207693_100531333 | 292 |
| 853 | 3300025918 | Ga0207662_10054009 | Ga0207662_100540092 | 292 |
| 854 | 3300025922 | Ga0207646_10171029 | Ga0207646_101710292 | 292 |
| 855 | 3300025927 | Ga0207687_10067922 | Ga0207687_100679223 | 292 |
| 856 | 3300025927 | Ga0207687_10228250 | Ga0207687_102282502 | 292 |
| 857 | 3300025931 | Ga0207644_10324036 | Ga0207644_103240362 | 292 |
| 858 | 3300025933 | Ga0207706_10029163 | Ga0207706_100291632 | 292 |
| 859 | 3300025933 | Ga0207706_10474433 | Ga0207706_104744332 | 292 |
| 860 | 3300025934 | Ga0207686_10047401 | Ga0207686_100474012 | 292 |
| 861 | 3300025936 | Ga0207670_10133935 | Ga0207670_101339352 | 292 |
| 862 | 3300025937 | Ga0207669_10123761 | Ga0207669_101237612 | 292 |
| 863 | 3300025938 | Ga0207704_10091011 | Ga0207704_100910112 | 292 |
| 864 | 3300025942 | Ga0207689_10169943 | Ga0207689_101699432 | 292 |
| 865 | 3300025949 | Ga0207667_10070874 | Ga0207667_100708744 | 292 |
| 866 | 3300025972 | Ga0207668_10215469 | Ga0207668_102154692 | 292 |
| 867 | 3300025981 | Ga0207640_10316069 | Ga0207640_103160692 | 292 |
| 868 | 3300026035 | Ga0207703_10121259 | Ga0207703_101212592 | 292 |
| 869 | 3300026067 | Ga0207678_10023870 | Ga0207678_100238703 | 292 |
| 870 | 3300026067 | Ga0207678_10219447 | Ga0207678_102194472 | 292 |
| 871 | 3300026075 | Ga0207708_10109280 | Ga0207708_101092802 | 292 |
| 872 | 3300026078 | Ga0207702_10115580 | Ga0207702_101155802 | 292 |
| 873 | 3300026088 | Ga0207641_10287269 | Ga0207641_102872691 | 292 |
| 874 | 3300026089 | Ga0207648_10032951 | Ga0207648_100329512 | 292 |
| 875 | 3300026095 | Ga0207676_10021216 | Ga0207676_100212163 | 292 |
| 876 | 3300026118 | Ga0207675_100108249 | Ga0207675_1001082492 | 292 |
| 877 | 3300026121 | Ga0207683_10042257 | Ga0207683_100422572 | 292 |
| 878 | 3300026121 | Ga0207683_10075803 | Ga0207683_100758032 | 292 |
| 879 | 3300026142 | Ga0207698_10087601 | Ga0207698_100876012 | 292 |
| 880 | 3300027357 | Ga0209589_1000001 | Ga0209589_1000001435 | 292 |
| 881 | 3300027361 | Ga0209489_100001 | Ga0209489_100001435 | 292 |
| 882 | 3300027363 | Ga0209700_100001 | Ga0209700_100001435 | 292 |
| 883 | 3300027671 | Ga0209588_1004023 | Ga0209588_10040232 | 292 |
| 884 | 3300028379 | Ga0268266_10074808 | Ga0268266_100748083 | 292 |
| 885 | 3300028379 | Ga0268266_10403154 | Ga0268266_104031542 | 292 |
| 886 | 3300028380 | Ga0268265_10037996 | Ga0268265_100379964 | 292 |
| 887 | 3300028380 | Ga0268265_10057458 | Ga0268265_100574583 | 292 |
| 888 | 3300028380 | Ga0268265_10164066 | Ga0268265_101640662 | 292 |
| 889 | 3300028380 | Ga0268265_10313870 | Ga0268265_103138702 | 292 |
| 890 | 3300028381 | Ga0268264_10285351 | Ga0268264_102853512 | 292 |
| 891 | 3300028786 | Ga0307517_10000386 | Ga0307517_1000038627 | 292 |
| 892 | 3300028786 | Ga0307517_10217944 | Ga0307517_102179442 | 292 |
| 893 | 3300028794 | Ga0307515_10052963 | Ga0307515_100529633 | 292 |
| 894 | 3300031235 | Ga0265330_10010015 | Ga0265330_100100152 | 292 |
| 895 | 3300031242 | Ga0265329_10061615 | Ga0265329_100616152 | 292 |
| 896 | 3300031247 | Ga0265340_10015257 | Ga0265340_100152572 | 292 |
| 897 | 3300031548 | Ga0307408_100301599 | Ga0307408_1003015992 | 292 |
| 898 | 3300031712 | Ga0265342_10091265 | Ga0265342_100912652 | 292 |
| 899 | 3300031995 | Ga0307409_100448569 | Ga0307409_1004485692 | 292 |
| 900 | 3300032005 | Ga0307411_10168016 | Ga0307411_101680161 | 292 |
| 901 | 3300033180 | Ga0307510_10036874 | Ga0307510_100368743 | 292 |
| 902 | 3300033442 | Ga0315911_1000002 | Ga0315911_1000002491 | 292 |
| 903 | 3300035086 | Ga0373934_0015429 | Ga0373934_0015429_1643_2572 | 292 |
| 904 | 3300035111 | Ga0373923_0008351 | Ga0373923_0008351_2147_3076 | 292 |
| 905 | 3300035113 | Ga0373936_0009582 | Ga0373936_0009582_2376_3305 | 292 |
| 906 | 3300035118 | Ga0373954_0000220 | Ga0373954_0000220_3462_4391 | 292 |
| 907 | 3300035118 | Ga0373954_0160337 | Ga0373954_0160337_137_1066 | 292 |
| 908 | 3300035119 | Ga0373956_0000306 | Ga0373956_0000306_4460_5389 | 292 |
| 909 | 3300035120 | Ga0373957_0002434 | Ga0373957_0002434_957_1886 | 292 |
| 910 | 3300035170 | Ga0373943_0006156 | Ga0373943_0006156_3074_4003 | 292 |
| 911 | 3300035172 | Ga0373955_0002760 | Ga0373955_0002760_5109_6038 | 292 |
| 912 | 3300035172 | Ga0373955_0129489 | Ga0373955_0129489_92_1021 | 292 |
| 913 | 3300035410 | Ga0373924_0081022 | Ga0373924_0081022_122_1051 | 292 |
| 914 | 3300035692 | Ga0373935_0001272 | Ga0373935_0001272_3971_4900 | 292 |
| 915 | 3300035692 | Ga0373935_0040080 | Ga0373935_0040080_1997_2926 | 292 |
| 916 | 3300035695 | Ga0373927_0000935 | Ga0373927_0000935_4292_5221 | 292 |
| 917 | 3300035724 | Ga0373933_0000164 | Ga0373933_0000164_605_1534 | 292 |
| 918 | 3300035724 | Ga0373933_0006353 | Ga0373933_0006353_14_943 | 292 |
| 919 | 3300035725 | Ga0373947_0000207 | Ga0373947_0000207_23055_23984 | 292 |
| 920 | 3300036401 | Ga0373937_0038226 | Ga0373937_0038226_103_1032 | 292 |
| 921 | 3300036401 | Ga0373937_0252271 | Ga0373937_0252271_718_1647 | 292 |
| 922 | 3300037068 | Ga0373925_0057191 | Ga0373925_0057191_422_1351 | 292 |
| 923 | 3300037471 | Ga0395905_0443304 | Ga0395905_0443304_224_1150 | 292 |
| 924 | 3300039447 | Ga0436361_0429826 | Ga0436361_0429826_2348_3277 | 292 |
| 925 | 3300041486 | Ga0451807_2024239 | Ga0451807_2024239_96_1025 | 292 |
| 926 | 3300044684 | Ga0466966_0002334 | Ga0466966_0002334_7939_8862 | 292 |
| 927 | 3300044693 | Ga0466961_0001110 | Ga0466961_0001110_15558_16481 | 292 |
| 928 | 3300045049 | Ga0466959_0001504 | Ga0466959_0001504_1507_2430 | 292 |
| 929 | 3300045049 | Ga0466959_0008358 | Ga0466959_0008358_5412_6341 | 292 |
| 930 | 3300046452 | Ga0495617_011389 | Ga0495617_011389_73_1002 | 292 |
| 931 | 3300046453 | Ga0495627_054474 | Ga0495627_054474_23_952 | 292 |
| 932 | 3300046454 | Ga0495592_0004993 | Ga0495592_0004993_1150_2079 | 292 |
| 933 | 3300046455 | Ga0495603_0000032 | Ga0495603_0000032_898_1827 | 292 |
| 934 | 3300046455 | Ga0495603_0005706 | Ga0495603_0005706_3236_4165 | 292 |
| 935 | 3300046455 | Ga0495603_0095918 | Ga0495603_0095918_422_1351 | 292 |
| 936 | 3300046457 | Ga0495590_0032236 | Ga0495590_0032236_767_1696 | 292 |
| 937 | 3300046459 | Ga0495629_0000094 | Ga0495629_0000094_65451_66380 | 292 |
| 938 | 3300046459 | Ga0495629_0000114 | Ga0495629_0000114_34246_35175 | 292 |
| 939 | 3300046460 | Ga0495638_0179132 | Ga0495638_0179132_48_977 | 292 |
| 940 | 3300046461 | Ga0495641_0002565 | Ga0495641_0002565_9466_10395 | 292 |
| 941 | 3300046463 | Ga0495653_0003100 | Ga0495653_0003100_20_949 | 292 |
| 942 | 3300046463 | Ga0495653_0078002 | Ga0495653_0078002_664_1593 | 292 |
| 943 | 3300046472 | Ga0495580_0004156 | Ga0495580_0004156_3866_4795 | 292 |
| 944 | 3300046473 | Ga0495582_0000030 | Ga0495582_0000030_9176_10105 | 292 |
| 945 | 3300046475 | Ga0495639_0000003 | Ga0495639_0000003_97986_98915 | 292 |
| 946 | 3300046476 | Ga0495662_0000008 | Ga0495662_0000008_69588_70517 | 292 |
| 947 | 3300046491 | Ga0495584_0074180 | Ga0495584_0074180_289_1218 | 292 |
| 948 | 3300046499 | Ga0495594_0000249 | Ga0495594_0000249_885_1814 | 292 |
| 949 | 3300046507 | Ga0495606_0020843 | Ga0495606_0020843_464_1393 | 292 |
| 950 | 3300046511 | Ga0495608_0051466 | Ga0495608_0051466_898_1827 | 292 |
| 951 | 3300046513 | Ga0495616_0095415 | Ga0495616_0095415_90_1019 | 292 |
| 952 | 3300046514 | Ga0495618_0106675 | Ga0495618_0106675_356_1285 | 292 |
| 953 | 3300046516 | Ga0495628_0004817 | Ga0495628_0004817_9277_10206 | 292 |
| 954 | 3300046516 | Ga0495628_0150930 | Ga0495628_0150930_354_1283 | 292 |
| 955 | 3300046517 | Ga0495630_0018007 | Ga0495630_0018007_3924_4853 | 292 |
| 956 | 3300046517 | Ga0495630_0316155 | Ga0495630_0316155_217_1146 | 292 |
| 957 | 3300046518 | Ga0495631_0096063 | Ga0495631_0096063_209_1138 | 292 |
| 958 | 3300046523 | Ga0495644_0034992 | Ga0495644_0034992_411_1340 | 292 |
| 959 | 3300046524 | Ga0495648_0023128 | Ga0495648_0023128_1126_2055 | 292 |
| 960 | 3300046524 | Ga0495648_0040083 | Ga0495648_0040083_1773_2702 | 292 |
| 961 | 3300046524 | Ga0495648_0070682 | Ga0495648_0070682_237_1166 | 292 |
| 962 | 3300046526 | Ga0495666_0049611 | Ga0495666_0049611_693_1622 | 292 |
| 963 | 3300046528 | Ga0495642_0014387 | Ga0495642_0014387_1367_2296 | 292 |
| 964 | 3300046529 | Ga0495652_0193133 | Ga0495652_0193133_471_1400 | 292 |
| 965 | 3300046529 | Ga0495652_0322496 | Ga0495652_0322496_20_949 | 292 |
| 966 | 3300046531 | Ga0495665_0000001 | Ga0495665_0000001_91229_92158 | 292 |
| 967 | 3300046533 | Ga0495640_0011846 | Ga0495640_0011846_3436_4365 | 292 |
| 968 | 3300046533 | Ga0495640_0012771 | Ga0495640_0012771_3949_4878 | 292 |
| 969 | 3300046536 | Ga0495587_0185187 | Ga0495587_0185187_148_1077 | 292 |
| 970 | 3300046538 | Ga0495609_0035426 | Ga0495609_0035426_459_1388 | 292 |
| 971 | 3300046538 | Ga0495609_0095844 | Ga0495609_0095844_164_1093 | 292 |
| 972 | 3300046543 | Ga0495645_0043602 | Ga0495645_0043602_1886_2815 | 292 |
| 973 | 3300046557 | Ga0495622_0004414 | Ga0495622_0004414_4529_5458 | 292 |
| 974 | 3300046557 | Ga0495622_0020192 | Ga0495622_0020192_1052_1981 | 292 |
| 975 | 3300046557 | Ga0495622_0071010 | Ga0495622_0071010_635_1564 | 292 |
| 976 | 3300046558 | Ga0495633_0026394 | Ga0495633_0026394_728_1657 | 292 |
| 977 | 3300046559 | Ga0495667_0035228 | Ga0495667_0035228_49_978 | 292 |
| 978 | 3300046559 | Ga0495667_0047807 | Ga0495667_0047807_349_1278 | 292 |
| 979 | 3300046615 | Ga0495656_0009498 | Ga0495656_0009498_1519_2448 | 292 |
| 980 | 3300046642 | Ga0495634_0003282 | Ga0495634_0003282_9300_10229 | 292 |
| 981 | 3300046642 | Ga0495634_0005378 | Ga0495634_0005378_1748_2677 | 292 |
| 982 | 3300046648 | Ga0495611_0028249 | Ga0495611_0028249_1098_2027 | 292 |
| 983 | 3300046648 | Ga0495611_0041248 | Ga0495611_0041248_932_1861 | 292 |
| 984 | 3300046663 | Ga0495635_0002364 | Ga0495635_0002364_7697_8626 | 292 |
| 985 | 3300046663 | Ga0495635_0002589 | Ga0495635_0002589_5868_6797 | 292 |
| 986 | 3300046674 | Ga0495588_0002455 | Ga0495588_0002455_3238_4167 | 292 |
| 987 | 3300046678 | Ga0495599_0000800 | Ga0495599_0000800_12522_13451 | 292 |
| 988 | 3300046679 | Ga0495623_0008330 | Ga0495623_0008330_103_1032 | 292 |
| 989 | 3300046680 | Ga0495646_0000456 | Ga0495646_0000456_5879_6808 | 292 |
| 990 | 3300046680 | Ga0495646_0101682 | Ga0495646_0101682_649_1578 | 292 |
| 991 | 3300046681 | Ga0495647_0000736 | Ga0495647_0000736_5041_5970 | 292 |
| 992 | 3300046683 | Ga0495658_0000285 | Ga0495658_0000285_25560_26489 | 292 |
| 993 | 3300046689 | Ga0495613_0005014 | Ga0495613_0005014_4018_4947 | 292 |
| 994 | 3300046690 | Ga0495624_0000193 | Ga0495624_0000193_40172_41101 | 292 |
| 995 | 3300046691 | Ga0495670_0135766 | Ga0495670_0135766_270_1199 | 292 |
| 996 | 3300046809 | Ga0495600_0011609 | Ga0495600_0011609_103_1032 | 292 |
| 997 | 3300047315 | Ga0495581_0000110 | Ga0495581_0000110_15592_16521 | 292 |
| 998 | 3300047319 | Ga0495674_0000031 | Ga0495674_0000031_58837_59766 | 292 |
| 999 | 3300047319 | Ga0495674_0020552 | Ga0495674_0020552_2668_3597 | 292 |
| 1000 | 3300047320 | Ga0495672_0124714 | Ga0495672_0124714_44_973 | 292 |
| 1001 | 3300047321 | Ga0495676_0017501 | Ga0495676_0017501_4304_5233 | 292 |
| 1002 | 3300047322 | Ga0495680_0236903 | Ga0495680_0236903_20_949 | 292 |
| 1003 | 3300047322 | Ga0495680_0284009 | Ga0495680_0284009_35_964 | 292 |
| 1004 | 3300047323 | Ga0495683_0005882 | Ga0495683_0005882_2485_3414 | 292 |
| 1005 | 3300047469 | Ga0495673_0019972 | Ga0495673_0019972_87_1016 | 292 |
| 1006 | 3300047469 | Ga0495673_0051837 | Ga0495673_0051837_234_1163 | 292 |
| 1007 | 3300047469 | Ga0495673_0102340 | Ga0495673_0102340_143_1072 | 292 |
| 1008 | 3300047471 | Ga0495684_0000739 | Ga0495684_0000739_14343_15272 | 292 |
| 1009 | 3300047472 | Ga0495686_0109670 | Ga0495686_0109670_82_1011 | 292 |
| 1010 | 3300047673 | Ga0495593_0000468 | Ga0495593_0000468_2875_3804 | 292 |
| 1011 | 3300047673 | Ga0495593_0002910 | Ga0495593_0002910_6037_6966 | 292 |
| 1012 | 3300048088 | Ga0495602_0357906 | Ga0495602_0357906_103_1032 | 292 |
| 1013 | 3300048091 | Ga0495626_0060495 | Ga0495626_0060495_266_1195 | 292 |
| 1014 | 3300048903 | Ga0496100_0027909 | Ga0496100_0027909_105_1034 | 292 |
| 1015 | 3300048904 | Ga0496101_0065211 | Ga0496101_0065211_701_1630 | 292 |
| 1016 | 3300048904 | Ga0496101_0102901 | Ga0496101_0102901_1127_2056 | 292 |
| 1017 | 3300048905 | Ga0496102_0179739 | Ga0496102_0179739_174_1103 | 292 |
| 1018 | 3300048905 | Ga0496102_0269156 | Ga0496102_0269156_582_1511 | 292 |
| 1019 | 3300048907 | Ga0496104_0255338 | Ga0496104_0255338_520_1449 | 292 |
| 1020 | 3300048908 | Ga0496105_0047703 | Ga0496105_0047703_582_1511 | 292 |
| 1021 | 3300048909 | Ga0496106_0050055 | Ga0496106_0050055_2200_3129 | 292 |
| 1022 | 3300048909 | Ga0496106_0057238 | Ga0496106_0057238_1776_2705 | 292 |
| 1023 | 3300048910 | Ga0496107_0026752 | Ga0496107_0026752_2272_3204 | 292 |
| 1024 | 3300048911 | Ga0496108_0220864 | Ga0496108_0220864_100_1029 | 292 |
| 1025 | 3300048912 | Ga0496109_0018596 | Ga0496109_0018596_544_1473 | 292 |
| 1026 | 3300048912 | Ga0496109_0329235 | Ga0496109_0329235_90_1019 | 292 |
| 1027 | 3300048912 | Ga0496109_0363933 | Ga0496109_0363933_316_1245 | 292 |
| 1028 | 3300048913 | Ga0496110_0022638 | Ga0496110_0022638_3346_4275 | 292 |
| 1029 | 3300048914 | Ga0496111_0051917 | Ga0496111_0051917_405_1334 | 292 |
| 1030 | 3300048916 | Ga0496113_0174494 | Ga0496113_0174494_460_1389 | 292 |
| 1031 | 3300048917 | Ga0496114_0208638 | Ga0496114_0208638_89_1018 | 292 |
| 1032 | 3300048918 | Ga0496115_0033388 | Ga0496115_0033388_2953_3882 | 292 |
| 1033 | 3300048918 | Ga0496115_0051013 | Ga0496115_0051013_149_1078 | 292 |
| 1034 | 3300048921 | Ga0496118_0014928 | Ga0496118_0014928_2336_3280 | 292 |
| 1035 | 3300048921 | Ga0496118_0129820 | Ga0496118_0129820_165_1097 | 292 |
| 1036 | 3300048922 | Ga0496119_0050984 | Ga0496119_0050984_218_1147 | 292 |
| 1037 | 3300048923 | Ga0496120_0113736 | Ga0496120_0113736_37_966 | 292 |
| 1038 | 3300048924 | Ga0496121_0000230 | Ga0496121_0000230_32427_33356 | 292 |
| 1039 | 3300048924 | Ga0496121_0002110 | Ga0496121_0002110_26893_27825 | 292 |
| 1040 | 3300048924 | Ga0496121_0027675 | Ga0496121_0027675_37_969 | 292 |
| 1041 | 3300048924 | Ga0496121_0181524 | Ga0496121_0181524_438_1367 | 292 |
| 1042 | 3300048924 | Ga0496121_0203141 | Ga0496121_0203141_21_950 | 292 |
| 1043 | 3300048924 | Ga0496121_0238559 | Ga0496121_0238559_246_1175 | 292 |
| 1044 | 3300048924 | Ga0496121_0264715 | Ga0496121_0264715_110_1036 | 292 |
| 1045 | 3300048928 | Ga0496125_0000763 | Ga0496125_0000763_40769_41698 | 292 |
| 1046 | 3300048928 | Ga0496125_0000796 | Ga0496125_0000796_31413_32342 | 292 |
| 1047 | 3300048928 | Ga0496125_0014089 | Ga0496125_0014089_3912_4841 | 292 |
| 1048 | 3300048929 | Ga0496126_0011936 | Ga0496126_0011936_4138_5067 | 292 |
| 1049 | 3300048929 | Ga0496126_0015175 | Ga0496126_0015175_6381_7310 | 292 |
| 1050 | 3300048929 | Ga0496126_0058324 | Ga0496126_0058324_2307_3239 | 292 |
| 1051 | 3300048929 | Ga0496126_0061127 | Ga0496126_0061127_261_1190 | 292 |
| 1052 | 3300048929 | Ga0496126_0066910 | Ga0496126_0066910_191_1120 | 292 |
| 1053 | 3300048929 | Ga0496126_0326321 | Ga0496126_0326321_76_1005 | 292 |
| 1054 | 3300049577 | Ga0501041_0204906 | Ga0501041_0204906_123_1052 | 292 |
| 1055 | 3300049743 | Ga0501081_0296556 | Ga0501081_0296556_219_1148 | 292 |
| 1056 | 3300050491 | nmdc:mga00v17_50405_c1 | nmdc:mga00v17_50405_c1_681_1610 | 292 |
| 1057 | 3300050492 | nmdc:mga0yw44_90003_c1 | nmdc:mga0yw44_90003_c1_254_1183 | 292 |
| 1058 | 3300050494 | nmdc:mga06z11_116659_c1 | nmdc:mga06z11_116659_c1_341_1270 | 292 |
| 1059 | 3300050496 | nmdc:mga07m45_175948_c1 | nmdc:mga07m45_175948_c1_274_1203 | 292 |
| 1060 | 3300050507 | nmdc:mga05p37_44591_c1 | nmdc:mga05p37_44591_c1_2996_3925 | 292 |
| 1061 | 3300050515 | nmdc:mga0a205_159553_c1 | nmdc:mga0a205_159553_c1_591_1520 | 292 |
| 1062 | 3300050516 | nmdc:mga0sz30_105157_c1 | nmdc:mga0sz30_105157_c1_82_1011 | 292 |
| 1063 | 3300050516 | nmdc:mga0sz30_26917_c1 | nmdc:mga0sz30_26917_c1_750_1679 | 292 |
| 1064 | 3300053084 | Ga0495595_0000846 | Ga0495595_0000846_812_1741 | 292 |
| 1065 | 3300053085 | Ga0495619_0000641 | Ga0495619_0000641_14682_15611 | 292 |
| 1066 | 3300053093 | Ga0500651_0002427 | Ga0500651_0002427_381_1310 | 292 |
| 1067 | 3300053093 | Ga0500651_0193814 | Ga0500651_0193814_236_1165 | 292 |
| 1068 | 3300053094 | Ga0500566_0037243 | Ga0500566_0037243_1785_2714 | 292 |
| 1069 | 3300053096 | Ga0500641_0027000 | Ga0500641_0027000_357_1286 | 292 |
| 1070 | 3300053102 | Ga0500554_004318 | Ga0500554_004318_1983_2912 | 292 |
| 1071 | 3300053108 | Ga0500562_039345 | Ga0500562_039345_61_990 | 292 |
| 1072 | 3300053109 | Ga0500569_002666 | Ga0500569_002666_1348_2277 | 292 |
| 1073 | 3300053119 | Ga0500595_001746 | Ga0500595_001746_4521_5450 | 292 |
| 1074 | 3300053119 | Ga0500595_004600 | Ga0500595_004600_1072_2001 | 292 |
| 1075 | 3300053119 | Ga0500595_004632 | Ga0500595_004632_3480_4409 | 292 |
| 1076 | 3300053119 | Ga0500595_009010 | Ga0500595_009010_219_1148 | 292 |
| 1077 | 3300053119 | Ga0500595_025647 | Ga0500595_025647_178_1107 | 292 |
| 1078 | 3300053124 | Ga0500617_044767 | Ga0500617_044767_136_1065 | 292 |
| 1079 | 3300053139 | Ga0500568_0027897 | Ga0500568_0027897_181_1110 | 292 |
| 1080 | 3300053142 | Ga0500577_0000893 | Ga0500577_0000893_3927_4856 | 292 |
| 1081 | 3300053178 | Ga0500637_0000231 | Ga0500637_0000231_1629_2558 | 292 |
| 1082 | 3300053730 | Ga0500645_009075 | Ga0500645_009075_617_1546 | 292 |
| 1083 | 3300055283 | Ga0500661_001742 | Ga0500661_001742_1059_1988 | 292 |
| 1084 | iso_pu_bacteria | 2511231221 | 2512037083 | 292 |
| 1085 | 3300005983 | Ga0081540_1031146 | Ga0081540_10311462 | 293 |
| 1086 | 3300013306 | Ga0163162_10215813 | Ga0163162_102158131 | 293 |
| 1087 | 3300031711 | Ga0265314_10018659 | Ga0265314_100186591 | 293 |
| 1088 | 3300048925 | Ga0496122_0075629 | Ga0496122_0075629_1105_2055 | 293 |
| 1089 | iso_pu_bacteria | 8054002106 | 8054008702 | 293 |
| 1090 | 3300050492 | nmdc:mga0yw44_286352_c1 | nmdc:mga0yw44_286352_c1_115_1056 | 294 |
| 1091 | 3300001904 | JGI24736J21556_1000003 | JGI24736J21556_100000339 | 299 |
| 1092 | 3300001915 | JGI24741J21665_1006315 | JGI24741J21665_10063152 | 299 |
| 1093 | 3300001976 | JGI24752J21851_1000802 | JGI24752J21851_10008021 | 299 |
| 1094 | 3300001979 | JGI24740J21852_10000141 | JGI24740J21852_1000014119 | 299 |
| 1095 | 3300001989 | JGI24739J22299_10003603 | JGI24739J22299_100036032 | 299 |
| 1096 | 3300001990 | JGI24737J22298_10000271 | JGI24737J22298_1000027112 | 299 |
| 1097 | 3300002067 | JGI24735J21928_10000163 | JGI24735J21928_1000016313 | 299 |
| 1098 | 3300002070 | JGI24750J21931_1002983 | JGI24750J21931_10029832 | 299 |
| 1099 | 3300002074 | JGI24748J21848_1000111 | JGI24748J21848_10001112 | 299 |
| 1100 | 3300002075 | JGI24738J21930_10000122 | JGI24738J21930_100001222 | 299 |
| 1101 | 3300002075 | JGI24738J21930_10004075 | JGI24738J21930_100040752 | 299 |
| 1102 | 3300002239 | JGI24034J26672_10000089 | JGI24034J26672_1000008917 | 299 |
| 1103 | 3300002244 | JGI24742J22300_10003440 | JGI24742J22300_100034402 | 299 |
| 1104 | 3300002244 | JGI24742J22300_10003919 | JGI24742J22300_100039192 | 299 |
| 1105 | 3300005295 | Ga0065707_10081846 | Ga0065707_1008184628 | 299 |
| 1106 | 3300005327 | Ga0070658_10065777 | Ga0070658_100657772 | 299 |
| 1107 | 3300005330 | Ga0070690_100000341 | Ga0070690_1000003417 | 299 |
| 1108 | 3300005335 | Ga0070666_10001085 | Ga0070666_100010851 | 299 |
| 1109 | 3300005339 | Ga0070660_100006161 | Ga0070660_1000061616 | 299 |
| 1110 | 3300005344 | Ga0070661_100003163 | Ga0070661_1000031632 | 299 |
| 1111 | 3300005347 | Ga0070668_100025763 | Ga0070668_1000257631 | 299 |
| 1112 | 3300005355 | Ga0070671_100001700 | Ga0070671_1000017001 | 299 |
| 1113 | 3300005367 | Ga0070667_100002314 | Ga0070667_1000023141 | 299 |
| 1114 | 3300005455 | Ga0070663_100021666 | Ga0070663_1000216662 | 299 |
| 1115 | 3300005457 | Ga0070662_100000370 | Ga0070662_10000037011 | 299 |
| 1116 | 3300005544 | Ga0070686_100000951 | Ga0070686_1000009511 | 299 |
| 1117 | 3300005564 | Ga0070664_100003613 | Ga0070664_10000361310 | 299 |
| 1118 | 3300005577 | Ga0068857_100036297 | Ga0068857_1000362973 | 299 |
| 1119 | 3300005578 | Ga0068854_100003709 | Ga0068854_10000370910 | 299 |
| 1120 | 3300005618 | Ga0068864_100002032 | Ga0068864_1000020321 | 299 |
| 1121 | 3300005719 | Ga0068861_100004465 | Ga0068861_10000446510 | 299 |
| 1122 | 3300005834 | Ga0068851_10008565 | Ga0068851_100085652 | 299 |
| 1123 | 3300005841 | Ga0068863_100034336 | Ga0068863_1000343362 | 299 |
| 1124 | 3300005843 | Ga0068860_100003263 | Ga0068860_1000032631 | 299 |
| 1125 | 3300009093 | Ga0105240_10132998 | Ga0105240_101329982 | 299 |
| 1126 | 3300009545 | Ga0105237_10031595 | Ga0105237_100315954 | 299 |
| 1127 | 3300009553 | Ga0105249_10002201 | Ga0105249_100022011 | 299 |
| 1128 | 3300010375 | Ga0105239_10120787 | Ga0105239_101207872 | 299 |
| 1129 | 3300010375 | Ga0105239_10528410 | Ga0105239_105284102 | 299 |
| 1130 | 3300013104 | Ga0157370_10009206 | Ga0157370_100092068 | 299 |
| 1131 | 3300013105 | Ga0157369_10040582 | Ga0157369_100405822 | 299 |
| 1132 | 3300013306 | Ga0163162_10021948 | Ga0163162_100219485 | 299 |
| 1133 | 3300014326 | Ga0157380_10018244 | Ga0157380_100182444 | 299 |
| 1134 | 3300014968 | Ga0157379_10089399 | Ga0157379_100893992 | 299 |
| 1135 | 3300017792 | Ga0163161_10001564 | Ga0163161_100015641 | 299 |
| 1136 | 3300025223 | Ga0207672_1000291 | Ga0207672_10002915 | 299 |
| 1137 | 3300025321 | Ga0207656_10002794 | Ga0207656_100027942 | 299 |
| 1138 | 3300025903 | Ga0207680_10000608 | Ga0207680_100006081 | 299 |
| 1139 | 3300025904 | Ga0207647_10000885 | Ga0207647_1000088517 | 299 |
| 1140 | 3300025909 | Ga0207705_10011230 | Ga0207705_100112304 | 299 |
| 1141 | 3300025911 | Ga0207654_10001250 | Ga0207654_100012504 | 299 |
| 1142 | 3300025913 | Ga0207695_10013483 | Ga0207695_100134832 | 299 |
| 1143 | 3300025914 | Ga0207671_10004455 | Ga0207671_100044554 | 299 |
| 1144 | 3300025919 | Ga0207657_10007886 | Ga0207657_100078868 | 299 |
| 1145 | 3300025920 | Ga0207649_10009737 | Ga0207649_100097374 | 299 |
| 1146 | 3300025924 | Ga0207694_10001025 | Ga0207694_1000102516 | 299 |
| 1147 | 3300025931 | Ga0207644_10001158 | Ga0207644_100011581 | 299 |
| 1148 | 3300025933 | Ga0207706_10001157 | Ga0207706_1000115711 | 299 |
| 1149 | 3300025945 | Ga0207679_10028262 | Ga0207679_100282622 | 299 |
| 1150 | 3300025949 | Ga0207667_10002524 | Ga0207667_1000252417 | 299 |
| 1151 | 3300025961 | Ga0207712_10001334 | Ga0207712_100013341 | 299 |
| 1152 | 3300025972 | Ga0207668_10195303 | Ga0207668_101953032 | 299 |
| 1153 | 3300025981 | Ga0207640_10102737 | Ga0207640_101027372 | 299 |
| 1154 | 3300025986 | Ga0207658_10000550 | Ga0207658_1000055037 | 299 |
| 1155 | 3300026041 | Ga0207639_10002001 | Ga0207639_1000200110 | 299 |
| 1156 | 3300026067 | Ga0207678_10004067 | Ga0207678_100040676 | 299 |
| 1157 | 3300026078 | Ga0207702_10012102 | Ga0207702_100121024 | 299 |
| 1158 | 3300026088 | Ga0207641_10000820 | Ga0207641_1000082016 | 299 |
| 1159 | 3300026095 | Ga0207676_10000112 | Ga0207676_1000011266 | 299 |
| 1160 | 3300026116 | Ga0207674_10002655 | Ga0207674_100026556 | 299 |
| 1161 | 3300026118 | Ga0207675_100004219 | Ga0207675_1000042195 | 299 |
| 1162 | 3300028381 | Ga0268264_10002306 | Ga0268264_100023061 | 299 |
| 1163 | 3300046525 | Ga0495663_0006202 | Ga0495663_0006202_1269_2168 | 299 |
| 1164 | 3300046530 | Ga0495654_0008175 | Ga0495654_0008175_1243_2142 | 299 |
| 1165 | 3300046616 | Ga0495668_0006900 | Ga0495668_0006900_3231_4130 | 299 |
| 1166 | 3300046616 | Ga0495668_0011250 | Ga0495668_0011250_972_1871 | 299 |
| 1167 | 3300048905 | Ga0496102_0000555 | Ga0496102_0000555_23099_23998 | 299 |
| 1168 | 3300048906 | Ga0496103_0000557 | Ga0496103_0000557_19438_20337 | 299 |
| 1169 | 3300048919 | Ga0496116_0001007 | Ga0496116_0001007_22570_23469 | 299 |
| 1170 | 3300048920 | Ga0496117_0002434 | Ga0496117_0002434_16034_16933 | 299 |
| 1171 | 3300048921 | Ga0496118_0003880 | Ga0496118_0003880_16034_16933 | 299 |
| 1172 | 3300048922 | Ga0496119_0069337 | Ga0496119_0069337_583_1482 | 299 |
| 1173 | 3300048923 | Ga0496120_0023478 | Ga0496120_0023478_2206_3105 | 299 |
| 1174 | 3300048924 | Ga0496121_0068250 | Ga0496121_0068250_1171_2070 | 299 |
| 1175 | 3300048927 | Ga0496124_0001208 | Ga0496124_0001208_23099_23998 | 299 |
| 1176 | 3300049459 | Ga0495678_019364 | Ga0495678_019364_504_1403 | 299 |
| 1177 | 3300053116 | Ga0500592_000131 | Ga0500592_000131_13495_14394 | 299 |
| 1178 | 3300053151 | Ga0500604_0002650 | Ga0500604_0002650_3623_4522 | 299 |
| 1179 | 3300053151 | Ga0500604_0088393 | Ga0500604_0088393_80_979 | 299 |
| 1180 | 3300053158 | Ga0500627_0001099 | Ga0500627_0001099_4277_5176 | 299 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6rh1-assembly1.cif.gz_C | revisiting ph-gated conformational switch. complex hk853-rr468 d53a ph 7 | 0.9748 | 2 | 120 |
| 6rfv-assembly1.cif.gz_C | revisiting ph-gated conformational switch. complex hk853-rr468 ph 7 | 0.9699 | 2 | 120 |
| 4jav-assembly1.cif.gz_D | structural basis of a rationally rewired protein-protein interface (hk853wt and rr468mutant v13p, l14i, i17m and n21v) | 0.9694 | 2 | 120 |
| 1nxx-assembly1.cif.gz_A-2 | micarec ph 5.5 | 0.9693 | 4 | 122 |
| 2qzj-assembly5.cif.gz_E | crystal structure of a two-component response regulator from clostridium difficile | 0.9678 | 2 | 120 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4ja2A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9775 | 2 | 121 | 3.40.50.2300 |
| af_O53213_1064_1134_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9754 | 236 | 293 | 1.10.10.10 |
| af_P9WGM1_5_87_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9666 | 1 | 81 | 3.40.50.2300 |
| af_P14375_1_129_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9665 | 2 | 126 | 3.40.50.2300 |
| 2qzjA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9661 | 2 | 120 | 3.40.50.2300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0F9CXP9-F1-model_v4 | Response regulatory domain-containing protein | 0.9928 | 2 | 126 |
GO:0000156
GO:0000976 GO:0005829 GO:0006355 GO:0010181 GO:0032993 |
| AF-A0A2V9CED2-F1-model_v4 | Response regulatory domain-containing protein | 0.9871 | 2 | 118 |
GO:0000160
|
| AF-A0A355CD79-F1-model_v4 | Response regulator | 0.9865 | 3 | 136 |
GO:0000160
|
| AF-A0A838VU44-F1-model_v4 | histidine kinase (EC 2.7.13.3) | 0.9861 | 3 | 121 |
GO:0000155
|
| AF-A0A496YFC6-F1-model_v4 | DNA-binding response regulator | 0.9791 | 1 | 120 |
GO:0000156
GO:0000976 GO:0005829 GO:0006355 GO:0032993 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar