F491255

General Info

Members Datasets Scaffolds Average Seq Length
1176 354 1168 295

Family's Representative Sequence

Representative Sequence 3300013102|Ga0157371_10020440|Ga0157371_100204404
Length 344
Sequence LPQVLNFDFSNVRQQSGSEFKVKAKAEINYILIDAKELRIANFALAKRLEMQLHPVDRIENISSEDFKNNYYRPQKPLVITELAKSWPAYNKWSWDYFKQIVGDKKVALYNNVKSDAYTPINTADDYKTFGEYIDMIQAGPAAWRIFLFNIFDHAPQLINDFTWPEHLMTGFVKKYPMLFTGGETSITHMHFDIDLSHILHTQFGGRKRVLLFRHEEQHNLYRKPFEVLSLADFSNYYTNRTPDYEKFPALKYAQGYDLILNPGDTLFMPAGYWHHMEYLDSGFAMSLRALQNSLGGKAQGVWNLFGMRSIDTVLKKTAPKWWYDYKIKKIDKQARIEIKKFSN

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2738541278 Niastella sp. CF465 Isolate Unclassified
3 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
4 2818991444 Filimonas endophytica 3197 Isolate Unclassified
5 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
6 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
7 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
8 2914759650 Rhizosphaericola mali Isolate Rhizosphere
9 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
10 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
11 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
12 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
13 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
14 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
15 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
16 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
17 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
18 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
19 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
20 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
21 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
22 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
23 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
24 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
25 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
26 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
27 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
28 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
29 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
30 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
31 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
32 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
33 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
34 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
35 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
36 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
37 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
38 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
39 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
40 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
41 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
42 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
43 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
44 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
45 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
46 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
47 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
48 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
49 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
50 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
51 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
52 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
53 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
54 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
55 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
56 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
57 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
58 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
59 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
60 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
61 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
62 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
63 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
64 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
65 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
66 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
67 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
68 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
69 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
70 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
71 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
72 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
73 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
74 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
75 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
76 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
77 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
78 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
79 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
80 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
81 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
82 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
83 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
84 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
85 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
86 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
87 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
88 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
89 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
90 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
91 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
92 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
93 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
94 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
95 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
96 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
97 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
98 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
99 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
100 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
101 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
102 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
103 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
104 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
105 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
106 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
107 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
108 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
109 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
110 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
111 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
112 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
113 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
114 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
115 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
116 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
117 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
118 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
119 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
120 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
121 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
122 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
123 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
124 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
125 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
126 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
127 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
128 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
129 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
130 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
131 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
132 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
134 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
136 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
137 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
138 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
139 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
141 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
200 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
201 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
202 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
206 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
207 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
208 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
209 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
210 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
211 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
212 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
213 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
214 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
215 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
216 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
217 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
218 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
219 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
220 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
221 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
222 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
223 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
224 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
225 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
226 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
227 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
228 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
229 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
230 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
231 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
232 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
233 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
234 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
235 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
236 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
237 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
238 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
239 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
240 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
241 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
242 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
243 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
244 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
245 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
246 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
247 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
248 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
249 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
250 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
251 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
252 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
253 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
254 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
255 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
256 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
257 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
258 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
259 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
260 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
261 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
262 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
263 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
264 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
265 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
266 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
267 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
268 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
269 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
270 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
271 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
272 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
273 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
274 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
275 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
276 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
277 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
278 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
279 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
280 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
281 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
282 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
283 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
284 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
285 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
286 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
287 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
288 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
289 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
290 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
291 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
292 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
293 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
294 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
295 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
296 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
297 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
298 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
299 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
300 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
301 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
302 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
303 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
304 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
305 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
306 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
307 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
308 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
309 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
310 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
311 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
312 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
313 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
314 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
315 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
316 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
317 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
318 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
319 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
320 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
321 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
322 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
323 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
324 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
325 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
326 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
327 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
328 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
329 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
330 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
331 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
332 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
333 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
334 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
335 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
336 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
337 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
338 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
339 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
340 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
341 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
342 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
343 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
344 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
345 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
346 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
347 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
348 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
349 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
350 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
351 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
352 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
353 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
354 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.32
Metatranscriptomes 0
Isolates 0.68

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.44
Nodule 0
Rhizoplane 0.51
Rhizosphere 90.22
Stem 0
Stem Tuber 0
Unclassified 3.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2098068 2162886007 Bacteria 1659
2 JGI24736J21556_1004228 3300001904 Bacteria 2464
3 JGI24739J22299_10000102 3300001989 Bacteria 25582
4 JGI24744J21845_10033521 3300002077 Unclassified 977
5 JGI24751J29686_10014477 3300002459 Bacteria 1627
6 JGI25158J39367_1007300 3300002739 Bacteria 1562
7 JGI25159J45721_1011777 3300002987 Bacteria 2121
8 JGI25406J46586_10001794 3300003203 Bacteria 10080
9 JGI25153J46596_10009658 3300003215 Bacteria 4445
10 rootH1_10010046 3300003316 Bacteria 4385
11 rootH1_10056141 3300003316 Bacteria 3053
12 rootH1_10188995 3300003316 Bacteria 1259
13 rootH2_10004583 3300003320 Bacteria 23654
14 rootH2_10010343 3300003320 Bacteria 28765
15 rootH2_10010818 3300003320 Bacteria 3303
16 rootH2_10029651 3300003320 Bacteria 1898
17 rootH2_10168493 3300003320 Unclassified 1185
18 rootH2_10175449 3300003320 Bacteria 1192
19 rootH2_10230505 3300003320 Bacteria 1277
20 rootH2_10273097 3300003320 Bacteria 1564
21 rootL2_10019422 3300003322 Bacteria 22736
22 rootL2_10020650 3300003322 Bacteria 10396
23 rootL2_10132269 3300003322 Bacteria 1691
24 rootL2_10279111 3300003322 Unclassified 2058
25 rootH1_10011210 3300003323 Bacteria 23390
26 rootH1_10028713 3300003323 Bacteria 20513
27 rootH1_10168367 3300003323 Bacteria 4121
28 JGI25160J50197_1002461 3300003354 Bacteria 8614
29 JGI25160J50197_1003700 3300003354 Bacteria 6752
30 Ga0055542_1006756 3300003762 Bacteria 2413
31 Ga0055528_1000907 3300003790 Bacteria 19994
32 Ga0055530_10000484 3300003791 Bacteria 34583
33 Ga0055531_10000029 3300003794 Bacteria 159248
34 Ga0055543_1006775 3300004625 Bacteria 2728
35 Ga0065165_1002498 3300005262 Bacteria 15380
36 Ga0065714_10095584 3300005288 Bacteria 1783
37 Ga0065704_10103341 3300005289 Bacteria 2175
38 Ga0065712_10014322 3300005290 Bacteria 2306
39 Ga0065712_10072376 3300005290 Bacteria 4781
40 Ga0065712_10086854 3300005290 Bacteria 2611
41 Ga0065712_10145787 3300005290 Bacteria 1410
42 Ga0065715_10001122 3300005293 Bacteria 9719
43 Ga0065707_10008266 3300005295 Bacteria 3690
44 Ga0065707_10113753 3300005295 Unclassified 2317
45 Ga0065707_10137728 3300005295 Unclassified 1816
46 Ga0070658_10011496 3300005327 Bacteria 7099
47 Ga0070658_10028992 3300005327 Bacteria 4445
48 Ga0070658_10119117 3300005327 Bacteria 2193
49 Ga0070658_10152409 3300005327 Bacteria 1936
50 Ga0070658_10193735 3300005327 Bacteria 1714
51 Ga0070658_10195329 3300005327 Bacteria 1706
52 Ga0070676_10002273 3300005328 Bacteria 9809
53 Ga0070676_10025399 3300005328 Bacteria 3349
54 Ga0070683_100005271 3300005329 Bacteria 10764
55 Ga0070683_100012489 3300005329 Bacteria 7382
56 Ga0070683_100016900 3300005329 Bacteria 6438
57 Ga0070683_100141657 3300005329 Bacteria 2278
58 Ga0070690_100023369 3300005330 Bacteria 3792
59 Ga0070690_100085122 3300005330 Bacteria 2073
60 Ga0070690_100115991 3300005330 Bacteria 1792
61 Ga0070690_100267781 3300005330 Bacteria 1214
62 Ga0070690_100274584 3300005330 Bacteria 1200
63 Ga0070670_100005023 3300005331 Bacteria 11131
64 Ga0070670_100031007 3300005331 Bacteria 4604
65 Ga0070670_100038908 3300005331 Bacteria 4090
66 Ga0070670_100055561 3300005331 Bacteria 3399
67 Ga0070670_100057493 3300005331 Bacteria 3339
68 Ga0070670_100060063 3300005331 Unclassified 3264
69 Ga0070670_100066976 3300005331 Bacteria 3082
70 Ga0070670_100069651 3300005331 Bacteria 3020
71 Ga0070670_100104101 3300005331 Unclassified 2445
72 Ga0070670_100192706 3300005331 Bacteria 1771
73 Ga0070670_100257034 3300005331 Bacteria 1522
74 Ga0070670_100295892 3300005331 Bacteria 1415
75 Ga0068869_100005421 3300005334 Bacteria 8023
76 Ga0068869_100024597 3300005334 Bacteria 4172
77 Ga0068869_100039178 3300005334 Bacteria 3382
78 Ga0068869_100059837 3300005334 Bacteria 2790
79 Ga0068869_100065886 3300005334 Bacteria 2668
80 Ga0068869_100208818 3300005334 Bacteria 1543
81 Ga0068869_100260603 3300005334 Bacteria 1388
82 Ga0068869_100435121 3300005334 Bacteria 1085
83 Ga0070666_10000055 3300005335 Bacteria 92269
84 Ga0070666_10070040 3300005335 Bacteria 2385
85 Ga0070666_10076438 3300005335 Bacteria 2284
86 Ga0070666_10204927 3300005335 Bacteria 1388
87 Ga0070680_100012999 3300005336 Bacteria 6477
88 Ga0070680_100038489 3300005336 Bacteria 3868
89 Ga0070680_100073505 3300005336 Unclassified 2812
90 Ga0070680_100132853 3300005336 Bacteria 2083
91 Ga0070680_100150644 3300005336 Bacteria 1952
92 Ga0070682_100000041 3300005337 Bacteria 142152
93 Ga0070682_100079918 3300005337 Bacteria 2113
94 Ga0070682_100247259 3300005337 Bacteria 1284
95 Ga0068868_100004611 3300005338 Bacteria 9667
96 Ga0068868_100016572 3300005338 Bacteria 5477
97 Ga0068868_100024924 3300005338 Bacteria 4543
98 Ga0068868_100044769 3300005338 Bacteria 3460
99 Ga0068868_100046339 3300005338 Bacteria 3403
100 Ga0068868_100090167 3300005338 Bacteria 2469
101 Ga0068868_100100707 3300005338 Bacteria 2337
102 Ga0068868_100219617 3300005338 Unclassified 1591
103 Ga0068868_100238296 3300005338 Bacteria 1527
104 Ga0070660_100003081 3300005339 Bacteria 11468
105 Ga0070660_100003088 3300005339 Bacteria 11447
106 Ga0070660_100173837 3300005339 Bacteria 1741
107 Ga0070660_100341269 3300005339 Bacteria 1232
108 Ga0070660_100440971 3300005339 Bacteria 1080
109 Ga0070689_100011119 3300005340 Bacteria 6439
110 Ga0070689_100030362 3300005340 Unclassified 4102
111 Ga0070689_100148575 3300005340 Bacteria 1889
112 Ga0070691_10021468 3300005341 Bacteria 2988
113 Ga0070691_10036360 3300005341 Bacteria 2321
114 Ga0070687_100034158 3300005343 Unclassified 2515
115 Ga0070687_100037290 3300005343 Unclassified 2429
116 Ga0070687_100044338 3300005343 Bacteria 2265
117 Ga0070661_100001376 3300005344 Bacteria 16996
118 Ga0070661_100007905 3300005344 Bacteria 7344
119 Ga0070661_100010249 3300005344 Bacteria 6511
120 Ga0070668_100019363 3300005347 Bacteria 5123
121 Ga0070668_100038665 3300005347 Bacteria 3648
122 Ga0070668_100050922 3300005347 Bacteria 3190
123 Ga0070668_100170160 3300005347 Bacteria 1773
124 Ga0070668_100525570 3300005347 Bacteria 1027
125 Ga0070669_100029713 3300005353 Bacteria 3942
126 Ga0070669_100043207 3300005353 Bacteria 3281
127 Ga0070669_100064037 3300005353 Bacteria 2707
128 Ga0070669_100289376 3300005353 Bacteria 1315
129 Ga0070675_100047006 3300005354 Bacteria 3536
130 Ga0070675_100052264 3300005354 Unclassified 3359
131 Ga0070675_100064550 3300005354 Bacteria 3027
132 Ga0070675_100076044 3300005354 Bacteria 2792
133 Ga0070675_100119004 3300005354 Bacteria 2243
134 Ga0070675_100178113 3300005354 Bacteria 1837
135 Ga0070675_100322750 3300005354 Bacteria 1364
136 Ga0070671_100074135 3300005355 Bacteria 2843
137 Ga0070671_100093885 3300005355 Bacteria 2514
138 Ga0070671_100150018 3300005355 Unclassified 1968
139 Ga0070671_100184326 3300005355 Bacteria 1768
140 Ga0070671_100247144 3300005355 Bacteria 1515
141 Ga0070671_100577505 3300005355 Bacteria 971
142 Ga0070674_100022849 3300005356 Bacteria 4037
143 Ga0070674_100035562 3300005356 Bacteria 3337
144 Ga0070674_100269428 3300005356 Bacteria 1345
145 Ga0070673_100016889 3300005364 Bacteria 5175
146 Ga0070673_100026959 3300005364 Bacteria 4253
147 Ga0070673_100049484 3300005364 Bacteria 3282
148 Ga0070673_100199346 3300005364 Bacteria 1723
149 Ga0070673_100255583 3300005364 Bacteria 1529
150 Ga0070673_100370584 3300005364 Bacteria 1275
151 Ga0070688_100008926 3300005365 Bacteria 5458
152 Ga0070688_100010064 3300005365 Bacteria 5198
153 Ga0070688_100110538 3300005365 Bacteria 1827
154 Ga0070659_100015884 3300005366 Bacteria 5647
155 Ga0070659_100017088 3300005366 Bacteria 5453
156 Ga0070659_100137850 3300005366 Bacteria 1985
157 Ga0070667_100016479 3300005367 Bacteria 6116
158 Ga0070667_100020920 3300005367 Bacteria 5435
159 Ga0070667_100023520 3300005367 Bacteria 5113
160 Ga0070667_100062801 3300005367 Bacteria 3146
161 Ga0070667_100147648 3300005367 Bacteria 2063
162 Ga0070667_100305840 3300005367 Bacteria 1432
163 Ga0070667_100445836 3300005367 Bacteria 1182
164 Ga0070701_10017095 3300005438 Unclassified 3386
165 Ga0070701_10034905 3300005438 Bacteria 2523
166 Ga0070663_100007273 3300005455 Bacteria 6730
167 Ga0070678_100066318 3300005456 Bacteria 2683
168 Ga0070678_100640324 3300005456 Bacteria 953
169 Ga0070662_100034025 3300005457 Bacteria 3591
170 Ga0070662_100095012 3300005457 Bacteria 2246
171 Ga0070681_10091204 3300005458 Bacteria 2997
172 Ga0070681_10115038 3300005458 Bacteria 2628
173 Ga0068867_100008127 3300005459 Bacteria 7413
174 Ga0068867_100013549 3300005459 Bacteria 5774
175 Ga0068867_100016141 3300005459 Bacteria 5305
176 Ga0068867_100059980 3300005459 Bacteria 2821
177 Ga0068867_100065780 3300005459 Bacteria 2699
178 Ga0068867_100094962 3300005459 Bacteria 2268
179 Ga0068867_100153421 3300005459 Unclassified 1811
180 Ga0068867_100172702 3300005459 Bacteria 1713
181 Ga0068867_100288863 3300005459 Unclassified 1347
182 Ga0070685_10017726 3300005466 Bacteria 3816
183 Ga0070698_100000061 3300005471 Bacteria 78637
184 Ga0070698_100005877 3300005471 Bacteria 13398
185 Ga0070698_100054790 3300005471 Bacteria 4048
186 Ga0070698_100238899 3300005471 Bacteria 1750
187 Ga0070699_100036344 3300005518 Bacteria 4261
188 Ga0070699_100328151 3300005518 Unclassified 1376
189 Ga0070679_100004260 3300005530 Bacteria 13202
190 Ga0070679_100005513 3300005530 Bacteria 11724
191 Ga0070679_100022012 3300005530 Bacteria 6226
192 Ga0070679_100038659 3300005530 Bacteria 4744
193 Ga0070679_100063078 3300005530 Bacteria 3694
194 Ga0070679_100074374 3300005530 Bacteria 3388
195 Ga0070679_100106351 3300005530 Bacteria 2792
196 Ga0070684_100003135 3300005535 Bacteria 12340
197 Ga0070684_100004694 3300005535 Bacteria 10432
198 Ga0070684_100005199 3300005535 Bacteria 9950
199 Ga0070684_100043434 3300005535 Bacteria 3882
200 Ga0070684_100053275 3300005535 Bacteria 3521
201 Ga0070684_100307185 3300005535 Bacteria 1456
202 Ga0068853_100001210 3300005539 Bacteria 18401
203 Ga0068853_100001749 3300005539 Bacteria 15939
204 Ga0068853_100053579 3300005539 Bacteria 3474
205 Ga0068853_100057886 3300005539 Bacteria 3345
206 Ga0068853_100060990 3300005539 Bacteria 3261
207 Ga0068853_100079277 3300005539 Bacteria 2872
208 Ga0068853_100193958 3300005539 Bacteria 1846
209 Ga0068853_100229240 3300005539 Bacteria 1699
210 Ga0068853_100231884 3300005539 Bacteria 1689
211 Ga0068853_100371980 3300005539 Bacteria 1333
212 Ga0070672_100013858 3300005543 Bacteria 5702
213 Ga0070672_100088106 3300005543 Bacteria 2499
214 Ga0070672_100105454 3300005543 Unclassified 2292
215 Ga0070672_100112936 3300005543 Unclassified 2217
216 Ga0070672_100132230 3300005543 Bacteria 2052
217 Ga0070672_100139504 3300005543 Bacteria 1998
218 Ga0070672_100202774 3300005543 Bacteria 1659
219 Ga0070672_100283698 3300005543 Bacteria 1401
220 Ga0070672_100411476 3300005543 Bacteria 1160
221 Ga0070672_100412628 3300005543 Bacteria 1159
222 Ga0070686_100015822 3300005544 Bacteria 4380
223 Ga0070686_100083132 3300005544 Bacteria 2125
224 Ga0070665_100000014 3300005548 Bacteria 484881
225 Ga0070665_100044176 3300005548 Bacteria 4475
226 Ga0070665_100175600 3300005548 Bacteria 2143
227 Ga0070665_100415359 3300005548 Bacteria 1354
228 Ga0068855_100004618 3300005563 Bacteria 16804
229 Ga0068855_100008908 3300005563 Bacteria 12130
230 Ga0068855_100032614 3300005563 Bacteria 6218
231 Ga0068855_100071409 3300005563 Bacteria 4037
232 Ga0068855_100090889 3300005563 Bacteria 3522
233 Ga0068855_100097089 3300005563 Bacteria 3394
234 Ga0068855_100135543 3300005563 Bacteria 2809
235 Ga0068855_100144269 3300005563 Bacteria 2712
236 Ga0068855_100166587 3300005563 Bacteria 2498
237 Ga0068855_100184370 3300005563 Bacteria 2358
238 Ga0068855_100192186 3300005563 Bacteria 2302
239 Ga0070664_100024601 3300005564 Bacteria 4983
240 Ga0070664_100037259 3300005564 Bacteria 4088
241 Ga0070664_100038858 3300005564 Bacteria 4007
242 Ga0070664_100094129 3300005564 Bacteria 2598
243 Ga0070664_100320206 3300005564 Unclassified 1405
244 Ga0068857_100008662 3300005577 Bacteria 8803
245 Ga0068857_100023723 3300005577 Bacteria 5400
246 Ga0068857_100027180 3300005577 Bacteria 5047
247 Ga0068857_100045500 3300005577 Bacteria 3894
248 Ga0068857_100048603 3300005577 Unclassified 3766
249 Ga0068857_100065629 3300005577 Bacteria 3228
250 Ga0068857_100129045 3300005577 Bacteria 2279
251 Ga0068857_100173625 3300005577 Bacteria 1960
252 Ga0068857_100192414 3300005577 Bacteria 1858
253 Ga0068857_100289834 3300005577 Bacteria 1507
254 Ga0068857_100303707 3300005577 Bacteria 1471
255 Ga0068854_100022321 3300005578 Bacteria 4309
256 Ga0068854_100065653 3300005578 Unclassified 2639
257 Ga0068854_100083728 3300005578 Bacteria 2359
258 Ga0068854_100084927 3300005578 Bacteria 2343
259 Ga0068854_100145832 3300005578 Unclassified 1821
260 Ga0068856_100021407 3300005614 Bacteria 6286
261 Ga0068856_100024408 3300005614 Bacteria 5885
262 Ga0068856_100033821 3300005614 Bacteria 5006
263 Ga0068856_100117719 3300005614 Bacteria 2658
264 Ga0068856_100127663 3300005614 Bacteria 2547
265 Ga0068856_100238029 3300005614 Bacteria 1836
266 Ga0070702_100004198 3300005615 Bacteria 6554
267 Ga0070702_100114238 3300005615 Bacteria 1680
268 Ga0068852_100020905 3300005616 Bacteria 5211
269 Ga0068852_100028008 3300005616 Bacteria 4604
270 Ga0068852_100030211 3300005616 Bacteria 4458
271 Ga0068852_100030564 3300005616 Bacteria 4436
272 Ga0068852_100040292 3300005616 Bacteria 3940
273 Ga0068852_100059804 3300005616 Bacteria 3306
274 Ga0068852_100150061 3300005616 Bacteria 2167
275 Ga0068852_100163935 3300005616 Bacteria 2078
276 Ga0068852_100196228 3300005616 Bacteria 1908
277 Ga0068852_100588367 3300005616 Unclassified 1116
278 Ga0068859_100000003 3300005617 Bacteria 479218
279 Ga0068859_100000872 3300005617 Bacteria 30780
280 Ga0068859_100006944 3300005617 Bacteria 11498
281 Ga0068859_100009053 3300005617 Bacteria 10058
282 Ga0068859_100020269 3300005617 Bacteria 6674
283 Ga0068859_100045290 3300005617 Bacteria 4420
284 Ga0068859_100079543 3300005617 Bacteria 3318
285 Ga0068859_100162605 3300005617 Bacteria 2312
286 Ga0068859_100430454 3300005617 Bacteria 1416
287 Ga0068864_100023605 3300005618 Bacteria 5167
288 Ga0068864_100058196 3300005618 Bacteria 3340
289 Ga0068864_100150341 3300005618 Bacteria 2109
290 Ga0068864_100261967 3300005618 Bacteria 1609
291 Ga0068864_100661561 3300005618 Bacteria 1018
292 Ga0068866_10031537 3300005718 Bacteria 2554
293 Ga0068866_10052184 3300005718 Bacteria 2086
294 Ga0068866_10145016 3300005718 Unclassified 1368
295 Ga0068861_100001764 3300005719 Bacteria 13901
296 Ga0068861_100005990 3300005719 Bacteria 8263
297 Ga0068861_100097820 3300005719 Bacteria 2329
298 Ga0068861_100175467 3300005719 Bacteria 1780
299 Ga0068861_100189248 3300005719 Bacteria 1719
300 Ga0068861_100194889 3300005719 Bacteria 1696
301 Ga0068861_100665406 3300005719 Unclassified 964
302 Ga0068851_10009472 3300005834 Bacteria 4531
303 Ga0068851_10011720 3300005834 Bacteria 4116
304 Ga0068851_10058367 3300005834 Bacteria 1972
305 Ga0068851_10061289 3300005834 Bacteria 1928
306 Ga0068851_10088679 3300005834 Bacteria 1626
307 Ga0068870_10045932 3300005840 Bacteria 2289
308 Ga0068870_10087394 3300005840 Unclassified 1736
309 Ga0068870_10193676 3300005840 Bacteria 1228
310 Ga0068863_100020280 3300005841 Bacteria 6359
311 Ga0068863_100022024 3300005841 Bacteria 6083
312 Ga0068863_100053692 3300005841 Bacteria 3820
313 Ga0068863_100060131 3300005841 Bacteria 3593
314 Ga0068863_100083745 3300005841 Bacteria 3022
315 Ga0068863_100126984 3300005841 Bacteria 2434
316 Ga0068863_100500876 3300005841 Bacteria 1196
317 Ga0068858_100022366 3300005842 Bacteria 5902
318 Ga0068858_100193457 3300005842 Bacteria 1922
319 Ga0068858_100243533 3300005842 Bacteria 1707
320 Ga0068858_100671015 3300005842 Bacteria 1008
321 Ga0068860_100000024 3300005843 Bacteria 271902
322 Ga0068860_100001067 3300005843 Bacteria 30243
323 Ga0068860_100001494 3300005843 Bacteria 25241
324 Ga0068860_100003395 3300005843 Bacteria 16381
325 Ga0068860_100008704 3300005843 Bacteria 10110
326 Ga0068860_100012840 3300005843 Bacteria 8234
327 Ga0068860_100034993 3300005843 Bacteria 4819
328 Ga0068860_100043514 3300005843 Bacteria 4284
329 Ga0068860_100069709 3300005843 Bacteria 3342
330 Ga0068860_100075622 3300005843 Bacteria 3203
331 Ga0068860_100083614 3300005843 Bacteria 3036
332 Ga0068860_100151641 3300005843 Bacteria 2232
333 Ga0068860_100159738 3300005843 Bacteria 2173
334 Ga0068860_100392410 3300005843 Bacteria 1372
335 Ga0068862_100013758 3300005844 Bacteria 6705
336 Ga0068862_100088710 3300005844 Unclassified 2691
337 Ga0068862_100092346 3300005844 Bacteria 2638
338 Ga0068862_100110647 3300005844 Unclassified 2410
339 Ga0068862_100119107 3300005844 Unclassified 2325
340 Ga0068862_100231486 3300005844 Bacteria 1677
341 Ga0068862_100395951 3300005844 Unclassified 1291
342 Ga0068862_100409780 3300005844 Bacteria 1270
343 Ga0068862_100551809 3300005844 Bacteria 1100
344 Ga0081540_1018746 3300005983 Bacteria 4232
345 Ga0081539_10000714 3300005985 Bacteria 66625
346 Ga0081539_10006848 3300005985 Bacteria 10657
347 Ga0070716_100017561 3300006173 Unclassified 3712
348 Ga0075366_10051449 3300006195 Bacteria 2447
349 Ga0075366_10067583 3300006195 Bacteria 2127
350 Ga0075366_10185716 3300006195 Bacteria 1263
351 Ga0097621_100000109 3300006237 Bacteria 46477
352 Ga0097621_100006082 3300006237 Bacteria 8541
353 Ga0097621_100016559 3300006237 Bacteria 5577
354 Ga0097621_100049668 3300006237 Bacteria 3409
355 Ga0097621_100125382 3300006237 Bacteria 2181
356 Ga0097621_100186512 3300006237 Unclassified 1794
357 Ga0097621_100211817 3300006237 Bacteria 1686
358 Ga0097621_100268537 3300006237 Unclassified 1498
359 Ga0097621_100552437 3300006237 Unclassified 1048
360 Ga0068871_100002333 3300006358 Bacteria 12926
361 Ga0068871_100006775 3300006358 Bacteria 8139
362 Ga0068871_100007253 3300006358 Bacteria 7907
363 Ga0068871_100007800 3300006358 Bacteria 7664
364 Ga0068871_100025134 3300006358 Bacteria 4629
365 Ga0068871_100035111 3300006358 Bacteria 3983
366 Ga0068871_100184529 3300006358 Bacteria 1794
367 Ga0068871_100228955 3300006358 Bacteria 1613
368 Ga0068871_100323037 3300006358 Bacteria 1360
369 Ga0075428_100000528 3300006844 Bacteria 38898
370 Ga0075428_100012181 3300006844 Bacteria 9563
371 Ga0075428_100269030 3300006844 Unclassified 1834
372 Ga0075430_100002050 3300006846 Bacteria 16602
373 Ga0075431_100006556 3300006847 Bacteria 11564
374 Ga0075429_100001456 3300006880 Bacteria 19435
375 Ga0075429_100035722 3300006880 Bacteria 4323
376 Ga0068865_100037327 3300006881 Bacteria 3280
377 Ga0068865_100058052 3300006881 Bacteria 2702
378 Ga0068865_100058786 3300006881 Bacteria 2687
379 Ga0068865_100135640 3300006881 Bacteria 1849
380 Ga0068865_100531385 3300006881 Bacteria 985
381 Ga0097620_100000003 3300006931 Bacteria 479218
382 Ga0097620_100000872 3300006931 Bacteria 30780
383 Ga0097620_100006943 3300006931 Bacteria 11498
384 Ga0097620_100009053 3300006931 Bacteria 10058
385 Ga0097620_100020271 3300006931 Bacteria 6674
386 Ga0097620_100045286 3300006931 Bacteria 4420
387 Ga0097620_100079547 3300006931 Bacteria 3318
388 Ga0097620_100162609 3300006931 Bacteria 2312
389 Ga0097620_100430491 3300006931 Bacteria 1416
390 Ga0105240_10000106 3300009093 Bacteria 171825
391 Ga0105240_10000131 3300009093 Bacteria 154386
392 Ga0105240_10000895 3300009093 Bacteria 53295
393 Ga0105240_10002358 3300009093 Bacteria 30449
394 Ga0105240_10004054 3300009093 Bacteria 22536
395 Ga0105240_10004897 3300009093 Bacteria 20156
396 Ga0105240_10014654 3300009093 Bacteria 10699
397 Ga0105240_10043611 3300009093 Bacteria 5705
398 Ga0105240_10171129 3300009093 Bacteria 2573
399 Ga0111539_10006625 3300009094 Bacteria 14919
400 Ga0111539_10022172 3300009094 Bacteria 7806
401 Ga0111539_10067897 3300009094 Bacteria 4209
402 Ga0111539_10406827 3300009094 Unclassified 1585
403 Ga0105245_10059034 3300009098 Bacteria 3454
404 Ga0105247_10005677 3300009101 Bacteria 7818
405 Ga0105247_10045251 3300009101 Bacteria 2700
406 Ga0114129_10001087 3300009147 Bacteria 35667
407 Ga0114129_10042428 3300009147 Bacteria 6406
408 Ga0114129_10099489 3300009147 Unclassified 4025
409 Ga0114129_10499385 3300009147 Bacteria 1589
410 Ga0105241_10000085 3300009174 Bacteria 69963
411 Ga0105241_10002426 3300009174 Bacteria 13985
412 Ga0105241_10008671 3300009174 Bacteria 7473
413 Ga0105241_10063653 3300009174 Bacteria 2847
414 Ga0105241_10088407 3300009174 Bacteria 2440
415 Ga0105241_10095657 3300009174 Bacteria 2351
416 Ga0105241_10099900 3300009174 Bacteria 2305
417 Ga0105241_10124919 3300009174 Bacteria 2077
418 Ga0105241_10232326 3300009174 Bacteria 1555
419 Ga0105241_10585658 3300009174 Bacteria 1006
420 Ga0105242_10025041 3300009176 Unclassified 4717
421 Ga0105242_10036312 3300009176 Bacteria 3953
422 Ga0105242_10046712 3300009176 Bacteria 3514
423 Ga0105242_10073555 3300009176 Bacteria 2842
424 Ga0105242_10077974 3300009176 Bacteria 2765
425 Ga0105242_10285123 3300009176 Bacteria 1502
426 Ga0105242_10406310 3300009176 Bacteria 1272
427 Ga0105242_10512117 3300009176 Bacteria 1143
428 Ga0105248_10002485 3300009177 Bacteria 20490
429 Ga0105248_10112826 3300009177 Bacteria 3066
430 Ga0105237_10000512 3300009545 Bacteria 54825
431 Ga0105237_10002282 3300009545 Bacteria 23838
432 Ga0105237_10002430 3300009545 Bacteria 23126
433 Ga0105237_10017579 3300009545 Bacteria 7411
434 Ga0105237_10029968 3300009545 Bacteria 5528
435 Ga0105237_10031106 3300009545 Bacteria 5414
436 Ga0105237_10051523 3300009545 Bacteria 4134
437 Ga0105237_10103483 3300009545 Bacteria 2839
438 Ga0105238_10003933 3300009551 Bacteria 14745
439 Ga0105238_10075503 3300009551 Bacteria 3362
440 Ga0105238_10316425 3300009551 Bacteria 1546
441 Ga0105249_10000561 3300009553 Bacteria 34246
442 Ga0105249_10005594 3300009553 Bacteria 10867
443 Ga0105249_10008945 3300009553 Bacteria 8746
444 Ga0105249_10010629 3300009553 Bacteria 8085
445 Ga0105249_10018185 3300009553 Bacteria 6248
446 Ga0105249_10076176 3300009553 Bacteria 3109
447 Ga0105249_10091732 3300009553 Bacteria 2843
448 Ga0105249_10102479 3300009553 Bacteria 2694
449 Ga0105249_10123558 3300009553 Bacteria 2462
450 Ga0105249_10260966 3300009553 Bacteria 1722
451 Ga0105239_10000019 3300010375 Bacteria 273836
452 Ga0105239_10000384 3300010375 Bacteria 64479
453 Ga0105239_10000940 3300010375 Bacteria 41071
454 Ga0105239_10001470 3300010375 Bacteria 31340
455 Ga0105239_10012836 3300010375 Bacteria 9319
456 Ga0105239_10055088 3300010375 Bacteria 4362
457 Ga0105239_10076981 3300010375 Bacteria 3670
458 Ga0105239_10082415 3300010375 Bacteria 3542
459 Ga0105239_10095902 3300010375 Bacteria 3276
460 Ga0105239_10263308 3300010375 Bacteria 1938
461 Ga0105239_10287264 3300010375 Bacteria 1852
462 Ga0105239_10311445 3300010375 Bacteria 1774
463 Ga0105246_10170401 3300011119 Unclassified 1667
464 Ga0157373_10004266 3300013100 Bacteria 10765
465 Ga0157373_10014249 3300013100 Bacteria 5832
466 Ga0157373_10017251 3300013100 Bacteria 5257
467 Ga0157373_10032426 3300013100 Bacteria 3760
468 Ga0157373_10044269 3300013100 Bacteria 3178
469 Ga0157373_10084471 3300013100 Bacteria 2238
470 Ga0157373_10146918 3300013100 Bacteria 1658
471 Ga0157371_10000326 3300013102 Bacteria 61810
472 Ga0157371_10000668 3300013102 Bacteria 40664
473 Ga0157371_10000898 3300013102 Bacteria 33500
474 Ga0157371_10009540 3300013102 Bacteria 7634
475 Ga0157371_10016406 3300013102 Bacteria 5528
476 Ga0157371_10020440 3300013102 Bacteria 4872
477 Ga0157371_10021529 3300013102 Bacteria 4731
478 Ga0157371_10023387 3300013102 Bacteria 4519
479 Ga0157371_10024808 3300013102 Bacteria 4376
480 Ga0157371_10041554 3300013102 Bacteria 3280
481 Ga0157371_10056971 3300013102 Bacteria 2771
482 Ga0157371_10059898 3300013102 Bacteria 2699
483 Ga0157371_10086136 3300013102 Bacteria 2225
484 Ga0157371_10092465 3300013102 Unclassified 2143
485 Ga0157371_10139437 3300013102 Unclassified 1727
486 Ga0157370_10005618 3300013104 Bacteria 14028
487 Ga0157370_10022074 3300013104 Bacteria 6339
488 Ga0157370_10031858 3300013104 Bacteria 5153
489 Ga0157370_10051093 3300013104 Bacteria 3950
490 Ga0157370_10083350 3300013104 Bacteria 3006
491 Ga0157370_10150060 3300013104 Bacteria 2169
492 Ga0157370_10157588 3300013104 Bacteria 2112
493 Ga0157370_10244397 3300013104 Unclassified 1660
494 Ga0157370_10564901 3300013104 Bacteria 1043
495 Ga0157369_10013331 3300013105 Bacteria 9297
496 Ga0157369_10019051 3300013105 Bacteria 7684
497 Ga0157369_10023949 3300013105 Bacteria 6794
498 Ga0157369_10035821 3300013105 Bacteria 5441
499 Ga0157369_10046176 3300013105 Bacteria 4734
500 Ga0157369_10102026 3300013105 Bacteria 3058
501 Ga0157369_10113483 3300013105 Bacteria 2879
502 Ga0157369_10158110 3300013105 Bacteria 2393
503 Ga0157369_10165642 3300013105 Bacteria 2331
504 Ga0157369_10276641 3300013105 Bacteria 1748
505 Ga0157374_10000011 3300013296 Bacteria 466749
506 Ga0157374_10008165 3300013296 Bacteria 8946
507 Ga0157374_10011097 3300013296 Bacteria 7786
508 Ga0157374_10037083 3300013296 Bacteria 4471
509 Ga0157374_10079191 3300013296 Bacteria 3113
510 Ga0157374_10153850 3300013296 Bacteria 2237
511 Ga0157374_10162521 3300013296 Bacteria 2175
512 Ga0157374_10194611 3300013296 Bacteria 1984
513 Ga0157374_10250954 3300013296 Bacteria 1741
514 Ga0157378_10009840 3300013297 Bacteria 8338
515 Ga0157378_10016682 3300013297 Bacteria 6435
516 Ga0157378_10024055 3300013297 Bacteria 5358
517 Ga0157378_10040519 3300013297 Bacteria 4130
518 Ga0157378_10076193 3300013297 Unclassified 3022
519 Ga0157378_10101348 3300013297 Bacteria 2630
520 Ga0157378_10129134 3300013297 Bacteria 2338
521 Ga0157378_10137283 3300013297 Unclassified 2268
522 Ga0157378_10383958 3300013297 Bacteria 1380
523 Ga0157378_10387849 3300013297 Bacteria 1373
524 Ga0157378_10863588 3300013297 Bacteria 934
525 Ga0163162_10000446 3300013306 Bacteria 38191
526 Ga0163162_10000579 3300013306 Bacteria 33893
527 Ga0163162_10000687 3300013306 Bacteria 31377
528 Ga0163162_10001718 3300013306 Bacteria 20509
529 Ga0163162_10006585 3300013306 Bacteria 11256
530 Ga0163162_10010061 3300013306 Bacteria 9196
531 Ga0163162_10018072 3300013306 Bacteria 6901
532 Ga0163162_10020425 3300013306 Bacteria 6509
533 Ga0163162_10030106 3300013306 Bacteria 5377
534 Ga0163162_10031855 3300013306 Bacteria 5232
535 Ga0163162_10044992 3300013306 Bacteria 4422
536 Ga0163162_10082439 3300013306 Bacteria 3288
537 Ga0163162_10152921 3300013306 Bacteria 2426
538 Ga0163162_10258425 3300013306 Bacteria 1873
539 Ga0163162_10450046 3300013306 Bacteria 1420
540 Ga0163162_10478854 3300013306 Unclassified 1376
541 Ga0163162_10620888 3300013306 Unclassified 1206
542 Ga0157372_10001462 3300013307 Bacteria 25620
543 Ga0157372_10003195 3300013307 Bacteria 17687
544 Ga0157372_10005014 3300013307 Bacteria 14064
545 Ga0157372_10007311 3300013307 Bacteria 11757
546 Ga0157372_10039260 3300013307 Bacteria 5225
547 Ga0157372_10045238 3300013307 Bacteria 4882
548 Ga0157372_10048682 3300013307 Bacteria 4712
549 Ga0157372_10051327 3300013307 Bacteria 4589
550 Ga0157372_10070599 3300013307 Bacteria 3930
551 Ga0157372_10084813 3300013307 Bacteria 3592
552 Ga0157372_10102864 3300013307 Bacteria 3263
553 Ga0157372_10115544 3300013307 Bacteria 3077
554 Ga0157372_10117877 3300013307 Bacteria 3045
555 Ga0157372_10159249 3300013307 Bacteria 2608
556 Ga0157372_10294338 3300013307 Bacteria 1888
557 Ga0157372_10298464 3300013307 Bacteria 1874
558 Ga0157372_10358567 3300013307 Bacteria 1699
559 Ga0157372_10392172 3300013307 Bacteria 1618
560 Ga0157372_10587223 3300013307 Unclassified 1298
561 Ga0157372_10740720 3300013307 Bacteria 1143
562 Ga0157375_10002298 3300013308 Bacteria 16512
563 Ga0157375_10019039 3300013308 Bacteria 6233
564 Ga0157375_10038344 3300013308 Bacteria 4601
565 Ga0157375_10059068 3300013308 Bacteria 3797
566 Ga0157375_10093984 3300013308 Bacteria 3066
567 Ga0157375_10103890 3300013308 Bacteria 2929
568 Ga0157375_10126175 3300013308 Bacteria 2674
569 Ga0157375_10147066 3300013308 Bacteria 2488
570 Ga0157375_10196858 3300013308 Bacteria 2170
571 Ga0157375_10420558 3300013308 Bacteria 1502
572 Ga0157375_10547696 3300013308 Unclassified 1319
573 Ga0157375_10790987 3300013308 Bacteria 1098
574 Ga0163163_10000325 3300014325 Bacteria 46201
575 Ga0163163_10000401 3300014325 Bacteria 40925
576 Ga0163163_10002269 3300014325 Bacteria 16219
577 Ga0163163_10072715 3300014325 Bacteria 3428
578 Ga0163163_10130995 3300014325 Bacteria 2548
579 Ga0163163_10140983 3300014325 Bacteria 2453
580 Ga0163163_10268279 3300014325 Bacteria 1758
581 Ga0163163_10369744 3300014325 Bacteria 1491
582 Ga0163163_10437765 3300014325 Unclassified 1367
583 Ga0157380_10020971 3300014326 Bacteria 4895
584 Ga0157380_10107982 3300014326 Unclassified 2332
585 Ga0157380_10125749 3300014326 Bacteria 2179
586 Ga0157380_10182492 3300014326 Unclassified 1845
587 Ga0157380_10248197 3300014326 Bacteria 1609
588 Ga0157377_10008604 3300014745 Bacteria 4981
589 Ga0157377_10010405 3300014745 Bacteria 4601
590 Ga0157377_10013802 3300014745 Bacteria 4095
591 Ga0157377_10014081 3300014745 Bacteria 4063
592 Ga0157377_10031414 3300014745 Bacteria 2886
593 Ga0157377_10197240 3300014745 Bacteria 1276
594 Ga0157379_10018323 3300014968 Bacteria 6172
595 Ga0157379_10027729 3300014968 Bacteria 5041
596 Ga0157379_10103462 3300014968 Bacteria 2555
597 Ga0157379_10400741 3300014968 Bacteria 1261
598 Ga0157376_10002607 3300014969 Bacteria 12248
599 Ga0157376_10007180 3300014969 Bacteria 7920
600 Ga0157376_10035020 3300014969 Bacteria 4058
601 Ga0157376_10049080 3300014969 Bacteria 3495
602 Ga0157376_10060866 3300014969 Bacteria 3172
603 Ga0157376_10074918 3300014969 Bacteria 2886
604 Ga0157376_10083825 3300014969 Bacteria 2743
605 Ga0157376_10136357 3300014969 Unclassified 2196
606 Ga0157376_10591673 3300014969 Bacteria 1103
607 Ga0163161_10008477 3300017792 Bacteria 7118
608 Ga0163161_10033267 3300017792 Bacteria 3684
609 Ga0163161_10083568 3300017792 Bacteria 2353
610 Ga0163161_10116620 3300017792 Bacteria 2002
611 Ga0163161_10219436 3300017792 Bacteria 1472
612 Ga0213876_10019087 3300021384 Bacteria 3620
613 Ga0209436_101913 3300025208 Bacteria 6710
614 Ga0209258_100098 3300025242 Bacteria 215216
615 Ga0209646_1000578 3300025246 Bacteria 15188
616 Ga0209148_1000120 3300025254 Bacteria 186836
617 Ga0209673_1000016 3300025273 Bacteria 506202
618 Ga0209130_1001317 3300025284 Bacteria 16940
619 Ga0209564_1009149 3300025295 Bacteria 4762
620 Ga0209758_1022176 3300025297 Bacteria 2927
621 Ga0209050_1000124 3300025298 Bacteria 194022
622 Ga0209050_1001667 3300025298 Bacteria 22432
623 Ga0207426_1000040 3300025302 Bacteria 433920
624 Ga0207426_1000139 3300025302 Bacteria 195835
625 Ga0207426_1001136 3300025302 Bacteria 24056
626 Ga0209257_1000013 3300025304 Bacteria 1047305
627 Ga0209257_1000658 3300025304 Bacteria 54552
628 Ga0207697_10007616 3300025315 Bacteria 4809
629 Ga0207656_10010753 3300025321 Bacteria 3438
630 Ga0207656_10019984 3300025321 Bacteria 2655
631 Ga0207656_10100464 3300025321 Unclassified 1326
632 Ga0207682_10003295 3300025893 Bacteria 7053
633 Ga0207642_10128333 3300025899 Bacteria 1319
634 Ga0207710_10001225 3300025900 Bacteria 13013
635 Ga0207688_10020012 3300025901 Bacteria 3651
636 Ga0207680_10000021 3300025903 Bacteria 87712
637 Ga0207647_10000025 3300025904 Bacteria 112150
638 Ga0207647_10025385 3300025904 Bacteria 3894
639 Ga0207647_10034227 3300025904 Bacteria 3245
640 Ga0207647_10047931 3300025904 Bacteria 2655
641 Ga0207647_10243950 3300025904 Bacteria 1031
642 Ga0207645_10000748 3300025907 Bacteria 27039
643 Ga0207645_10038081 3300025907 Bacteria 3085
644 Ga0207643_10003612 3300025908 Bacteria 8341
645 Ga0207643_10005299 3300025908 Bacteria 6902
646 Ga0207643_10022737 3300025908 Bacteria 3455
647 Ga0207643_10096252 3300025908 Bacteria 1731
648 Ga0207705_10016349 3300025909 Bacteria 5320
649 Ga0207705_10038181 3300025909 Bacteria 3438
650 Ga0207705_10052204 3300025909 Bacteria 2943
651 Ga0207705_10067316 3300025909 Bacteria 2592
652 Ga0207684_10260816 3300025910 Bacteria 1495
653 Ga0207654_10015275 3300025911 Bacteria 3981
654 Ga0207654_10115343 3300025911 Bacteria 1678
655 Ga0207707_10016034 3300025912 Bacteria 6534
656 Ga0207707_10049374 3300025912 Bacteria 3666
657 Ga0207707_10295871 3300025912 Bacteria 1400
658 Ga0207695_10000087 3300025913 Bacteria 276412
659 Ga0207695_10000217 3300025913 Bacteria 155047
660 Ga0207695_10000522 3300025913 Bacteria 81461
661 Ga0207695_10000582 3300025913 Bacteria 74405
662 Ga0207695_10000909 3300025913 Bacteria 53303
663 Ga0207695_10008314 3300025913 Bacteria 13003
664 Ga0207695_10019969 3300025913 Bacteria 7691
665 Ga0207695_10026064 3300025913 Bacteria 6531
666 Ga0207695_10092901 3300025913 Bacteria 3027
667 Ga0207695_10113992 3300025913 Bacteria 2679
668 Ga0207695_10272097 3300025913 Bacteria 1589
669 Ga0207671_10001101 3300025914 Bacteria 32578
670 Ga0207671_10002074 3300025914 Bacteria 21929
671 Ga0207671_10005577 3300025914 Bacteria 11557
672 Ga0207671_10006522 3300025914 Bacteria 10370
673 Ga0207671_10009392 3300025914 Bacteria 8176
674 Ga0207671_10032937 3300025914 Bacteria 3857
675 Ga0207671_10068444 3300025914 Bacteria 2645
676 Ga0207660_10030770 3300025917 Bacteria 3690
677 Ga0207660_10471105 3300025917 Bacteria 1017
678 Ga0207662_10032572 3300025918 Bacteria 3035
679 Ga0207662_10060977 3300025918 Bacteria 2264
680 Ga0207657_10003852 3300025919 Bacteria 15932
681 Ga0207657_10034904 3300025919 Bacteria 4515
682 Ga0207657_10097305 3300025919 Bacteria 2447
683 Ga0207657_10179047 3300025919 Unclassified 1714
684 Ga0207657_10269224 3300025919 Bacteria 1354
685 Ga0207657_10349482 3300025919 Unclassified 1166
686 Ga0207649_10002669 3300025920 Bacteria 9894
687 Ga0207649_10007975 3300025920 Bacteria 5762
688 Ga0207649_10249286 3300025920 Bacteria 1278
689 Ga0207652_10000051 3300025921 Bacteria 120327
690 Ga0207652_10000633 3300025921 Bacteria 34817
691 Ga0207652_10026129 3300025921 Bacteria 4860
692 Ga0207652_10042720 3300025921 Bacteria 3860
693 Ga0207652_10065543 3300025921 Bacteria 3146
694 Ga0207652_10087251 3300025921 Bacteria 2736
695 Ga0207652_10244998 3300025921 Bacteria 1616
696 Ga0207646_10156003 3300025922 Bacteria 2059
697 Ga0207681_10041081 3300025923 Bacteria 3081
698 Ga0207681_10086048 3300025923 Bacteria 2232
699 Ga0207681_10398219 3300025923 Bacteria 1111
700 Ga0207694_10072267 3300025924 Bacteria 2697
701 Ga0207694_10214730 3300025924 Bacteria 1568
702 Ga0207650_10000730 3300025925 Bacteria 25353
703 Ga0207650_10037296 3300025925 Bacteria 3541
704 Ga0207650_10061023 3300025925 Bacteria 2814
705 Ga0207650_10130872 3300025925 Unclassified 1963
706 Ga0207650_10139615 3300025925 Bacteria 1904
707 Ga0207650_10149232 3300025925 Bacteria 1844
708 Ga0207650_10177167 3300025925 Bacteria 1698
709 Ga0207650_10207238 3300025925 Bacteria 1573
710 Ga0207650_10223035 3300025925 Bacteria 1518
711 Ga0207650_10250938 3300025925 Unclassified 1432
712 Ga0207650_10276585 3300025925 Unclassified 1366
713 Ga0207650_10283033 3300025925 Bacteria 1351
714 Ga0207659_10021036 3300025926 Bacteria 4324
715 Ga0207659_10059546 3300025926 Bacteria 2746
716 Ga0207659_10074828 3300025926 Bacteria 2483
717 Ga0207659_10145101 3300025926 Unclassified 1847
718 Ga0207644_10019394 3300025931 Bacteria 4613
719 Ga0207644_10079812 3300025931 Bacteria 2415
720 Ga0207644_10115163 3300025931 Bacteria 2038
721 Ga0207644_10123976 3300025931 Bacteria 1970
722 Ga0207644_10144903 3300025931 Bacteria 1833
723 Ga0207644_10149600 3300025931 Bacteria 1806
724 Ga0207690_10007408 3300025932 Bacteria 6515
725 Ga0207690_10009343 3300025932 Bacteria 5824
726 Ga0207690_10014109 3300025932 Bacteria 4818
727 Ga0207690_10036137 3300025932 Bacteria 3196
728 Ga0207690_10070539 3300025932 Bacteria 2407
729 Ga0207706_10007108 3300025933 Bacteria 10357
730 Ga0207706_10017416 3300025933 Bacteria 6471
731 Ga0207686_10000977 3300025934 Bacteria 17010
732 Ga0207686_10161546 3300025934 Bacteria 1570
733 Ga0207686_10452972 3300025934 Bacteria 987
734 Ga0207670_10007047 3300025936 Bacteria 6260
735 Ga0207670_10094913 3300025936 Bacteria 2117
736 Ga0207670_10277765 3300025936 Bacteria 1304
737 Ga0207669_10013989 3300025937 Bacteria 4008
738 Ga0207669_10024254 3300025937 Bacteria 3257
739 Ga0207669_10057689 3300025937 Bacteria 2365
740 Ga0207704_10059642 3300025938 Bacteria 2357
741 Ga0207704_10127967 3300025938 Bacteria 1752
742 Ga0207704_10418539 3300025938 Bacteria 1062
743 Ga0207704_10482246 3300025938 Bacteria 996
744 Ga0207691_10021281 3300025940 Bacteria 6125
745 Ga0207691_10035730 3300025940 Bacteria 4609
746 Ga0207691_10044522 3300025940 Bacteria 4085
747 Ga0207691_10045725 3300025940 Bacteria 4024
748 Ga0207691_10051530 3300025940 Bacteria 3763
749 Ga0207691_10085460 3300025940 Bacteria 2831
750 Ga0207691_10091714 3300025940 Bacteria 2722
751 Ga0207691_10252919 3300025940 Bacteria 1520
752 Ga0207691_10381804 3300025940 Bacteria 1203
753 Ga0207711_10128224 3300025941 Bacteria 2272
754 Ga0207689_10000628 3300025942 Bacteria 33617
755 Ga0207689_10007312 3300025942 Bacteria 9693
756 Ga0207689_10026457 3300025942 Bacteria 4858
757 Ga0207689_10026582 3300025942 Bacteria 4848
758 Ga0207689_10041325 3300025942 Bacteria 3815
759 Ga0207689_10050585 3300025942 Bacteria 3426
760 Ga0207689_10099058 3300025942 Bacteria 2395
761 Ga0207689_10102121 3300025942 Bacteria 2355
762 Ga0207689_10144372 3300025942 Unclassified 1961
763 Ga0207689_10157284 3300025942 Bacteria 1873
764 Ga0207661_10004686 3300025944 Bacteria 9579
765 Ga0207661_10022692 3300025944 Bacteria 4731
766 Ga0207661_10023969 3300025944 Bacteria 4617
767 Ga0207661_10049792 3300025944 Unclassified 3336
768 Ga0207661_10092258 3300025944 Bacteria 2524
769 Ga0207661_10201229 3300025944 Bacteria 1751
770 Ga0207679_10008941 3300025945 Bacteria 6397
771 Ga0207679_10029132 3300025945 Bacteria 3841
772 Ga0207679_10052171 3300025945 Bacteria 2998
773 Ga0207679_10201863 3300025945 Bacteria 1661
774 Ga0207679_10235237 3300025945 Unclassified 1549
775 Ga0207679_10319927 3300025945 Unclassified 1343
776 Ga0207679_10438471 3300025945 Bacteria 1156
777 Ga0207667_10000749 3300025949 Bacteria 42187
778 Ga0207667_10000936 3300025949 Bacteria 37241
779 Ga0207667_10004188 3300025949 Bacteria 17720
780 Ga0207667_10013273 3300025949 Bacteria 9438
781 Ga0207667_10025535 3300025949 Bacteria 6466
782 Ga0207667_10029606 3300025949 Bacteria 5937
783 Ga0207667_10078620 3300025949 Bacteria 3419
784 Ga0207667_10251321 3300025949 Bacteria 1808
785 Ga0207651_10002063 3300025960 Bacteria 9463
786 Ga0207651_10093367 3300025960 Bacteria 2209
787 Ga0207651_10146394 3300025960 Bacteria 1832
788 Ga0207651_10193664 3300025960 Unclassified 1623
789 Ga0207651_10543719 3300025960 Bacteria 1009
790 Ga0207651_10626161 3300025960 Bacteria 943
791 Ga0207712_10000844 3300025961 Bacteria 22396
792 Ga0207712_10001111 3300025961 Bacteria 18799
793 Ga0207712_10003901 3300025961 Bacteria 9419
794 Ga0207712_10004398 3300025961 Bacteria 8905
795 Ga0207712_10004528 3300025961 Bacteria 8776
796 Ga0207712_10038033 3300025961 Bacteria 3288
797 Ga0207712_10071705 3300025961 Bacteria 2492
798 Ga0207712_10206959 3300025961 Bacteria 1560
799 Ga0207712_10261662 3300025961 Bacteria 1403
800 Ga0207668_10014070 3300025972 Bacteria 4947
801 Ga0207668_10032875 3300025972 Bacteria 3433
802 Ga0207640_10037196 3300025981 Bacteria 3061
803 Ga0207640_10037747 3300025981 Bacteria 3042
804 Ga0207640_10042355 3300025981 Bacteria 2903
805 Ga0207640_10144195 3300025981 Unclassified 1740
806 Ga0207658_10009068 3300025986 Bacteria 6747
807 Ga0207658_10017648 3300025986 Bacteria 4921
808 Ga0207658_10041616 3300025986 Bacteria 3328
809 Ga0207658_10101184 3300025986 Bacteria 2258
810 Ga0207658_10111090 3300025986 Bacteria 2167
811 Ga0207658_10366366 3300025986 Bacteria 1259
812 Ga0207677_10008822 3300026023 Bacteria 5649
813 Ga0207677_10023169 3300026023 Bacteria 3829
814 Ga0207677_10039983 3300026023 Bacteria 3088
815 Ga0207677_10047154 3300026023 Unclassified 2891
816 Ga0207677_10241327 3300026023 Bacteria 1462
817 Ga0207677_10247571 3300026023 Unclassified 1446
818 Ga0207677_10496979 3300026023 Bacteria 1054
819 Ga0207703_10005370 3300026035 Bacteria 10322
820 Ga0207703_10097591 3300026035 Bacteria 2483
821 Ga0207703_10204813 3300026035 Unclassified 1755
822 Ga0207639_10001239 3300026041 Bacteria 17289
823 Ga0207639_10013725 3300026041 Bacteria 5680
824 Ga0207639_10046531 3300026041 Bacteria 3274
825 Ga0207639_10067229 3300026041 Bacteria 2788
826 Ga0207639_10092456 3300026041 Bacteria 2424
827 Ga0207639_10108061 3300026041 Bacteria 2261
828 Ga0207639_10160390 3300026041 Bacteria 1894
829 Ga0207639_10305911 3300026041 Bacteria 1407
830 Ga0207678_10039950 3300026067 Bacteria 4069
831 Ga0207678_10057567 3300026067 Bacteria 3345
832 Ga0207678_10108391 3300026067 Bacteria 2369
833 Ga0207708_10017910 3300026075 Bacteria 5331
834 Ga0207708_10046170 3300026075 Bacteria 3318
835 Ga0207702_10031283 3300026078 Bacteria 4436
836 Ga0207702_10033893 3300026078 Bacteria 4267
837 Ga0207702_10035921 3300026078 Bacteria 4144
838 Ga0207702_10045451 3300026078 Bacteria 3693
839 Ga0207702_10385944 3300026078 Bacteria 1348
840 Ga0207641_10000318 3300026088 Bacteria 59432
841 Ga0207641_10000442 3300026088 Bacteria 47467
842 Ga0207641_10020809 3300026088 Bacteria 5392
843 Ga0207641_10110366 3300026088 Bacteria 2437
844 Ga0207641_10112634 3300026088 Bacteria 2414
845 Ga0207641_10171576 3300026088 Bacteria 1980
846 Ga0207641_10186810 3300026088 Bacteria 1902
847 Ga0207641_10295590 3300026088 Bacteria 1528
848 Ga0207648_10000372 3300026089 Bacteria 49262
849 Ga0207648_10005357 3300026089 Bacteria 12934
850 Ga0207648_10054623 3300026089 Bacteria 3488
851 Ga0207648_10055067 3300026089 Bacteria 3472
852 Ga0207648_10058257 3300026089 Bacteria 3369
853 Ga0207648_10059177 3300026089 Bacteria 3341
854 Ga0207648_10092980 3300026089 Bacteria 2637
855 Ga0207648_10100411 3300026089 Bacteria 2535
856 Ga0207648_10228913 3300026089 Bacteria 1653
857 Ga0207648_10249038 3300026089 Bacteria 1584
858 Ga0207648_10283950 3300026089 Bacteria 1481
859 Ga0207648_10289000 3300026089 Unclassified 1468
860 Ga0207676_10008995 3300026095 Bacteria 7106
861 Ga0207676_10026560 3300026095 Bacteria 4307
862 Ga0207676_10045020 3300026095 Bacteria 3407
863 Ga0207676_10047297 3300026095 Bacteria 3333
864 Ga0207676_10143714 3300026095 Bacteria 2046
865 Ga0207676_10148127 3300026095 Bacteria 2018
866 Ga0207676_10397793 3300026095 Bacteria 1287
867 Ga0207674_10008317 3300026116 Bacteria 12006
868 Ga0207674_10010951 3300026116 Bacteria 10207
869 Ga0207674_10014298 3300026116 Bacteria 8771
870 Ga0207674_10037558 3300026116 Bacteria 5036
871 Ga0207674_10062630 3300026116 Bacteria 3757
872 Ga0207674_10064718 3300026116 Bacteria 3688
873 Ga0207674_10067535 3300026116 Bacteria 3599
874 Ga0207674_10078738 3300026116 Bacteria 3301
875 Ga0207674_10159572 3300026116 Bacteria 2210
876 Ga0207674_10233262 3300026116 Bacteria 1788
877 Ga0207674_10241471 3300026116 Bacteria 1753
878 Ga0207675_100001072 3300026118 Bacteria 27156
879 Ga0207675_100004328 3300026118 Bacteria 13719
880 Ga0207675_100049740 3300026118 Bacteria 3911
881 Ga0207675_100056264 3300026118 Bacteria 3669
882 Ga0207675_100148447 3300026118 Unclassified 2230
883 Ga0207675_100156092 3300026118 Bacteria 2175
884 Ga0207675_100160928 3300026118 Bacteria 2141
885 Ga0207675_100333935 3300026118 Bacteria 1482
886 Ga0207675_100598958 3300026118 Bacteria 1105
887 Ga0207683_10001617 3300026121 Bacteria 20205
888 Ga0207683_10037479 3300026121 Bacteria 4222
889 Ga0207683_10064287 3300026121 Bacteria 3233
890 Ga0207683_10079932 3300026121 Bacteria 2900
891 Ga0207683_10108964 3300026121 Bacteria 2479
892 Ga0207698_10005710 3300026142 Bacteria 7708
893 Ga0207698_10007833 3300026142 Bacteria 6718
894 Ga0207698_10036469 3300026142 Bacteria 3610
895 Ga0207698_10054047 3300026142 Bacteria 3087
896 Ga0207698_10070194 3300026142 Bacteria 2774
897 Ga0207698_10080320 3300026142 Bacteria 2626
898 Ga0207698_10084693 3300026142 Bacteria 2571
899 Ga0207698_10102487 3300026142 Bacteria 2376
900 Ga0207698_10573399 3300026142 Bacteria 1109
901 Ga0209995_1017727 3300027471 Unclassified 1172
902 Ga0209974_10024122 3300027876 Unclassified 2013
903 Ga0207428_10053311 3300027907 Unclassified 3226
904 Ga0268266_10000048 3300028379 Bacteria 310336
905 Ga0268266_10103695 3300028379 Bacteria 2510
906 Ga0268265_10009494 3300028380 Bacteria 6570
907 Ga0268265_10086443 3300028380 Unclassified 2492
908 Ga0268264_10000028 3300028381 Bacteria 426662
909 Ga0268264_10000558 3300028381 Bacteria 45913
910 Ga0268264_10001559 3300028381 Bacteria 21251
911 Ga0268264_10008151 3300028381 Bacteria 8708
912 Ga0268264_10016734 3300028381 Bacteria 6003
913 Ga0268264_10026939 3300028381 Bacteria 4695
914 Ga0268264_10053315 3300028381 Bacteria 3373
915 Ga0268264_10064713 3300028381 Bacteria 3078
916 Ga0268264_10068487 3300028381 Bacteria 2999
917 Ga0307517_10000268 3300028786 Bacteria 89531
918 Ga0307515_10001257 3300028794 Bacteria 57814
919 Ga0307511_10000076 3300030521 Bacteria 82520
920 Ga0265327_10000013 3300031251 Bacteria 519549
921 Ga0265327_10000152 3300031251 Bacteria 149065
922 Ga0265327_10002463 3300031251 Bacteria 19492
923 Ga0307513_10064059 3300031456 Bacteria 3876
924 Ga0307513_10265564 3300031456 Bacteria 1503
925 Ga0307509_10046566 3300031507 Bacteria 4669
926 Ga0307509_10054097 3300031507 Bacteria 4275
927 Ga0307508_10003014 3300031616 Bacteria 17367
928 Ga0307516_10001840 3300031730 Bacteria 29117
929 Ga0307516_10020825 3300031730 Bacteria 6768
930 Ga0307516_10201639 3300031730 Bacteria 1709
931 Ga0307411_10125176 3300032005 Bacteria 1868
932 Ga0307507_10122326 3300033179 Bacteria 2076
933 Ga0307510_10000949 3300033180 Bacteria 30604
934 Ga0373955_0128442 3300035172 Bacteria 1478
935 Ga0373955_0259185 3300035172 Bacteria 1044
936 Ga0373937_0042272 3300036401 Bacteria 4157
937 Ga0373937_0102367 3300036401 Unclassified 2659
938 Ga0395899_0005876 3300037312 Bacteria 9523
939 Ga0395899_0065724 3300037312 Unclassified 2664
940 Ga0395900_0029849 3300037418 Bacteria 5596
941 Ga0395900_0040184 3300037418 Bacteria 4821
942 Ga0395900_0060464 3300037418 Bacteria 3898
943 Ga0395900_0105523 3300037418 Bacteria 2895
944 Ga0395900_0125102 3300037418 Bacteria 2636
945 Ga0395898_0025501 3300037466 Bacteria 5957
946 Ga0395898_0042680 3300037466 Bacteria 4473
947 Ga0395898_0051601 3300037466 Bacteria 4021
948 Ga0395898_0147398 3300037466 Unclassified 2252
949 Ga0395898_0418832 3300037466 Bacteria 1276
950 Ga0395905_0008368 3300037471 Bacteria 10202
951 Ga0395905_0050318 3300037471 Bacteria 3904
952 Ga0395905_0137496 3300037471 Bacteria 2299
953 Ga0395901_0001002 3300038443 Bacteria 30541
954 Ga0395901_0018856 3300038443 Bacteria 7052
955 Ga0395901_0030228 3300038443 Bacteria 5581
956 Ga0395901_0111267 3300038443 Bacteria 2876
957 Ga0395901_0111946 3300038443 Bacteria 2867
958 Ga0395901_0369524 3300038443 Bacteria 1477
959 Ga0436365_0085418 3300039437 Bacteria 1349
960 Ga0436365_0399137 3300039437 Bacteria 2130
961 Ga0436365_0987978 3300039437 Bacteria 58639
962 Ga0436365_1655707 3300039437 Bacteria 1689
963 Ga0439439_0017010 3300041406 Bacteria 1785
964 Ga0439453_0004567 3300041408 Bacteria 2063
965 Ga0439466_0106212 3300041411 Bacteria 873
966 Ga0451853_1090644 3300041512 Bacteria 1773
967 Ga0439431_0002468 3300041997 Bacteria 4092
968 Ga0439442_028543 3300042002 Bacteria 1163
969 Ga0439445_0050968 3300042004 Bacteria 1117
970 Ga0439449_0089934 3300042007 Bacteria 1133
971 Ga0439457_000097 3300042014 Bacteria 20341
972 Ga0439462_0058861 3300042015 Bacteria 1039
973 Ga0450898_014743 3300042134 Bacteria 1317
974 Ga0439434_0008423 3300042435 Bacteria 3022
975 Ga0451577_0298894 3300042876 Bacteria 1459
976 Ga0466969_0000759 3300044656 Bacteria 17514
977 Ga0466972_0000049 3300044658 Bacteria 118829
978 Ga0466972_0000057 3300044658 Bacteria 110775
979 Ga0466972_0006768 3300044658 Bacteria 5752
980 Ga0466972_0009353 3300044658 Bacteria 4928
981 Ga0466965_0032746 3300044683 Bacteria 2539
982 Ga0466966_0002403 3300044684 Bacteria 12222
983 Ga0466961_0058945 3300044693 Bacteria 2442
984 Ga0453684_0006782 3300044712 Bacteria 21547
985 Ga0453684_0023605 3300044712 Bacteria 9043
986 Ga0453684_0086538 3300044712 Bacteria 3888
987 Ga0453684_0300740 3300044712 Bacteria 1824
988 Ga0453684_0304124 3300044712 Bacteria 1812
989 Ga0453684_0325602 3300044712 Bacteria 1739
990 Ga0466970_0000356 3300044765 Bacteria 22182
991 Ga0466970_0138209 3300044765 Unclassified 1341
992 Ga0466970_0148207 3300044765 Bacteria 1295
993 Ga0466957_0245411 3300044842 Unclassified 1189
994 Ga0466960_0147230 3300044901 Bacteria 1255
995 Ga0466959_0000466 3300045049 Bacteria 23615
996 Ga0466959_0022965 3300045049 Bacteria 4612
997 Ga0466959_0067225 3300045049 Bacteria 2599
998 Ga0451576_0005084 3300045051 Bacteria 16676
999 Ga0495629_0032133 3300046459 Bacteria 3717
1000 Ga0495638_0000013 3300046460 Bacteria 430133
1001 Ga0495638_0014384 3300046460 Bacteria 5351
1002 Ga0495638_0179210 3300046460 Bacteria 1210
1003 Ga0495650_0011424 3300046471 Bacteria 4864
1004 Ga0495664_0056659 3300046477 Bacteria 2332
1005 Ga0495606_0001358 3300046507 Bacteria 33214
1006 Ga0495628_0045482 3300046516 Bacteria 3490
1007 Ga0495630_0015688 3300046517 Bacteria 5536
1008 Ga0495630_0174790 3300046517 Unclassified 1637
1009 Ga0495648_0008986 3300046524 Bacteria 7802
1010 Ga0495586_0060457 3300046535 Bacteria 2060
1011 Ga0495586_0073857 3300046535 Bacteria 1866
1012 Ga0495621_0014650 3300046539 Bacteria 2486
1013 Ga0495621_0016625 3300046539 Bacteria 2364
1014 Ga0495668_0000023 3300046616 Bacteria 363848
1015 Ga0495668_0001798 3300046616 Bacteria 19556
1016 Ga0495668_0045468 3300046616 Bacteria 2441
1017 Ga0495634_0061340 3300046642 Bacteria 2500
1018 Ga0495611_0000813 3300046648 Bacteria 17326
1019 Ga0495625_0085289 3300046660 Bacteria 2192
1020 Ga0495625_0093937 3300046660 Bacteria 2070
1021 Ga0495635_0051341 3300046663 Unclassified 2842
1022 Ga0495635_0348690 3300046663 Bacteria 988
1023 Ga0495635_0373734 3300046663 Bacteria 949
1024 Ga0495659_0039217 3300046664 Bacteria 1684
1025 Ga0495599_0165546 3300046678 Bacteria 1366
1026 Ga0495670_0007945 3300046691 Bacteria 5214
1027 Ga0495604_0048861 3300047317 Bacteria 3290
1028 Ga0495687_000429 3300047443 Bacteria 51940
1029 Ga0495684_0213094 3300047471 Bacteria 1419
1030 Ga0495684_0233123 3300047471 Bacteria 1346
1031 Ga0495686_0000005 3300047472 Bacteria 827143
1032 Ga0495686_0007391 3300047472 Bacteria 8242
1033 Ga0495686_0225186 3300047472 Bacteria 1065
1034 Ga0495602_0412551 3300048088 Bacteria 961
1035 Ga0496101_0133062 3300048904 Bacteria 1890
1036 Ga0496101_0285049 3300048904 Bacteria 1292
1037 Ga0496106_0137223 3300048909 Bacteria 1922
1038 Ga0496113_0287677 3300048916 Bacteria 1315
1039 Ga0496114_0021219 3300048917 Bacteria 5283
1040 Ga0496115_0209555 3300048918 Unclassified 1610
1041 Ga0496124_0047663 3300048927 Bacteria 3665
1042 Ga0501292_007803 3300049515 Bacteria 1552
1043 Ga0501298_002065 3300049521 Bacteria 3011
1044 Ga0501300_002404 3300049523 Bacteria 2800
1045 Ga0501031_0044821 3300049568 Bacteria 2886
1046 Ga0501032_0008460 3300049569 Bacteria 7501
1047 Ga0501033_0019167 3300049570 Bacteria 5174
1048 Ga0501033_0029345 3300049570 Bacteria 4134
1049 Ga0501033_0239518 3300049570 Bacteria 1287
1050 Ga0501033_0256723 3300049570 Bacteria 1238
1051 Ga0501034_0003293 3300049571 Bacteria 18452
1052 Ga0501034_0006045 3300049571 Bacteria 13078
1053 Ga0501034_0028748 3300049571 Bacteria 5657
1054 Ga0501034_0375831 3300049571 Bacteria 1346
1055 Ga0501036_0055414 3300049572 Bacteria 3358
1056 Ga0501036_0153946 3300049572 Bacteria 1939
1057 Ga0501036_0225091 3300049572 Unclassified 1574
1058 Ga0501037_0002081 3300049573 Bacteria 14500
1059 Ga0501037_0006685 3300049573 Bacteria 8433
1060 Ga0501037_0158724 3300049573 Bacteria 1613
1061 Ga0501038_0007716 3300049574 Bacteria 9921
1062 Ga0501038_0063242 3300049574 Bacteria 3160
1063 Ga0501038_0070863 3300049574 Bacteria 2958
1064 Ga0501039_0009882 3300049575 Bacteria 7277
1065 Ga0501039_0079910 3300049575 Unclassified 2544
1066 Ga0501039_0082054 3300049575 Unclassified 2510
1067 Ga0501043_0008069 3300049579 Bacteria 8309
1068 Ga0501043_0045170 3300049579 Bacteria 3464
1069 Ga0501043_0073170 3300049579 Bacteria 2692
1070 Ga0501046_0001780 3300049580 Bacteria 20573
1071 Ga0501047_0002365 3300049581 Bacteria 18037
1072 Ga0501047_0027272 3300049581 Bacteria 5502
1073 Ga0501047_0067142 3300049581 Bacteria 3457
1074 Ga0501047_0250948 3300049581 Bacteria 1618
1075 Ga0501069_0122150 3300049585 Unclassified 1488
1076 Ga0501070_0101064 3300049586 Bacteria 2385
1077 Ga0501070_0502851 3300049586 Bacteria 974
1078 Ga0501072_0120761 3300049588 Bacteria 2088
1079 Ga0501073_0334644 3300049589 Bacteria 1045
1080 Ga0501074_0001751 3300049590 Bacteria 14833
1081 Ga0501198_005411 3300049649 Bacteria 1798
1082 Ga0501201_000010 3300049651 Bacteria 11245
1083 Ga0501207_000091 3300049654 Bacteria 7278
1084 Ga0501217_003534 3300049661 Bacteria 3161
1085 Ga0501217_009321 3300049661 Bacteria 2133
1086 Ga0501222_003088 3300049662 Unclassified 2287
1087 Ga0501223_004726 3300049663 Bacteria 2896
1088 Ga0501223_008994 3300049663 Bacteria 2029
1089 Ga0501224_000271 3300049664 Bacteria 5957
1090 Ga0501233_000927 3300049668 Bacteria 4974
1091 Ga0501235_000256 3300049669 Bacteria 9786
1092 Ga0501240_002698 3300049673 Bacteria 1909
1093 Ga0501243_002836 3300049675 Bacteria 2554
1094 Ga0501249_004647 3300049679 Bacteria 2791
1095 Ga0501253_005612 3300049683 Bacteria 1656
1096 Ga0501257_011928 3300049686 Bacteria 1987
1097 Ga0501259_000276 3300049688 Bacteria 8095
1098 Ga0501261_004108 3300049690 Bacteria 1791
1099 Ga0501219_000280 3300049703 Bacteria 9053
1100 Ga0501221_000133 3300049704 Bacteria 9603
1101 Ga0501225_0000893 3300049705 Bacteria 9288
1102 Ga0501225_0015107 3300049705 Bacteria 2153
1103 Ga0501234_007515 3300049707 Bacteria 1705
1104 Ga0501245_000074 3300049708 Bacteria 9749
1105 Ga0501083_0004260 3300049744 Bacteria 10070
1106 Ga0501241_004900 3300049758 Bacteria 2498
1107 Ga0501241_006602 3300049758 Unclassified 2133
1108 Ga0501269_002765 3300049766 Unclassified 2139
1109 Ga0501271_006419 3300049768 Bacteria 1167
1110 Ga0501035_0061577 3300049822 Bacteria 3340
1111 Ga0501035_0121282 3300049822 Bacteria 2285
1112 Ga0501035_0403582 3300049822 Bacteria 1137
1113 Ga0501044_0004216 3300049823 Bacteria 16154
1114 Ga0501044_0015504 3300049823 Bacteria 8208
1115 Ga0501044_0087085 3300049823 Bacteria 3155
1116 Ga0501044_0119530 3300049823 Bacteria 2637
1117 Ga0501044_0140775 3300049823 Bacteria 2401
1118 Ga0501044_0259059 3300049823 Bacteria 1678
1119 Ga0501044_0321841 3300049823 Bacteria 1471
1120 Ga0501284_00002 3300050005 Bacteria 220402
1121 nmdc:mga0k408_2621_c1 3300050493 Bacteria 9558
1122 nmdc:mga0k408_34886_c1 3300050493 Bacteria 2882
1123 nmdc:mga05p37_379423_c1 3300050507 Bacteria 1657
1124 nmdc:mga05p37_4461_c1 3300050507 Bacteria 6112
1125 nmdc:mga09592_1071_c1 3300050508 Bacteria 21759
1126 nmdc:mga09592_68842_c1 3300050508 Bacteria 3002
1127 nmdc:mga0qj67_20329_c1 3300050509 Bacteria 5082
1128 nmdc:mga0qj67_84355_c1 3300050509 Unclassified 2547
1129 nmdc:mga06r32_1494_c1 3300050510 Bacteria 21025
1130 nmdc:mga08y16_11872_c1 3300050511 Bacteria 9150
1131 nmdc:mga08y16_27698_c1 3300050511 Bacteria 5970
1132 nmdc:mga08y16_296719_c1 3300050511 Unclassified 1666
1133 Ga0500578_0000605 3300053086 Bacteria 43458
1134 Ga0500578_0008201 3300053086 Bacteria 6839
1135 Ga0500644_0002191 3300053088 Bacteria 4932
1136 Ga0500646_0005284 3300053090 Bacteria 3264
1137 Ga0500646_0013853 3300053090 Bacteria 2090
1138 Ga0500646_0014670 3300053090 Bacteria 2035
1139 Ga0500646_0017891 3300053090 Bacteria 1863
1140 Ga0500583_0000055 3300053092 Bacteria 72367
1141 Ga0500583_0002404 3300053092 Bacteria 5617
1142 Ga0500583_0010626 3300053092 Bacteria 3426
1143 Ga0500556_0128881 3300053104 Bacteria 991
1144 Ga0500557_008083 3300053105 Bacteria 2497
1145 Ga0500569_000136 3300053109 Bacteria 11674
1146 Ga0500572_029654 3300053111 Bacteria 1515
1147 Ga0500594_0015087 3300053118 Bacteria 1859
1148 Ga0500642_0054423 3300053130 Bacteria 1777
1149 Ga0500652_012326 3300053131 Bacteria 2996
1150 Ga0500568_0000080 3300053139 Bacteria 92694
1151 Ga0500573_0016436 3300053140 Bacteria 4201
1152 Ga0500577_0040375 3300053142 Bacteria 1696
1153 Ga0500588_0022595 3300053146 Bacteria 1715
1154 Ga0500589_029663 3300053147 Bacteria 2545
1155 Ga0500590_023321 3300053148 Bacteria 3214
1156 Ga0500616_0000013 3300053153 Bacteria 674172
1157 Ga0500616_0000685 3300053153 Bacteria 39676
1158 Ga0500616_0012238 3300053153 Bacteria 5023
1159 Ga0500616_0018027 3300053153 Bacteria 3995
1160 Ga0500622_0012218 3300053156 Bacteria 4657
1161 Ga0500634_0023687 3300053161 Bacteria 3338
1162 Ga0500639_030150 3300053163 Bacteria 2866
1163 Ga0500636_0025813 3300053177 Bacteria 3473
1164 Ga0500636_0184003 3300053177 Bacteria 1119
1165 Ga0500611_000003 3300053727 Bacteria 333431
1166 Ga0500645_017956 3300053730 Bacteria 2214
1167 Ga0466962_0066496 3300061719 Bacteria 1721
1168 Ga0466962_0099416 3300061719 Bacteria 1397

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041411 Ga0439466_0106212 Ga0439466_0106212_51_839 258
2 3300009093 Ga0105240_10000106 Ga0105240_10000106130 263
3 3300009174 Ga0105241_10000085 Ga0105241_1000008538 263
4 3300009545 Ga0105237_10000512 Ga0105237_100005124 263
5 3300009551 Ga0105238_10003933 Ga0105238_1000393316 263
6 3300010375 Ga0105239_10263308 Ga0105239_102633082 263
7 3300044765 Ga0466970_0148207 Ga0466970_0148207_271_1110 263
8 3300045049 Ga0466959_0022965 Ga0466959_0022965_2746_3585 263
9 3300047472 Ga0495686_0000005 Ga0495686_0000005_587528_588346 263
10 3300013297 Ga0157378_10863588 Ga0157378_108635881 264
11 3300025934 Ga0207686_10452972 Ga0207686_104529721 264
12 3300044712 Ga0453684_0325602 Ga0453684_0325602_14_820 264
13 3300013102 Ga0157371_10000898 Ga0157371_100008989 266
14 3300005339 Ga0070660_100003081 Ga0070660_1000030814 268
15 3300025919 Ga0207657_10034904 Ga0207657_100349044 268
16 3300046616 Ga0495668_0000023 Ga0495668_0000023_53712_54518 268
17 3300009545 Ga0105237_10103483 Ga0105237_101034832 273
18 3300006844 Ga0075428_100012181 Ga0075428_1000121818 274
19 3300005577 Ga0068857_100173625 Ga0068857_1001736252 276
20 3300001904 JGI24736J21556_1004228 JGI24736J21556_10042282 279
21 3300005366 Ga0070659_100015884 Ga0070659_1000158845 279
22 3300005563 Ga0068855_100071409 Ga0068855_1000714093 279
23 3300005616 Ga0068852_100040292 Ga0068852_1000402923 279
24 3300005843 Ga0068860_100001067 Ga0068860_1000010671 279
25 3300013104 Ga0157370_10244397 Ga0157370_102443972 279
26 3300025904 Ga0207647_10000025 Ga0207647_1000002549 279
27 3300025904 Ga0207647_10025385 Ga0207647_100253853 279
28 3300025932 Ga0207690_10014109 Ga0207690_100141094 279
29 3300025981 Ga0207640_10042355 Ga0207640_100423553 279
30 3300026075 Ga0207708_10046170 Ga0207708_100461704 279
31 3300026088 Ga0207641_10186810 Ga0207641_101868102 279
32 3300028381 Ga0268264_10008151 Ga0268264_100081519 279
33 3300053139 Ga0500568_0000080 Ga0500568_0000080_26713_27594 279
34 3300005331 Ga0070670_100295892 Ga0070670_1002958922 280
35 3300005334 Ga0068869_100260603 Ga0068869_1002606031 280
36 3300006195 Ga0075366_10067583 Ga0075366_100675833 280
37 3300050493 nmdc:mga0k408_2621_c1 nmdc:mga0k408_2621_c1_6576_7457 280
38 3300005327 Ga0070658_10028992 Ga0070658_100289923 281
39 3300005530 Ga0070679_100004260 Ga0070679_10000426014 281
40 3300013100 Ga0157373_10084471 Ga0157373_100844712 281
41 3300027471 Ga0209995_1017727 Ga0209995_10177271 281
42 3300027876 Ga0209974_10024122 Ga0209974_100241223 281
43 3300037418 Ga0395900_0040184 Ga0395900_0040184_3017_3904 281
44 3300038443 Ga0395901_0111267 Ga0395901_0111267_1171_2058 281
45 3300047472 Ga0495686_0225186 Ga0495686_0225186_80_961 281
46 3300049579 Ga0501043_0073170 Ga0501043_0073170_1360_2358 281
47 3300003320 rootH2_10230505 rootH2_102305051 282
48 3300005295 Ga0065707_10008266 Ga0065707_100082665 282
49 3300005330 Ga0070690_100274584 Ga0070690_1002745842 282
50 3300005343 Ga0070687_100044338 Ga0070687_1000443382 282
51 3300005353 Ga0070669_100029713 Ga0070669_1000297134 282
52 3300005353 Ga0070669_100064037 Ga0070669_1000640371 282
53 3300005354 Ga0070675_100064550 Ga0070675_1000645501 282
54 3300005355 Ga0070671_100577505 Ga0070671_1005775051 282
55 3300005459 Ga0068867_100016141 Ga0068867_1000161412 282
56 3300005471 Ga0070698_100000061 Ga0070698_1000000611 282
57 3300005471 Ga0070698_100005877 Ga0070698_1000058775 282
58 3300005471 Ga0070698_100238899 Ga0070698_1002388991 282
59 3300005518 Ga0070699_100036344 Ga0070699_1000363444 282
60 3300005518 Ga0070699_100328151 Ga0070699_1003281512 282
61 3300005617 Ga0068859_100006944 Ga0068859_1000069446 282
62 3300005617 Ga0068859_100020269 Ga0068859_1000202692 282
63 3300005617 Ga0068859_100430454 Ga0068859_1004304542 282
64 3300005618 Ga0068864_100261967 Ga0068864_1002619672 282
65 3300005719 Ga0068861_100001764 Ga0068861_1000017648 282
66 3300005719 Ga0068861_100194889 Ga0068861_1001948892 282
67 3300005843 Ga0068860_100034993 Ga0068860_1000349934 282
68 3300005843 Ga0068860_100083614 Ga0068860_1000836143 282
69 3300006846 Ga0075430_100002050 Ga0075430_1000020508 282
70 3300006847 Ga0075431_100006556 Ga0075431_1000065563 282
71 3300006931 Ga0097620_100006943 Ga0097620_1000069436 282
72 3300006931 Ga0097620_100020271 Ga0097620_1000202718 282
73 3300006931 Ga0097620_100430491 Ga0097620_1004304912 282
74 3300009101 Ga0105247_10005677 Ga0105247_100056777 282
75 3300009147 Ga0114129_10099489 Ga0114129_100994893 282
76 3300009147 Ga0114129_10499385 Ga0114129_104993852 282
77 3300009553 Ga0105249_10008945 Ga0105249_100089456 282
78 3300009553 Ga0105249_10018185 Ga0105249_100181857 282
79 3300013308 Ga0157375_10547696 Ga0157375_105476961 282
80 3300014325 Ga0163163_10140983 Ga0163163_101409832 282
81 3300025900 Ga0207710_10001225 Ga0207710_100012257 282
82 3300025910 Ga0207684_10260816 Ga0207684_102608162 282
83 3300025918 Ga0207662_10060977 Ga0207662_100609773 282
84 3300025922 Ga0207646_10156003 Ga0207646_101560032 282
85 3300025923 Ga0207681_10398219 Ga0207681_103982192 282
86 3300025942 Ga0207689_10050585 Ga0207689_100505853 282
87 3300025960 Ga0207651_10002063 Ga0207651_100020638 282
88 3300025961 Ga0207712_10000844 Ga0207712_100008445 282
89 3300025961 Ga0207712_10001111 Ga0207712_100011115 282
90 3300026089 Ga0207648_10249038 Ga0207648_102490382 282
91 3300026095 Ga0207676_10045020 Ga0207676_100450204 282
92 3300026095 Ga0207676_10047297 Ga0207676_100472971 282
93 3300026118 Ga0207675_100004328 Ga0207675_1000043286 282
94 3300026118 Ga0207675_100049740 Ga0207675_1000497405 282
95 3300028381 Ga0268264_10026939 Ga0268264_100269394 282
96 3300044658 Ga0466972_0000057 Ga0466972_0000057_64293_65153 282
97 3300050509 nmdc:mga0qj67_20329_c1 nmdc:mga0qj67_20329_c1_3806_4696 282
98 3300003320 rootH2_10010818 rootH2_100108185 283
99 3300005288 Ga0065714_10095584 Ga0065714_100955842 283
100 3300005290 Ga0065712_10014322 Ga0065712_100143223 283
101 3300005293 Ga0065715_10001122 Ga0065715_100011229 283
102 3300005330 Ga0070690_100085122 Ga0070690_1000851222 283
103 3300005331 Ga0070670_100069651 Ga0070670_1000696512 283
104 3300005334 Ga0068869_100024597 Ga0068869_1000245972 283
105 3300005343 Ga0070687_100034158 Ga0070687_1000341583 283
106 3300005347 Ga0070668_100525570 Ga0070668_1005255701 283
107 3300005353 Ga0070669_100289376 Ga0070669_1002893762 283
108 3300005364 Ga0070673_100199346 Ga0070673_1001993462 283
109 3300005438 Ga0070701_10034905 Ga0070701_100349053 283
110 3300005539 Ga0068853_100193958 Ga0068853_1001939582 283
111 3300005543 Ga0070672_100139504 Ga0070672_1001395043 283
112 3300005543 Ga0070672_100202774 Ga0070672_1002027742 283
113 3300005617 Ga0068859_100045290 Ga0068859_1000452902 283
114 3300005841 Ga0068863_100060131 Ga0068863_1000601314 283
115 3300005844 Ga0068862_100231486 Ga0068862_1002314862 283
116 3300006237 Ga0097621_100186512 Ga0097621_1001865122 283
117 3300006931 Ga0097620_100045286 Ga0097620_1000452862 283
118 3300009176 Ga0105242_10046712 Ga0105242_100467124 283
119 3300009176 Ga0105242_10512117 Ga0105242_105121171 283
120 3300009553 Ga0105249_10005594 Ga0105249_100055946 283
121 3300009553 Ga0105249_10260966 Ga0105249_102609662 283
122 3300013296 Ga0157374_10000011 Ga0157374_10000011402 283
123 3300013306 Ga0163162_10152921 Ga0163162_101529212 283
124 3300013308 Ga0157375_10790987 Ga0157375_107909871 283
125 3300014745 Ga0157377_10008604 Ga0157377_100086041 283
126 3300014969 Ga0157376_10002607 Ga0157376_100026074 283
127 3300014969 Ga0157376_10083825 Ga0157376_100838253 283
128 3300025893 Ga0207682_10003295 Ga0207682_100032955 283
129 3300025908 Ga0207643_10003612 Ga0207643_100036128 283
130 3300025923 Ga0207681_10086048 Ga0207681_100860483 283
131 3300025924 Ga0207694_10072267 Ga0207694_100722671 283
132 3300025925 Ga0207650_10149232 Ga0207650_101492322 283
133 3300025926 Ga0207659_10074828 Ga0207659_100748283 283
134 3300025931 Ga0207644_10149600 Ga0207644_101496002 283
135 3300025934 Ga0207686_10000977 Ga0207686_100009779 283
136 3300025936 Ga0207670_10007047 Ga0207670_100070473 283
137 3300025940 Ga0207691_10051530 Ga0207691_100515302 283
138 3300025940 Ga0207691_10252919 Ga0207691_102529192 283
139 3300025942 Ga0207689_10102121 Ga0207689_101021212 283
140 3300025960 Ga0207651_10146394 Ga0207651_101463942 283
141 3300025961 Ga0207712_10003901 Ga0207712_100039016 283
142 3300025986 Ga0207658_10101184 Ga0207658_101011842 283
143 3300026088 Ga0207641_10000318 Ga0207641_1000031828 283
144 3300026088 Ga0207641_10112634 Ga0207641_101126343 283
145 3300026121 Ga0207683_10064287 Ga0207683_100642872 283
146 3300026142 Ga0207698_10054047 Ga0207698_100540472 283
147 3300028380 Ga0268265_10009494 Ga0268265_100094942 283
148 3300035172 Ga0373955_0259185 Ga0373955_0259185_116_1009 283
149 3300046539 Ga0495621_0014650 Ga0495621_0014650_858_1751 283
150 3300047472 Ga0495686_0007391 Ga0495686_0007391_1410_2417 283
151 3300049568 Ga0501031_0044821 Ga0501031_0044821_692_1636 283
152 3300049571 Ga0501034_0375831 Ga0501034_0375831_251_1195 283
153 3300049572 Ga0501036_0055414 Ga0501036_0055414_1187_2131 283
154 3300049573 Ga0501037_0006685 Ga0501037_0006685_6098_7042 283
155 3300049574 Ga0501038_0070863 Ga0501038_0070863_1337_2281 283
156 3300049575 Ga0501039_0079910 Ga0501039_0079910_270_1214 283
157 3300049589 Ga0501073_0334644 Ga0501073_0334644_43_987 283
158 3300002739 JGI25158J39367_1007300 JGI25158J39367_10073001 284
159 3300002987 JGI25159J45721_1011777 JGI25159J45721_10117772 284
160 3300003322 rootL2_10020650 rootL2_100206506 284
161 3300003354 JGI25160J50197_1003700 JGI25160J50197_10037008 284
162 3300003794 Ga0055531_10000029 Ga0055531_1000002916 284
163 3300025208 Ga0209436_101913 Ga0209436_1019132 284
164 3300025284 Ga0209130_1001317 Ga0209130_100131710 284
165 3300025302 Ga0207426_1000139 Ga0207426_100013970 284
166 3300025909 Ga0207705_10038181 Ga0207705_100381812 284
167 3300025917 Ga0207660_10471105 Ga0207660_104711051 284
168 3300025921 Ga0207652_10000051 Ga0207652_10000051108 284
169 3300025932 Ga0207690_10009343 Ga0207690_100093435 284
170 3300037418 Ga0395900_0029849 Ga0395900_0029849_1909_2796 284
171 3300005331 Ga0070670_100031007 Ga0070670_1000310074 285
172 3300005338 Ga0068868_100024924 Ga0068868_1000249244 285
173 3300005355 Ga0070671_100074135 Ga0070671_1000741352 285
174 3300005841 Ga0068863_100022024 Ga0068863_1000220244 285
175 3300006844 Ga0075428_100000528 Ga0075428_10000052811 285
176 3300006880 Ga0075429_100001456 Ga0075429_10000145610 285
177 3300013297 Ga0157378_10009840 Ga0157378_100098403 285
178 3300013306 Ga0163162_10478854 Ga0163162_104788542 285
179 3300013308 Ga0157375_10126175 Ga0157375_101261752 285
180 3300025304 Ga0209257_1000013 Ga0209257_1000013650 285
181 3300025321 Ga0207656_10019984 Ga0207656_100199843 285
182 3300025925 Ga0207650_10061023 Ga0207650_100610233 285
183 3300025931 Ga0207644_10079812 Ga0207644_100798121 285
184 3300026023 Ga0207677_10047154 Ga0207677_100471541 285
185 3300026023 Ga0207677_10496979 Ga0207677_104969791 285
186 3300026088 Ga0207641_10020809 Ga0207641_100208094 285
187 3300041408 Ga0439453_0004567 Ga0439453_0004567_487_1374 285
188 3300044712 Ga0453684_0006782 Ga0453684_0006782_2448_3320 285
189 3300044712 Ga0453684_0304124 Ga0453684_0304124_497_1363 285
190 3300045051 Ga0451576_0005084 Ga0451576_0005084_10647_11519 285
191 3300050508 nmdc:mga09592_1071_c1 nmdc:mga09592_1071_c1_1102_1989 285
192 3300053090 Ga0500646_0017891 Ga0500646_0017891_501_1370 285
193 3300003320 rootH2_10273097 rootH2_102730971 286
194 3300003322 rootL2_10019422 rootL2_1001942212 286
195 3300005331 Ga0070670_100066976 Ga0070670_1000669763 286
196 3300005355 Ga0070671_100150018 Ga0070671_1001500183 286
197 3300005543 Ga0070672_100412628 Ga0070672_1004126282 286
198 3300005841 Ga0068863_100126984 Ga0068863_1001269843 286
199 3300006237 Ga0097621_100000109 Ga0097621_10000010910 286
200 3300006358 Ga0068871_100002333 Ga0068871_10000233310 286
201 3300006844 Ga0075428_100269030 Ga0075428_1002690302 286
202 3300009094 Ga0111539_10022172 Ga0111539_100221723 286
203 3300009176 Ga0105242_10073555 Ga0105242_100735552 286
204 3300009177 Ga0105248_10002485 Ga0105248_1000248517 286
205 3300009553 Ga0105249_10091732 Ga0105249_100917322 286
206 3300013297 Ga0157378_10024055 Ga0157378_100240553 286
207 3300013306 Ga0163162_10000579 Ga0163162_1000057910 286
208 3300013308 Ga0157375_10002298 Ga0157375_100022989 286
209 3300014325 Ga0163163_10000401 Ga0163163_1000040130 286
210 3300014968 Ga0157379_10400741 Ga0157379_104007412 286
211 3300014969 Ga0157376_10007180 Ga0157376_100071801 286
212 3300014969 Ga0157376_10049080 Ga0157376_100490802 286
213 3300017792 Ga0163161_10008477 Ga0163161_100084772 286
214 3300017792 Ga0163161_10219436 Ga0163161_102194361 286
215 3300025298 Ga0209050_1001667 Ga0209050_100166721 286
216 3300025931 Ga0207644_10019394 Ga0207644_100193942 286
217 3300025938 Ga0207704_10418539 Ga0207704_104185391 286
218 3300025941 Ga0207711_10128224 Ga0207711_101282241 286
219 3300025961 Ga0207712_10206959 Ga0207712_102069592 286
220 3300026088 Ga0207641_10171576 Ga0207641_101715761 286
221 3300031456 Ga0307513_10064059 Ga0307513_100640593 286
222 3300044712 Ga0453684_0023605 Ga0453684_0023605_498_1382 286
223 3300046460 Ga0495638_0000013 Ga0495638_0000013_122047_122955 286
224 3300048909 Ga0496106_0137223 Ga0496106_0137223_234_1148 286
225 3300048917 Ga0496114_0021219 Ga0496114_0021219_2972_3886 286
226 3300050509 nmdc:mga0qj67_84355_c1 nmdc:mga0qj67_84355_c1_436_1314 286
227 3300050511 nmdc:mga08y16_27698_c1 nmdc:mga08y16_27698_c1_2949_3827 286
228 3300053105 Ga0500557_008083 Ga0500557_008083_1428_2336 286
229 3300053153 Ga0500616_0000013 Ga0500616_0000013_594630_595538 286
230 iso_pu_bacteria 2914759650 2914762651 286
231 iso_pu_bacteria 2929239360 2929242958 286
232 3300003320 rootH2_10004583 rootH2_100045831 287
233 3300005329 Ga0070683_100012489 Ga0070683_1000124892 287
234 3300005331 Ga0070670_100104101 Ga0070670_1001041013 287
235 3300005341 Ga0070691_10021468 Ga0070691_100214682 287
236 3300005341 Ga0070691_10036360 Ga0070691_100363602 287
237 3300005354 Ga0070675_100178113 Ga0070675_1001781132 287
238 3300005456 Ga0070678_100640324 Ga0070678_1006403241 287
239 3300005535 Ga0070684_100005199 Ga0070684_1000051991 287
240 3300005539 Ga0068853_100001749 Ga0068853_10000174912 287
241 3300005548 Ga0070665_100000014 Ga0070665_100000014129 287
242 3300005563 Ga0068855_100008908 Ga0068855_10000890812 287
243 3300005577 Ga0068857_100027180 Ga0068857_1000271806 287
244 3300005578 Ga0068854_100022321 Ga0068854_1000223212 287
245 3300005614 Ga0068856_100127663 Ga0068856_1001276632 287
246 3300005614 Ga0068856_100238029 Ga0068856_1002380292 287
247 3300005616 Ga0068852_100059804 Ga0068852_1000598043 287
248 3300005834 Ga0068851_10061289 Ga0068851_100612893 287
249 3300005843 Ga0068860_100000024 Ga0068860_100000024176 287
250 3300009093 Ga0105240_10000895 Ga0105240_1000089523 287
251 3300009093 Ga0105240_10002358 Ga0105240_1000235812 287
252 3300009093 Ga0105240_10004054 Ga0105240_1000405420 287
253 3300009093 Ga0105240_10004897 Ga0105240_1000489716 287
254 3300009093 Ga0105240_10014654 Ga0105240_100146542 287
255 3300009093 Ga0105240_10171129 Ga0105240_101711294 287
256 3300009174 Ga0105241_10095657 Ga0105241_100956571 287
257 3300009174 Ga0105241_10232326 Ga0105241_102323262 287
258 3300009545 Ga0105237_10002282 Ga0105237_100022825 287
259 3300009545 Ga0105237_10029968 Ga0105237_100299683 287
260 3300009545 Ga0105237_10051523 Ga0105237_100515232 287
261 3300009551 Ga0105238_10316425 Ga0105238_103164252 287
262 3300010375 Ga0105239_10000384 Ga0105239_1000038448 287
263 3300010375 Ga0105239_10012836 Ga0105239_100128368 287
264 3300010375 Ga0105239_10082415 Ga0105239_100824155 287
265 3300013104 Ga0157370_10031858 Ga0157370_100318584 287
266 3300013104 Ga0157370_10051093 Ga0157370_100510935 287
267 3300013105 Ga0157369_10046176 Ga0157369_100461762 287
268 3300013306 Ga0163162_10000687 Ga0163162_100006876 287
269 3300013306 Ga0163162_10031855 Ga0163162_100318557 287
270 3300013307 Ga0157372_10001462 Ga0157372_1000146215 287
271 3300013307 Ga0157372_10294338 Ga0157372_102943381 287
272 3300013308 Ga0157375_10196858 Ga0157375_101968582 287
273 3300014325 Ga0163163_10072715 Ga0163163_100727153 287
274 3300025911 Ga0207654_10115343 Ga0207654_101153432 287
275 3300025912 Ga0207707_10049374 Ga0207707_100493742 287
276 3300025913 Ga0207695_10000087 Ga0207695_10000087124 287
277 3300025913 Ga0207695_10000522 Ga0207695_1000052264 287
278 3300025913 Ga0207695_10000582 Ga0207695_1000058241 287
279 3300025913 Ga0207695_10000909 Ga0207695_1000090922 287
280 3300025913 Ga0207695_10019969 Ga0207695_100199695 287
281 3300025913 Ga0207695_10026064 Ga0207695_100260647 287
282 3300025913 Ga0207695_10092901 Ga0207695_100929012 287
283 3300025913 Ga0207695_10113992 Ga0207695_101139923 287
284 3300025914 Ga0207671_10001101 Ga0207671_1000110129 287
285 3300025914 Ga0207671_10002074 Ga0207671_100020747 287
286 3300025914 Ga0207671_10006522 Ga0207671_100065222 287
287 3300025914 Ga0207671_10009392 Ga0207671_100093929 287
288 3300025914 Ga0207671_10068444 Ga0207671_100684442 287
289 3300025924 Ga0207694_10214730 Ga0207694_102147302 287
290 3300025925 Ga0207650_10250938 Ga0207650_102509382 287
291 3300025940 Ga0207691_10091714 Ga0207691_100917142 287
292 3300025944 Ga0207661_10004686 Ga0207661_100046862 287
293 3300025949 Ga0207667_10000749 Ga0207667_1000074916 287
294 3300025949 Ga0207667_10013273 Ga0207667_100132735 287
295 3300025949 Ga0207667_10029606 Ga0207667_100296062 287
296 3300025960 Ga0207651_10626161 Ga0207651_106261611 287
297 3300026041 Ga0207639_10067229 Ga0207639_100672291 287
298 3300026041 Ga0207639_10092456 Ga0207639_100924563 287
299 3300026078 Ga0207702_10031283 Ga0207702_100312835 287
300 3300026078 Ga0207702_10045451 Ga0207702_100454512 287
301 3300026095 Ga0207676_10397793 Ga0207676_103977931 287
302 3300026116 Ga0207674_10037558 Ga0207674_100375586 287
303 3300026142 Ga0207698_10007833 Ga0207698_100078332 287
304 3300026142 Ga0207698_10084693 Ga0207698_100846932 287
305 3300028379 Ga0268266_10000048 Ga0268266_10000048207 287
306 3300028381 Ga0268264_10000028 Ga0268264_10000028357 287
307 3300028786 Ga0307517_10000268 Ga0307517_1000026823 287
308 3300030521 Ga0307511_10000076 Ga0307511_1000007638 287
309 3300031730 Ga0307516_10001840 Ga0307516_1000184021 287
310 3300031730 Ga0307516_10020825 Ga0307516_100208251 287
311 3300033180 Ga0307510_10000949 Ga0307510_1000094926 287
312 3300044658 Ga0466972_0006768 Ga0466972_0006768_1737_2624 287
313 3300044683 Ga0466965_0032746 Ga0466965_0032746_218_1108 287
314 3300044712 Ga0453684_0300740 Ga0453684_0300740_815_1684 287
315 3300046460 Ga0495638_0014384 Ga0495638_0014384_1813_2703 287
316 3300046507 Ga0495606_0001358 Ga0495606_0001358_9177_10067 287
317 3300046524 Ga0495648_0008986 Ga0495648_0008986_2955_3845 287
318 3300046648 Ga0495611_0000813 Ga0495611_0000813_9152_10042 287
319 3300046660 Ga0495625_0093937 Ga0495625_0093937_602_1492 287
320 3300047443 Ga0495687_000429 Ga0495687_000429_30868_31758 287
321 3300049575 Ga0501039_0082054 Ga0501039_0082054_380_1252 287
322 3300049768 Ga0501271_006419 Ga0501271_006419_10_891 287
323 3300053090 Ga0500646_0013853 Ga0500646_0013853_969_1844 287
324 3300053092 Ga0500583_0002404 Ga0500583_0002404_2167_3057 287
325 3300053146 Ga0500588_0022595 Ga0500588_0022595_639_1529 287
326 3300053156 Ga0500622_0012218 Ga0500622_0012218_1953_2843 287
327 iso_pu_bacteria 2818991460 2819679019 287
328 3300003203 JGI25406J46586_10001794 JGI25406J46586_100017948 288
329 3300003320 rootH2_10010343 rootH2_1001034314 288
330 3300003320 rootH2_10168493 rootH2_101684931 288
331 3300005329 Ga0070683_100016900 Ga0070683_1000169002 288
332 3300005330 Ga0070690_100267781 Ga0070690_1002677811 288
333 3300005331 Ga0070670_100257034 Ga0070670_1002570342 288
334 3300005337 Ga0070682_100247259 Ga0070682_1002472592 288
335 3300005338 Ga0068868_100090167 Ga0068868_1000901671 288
336 3300005339 Ga0070660_100003088 Ga0070660_1000030886 288
337 3300005344 Ga0070661_100010249 Ga0070661_1000102492 288
338 3300005364 Ga0070673_100255583 Ga0070673_1002555832 288
339 3300005367 Ga0070667_100305840 Ga0070667_1003058402 288
340 3300005535 Ga0070684_100053275 Ga0070684_1000532752 288
341 3300005564 Ga0070664_100038858 Ga0070664_1000388583 288
342 3300005577 Ga0068857_100045500 Ga0068857_1000455002 288
343 3300005577 Ga0068857_100048603 Ga0068857_1000486032 288
344 3300005578 Ga0068854_100065653 Ga0068854_1000656532 288
345 3300005719 Ga0068861_100189248 Ga0068861_1001892483 288
346 3300005844 Ga0068862_100088710 Ga0068862_1000887102 288
347 3300005985 Ga0081539_10000714 Ga0081539_1000071472 288
348 3300006358 Ga0068871_100025134 Ga0068871_1000251343 288
349 3300009174 Ga0105241_10099900 Ga0105241_100999002 288
350 3300009553 Ga0105249_10000561 Ga0105249_1000056121 288
351 3300013100 Ga0157373_10004266 Ga0157373_100042669 288
352 3300013102 Ga0157371_10056971 Ga0157371_100569712 288
353 3300013102 Ga0157371_10059898 Ga0157371_100598981 288
354 3300013104 Ga0157370_10083350 Ga0157370_100833502 288
355 3300013105 Ga0157369_10019051 Ga0157369_100190512 288
356 3300013105 Ga0157369_10276641 Ga0157369_102766412 288
357 3300013296 Ga0157374_10011097 Ga0157374_100110972 288
358 3300013306 Ga0163162_10044992 Ga0163162_100449922 288
359 3300013307 Ga0157372_10048682 Ga0157372_100486825 288
360 3300013307 Ga0157372_10117877 Ga0157372_101178772 288
361 3300013307 Ga0157372_10587223 Ga0157372_105872232 288
362 3300014745 Ga0157377_10014081 Ga0157377_100140812 288
363 3300025904 Ga0207647_10047931 Ga0207647_100479311 288
364 3300025919 Ga0207657_10003852 Ga0207657_100038525 288
365 3300025920 Ga0207649_10249286 Ga0207649_102492861 288
366 3300025921 Ga0207652_10244998 Ga0207652_102449982 288
367 3300025925 Ga0207650_10223035 Ga0207650_102230352 288
368 3300025944 Ga0207661_10049792 Ga0207661_100497922 288
369 3300025961 Ga0207712_10004398 Ga0207712_100043986 288
370 3300025986 Ga0207658_10366366 Ga0207658_103663661 288
371 3300026023 Ga0207677_10039983 Ga0207677_100399832 288
372 3300026078 Ga0207702_10385944 Ga0207702_103859441 288
373 3300026116 Ga0207674_10062630 Ga0207674_100626304 288
374 3300026116 Ga0207674_10067535 Ga0207674_100675352 288
375 3300026118 Ga0207675_100160928 Ga0207675_1001609282 288
376 3300026142 Ga0207698_10573399 Ga0207698_105733992 288
377 3300031251 Ga0265327_10000152 Ga0265327_100001522 288
378 3300039437 Ga0436365_1655707 Ga0436365_1655707_580_1458 288
379 3300048927 Ga0496124_0047663 Ga0496124_0047663_1720_2607 288
380 3300049661 Ga0501217_009321 Ga0501217_009321_615_1508 288
381 3300049663 Ga0501223_008994 Ga0501223_008994_359_1252 288
382 iso_pu_bacteria 2818991442 2819575736 288
383 iso_pu_bacteria 2818991444 2819585707 288
384 iso_pu_bacteria 2884791551 2884792125 288
385 3300003316 rootH1_10056141 rootH1_100561413 289
386 3300003320 rootH2_10175449 rootH2_101754492 289
387 3300003322 rootL2_10279111 rootL2_102791112 289
388 3300003323 rootH1_10168367 rootH1_101683674 289
389 3300003354 JGI25160J50197_1002461 JGI25160J50197_10024616 289
390 3300005328 Ga0070676_10025399 Ga0070676_100253994 289
391 3300005334 Ga0068869_100005421 Ga0068869_1000054216 289
392 3300005338 Ga0068868_100016572 Ga0068868_1000165722 289
393 3300005364 Ga0070673_100370584 Ga0070673_1003705842 289
394 3300005459 Ga0068867_100059980 Ga0068867_1000599801 289
395 3300005985 Ga0081539_10006848 Ga0081539_100068488 289
396 3300006195 Ga0075366_10185716 Ga0075366_101857161 289
397 3300006358 Ga0068871_100184529 Ga0068871_1001845292 289
398 3300006881 Ga0068865_100531385 Ga0068865_1005313851 289
399 3300010375 Ga0105239_10000019 Ga0105239_100000196 289
400 3300013296 Ga0157374_10153850 Ga0157374_101538502 289
401 3300013297 Ga0157378_10387849 Ga0157378_103878491 289
402 3300013306 Ga0163162_10001718 Ga0163162_100017184 289
403 3300013307 Ga0157372_10159249 Ga0157372_101592493 289
404 3300014745 Ga0157377_10013802 Ga0157377_100138023 289
405 3300025302 Ga0207426_1000040 Ga0207426_1000040218 289
406 3300025933 Ga0207706_10017416 Ga0207706_100174164 289
407 3300025938 Ga0207704_10482246 Ga0207704_104822461 289
408 3300025942 Ga0207689_10007312 Ga0207689_100073126 289
409 3300025960 Ga0207651_10543719 Ga0207651_105437191 289
410 3300026023 Ga0207677_10023169 Ga0207677_100231693 289
411 3300026118 Ga0207675_100333935 Ga0207675_1003339352 289
412 3300037418 Ga0395900_0105523 Ga0395900_0105523_1532_2413 289
413 3300044712 Ga0453684_0086538 Ga0453684_0086538_479_1360 289
414 3300049515 Ga0501292_007803 Ga0501292_007803_17_904 289
415 3300049521 Ga0501298_002065 Ga0501298_002065_57_944 289
416 3300049523 Ga0501300_002404 Ga0501300_002404_520_1407 289
417 3300049572 Ga0501036_0225091 Ga0501036_0225091_360_1244 289
418 3300049574 Ga0501038_0063242 Ga0501038_0063242_2171_3055 289
419 3300049579 Ga0501043_0045170 Ga0501043_0045170_1360_2244 289
420 3300049580 Ga0501046_0001780 Ga0501046_0001780_162_1046 289
421 3300049586 Ga0501070_0101064 Ga0501070_0101064_997_1881 289
422 3300049590 Ga0501074_0001751 Ga0501074_0001751_11749_12633 289
423 3300049649 Ga0501198_005411 Ga0501198_005411_275_1162 289
424 3300049651 Ga0501201_000010 Ga0501201_000010_3122_4009 289
425 3300049654 Ga0501207_000091 Ga0501207_000091_958_1845 289
426 3300049661 Ga0501217_003534 Ga0501217_003534_1781_2668 289
427 3300049662 Ga0501222_003088 Ga0501222_003088_769_1656 289
428 3300049663 Ga0501223_004726 Ga0501223_004726_1727_2614 289
429 3300049664 Ga0501224_000271 Ga0501224_000271_3339_4226 289
430 3300049668 Ga0501233_000927 Ga0501233_000927_279_1166 289
431 3300049669 Ga0501235_000256 Ga0501235_000256_769_1656 289
432 3300049673 Ga0501240_002698 Ga0501240_002698_399_1286 289
433 3300049675 Ga0501243_002836 Ga0501243_002836_1173_2060 289
434 3300049679 Ga0501249_004647 Ga0501249_004647_996_1883 289
435 3300049683 Ga0501253_005612 Ga0501253_005612_494_1381 289
436 3300049686 Ga0501257_011928 Ga0501257_011928_28_915 289
437 3300049688 Ga0501259_000276 Ga0501259_000276_5455_6342 289
438 3300049690 Ga0501261_004108 Ga0501261_004108_150_1037 289
439 3300049704 Ga0501221_000133 Ga0501221_000133_1074_1961 289
440 3300049705 Ga0501225_0015107 Ga0501225_0015107_110_997 289
441 3300049707 Ga0501234_007515 Ga0501234_007515_637_1524 289
442 3300049708 Ga0501245_000074 Ga0501245_000074_951_1838 289
443 3300049744 Ga0501083_0004260 Ga0501083_0004260_8880_9764 289
444 3300049758 Ga0501241_006602 Ga0501241_006602_716_1603 289
445 3300049822 Ga0501035_0121282 Ga0501035_0121282_1259_2143 289
446 3300053153 Ga0500616_0018027 Ga0500616_0018027_1825_2706 289
447 3300002077 JGI24744J21845_10033521 JGI24744J21845_100335211 290
448 3300002459 JGI24751J29686_10014477 JGI24751J29686_100144772 290
449 3300003316 rootH1_10010046 rootH1_100100462 290
450 3300003316 rootH1_10188995 rootH1_101889952 290
451 3300003320 rootH2_10029651 rootH2_100296512 290
452 3300003323 rootH1_10011210 rootH1_100112109 290
453 3300003762 Ga0055542_1006756 Ga0055542_10067562 290
454 3300005290 Ga0065712_10072376 Ga0065712_100723762 290
455 3300005290 Ga0065712_10086854 Ga0065712_100868543 290
456 3300005295 Ga0065707_10113753 Ga0065707_101137532 290
457 3300005295 Ga0065707_10137728 Ga0065707_101377282 290
458 3300005327 Ga0070658_10011496 Ga0070658_100114964 290
459 3300005327 Ga0070658_10119117 Ga0070658_101191172 290
460 3300005327 Ga0070658_10152409 Ga0070658_101524091 290
461 3300005327 Ga0070658_10193735 Ga0070658_101937352 290
462 3300005327 Ga0070658_10195329 Ga0070658_101953291 290
463 3300005328 Ga0070676_10002273 Ga0070676_100022739 290
464 3300005329 Ga0070683_100005271 Ga0070683_1000052717 290
465 3300005329 Ga0070683_100141657 Ga0070683_1001416572 290
466 3300005330 Ga0070690_100023369 Ga0070690_1000233694 290
467 3300005330 Ga0070690_100115991 Ga0070690_1001159912 290
468 3300005331 Ga0070670_100005023 Ga0070670_1000050235 290
469 3300005331 Ga0070670_100038908 Ga0070670_1000389085 290
470 3300005331 Ga0070670_100055561 Ga0070670_1000555612 290
471 3300005331 Ga0070670_100057493 Ga0070670_1000574934 290
472 3300005331 Ga0070670_100060063 Ga0070670_1000600634 290
473 3300005331 Ga0070670_100192706 Ga0070670_1001927062 290
474 3300005334 Ga0068869_100039178 Ga0068869_1000391782 290
475 3300005334 Ga0068869_100059837 Ga0068869_1000598372 290
476 3300005334 Ga0068869_100065886 Ga0068869_1000658862 290
477 3300005334 Ga0068869_100435121 Ga0068869_1004351211 290
478 3300005335 Ga0070666_10000055 Ga0070666_1000005583 290
479 3300005335 Ga0070666_10070040 Ga0070666_100700402 290
480 3300005335 Ga0070666_10076438 Ga0070666_100764382 290
481 3300005335 Ga0070666_10204927 Ga0070666_102049272 290
482 3300005336 Ga0070680_100012999 Ga0070680_1000129992 290
483 3300005336 Ga0070680_100038489 Ga0070680_1000384891 290
484 3300005336 Ga0070680_100073505 Ga0070680_1000735053 290
485 3300005336 Ga0070680_100132853 Ga0070680_1001328532 290
486 3300005336 Ga0070680_100150644 Ga0070680_1001506442 290
487 3300005337 Ga0070682_100079918 Ga0070682_1000799182 290
488 3300005338 Ga0068868_100004611 Ga0068868_1000046114 290
489 3300005338 Ga0068868_100044769 Ga0068868_1000447692 290
490 3300005338 Ga0068868_100046339 Ga0068868_1000463392 290
491 3300005338 Ga0068868_100100707 Ga0068868_1001007072 290
492 3300005338 Ga0068868_100219617 Ga0068868_1002196171 290
493 3300005338 Ga0068868_100238296 Ga0068868_1002382962 290
494 3300005339 Ga0070660_100173837 Ga0070660_1001738372 290
495 3300005339 Ga0070660_100341269 Ga0070660_1003412691 290
496 3300005339 Ga0070660_100440971 Ga0070660_1004409711 290
497 3300005340 Ga0070689_100011119 Ga0070689_1000111191 290
498 3300005340 Ga0070689_100030362 Ga0070689_1000303622 290
499 3300005340 Ga0070689_100148575 Ga0070689_1001485752 290
500 3300005343 Ga0070687_100037290 Ga0070687_1000372902 290
501 3300005344 Ga0070661_100001376 Ga0070661_1000013767 290
502 3300005344 Ga0070661_100007905 Ga0070661_1000079056 290
503 3300005347 Ga0070668_100019363 Ga0070668_1000193634 290
504 3300005347 Ga0070668_100050922 Ga0070668_1000509222 290
505 3300005347 Ga0070668_100170160 Ga0070668_1001701601 290
506 3300005353 Ga0070669_100043207 Ga0070669_1000432072 290
507 3300005354 Ga0070675_100052264 Ga0070675_1000522644 290
508 3300005354 Ga0070675_100076044 Ga0070675_1000760444 290
509 3300005354 Ga0070675_100119004 Ga0070675_1001190042 290
510 3300005354 Ga0070675_100322750 Ga0070675_1003227501 290
511 3300005355 Ga0070671_100093885 Ga0070671_1000938852 290
512 3300005355 Ga0070671_100184326 Ga0070671_1001843262 290
513 3300005356 Ga0070674_100022849 Ga0070674_1000228496 290
514 3300005356 Ga0070674_100035562 Ga0070674_1000355623 290
515 3300005364 Ga0070673_100016889 Ga0070673_1000168893 290
516 3300005364 Ga0070673_100026959 Ga0070673_1000269595 290
517 3300005364 Ga0070673_100049484 Ga0070673_1000494843 290
518 3300005365 Ga0070688_100008926 Ga0070688_1000089266 290
519 3300005365 Ga0070688_100010064 Ga0070688_1000100641 290
520 3300005365 Ga0070688_100110538 Ga0070688_1001105381 290
521 3300005366 Ga0070659_100017088 Ga0070659_1000170883 290
522 3300005366 Ga0070659_100137850 Ga0070659_1001378502 290
523 3300005367 Ga0070667_100016479 Ga0070667_1000164796 290
524 3300005367 Ga0070667_100020920 Ga0070667_1000209204 290
525 3300005367 Ga0070667_100023520 Ga0070667_1000235203 290
526 3300005367 Ga0070667_100062801 Ga0070667_1000628012 290
527 3300005367 Ga0070667_100147648 Ga0070667_1001476482 290
528 3300005367 Ga0070667_100445836 Ga0070667_1004458361 290
529 3300005438 Ga0070701_10017095 Ga0070701_100170952 290
530 3300005455 Ga0070663_100007273 Ga0070663_1000072732 290
531 3300005456 Ga0070678_100066318 Ga0070678_1000663183 290
532 3300005457 Ga0070662_100034025 Ga0070662_1000340253 290
533 3300005457 Ga0070662_100095012 Ga0070662_1000950122 290
534 3300005458 Ga0070681_10091204 Ga0070681_100912043 290
535 3300005458 Ga0070681_10115038 Ga0070681_101150382 290
536 3300005459 Ga0068867_100008127 Ga0068867_1000081274 290
537 3300005459 Ga0068867_100013549 Ga0068867_1000135493 290
538 3300005459 Ga0068867_100065780 Ga0068867_1000657802 290
539 3300005459 Ga0068867_100094962 Ga0068867_1000949622 290
540 3300005459 Ga0068867_100153421 Ga0068867_1001534213 290
541 3300005459 Ga0068867_100172702 Ga0068867_1001727022 290
542 3300005466 Ga0070685_10017726 Ga0070685_100177261 290
543 3300005471 Ga0070698_100054790 Ga0070698_1000547905 290
544 3300005530 Ga0070679_100005513 Ga0070679_1000055138 290
545 3300005530 Ga0070679_100022012 Ga0070679_1000220123 290
546 3300005530 Ga0070679_100038659 Ga0070679_1000386595 290
547 3300005530 Ga0070679_100063078 Ga0070679_1000630782 290
548 3300005530 Ga0070679_100074374 Ga0070679_1000743742 290
549 3300005535 Ga0070684_100003135 Ga0070684_1000031358 290
550 3300005535 Ga0070684_100004694 Ga0070684_1000046946 290
551 3300005535 Ga0070684_100043434 Ga0070684_1000434342 290
552 3300005535 Ga0070684_100307185 Ga0070684_1003071852 290
553 3300005539 Ga0068853_100001210 Ga0068853_1000012108 290
554 3300005539 Ga0068853_100053579 Ga0068853_1000535794 290
555 3300005539 Ga0068853_100057886 Ga0068853_1000578861 290
556 3300005539 Ga0068853_100060990 Ga0068853_1000609905 290
557 3300005539 Ga0068853_100229240 Ga0068853_1002292402 290
558 3300005539 Ga0068853_100231884 Ga0068853_1002318842 290
559 3300005539 Ga0068853_100371980 Ga0068853_1003719802 290
560 3300005543 Ga0070672_100013858 Ga0070672_1000138585 290
561 3300005543 Ga0070672_100088106 Ga0070672_1000881062 290
562 3300005543 Ga0070672_100105454 Ga0070672_1001054543 290
563 3300005543 Ga0070672_100132230 Ga0070672_1001322302 290
564 3300005543 Ga0070672_100283698 Ga0070672_1002836982 290
565 3300005543 Ga0070672_100411476 Ga0070672_1004114761 290
566 3300005544 Ga0070686_100015822 Ga0070686_1000158226 290
567 3300005544 Ga0070686_100083132 Ga0070686_1000831322 290
568 3300005548 Ga0070665_100044176 Ga0070665_1000441766 290
569 3300005548 Ga0070665_100175600 Ga0070665_1001756002 290
570 3300005548 Ga0070665_100415359 Ga0070665_1004153591 290
571 3300005563 Ga0068855_100004618 Ga0068855_1000046183 290
572 3300005563 Ga0068855_100032614 Ga0068855_1000326142 290
573 3300005563 Ga0068855_100090889 Ga0068855_1000908894 290
574 3300005563 Ga0068855_100097089 Ga0068855_1000970892 290
575 3300005563 Ga0068855_100135543 Ga0068855_1001355432 290
576 3300005563 Ga0068855_100144269 Ga0068855_1001442693 290
577 3300005563 Ga0068855_100166587 Ga0068855_1001665873 290
578 3300005563 Ga0068855_100184370 Ga0068855_1001843702 290
579 3300005563 Ga0068855_100192186 Ga0068855_1001921863 290
580 3300005564 Ga0070664_100024601 Ga0070664_1000246012 290
581 3300005564 Ga0070664_100037259 Ga0070664_1000372594 290
582 3300005564 Ga0070664_100094129 Ga0070664_1000941293 290
583 3300005564 Ga0070664_100320206 Ga0070664_1003202062 290
584 3300005577 Ga0068857_100008662 Ga0068857_1000086626 290
585 3300005577 Ga0068857_100023723 Ga0068857_1000237234 290
586 3300005577 Ga0068857_100065629 Ga0068857_1000656293 290
587 3300005577 Ga0068857_100129045 Ga0068857_1001290452 290
588 3300005577 Ga0068857_100192414 Ga0068857_1001924142 290
589 3300005577 Ga0068857_100303707 Ga0068857_1003037072 290
590 3300005578 Ga0068854_100083728 Ga0068854_1000837283 290
591 3300005578 Ga0068854_100084927 Ga0068854_1000849272 290
592 3300005578 Ga0068854_100145832 Ga0068854_1001458322 290
593 3300005614 Ga0068856_100024408 Ga0068856_1000244084 290
594 3300005614 Ga0068856_100033821 Ga0068856_1000338213 290
595 3300005614 Ga0068856_100117719 Ga0068856_1001177191 290
596 3300005615 Ga0070702_100004198 Ga0070702_1000041988 290
597 3300005615 Ga0070702_100114238 Ga0070702_1001142382 290
598 3300005616 Ga0068852_100020905 Ga0068852_1000209053 290
599 3300005616 Ga0068852_100028008 Ga0068852_1000280082 290
600 3300005616 Ga0068852_100030211 Ga0068852_1000302114 290
601 3300005616 Ga0068852_100030564 Ga0068852_1000305644 290
602 3300005616 Ga0068852_100150061 Ga0068852_1001500612 290
603 3300005616 Ga0068852_100163935 Ga0068852_1001639351 290
604 3300005616 Ga0068852_100196228 Ga0068852_1001962282 290
605 3300005616 Ga0068852_100588367 Ga0068852_1005883672 290
606 3300005617 Ga0068859_100000003 Ga0068859_1000000034 290
607 3300005617 Ga0068859_100009053 Ga0068859_10000905314 290
608 3300005617 Ga0068859_100079543 Ga0068859_1000795433 290
609 3300005617 Ga0068859_100162605 Ga0068859_1001626052 290
610 3300005618 Ga0068864_100023605 Ga0068864_1000236052 290
611 3300005618 Ga0068864_100058196 Ga0068864_1000581963 290
612 3300005618 Ga0068864_100661561 Ga0068864_1006615612 290
613 3300005718 Ga0068866_10031537 Ga0068866_100315372 290
614 3300005718 Ga0068866_10052184 Ga0068866_100521843 290
615 3300005718 Ga0068866_10145016 Ga0068866_101450161 290
616 3300005719 Ga0068861_100005990 Ga0068861_1000059902 290
617 3300005719 Ga0068861_100097820 Ga0068861_1000978202 290
618 3300005719 Ga0068861_100175467 Ga0068861_1001754672 290
619 3300005719 Ga0068861_100665406 Ga0068861_1006654061 290
620 3300005834 Ga0068851_10009472 Ga0068851_100094725 290
621 3300005834 Ga0068851_10011720 Ga0068851_100117202 290
622 3300005834 Ga0068851_10058367 Ga0068851_100583672 290
623 3300005834 Ga0068851_10088679 Ga0068851_100886792 290
624 3300005840 Ga0068870_10045932 Ga0068870_100459324 290
625 3300005840 Ga0068870_10087394 Ga0068870_100873941 290
626 3300005841 Ga0068863_100020280 Ga0068863_1000202805 290
627 3300005841 Ga0068863_100053692 Ga0068863_1000536922 290
628 3300005841 Ga0068863_100083745 Ga0068863_1000837452 290
629 3300005841 Ga0068863_100500876 Ga0068863_1005008762 290
630 3300005842 Ga0068858_100022366 Ga0068858_1000223662 290
631 3300005842 Ga0068858_100193457 Ga0068858_1001934572 290
632 3300005842 Ga0068858_100243533 Ga0068858_1002435332 290
633 3300005842 Ga0068858_100671015 Ga0068858_1006710152 290
634 3300005843 Ga0068860_100001494 Ga0068860_1000014949 290
635 3300005843 Ga0068860_100003395 Ga0068860_10000339512 290
636 3300005843 Ga0068860_100008704 Ga0068860_1000087045 290
637 3300005843 Ga0068860_100012840 Ga0068860_1000128407 290
638 3300005843 Ga0068860_100043514 Ga0068860_1000435143 290
639 3300005843 Ga0068860_100069709 Ga0068860_1000697092 290
640 3300005843 Ga0068860_100075622 Ga0068860_1000756223 290
641 3300005843 Ga0068860_100151641 Ga0068860_1001516412 290
642 3300005843 Ga0068860_100159738 Ga0068860_1001597382 290
643 3300005844 Ga0068862_100013758 Ga0068862_1000137587 290
644 3300005844 Ga0068862_100092346 Ga0068862_1000923463 290
645 3300005844 Ga0068862_100110647 Ga0068862_1001106473 290
646 3300005844 Ga0068862_100119107 Ga0068862_1001191072 290
647 3300005844 Ga0068862_100409780 Ga0068862_1004097802 290
648 3300005844 Ga0068862_100551809 Ga0068862_1005518092 290
649 3300005983 Ga0081540_1018746 Ga0081540_10187464 290
650 3300006195 Ga0075366_10051449 Ga0075366_100514491 290
651 3300006237 Ga0097621_100049668 Ga0097621_1000496681 290
652 3300006237 Ga0097621_100125382 Ga0097621_1001253822 290
653 3300006237 Ga0097621_100211817 Ga0097621_1002118172 290
654 3300006237 Ga0097621_100268537 Ga0097621_1002685372 290
655 3300006237 Ga0097621_100552437 Ga0097621_1005524371 290
656 3300006358 Ga0068871_100007800 Ga0068871_1000078002 290
657 3300006358 Ga0068871_100035111 Ga0068871_1000351114 290
658 3300006358 Ga0068871_100228955 Ga0068871_1002289552 290
659 3300006358 Ga0068871_100323037 Ga0068871_1003230372 290
660 3300006880 Ga0075429_100035722 Ga0075429_1000357225 290
661 3300006881 Ga0068865_100058052 Ga0068865_1000580522 290
662 3300006881 Ga0068865_100058786 Ga0068865_1000587863 290
663 3300006881 Ga0068865_100135640 Ga0068865_1001356402 290
664 3300006931 Ga0097620_100000003 Ga0097620_1000000034 290
665 3300006931 Ga0097620_100009053 Ga0097620_10000905314 290
666 3300006931 Ga0097620_100079547 Ga0097620_1000795472 290
667 3300006931 Ga0097620_100162609 Ga0097620_1001626092 290
668 3300009093 Ga0105240_10043611 Ga0105240_100436114 290
669 3300009094 Ga0111539_10006625 Ga0111539_1000662513 290
670 3300009094 Ga0111539_10067897 Ga0111539_100678973 290
671 3300009098 Ga0105245_10059034 Ga0105245_100590343 290
672 3300009101 Ga0105247_10045251 Ga0105247_100452512 290
673 3300009147 Ga0114129_10001087 Ga0114129_1000108738 290
674 3300009174 Ga0105241_10002426 Ga0105241_100024263 290
675 3300009174 Ga0105241_10008671 Ga0105241_100086714 290
676 3300009174 Ga0105241_10063653 Ga0105241_100636533 290
677 3300009174 Ga0105241_10088407 Ga0105241_100884072 290
678 3300009174 Ga0105241_10585658 Ga0105241_105856581 290
679 3300009176 Ga0105242_10025041 Ga0105242_100250414 290
680 3300009176 Ga0105242_10036312 Ga0105242_100363125 290
681 3300009176 Ga0105242_10077974 Ga0105242_100779742 290
682 3300009177 Ga0105248_10112826 Ga0105248_101128262 290
683 3300009545 Ga0105237_10002430 Ga0105237_1000243022 290
684 3300009545 Ga0105237_10017579 Ga0105237_100175794 290
685 3300009545 Ga0105237_10031106 Ga0105237_100311066 290
686 3300009553 Ga0105249_10010629 Ga0105249_100106292 290
687 3300009553 Ga0105249_10076176 Ga0105249_100761763 290
688 3300009553 Ga0105249_10102479 Ga0105249_101024793 290
689 3300009553 Ga0105249_10123558 Ga0105249_101235582 290
690 3300010375 Ga0105239_10000940 Ga0105239_1000094030 290
691 3300010375 Ga0105239_10055088 Ga0105239_100550882 290
692 3300010375 Ga0105239_10076981 Ga0105239_100769812 290
693 3300010375 Ga0105239_10095902 Ga0105239_100959021 290
694 3300010375 Ga0105239_10287264 Ga0105239_102872642 290
695 3300010375 Ga0105239_10311445 Ga0105239_103114451 290
696 3300011119 Ga0105246_10170401 Ga0105246_101704012 290
697 3300013100 Ga0157373_10014249 Ga0157373_100142494 290
698 3300013100 Ga0157373_10017251 Ga0157373_100172515 290
699 3300013100 Ga0157373_10032426 Ga0157373_100324261 290
700 3300013100 Ga0157373_10146918 Ga0157373_101469183 290
701 3300013102 Ga0157371_10000326 Ga0157371_1000032617 290
702 3300013102 Ga0157371_10000668 Ga0157371_1000066832 290
703 3300013102 Ga0157371_10009540 Ga0157371_100095403 290
704 3300013102 Ga0157371_10016406 Ga0157371_100164062 290
705 3300013102 Ga0157371_10020440 Ga0157371_100204404 290
706 3300013102 Ga0157371_10021529 Ga0157371_100215292 290
707 3300013102 Ga0157371_10023387 Ga0157371_100233873 290
708 3300013102 Ga0157371_10024808 Ga0157371_100248083 290
709 3300013102 Ga0157371_10041554 Ga0157371_100415543 290
710 3300013102 Ga0157371_10086136 Ga0157371_100861362 290
711 3300013102 Ga0157371_10139437 Ga0157371_101394371 290
712 3300013104 Ga0157370_10005618 Ga0157370_100056185 290
713 3300013104 Ga0157370_10022074 Ga0157370_100220747 290
714 3300013104 Ga0157370_10150060 Ga0157370_101500602 290
715 3300013104 Ga0157370_10157588 Ga0157370_101575881 290
716 3300013104 Ga0157370_10564901 Ga0157370_105649011 290
717 3300013105 Ga0157369_10013331 Ga0157369_100133318 290
718 3300013105 Ga0157369_10023949 Ga0157369_100239495 290
719 3300013105 Ga0157369_10035821 Ga0157369_100358213 290
720 3300013105 Ga0157369_10102026 Ga0157369_101020263 290
721 3300013105 Ga0157369_10113483 Ga0157369_101134832 290
722 3300013105 Ga0157369_10158110 Ga0157369_101581102 290
723 3300013296 Ga0157374_10008165 Ga0157374_100081656 290
724 3300013296 Ga0157374_10037083 Ga0157374_100370832 290
725 3300013296 Ga0157374_10079191 Ga0157374_100791913 290
726 3300013296 Ga0157374_10194611 Ga0157374_101946112 290
727 3300013296 Ga0157374_10250954 Ga0157374_102509542 290
728 3300013297 Ga0157378_10016682 Ga0157378_100166826 290
729 3300013297 Ga0157378_10040519 Ga0157378_100405194 290
730 3300013297 Ga0157378_10101348 Ga0157378_101013482 290
731 3300013297 Ga0157378_10129134 Ga0157378_101291342 290
732 3300013297 Ga0157378_10137283 Ga0157378_101372833 290
733 3300013297 Ga0157378_10383958 Ga0157378_103839582 290
734 3300013306 Ga0163162_10000446 Ga0163162_1000044639 290
735 3300013306 Ga0163162_10006585 Ga0163162_100065857 290
736 3300013306 Ga0163162_10018072 Ga0163162_100180726 290
737 3300013306 Ga0163162_10082439 Ga0163162_100824392 290
738 3300013306 Ga0163162_10258425 Ga0163162_102584252 290
739 3300013306 Ga0163162_10450046 Ga0163162_104500462 290
740 3300013306 Ga0163162_10620888 Ga0163162_106208881 290
741 3300013307 Ga0157372_10005014 Ga0157372_100050142 290
742 3300013307 Ga0157372_10007311 Ga0157372_100073116 290
743 3300013307 Ga0157372_10039260 Ga0157372_100392603 290
744 3300013307 Ga0157372_10045238 Ga0157372_100452382 290
745 3300013307 Ga0157372_10051327 Ga0157372_100513274 290
746 3300013307 Ga0157372_10084813 Ga0157372_100848133 290
747 3300013307 Ga0157372_10102864 Ga0157372_101028642 290
748 3300013307 Ga0157372_10115544 Ga0157372_101155442 290
749 3300013307 Ga0157372_10298464 Ga0157372_102984642 290
750 3300013307 Ga0157372_10358567 Ga0157372_103585672 290
751 3300013307 Ga0157372_10392172 Ga0157372_103921722 290
752 3300013307 Ga0157372_10740720 Ga0157372_107407201 290
753 3300013308 Ga0157375_10059068 Ga0157375_100590684 290
754 3300013308 Ga0157375_10103890 Ga0157375_101038901 290
755 3300013308 Ga0157375_10147066 Ga0157375_101470662 290
756 3300014325 Ga0163163_10000325 Ga0163163_1000032539 290
757 3300014325 Ga0163163_10002269 Ga0163163_100022698 290
758 3300014325 Ga0163163_10130995 Ga0163163_101309952 290
759 3300014325 Ga0163163_10268279 Ga0163163_102682792 290
760 3300014325 Ga0163163_10369744 Ga0163163_103697442 290
761 3300014325 Ga0163163_10437765 Ga0163163_104377651 290
762 3300014326 Ga0157380_10020971 Ga0157380_100209712 290
763 3300014326 Ga0157380_10107982 Ga0157380_101079823 290
764 3300014745 Ga0157377_10010405 Ga0157377_100104052 290
765 3300014745 Ga0157377_10031414 Ga0157377_100314143 290
766 3300014968 Ga0157379_10018323 Ga0157379_100183233 290
767 3300014968 Ga0157379_10027729 Ga0157379_100277293 290
768 3300014968 Ga0157379_10103462 Ga0157379_101034622 290
769 3300014969 Ga0157376_10035020 Ga0157376_100350204 290
770 3300014969 Ga0157376_10060866 Ga0157376_100608662 290
771 3300014969 Ga0157376_10074918 Ga0157376_100749182 290
772 3300014969 Ga0157376_10136357 Ga0157376_101363572 290
773 3300014969 Ga0157376_10591673 Ga0157376_105916731 290
774 3300017792 Ga0163161_10033267 Ga0163161_100332671 290
775 3300017792 Ga0163161_10116620 Ga0163161_101166202 290
776 3300021384 Ga0213876_10019087 Ga0213876_100190872 290
777 3300025242 Ga0209258_100098 Ga0209258_100098114 290
778 3300025246 Ga0209646_1000578 Ga0209646_10005787 290
779 3300025254 Ga0209148_1000120 Ga0209148_100012088 290
780 3300025315 Ga0207697_10007616 Ga0207697_100076165 290
781 3300025321 Ga0207656_10010753 Ga0207656_100107532 290
782 3300025321 Ga0207656_10100464 Ga0207656_101004642 290
783 3300025899 Ga0207642_10128333 Ga0207642_101283332 290
784 3300025901 Ga0207688_10020012 Ga0207688_100200123 290
785 3300025903 Ga0207680_10000021 Ga0207680_1000002185 290
786 3300025904 Ga0207647_10034227 Ga0207647_100342273 290
787 3300025904 Ga0207647_10243950 Ga0207647_102439501 290
788 3300025907 Ga0207645_10000748 Ga0207645_1000074812 290
789 3300025907 Ga0207645_10038081 Ga0207645_100380813 290
790 3300025908 Ga0207643_10005299 Ga0207643_100052993 290
791 3300025908 Ga0207643_10022737 Ga0207643_100227375 290
792 3300025908 Ga0207643_10096252 Ga0207643_100962522 290
793 3300025909 Ga0207705_10016349 Ga0207705_100163495 290
794 3300025909 Ga0207705_10052204 Ga0207705_100522044 290
795 3300025909 Ga0207705_10067316 Ga0207705_100673162 290
796 3300025911 Ga0207654_10015275 Ga0207654_100152751 290
797 3300025912 Ga0207707_10016034 Ga0207707_100160347 290
798 3300025912 Ga0207707_10295871 Ga0207707_102958711 290
799 3300025913 Ga0207695_10008314 Ga0207695_1000831412 290
800 3300025913 Ga0207695_10272097 Ga0207695_102720971 290
801 3300025914 Ga0207671_10005577 Ga0207671_100055779 290
802 3300025914 Ga0207671_10032937 Ga0207671_100329371 290
803 3300025917 Ga0207660_10030770 Ga0207660_100307702 290
804 3300025918 Ga0207662_10032572 Ga0207662_100325722 290
805 3300025919 Ga0207657_10097305 Ga0207657_100973053 290
806 3300025919 Ga0207657_10179047 Ga0207657_101790472 290
807 3300025919 Ga0207657_10269224 Ga0207657_102692242 290
808 3300025919 Ga0207657_10349482 Ga0207657_103494821 290
809 3300025920 Ga0207649_10002669 Ga0207649_100026691 290
810 3300025920 Ga0207649_10007975 Ga0207649_100079755 290
811 3300025921 Ga0207652_10000633 Ga0207652_1000063335 290
812 3300025921 Ga0207652_10026129 Ga0207652_100261294 290
813 3300025921 Ga0207652_10042720 Ga0207652_100427202 290
814 3300025921 Ga0207652_10065543 Ga0207652_100655432 290
815 3300025921 Ga0207652_10087251 Ga0207652_100872513 290
816 3300025923 Ga0207681_10041081 Ga0207681_100410813 290
817 3300025925 Ga0207650_10000730 Ga0207650_100007302 290
818 3300025925 Ga0207650_10037296 Ga0207650_100372964 290
819 3300025925 Ga0207650_10130872 Ga0207650_101308722 290
820 3300025925 Ga0207650_10139615 Ga0207650_101396152 290
821 3300025925 Ga0207650_10177167 Ga0207650_101771671 290
822 3300025925 Ga0207650_10207238 Ga0207650_102072382 290
823 3300025925 Ga0207650_10276585 Ga0207650_102765852 290
824 3300025926 Ga0207659_10021036 Ga0207659_100210365 290
825 3300025926 Ga0207659_10059546 Ga0207659_100595462 290
826 3300025926 Ga0207659_10145101 Ga0207659_101451012 290
827 3300025931 Ga0207644_10115163 Ga0207644_101151632 290
828 3300025931 Ga0207644_10123976 Ga0207644_101239762 290
829 3300025931 Ga0207644_10144903 Ga0207644_101449032 290
830 3300025932 Ga0207690_10007408 Ga0207690_100074085 290
831 3300025932 Ga0207690_10036137 Ga0207690_100361373 290
832 3300025932 Ga0207690_10070539 Ga0207690_100705391 290
833 3300025933 Ga0207706_10007108 Ga0207706_100071086 290
834 3300025934 Ga0207686_10161546 Ga0207686_101615462 290
835 3300025936 Ga0207670_10094913 Ga0207670_100949132 290
836 3300025936 Ga0207670_10277765 Ga0207670_102777651 290
837 3300025937 Ga0207669_10013989 Ga0207669_100139892 290
838 3300025937 Ga0207669_10057689 Ga0207669_100576892 290
839 3300025938 Ga0207704_10059642 Ga0207704_100596422 290
840 3300025938 Ga0207704_10127967 Ga0207704_101279672 290
841 3300025940 Ga0207691_10021281 Ga0207691_100212815 290
842 3300025940 Ga0207691_10035730 Ga0207691_100357302 290
843 3300025940 Ga0207691_10044522 Ga0207691_100445224 290
844 3300025940 Ga0207691_10045725 Ga0207691_100457254 290
845 3300025940 Ga0207691_10085460 Ga0207691_100854602 290
846 3300025940 Ga0207691_10381804 Ga0207691_103818042 290
847 3300025942 Ga0207689_10000628 Ga0207689_1000062813 290
848 3300025942 Ga0207689_10026457 Ga0207689_100264573 290
849 3300025942 Ga0207689_10026582 Ga0207689_100265823 290
850 3300025942 Ga0207689_10041325 Ga0207689_100413253 290
851 3300025942 Ga0207689_10099058 Ga0207689_100990582 290
852 3300025942 Ga0207689_10144372 Ga0207689_101443722 290
853 3300025944 Ga0207661_10022692 Ga0207661_100226921 290
854 3300025944 Ga0207661_10023969 Ga0207661_100239692 290
855 3300025944 Ga0207661_10092258 Ga0207661_100922582 290
856 3300025944 Ga0207661_10201229 Ga0207661_102012292 290
857 3300025945 Ga0207679_10008941 Ga0207679_100089412 290
858 3300025945 Ga0207679_10029132 Ga0207679_100291324 290
859 3300025945 Ga0207679_10052171 Ga0207679_100521714 290
860 3300025945 Ga0207679_10201863 Ga0207679_102018632 290
861 3300025945 Ga0207679_10235237 Ga0207679_102352371 290
862 3300025945 Ga0207679_10319927 Ga0207679_103199272 290
863 3300025945 Ga0207679_10438471 Ga0207679_104384711 290
864 3300025949 Ga0207667_10000936 Ga0207667_100009363 290
865 3300025949 Ga0207667_10004188 Ga0207667_1000418810 290
866 3300025949 Ga0207667_10025535 Ga0207667_100255353 290
867 3300025949 Ga0207667_10078620 Ga0207667_100786203 290
868 3300025949 Ga0207667_10251321 Ga0207667_102513211 290
869 3300025960 Ga0207651_10093367 Ga0207651_100933673 290
870 3300025960 Ga0207651_10193664 Ga0207651_101936642 290
871 3300025961 Ga0207712_10004528 Ga0207712_100045287 290
872 3300025961 Ga0207712_10038033 Ga0207712_100380332 290
873 3300025961 Ga0207712_10071705 Ga0207712_100717053 290
874 3300025961 Ga0207712_10261662 Ga0207712_102616622 290
875 3300025972 Ga0207668_10014070 Ga0207668_100140703 290
876 3300025972 Ga0207668_10032875 Ga0207668_100328753 290
877 3300025981 Ga0207640_10037196 Ga0207640_100371963 290
878 3300025981 Ga0207640_10037747 Ga0207640_100377472 290
879 3300025981 Ga0207640_10144195 Ga0207640_101441952 290
880 3300025986 Ga0207658_10009068 Ga0207658_100090681 290
881 3300025986 Ga0207658_10017648 Ga0207658_100176483 290
882 3300025986 Ga0207658_10041616 Ga0207658_100416164 290
883 3300025986 Ga0207658_10111090 Ga0207658_101110902 290
884 3300026023 Ga0207677_10008822 Ga0207677_100088223 290
885 3300026023 Ga0207677_10241327 Ga0207677_102413271 290
886 3300026023 Ga0207677_10247571 Ga0207677_102475711 290
887 3300026035 Ga0207703_10005370 Ga0207703_100053706 290
888 3300026035 Ga0207703_10097591 Ga0207703_100975914 290
889 3300026035 Ga0207703_10204813 Ga0207703_102048132 290
890 3300026041 Ga0207639_10001239 Ga0207639_100012396 290
891 3300026041 Ga0207639_10046531 Ga0207639_100465315 290
892 3300026041 Ga0207639_10160390 Ga0207639_101603901 290
893 3300026041 Ga0207639_10305911 Ga0207639_103059112 290
894 3300026067 Ga0207678_10039950 Ga0207678_100399504 290
895 3300026067 Ga0207678_10057567 Ga0207678_100575673 290
896 3300026067 Ga0207678_10108391 Ga0207678_101083912 290
897 3300026075 Ga0207708_10017910 Ga0207708_100179104 290
898 3300026078 Ga0207702_10035921 Ga0207702_100359211 290
899 3300026088 Ga0207641_10000442 Ga0207641_1000044257 290
900 3300026088 Ga0207641_10110366 Ga0207641_101103662 290
901 3300026088 Ga0207641_10295590 Ga0207641_102955901 290
902 3300026089 Ga0207648_10000372 Ga0207648_1000037220 290
903 3300026089 Ga0207648_10005357 Ga0207648_100053575 290
904 3300026089 Ga0207648_10054623 Ga0207648_100546234 290
905 3300026089 Ga0207648_10055067 Ga0207648_100550673 290
906 3300026089 Ga0207648_10058257 Ga0207648_100582574 290
907 3300026089 Ga0207648_10092980 Ga0207648_100929802 290
908 3300026089 Ga0207648_10228913 Ga0207648_102289133 290
909 3300026089 Ga0207648_10283950 Ga0207648_102839502 290
910 3300026089 Ga0207648_10289000 Ga0207648_102890002 290
911 3300026095 Ga0207676_10008995 Ga0207676_100089954 290
912 3300026095 Ga0207676_10026560 Ga0207676_100265603 290
913 3300026116 Ga0207674_10008317 Ga0207674_100083173 290
914 3300026116 Ga0207674_10010951 Ga0207674_100109518 290
915 3300026116 Ga0207674_10014298 Ga0207674_100142984 290
916 3300026116 Ga0207674_10064718 Ga0207674_100647184 290
917 3300026116 Ga0207674_10159572 Ga0207674_101595721 290
918 3300026116 Ga0207674_10233262 Ga0207674_102332621 290
919 3300026118 Ga0207675_100001072 Ga0207675_10000107211 290
920 3300026118 Ga0207675_100056264 Ga0207675_1000562642 290
921 3300026118 Ga0207675_100148447 Ga0207675_1001484471 290
922 3300026118 Ga0207675_100156092 Ga0207675_1001560923 290
923 3300026121 Ga0207683_10001617 Ga0207683_1000161711 290
924 3300026121 Ga0207683_10037479 Ga0207683_100374792 290
925 3300026121 Ga0207683_10108964 Ga0207683_101089643 290
926 3300026142 Ga0207698_10005710 Ga0207698_100057101 290
927 3300026142 Ga0207698_10036469 Ga0207698_100364693 290
928 3300026142 Ga0207698_10070194 Ga0207698_100701943 290
929 3300026142 Ga0207698_10080320 Ga0207698_100803203 290
930 3300026142 Ga0207698_10102487 Ga0207698_101024873 290
931 3300027907 Ga0207428_10053311 Ga0207428_100533112 290
932 3300028379 Ga0268266_10103695 Ga0268266_101036953 290
933 3300028380 Ga0268265_10086443 Ga0268265_100864434 290
934 3300028381 Ga0268264_10000558 Ga0268264_1000055816 290
935 3300028381 Ga0268264_10001559 Ga0268264_1000155917 290
936 3300028381 Ga0268264_10016734 Ga0268264_100167342 290
937 3300028381 Ga0268264_10053315 Ga0268264_100533151 290
938 3300028381 Ga0268264_10064713 Ga0268264_100647132 290
939 3300028381 Ga0268264_10068487 Ga0268264_100684872 290
940 3300028794 Ga0307515_10001257 Ga0307515_1000125716 290
941 3300031456 Ga0307513_10265564 Ga0307513_102655641 290
942 3300031507 Ga0307509_10046566 Ga0307509_100465662 290
943 3300031507 Ga0307509_10054097 Ga0307509_100540972 290
944 3300031616 Ga0307508_10003014 Ga0307508_1000301415 290
945 3300031730 Ga0307516_10201639 Ga0307516_102016392 290
946 3300032005 Ga0307411_10125176 Ga0307411_101251762 290
947 3300033179 Ga0307507_10122326 Ga0307507_101223263 290
948 3300035172 Ga0373955_0128442 Ga0373955_0128442_569_1453 290
949 3300036401 Ga0373937_0042272 Ga0373937_0042272_1360_2244 290
950 3300037312 Ga0395899_0005876 Ga0395899_0005876_6883_7803 290
951 3300037312 Ga0395899_0065724 Ga0395899_0065724_674_1561 290
952 3300037418 Ga0395900_0060464 Ga0395900_0060464_2338_3225 290
953 3300037418 Ga0395900_0125102 Ga0395900_0125102_841_1728 290
954 3300037466 Ga0395898_0025501 Ga0395898_0025501_2931_3851 290
955 3300037466 Ga0395898_0042680 Ga0395898_0042680_3101_4021 290
956 3300037466 Ga0395898_0051601 Ga0395898_0051601_47_934 290
957 3300037466 Ga0395898_0147398 Ga0395898_0147398_674_1561 290
958 3300037466 Ga0395898_0418832 Ga0395898_0418832_372_1259 290
959 3300037471 Ga0395905_0008368 Ga0395905_0008368_4600_5487 290
960 3300037471 Ga0395905_0137496 Ga0395905_0137496_1388_2275 290
961 3300038443 Ga0395901_0001002 Ga0395901_0001002_2590_3477 290
962 3300038443 Ga0395901_0018856 Ga0395901_0018856_3168_4055 290
963 3300038443 Ga0395901_0030228 Ga0395901_0030228_2542_3462 290
964 3300038443 Ga0395901_0111946 Ga0395901_0111946_440_1360 290
965 3300038443 Ga0395901_0369524 Ga0395901_0369524_39_926 290
966 3300039437 Ga0436365_0085418 Ga0436365_0085418_65_979 290
967 3300039437 Ga0436365_0399137 Ga0436365_0399137_121_1017 290
968 3300039437 Ga0436365_0987978 Ga0436365_0987978_57051_57941 290
969 3300041406 Ga0439439_0017010 Ga0439439_0017010_62_949 290
970 3300041512 Ga0451853_1090644 Ga0451853_1090644_202_1089 290
971 3300042002 Ga0439442_028543 Ga0439442_028543_174_1058 290
972 3300042007 Ga0439449_0089934 Ga0439449_0089934_50_1054 290
973 3300042014 Ga0439457_000097 Ga0439457_000097_5475_6479 290
974 3300042015 Ga0439462_0058861 Ga0439462_0058861_112_999 290
975 3300042134 Ga0450898_014743 Ga0450898_014743_173_1057 290
976 3300042435 Ga0439434_0008423 Ga0439434_0008423_407_1291 290
977 3300042876 Ga0451577_0298894 Ga0451577_0298894_265_1149 290
978 3300044656 Ga0466969_0000759 Ga0466969_0000759_6315_7202 290
979 3300044658 Ga0466972_0000049 Ga0466972_0000049_78344_79234 290
980 3300044684 Ga0466966_0002403 Ga0466966_0002403_1612_2499 290
981 3300044693 Ga0466961_0058945 Ga0466961_0058945_701_1588 290
982 3300044765 Ga0466970_0000356 Ga0466970_0000356_7828_8712 290
983 3300044765 Ga0466970_0138209 Ga0466970_0138209_350_1237 290
984 3300044842 Ga0466957_0245411 Ga0466957_0245411_167_1066 290
985 3300044901 Ga0466960_0147230 Ga0466960_0147230_226_1116 290
986 3300045049 Ga0466959_0000466 Ga0466959_0000466_21117_22004 290
987 3300046460 Ga0495638_0179210 Ga0495638_0179210_79_966 290
988 3300046471 Ga0495650_0011424 Ga0495650_0011424_3013_3894 290
989 3300046477 Ga0495664_0056659 Ga0495664_0056659_1368_2252 290
990 3300046516 Ga0495628_0045482 Ga0495628_0045482_1754_2638 290
991 3300046517 Ga0495630_0015688 Ga0495630_0015688_2478_3362 290
992 3300046535 Ga0495586_0060457 Ga0495586_0060457_982_1866 290
993 3300046539 Ga0495621_0016625 Ga0495621_0016625_377_1270 290
994 3300046616 Ga0495668_0001798 Ga0495668_0001798_17313_18227 290
995 3300046616 Ga0495668_0045468 Ga0495668_0045468_49_921 290
996 3300046642 Ga0495634_0061340 Ga0495634_0061340_159_1043 290
997 3300046660 Ga0495625_0085289 Ga0495625_0085289_638_1522 290
998 3300046663 Ga0495635_0373734 Ga0495635_0373734_40_924 290
999 3300046664 Ga0495659_0039217 Ga0495659_0039217_287_1180 290
1000 3300047317 Ga0495604_0048861 Ga0495604_0048861_790_1674 290
1001 3300047471 Ga0495684_0213094 Ga0495684_0213094_20_904 290
1002 3300047471 Ga0495684_0233123 Ga0495684_0233123_171_1070 290
1003 3300048904 Ga0496101_0285049 Ga0496101_0285049_189_1073 290
1004 3300048916 Ga0496113_0287677 Ga0496113_0287677_350_1234 290
1005 3300049570 Ga0501033_0019167 Ga0501033_0019167_1491_2378 290
1006 3300049570 Ga0501033_0239518 Ga0501033_0239518_69_956 290
1007 3300049570 Ga0501033_0256723 Ga0501033_0256723_310_1200 290
1008 3300049571 Ga0501034_0003293 Ga0501034_0003293_16854_17741 290
1009 3300049571 Ga0501034_0028748 Ga0501034_0028748_4280_5281 290
1010 3300049581 Ga0501047_0027272 Ga0501047_0027272_3558_4442 290
1011 3300049581 Ga0501047_0067142 Ga0501047_0067142_2280_3164 290
1012 3300049585 Ga0501069_0122150 Ga0501069_0122150_154_1053 290
1013 3300049586 Ga0501070_0502851 Ga0501070_0502851_55_942 290
1014 3300049588 Ga0501072_0120761 Ga0501072_0120761_1135_2022 290
1015 3300049703 Ga0501219_000280 Ga0501219_000280_276_1193 290
1016 3300049705 Ga0501225_0000893 Ga0501225_0000893_2677_3684 290
1017 3300049758 Ga0501241_004900 Ga0501241_004900_529_1446 290
1018 3300049822 Ga0501035_0403582 Ga0501035_0403582_36_926 290
1019 3300049823 Ga0501044_0004216 Ga0501044_0004216_3483_4367 290
1020 3300049823 Ga0501044_0119530 Ga0501044_0119530_1443_2330 290
1021 3300049823 Ga0501044_0140775 Ga0501044_0140775_1410_2297 290
1022 3300049823 Ga0501044_0259059 Ga0501044_0259059_617_1537 290
1023 3300049823 Ga0501044_0321841 Ga0501044_0321841_411_1298 290
1024 3300050005 Ga0501284_00002 Ga0501284_00002_73303_74220 290
1025 3300050493 nmdc:mga0k408_34886_c1 nmdc:mga0k408_34886_c1_1331_2215 290
1026 3300050507 nmdc:mga05p37_4461_c1 nmdc:mga05p37_4461_c1_2523_3410 290
1027 3300050508 nmdc:mga09592_68842_c1 nmdc:mga09592_68842_c1_1654_2664 290
1028 3300050511 nmdc:mga08y16_11872_c1 nmdc:mga08y16_11872_c1_1787_2671 290
1029 3300053086 Ga0500578_0000605 Ga0500578_0000605_15872_16762 290
1030 3300053086 Ga0500578_0008201 Ga0500578_0008201_10_900 290
1031 3300053088 Ga0500644_0002191 Ga0500644_0002191_679_1551 290
1032 3300053090 Ga0500646_0005284 Ga0500646_0005284_1737_2624 290
1033 3300053090 Ga0500646_0014670 Ga0500646_0014670_658_1530 290
1034 3300053092 Ga0500583_0000055 Ga0500583_0000055_33045_33932 290
1035 3300053092 Ga0500583_0010626 Ga0500583_0010626_496_1383 290
1036 3300053109 Ga0500569_000136 Ga0500569_000136_2339_3211 290
1037 3300053111 Ga0500572_029654 Ga0500572_029654_142_1032 290
1038 3300053118 Ga0500594_0015087 Ga0500594_0015087_484_1371 290
1039 3300053130 Ga0500642_0054423 Ga0500642_0054423_677_1564 290
1040 3300053131 Ga0500652_012326 Ga0500652_012326_1138_2025 290
1041 3300053140 Ga0500573_0016436 Ga0500573_0016436_2848_3735 290
1042 3300053142 Ga0500577_0040375 Ga0500577_0040375_339_1211 290
1043 3300053147 Ga0500589_029663 Ga0500589_029663_1211_2098 290
1044 3300053148 Ga0500590_023321 Ga0500590_023321_312_1265 290
1045 3300053153 Ga0500616_0012238 Ga0500616_0012238_1397_2269 290
1046 3300053161 Ga0500634_0023687 Ga0500634_0023687_109_981 290
1047 3300053163 Ga0500639_030150 Ga0500639_030150_56_943 290
1048 3300053177 Ga0500636_0025813 Ga0500636_0025813_1937_2827 290
1049 3300053177 Ga0500636_0184003 Ga0500636_0184003_105_992 290
1050 3300053727 Ga0500611_000003 Ga0500611_000003_261501_262388 290
1051 3300053730 Ga0500645_017956 Ga0500645_017956_226_1116 290
1052 3300061719 Ga0466962_0066496 Ga0466962_0066496_500_1390 290
1053 3300061719 Ga0466962_0099416 Ga0466962_0099416_335_1222 290
1054 iso_pu_bacteria 2738541278 2738725523 290
1055 iso_pu_bacteria 2896109856 2896110427 290
1056 3300003322 rootL2_10132269 rootL2_101322693 291
1057 3300005290 Ga0065712_10145787 Ga0065712_101457871 291
1058 3300005334 Ga0068869_100208818 Ga0068869_1002088182 291
1059 3300005337 Ga0070682_100000041 Ga0070682_10000004155 291
1060 3300005347 Ga0070668_100038665 Ga0070668_1000386652 291
1061 3300005354 Ga0070675_100047006 Ga0070675_1000470066 291
1062 3300005355 Ga0070671_100247144 Ga0070671_1002471442 291
1063 3300005356 Ga0070674_100269428 Ga0070674_1002694281 291
1064 3300005459 Ga0068867_100288863 Ga0068867_1002888632 291
1065 3300005530 Ga0070679_100106351 Ga0070679_1001063512 291
1066 3300005539 Ga0068853_100079277 Ga0068853_1000792772 291
1067 3300005543 Ga0070672_100112936 Ga0070672_1001129362 291
1068 3300005577 Ga0068857_100289834 Ga0068857_1002898341 291
1069 3300005614 Ga0068856_100021407 Ga0068856_1000214078 291
1070 3300005617 Ga0068859_100000872 Ga0068859_10000087232 291
1071 3300005618 Ga0068864_100150341 Ga0068864_1001503413 291
1072 3300005840 Ga0068870_10193676 Ga0068870_101936761 291
1073 3300005843 Ga0068860_100392410 Ga0068860_1003924102 291
1074 3300005844 Ga0068862_100395951 Ga0068862_1003959512 291
1075 3300006237 Ga0097621_100006082 Ga0097621_1000060824 291
1076 3300006237 Ga0097621_100016559 Ga0097621_1000165596 291
1077 3300006358 Ga0068871_100006775 Ga0068871_1000067751 291
1078 3300006358 Ga0068871_100007253 Ga0068871_1000072532 291
1079 3300006881 Ga0068865_100037327 Ga0068865_1000373272 291
1080 3300006931 Ga0097620_100000872 Ga0097620_10000087232 291
1081 3300009094 Ga0111539_10406827 Ga0111539_104068271 291
1082 3300009147 Ga0114129_10042428 Ga0114129_100424282 291
1083 3300009174 Ga0105241_10124919 Ga0105241_101249192 291
1084 3300009176 Ga0105242_10285123 Ga0105242_102851231 291
1085 3300009176 Ga0105242_10406310 Ga0105242_104063101 291
1086 3300009551 Ga0105238_10075503 Ga0105238_100755034 291
1087 3300013100 Ga0157373_10044269 Ga0157373_100442693 291
1088 3300013102 Ga0157371_10092465 Ga0157371_100924652 291
1089 3300013105 Ga0157369_10165642 Ga0157369_101656422 291
1090 3300013296 Ga0157374_10162521 Ga0157374_101625212 291
1091 3300013297 Ga0157378_10076193 Ga0157378_100761932 291
1092 3300013306 Ga0163162_10010061 Ga0163162_100100612 291
1093 3300013306 Ga0163162_10020425 Ga0163162_100204256 291
1094 3300013306 Ga0163162_10030106 Ga0163162_100301065 291
1095 3300013307 Ga0157372_10003195 Ga0157372_100031958 291
1096 3300013307 Ga0157372_10070599 Ga0157372_100705999 291
1097 3300013308 Ga0157375_10019039 Ga0157375_100190392 291
1098 3300013308 Ga0157375_10038344 Ga0157375_100383443 291
1099 3300013308 Ga0157375_10093984 Ga0157375_100939842 291
1100 3300013308 Ga0157375_10420558 Ga0157375_104205581 291
1101 3300014326 Ga0157380_10125749 Ga0157380_101257492 291
1102 3300014326 Ga0157380_10182492 Ga0157380_101824921 291
1103 3300014326 Ga0157380_10248197 Ga0157380_102481972 291
1104 3300014745 Ga0157377_10197240 Ga0157377_101972402 291
1105 3300017792 Ga0163161_10083568 Ga0163161_100835682 291
1106 3300025925 Ga0207650_10283033 Ga0207650_102830332 291
1107 3300025937 Ga0207669_10024254 Ga0207669_100242542 291
1108 3300025942 Ga0207689_10157284 Ga0207689_101572842 291
1109 3300026041 Ga0207639_10013725 Ga0207639_100137254 291
1110 3300026041 Ga0207639_10108061 Ga0207639_101080612 291
1111 3300026078 Ga0207702_10033893 Ga0207702_100338932 291
1112 3300026089 Ga0207648_10059177 Ga0207648_100591774 291
1113 3300026089 Ga0207648_10100411 Ga0207648_101004113 291
1114 3300026095 Ga0207676_10143714 Ga0207676_101437142 291
1115 3300026095 Ga0207676_10148127 Ga0207676_101481271 291
1116 3300026116 Ga0207674_10078738 Ga0207674_100787384 291
1117 3300026116 Ga0207674_10241471 Ga0207674_102414711 291
1118 3300026118 Ga0207675_100598958 Ga0207675_1005989582 291
1119 3300026121 Ga0207683_10079932 Ga0207683_100799323 291
1120 3300031251 Ga0265327_10000013 Ga0265327_10000013334 291
1121 3300031251 Ga0265327_10002463 Ga0265327_100024637 291
1122 3300036401 Ga0373937_0102367 Ga0373937_0102367_699_1649 291
1123 3300044658 Ga0466972_0009353 Ga0466972_0009353_1750_2631 291
1124 3300045049 Ga0466959_0067225 Ga0466959_0067225_476_1357 291
1125 3300046459 Ga0495629_0032133 Ga0495629_0032133_2748_3698 291
1126 3300046517 Ga0495630_0174790 Ga0495630_0174790_307_1257 291
1127 3300046535 Ga0495586_0073857 Ga0495586_0073857_949_1836 291
1128 3300046663 Ga0495635_0051341 Ga0495635_0051341_1383_2333 291
1129 3300046663 Ga0495635_0348690 Ga0495635_0348690_78_968 291
1130 3300046678 Ga0495599_0165546 Ga0495599_0165546_239_1132 291
1131 3300046691 Ga0495670_0007945 Ga0495670_0007945_558_1448 291
1132 3300048088 Ga0495602_0412551 Ga0495602_0412551_24_911 291
1133 3300048904 Ga0496101_0133062 Ga0496101_0133062_691_1566 291
1134 3300048918 Ga0496115_0209555 Ga0496115_0209555_598_1557 291
1135 3300049569 Ga0501032_0008460 Ga0501032_0008460_6306_7196 291
1136 3300049570 Ga0501033_0029345 Ga0501033_0029345_1143_2033 291
1137 3300049571 Ga0501034_0006045 Ga0501034_0006045_1792_2682 291
1138 3300049572 Ga0501036_0153946 Ga0501036_0153946_1005_1895 291
1139 3300049573 Ga0501037_0002081 Ga0501037_0002081_299_1189 291
1140 3300049573 Ga0501037_0158724 Ga0501037_0158724_449_1324 291
1141 3300049574 Ga0501038_0007716 Ga0501038_0007716_5292_6182 291
1142 3300049575 Ga0501039_0009882 Ga0501039_0009882_1722_2612 291
1143 3300049579 Ga0501043_0008069 Ga0501043_0008069_91_981 291
1144 3300049581 Ga0501047_0002365 Ga0501047_0002365_11667_12557 291
1145 3300049581 Ga0501047_0250948 Ga0501047_0250948_251_1126 291
1146 3300049822 Ga0501035_0061577 Ga0501035_0061577_340_1230 291
1147 3300049823 Ga0501044_0015504 Ga0501044_0015504_2032_2922 291
1148 3300049823 Ga0501044_0087085 Ga0501044_0087085_1060_1935 291
1149 3300050507 nmdc:mga05p37_379423_c1 nmdc:mga05p37_379423_c1_459_1343 291
1150 3300050510 nmdc:mga06r32_1494_c1 nmdc:mga06r32_1494_c1_18366_19250 291
1151 3300050511 nmdc:mga08y16_296719_c1 nmdc:mga08y16_296719_c1_516_1406 291
1152 3300053104 Ga0500556_0128881 Ga0500556_0128881_39_917 291
1153 3300001989 JGI24739J22299_10000102 JGI24739J22299_1000010216 292
1154 3300003215 JGI25153J46596_10009658 JGI25153J46596_100096583 292
1155 3300003323 rootH1_10028713 rootH1_100287138 292
1156 3300003790 Ga0055528_1000907 Ga0055528_100090712 292
1157 3300003791 Ga0055530_10000484 Ga0055530_1000048415 292
1158 3300004625 Ga0055543_1006775 Ga0055543_10067752 292
1159 3300005262 Ga0065165_1002498 Ga0065165_10024987 292
1160 3300006173 Ga0070716_100017561 Ga0070716_1000175616 292
1161 3300009093 Ga0105240_10000131 Ga0105240_1000013194 292
1162 3300010375 Ga0105239_10001470 Ga0105239_1000147038 292
1163 3300025273 Ga0209673_1000016 Ga0209673_100001685 292
1164 3300025295 Ga0209564_1009149 Ga0209564_10091492 292
1165 3300025297 Ga0209758_1022176 Ga0209758_10221761 292
1166 3300025298 Ga0209050_1000124 Ga0209050_100012493 292
1167 3300025302 Ga0207426_1001136 Ga0207426_100113625 292
1168 3300025304 Ga0209257_1000658 Ga0209257_100065825 292
1169 3300025913 Ga0207695_10000217 Ga0207695_1000021758 292
1170 3300037471 Ga0395905_0050318 Ga0395905_0050318_554_1450 292
1171 3300041997 Ga0439431_0002468 Ga0439431_0002468_2843_3721 292
1172 3300042004 Ga0439445_0050968 Ga0439445_0050968_158_1036 292
1173 3300049766 Ga0501269_002765 Ga0501269_002765_1099_1986 292
1174 3300053153 Ga0500616_0000685 Ga0500616_0000685_23099_23986 292
1175 2162886007 SwRhRL2b_contig_2098068 SwRhRL2b_0114.00000980 294
1176 3300005289 Ga0065704_10103341 Ga0065704_101033411 294

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13621

Cupin_8

Cupin-like domain

64

294

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
7u1h-assembly1.cif.gz_B crystal structure of lens culinaris vicilin 0.8914 127 240
4aap-assembly2.cif.gz_B crystal structure of jmjd5 domain of human lysine-specific demethylase 8 (kdm8) in complex with n-oxalylglycine (nog) 0.8839 1 240
1ipk-assembly1.cif.gz_C crystal structures of recombinant and native soybean beta-conglycinin beta homotrimers 0.8814 127 240
4aap-assembly1.cif.gz_A crystal structure of jmjd5 domain of human lysine-specific demethylase 8 (kdm8) in complex with n-oxalylglycine (nog) 0.8799 1 240
4aap-assembly2.cif.gz_B crystal structure of jmjd5 domain of human lysine-specific demethylase 8 (kdm8) in complex with n-oxalylglycine (nog) 0.8768 1 240
ID Description Score Start End Superfamily
af_F4IQK5_38_206_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8821 127 240 2.60.120.10
3rnsA01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8748 126 242 2.60.120.10
af_C6T0Q1_25_220_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8639 127 241 2.60.120.10
af_A0A1D6QI94_1_177_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8629 127 241 2.60.120.10
af_A0A0R0EIG9_21_186_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8623 127 241 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A2M9CX32-F1-model_v4 Cupin-like domain-containing protein 0.9757 1 293
AF-A0A7V9M432-F1-model_v4 Cupin-like domain-containing protein 0.9753 1 156
AF-A0A561IET4-F1-model_v4 deleted 0.9711 1 289
AF-A0A519VYI0-F1-model_v4 Cupin-like domain-containing protein 0.9697 4 183
AF-A0A519SDK3-F1-model_v4 Cupin-like domain-containing protein 0.9681 4 145

Feature Viewer

pLDDT pTM Quality
88.81 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map