F491237

General Info

Members Datasets Scaffolds Average Seq Length
1175 430 1165 105

Family's Representative Sequence

Representative Sequence 3300005844|Ga0068862_100642713|Ga0068862_1006427132
Length 110
Sequence MAKAKKQAAQGVVDISHYDVILSPHITEKSTLLSEHNAVVFKVAREATKPQIKAAVEALFGVAVTGVNTITQKGKTKRWKGRPYKRSDSKKAIVTLAEGQSIDVTEGARG

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
3 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
4 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
5 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
6 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
7 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
8 2830075706 Sphingomonas jinjuensis DSM 21457 Isolate Rhizosphere
9 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
10 3000865235 Altericroceibacterium indicum DSM 18604 Isolate Rhizosphere
11 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
12 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
13 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
14 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
15 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
16 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
17 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
18 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
19 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
20 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
21 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
22 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
23 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
24 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
25 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
26 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
27 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
28 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
29 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
30 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
31 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
32 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
33 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
34 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
35 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
36 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
37 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
38 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
39 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
40 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
41 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
42 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
43 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
44 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
45 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
46 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
47 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
48 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
49 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
50 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
51 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
52 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
53 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
54 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
55 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
56 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
57 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
58 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
59 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
60 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
61 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
62 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
63 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
64 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
65 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
66 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
67 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
68 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
69 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
70 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
71 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
72 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
73 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
74 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
75 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
76 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
77 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
78 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
79 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
80 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
81 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
82 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
83 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
84 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
85 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
86 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
87 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
88 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
89 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
90 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
91 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
92 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
93 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
94 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
95 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
96 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
97 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
98 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
99 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
100 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
101 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
102 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
103 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
104 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
105 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
106 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
107 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
108 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
109 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
110 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
111 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
112 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
113 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
114 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
115 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
116 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
117 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
118 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
119 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
120 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
121 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
122 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
123 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
124 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
125 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
126 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
127 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
128 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
129 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
130 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
131 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
132 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
133 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
134 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
135 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
136 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
137 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
138 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
139 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
141 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
199 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
200 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
201 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
202 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
203 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
204 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
208 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
209 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
210 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
211 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
212 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
213 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
214 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
215 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
216 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
217 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
218 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
219 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
220 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
221 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
222 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
223 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
224 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
225 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
226 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
227 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
228 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
229 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
230 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
231 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
232 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
233 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
234 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
235 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
236 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
237 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
238 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
239 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
240 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
241 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
242 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
243 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
244 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
245 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
246 3300041444 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaT Metatranscriptome Rhizoplane
247 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
248 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
249 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
250 3300041502 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT Metatranscriptome Unclassified
251 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
252 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
253 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
254 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
255 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
256 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
257 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
258 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
259 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
260 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
261 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
262 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
263 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
264 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
265 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
266 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
267 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
268 3300044659 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E Metagenome Unclassified
269 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
270 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
271 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
272 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
273 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
274 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
275 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
276 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
277 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
278 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
279 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
280 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
281 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
282 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
283 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
284 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
285 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
286 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
287 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
288 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
289 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
290 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
291 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
292 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
293 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
294 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
295 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
296 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
297 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
298 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
299 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
300 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
301 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
302 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
303 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
304 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
305 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
306 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
307 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
308 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
309 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
310 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
311 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
312 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
313 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
314 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
315 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
316 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
317 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
318 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
319 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
320 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
321 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
322 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
323 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
324 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
325 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
326 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
327 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
328 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
329 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
330 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
331 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
332 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
333 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
334 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
335 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
336 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
337 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
338 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
339 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
340 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
341 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
342 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
343 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
344 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
345 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
346 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
347 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
348 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
349 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
350 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
351 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
352 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
353 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
354 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
355 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
356 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
357 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
358 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
359 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
360 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
361 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
362 3300049553 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
363 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
364 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
365 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
366 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
367 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
368 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
369 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
370 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
371 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
372 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
373 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
374 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
375 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
376 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
377 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
378 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
379 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
380 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
381 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
382 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
383 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
384 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
385 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
386 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
387 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
388 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
389 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
390 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
391 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
392 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
393 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
394 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
395 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
396 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
397 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
398 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
399 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
400 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
401 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
402 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
403 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
404 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
405 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
406 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
407 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
408 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
409 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
410 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
411 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
412 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
413 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
414 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
415 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
416 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
417 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
418 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
419 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
420 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
421 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
422 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
423 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
424 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
425 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
426 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
427 3300059660 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
428 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
429 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
430 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.87
Metatranscriptomes 5.28
Isolates 0.85

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4
Nodule 0.26
Rhizoplane 1.36
Rhizosphere 89.28
Stem 0
Stem Tuber 0
Unclassified 5.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1707570 2162886007 Bacteria 1694
2 SwRhRL2b_contig_308716 2162886007 Bacteria 918
3 SwRhRL2b_contig_373569 2162886007 Bacteria 900
4 JGI24736J21556_1000017 3300001904 Bacteria 28475
5 JGI24736J21556_1000244 3300001904 Bacteria 9911
6 JGI24736J21556_1020976 3300001904 Bacteria 1025
7 JGI24736J21556_1022190 3300001904 Bacteria 994
8 JGI24741J21665_1016662 3300001915 Bacteria 1197
9 JGI24752J21851_1000810 3300001976 Bacteria 4211
10 JGI24740J21852_10008905 3300001979 Bacteria 3967
11 JGI24740J21852_10008925 3300001979 Bacteria 3963
12 JGI24740J21852_10115295 3300001979 Bacteria 675
13 JGI24740J21852_10142843 3300001979 Bacteria 595
14 JGI24739J22299_10017509 3300001989 Bacteria 2585
15 JGI24739J22299_10026040 3300001989 Bacteria 2055
16 JGI24739J22299_10029465 3300001989 Bacteria 1908
17 JGI24739J22299_10065973 3300001989 Bacteria 1134
18 JGI24737J22298_10010075 3300001990 Bacteria 3131
19 JGI24737J22298_10027704 3300001990 Bacteria 1785
20 JGI24737J22298_10057940 3300001990 Bacteria 1169
21 JGI24737J22298_10092202 3300001990 Bacteria 898
22 JGI24737J22298_10104394 3300001990 Bacteria 839
23 JGI24737J22298_10142305 3300001990 Bacteria 708
24 JGI24735J21928_10003396 3300002067 Bacteria 5432
25 JGI24735J21928_10022535 3300002067 Bacteria 1916
26 JGI24750J21931_1028129 3300002070 Bacteria 815
27 JGI24738J21930_10002167 3300002075 Bacteria 5226
28 JGI24738J21930_10013156 3300002075 Bacteria 1794
29 JGI24738J21930_10035086 3300002075 Bacteria 1021
30 JGI24749J21850_1000052 3300002076 Bacteria 22270
31 JGI24749J21850_1001152 3300002076 Bacteria 3752
32 JGI24034J26672_10002744 3300002239 Bacteria 2430
33 JGI24034J26672_10009328 3300002239 Bacteria 1446
34 JGI24751J29686_10000325 3300002459 Bacteria 17611
35 Ga0055530_10027359 3300003791 Bacteria 1559
36 JGI25405J52794_10005009 3300003911 Bacteria 2376
37 Ga0058861_12019348 3300004800 Bacteria 2352
38 Ga0058862_12510110 3300004803 Bacteria 535
39 Ga0065704_10009321 3300005289 Bacteria 3045
40 Ga0065704_10133643 3300005289 Bacteria 1598
41 Ga0065704_10158827 3300005289 Bacteria 1370
42 Ga0065712_10044080 3300005290 Bacteria 906
43 Ga0065712_10520019 3300005290 Bacteria 636
44 Ga0065715_10090134 3300005293 Bacteria 7598
45 Ga0065715_10392675 3300005293 Bacteria 892
46 Ga0065715_10446466 3300005293 Bacteria 830
47 Ga0065715_10617514 3300005293 Bacteria 697
48 Ga0065707_10007537 3300005295 Bacteria 4124
49 Ga0065707_10108385 3300005295 Bacteria 2512
50 Ga0065707_10186565 3300005295 Bacteria 1385
51 Ga0065707_10385618 3300005295 Bacteria 871
52 Ga0065707_10426403 3300005295 Bacteria 825
53 Ga0070658_10000172 3300005327 Bacteria 56478
54 Ga0070658_10000808 3300005327 Bacteria 26765
55 Ga0070658_10026506 3300005327 Bacteria 4650
56 Ga0070658_10034387 3300005327 Bacteria 4078
57 Ga0070658_10147154 3300005327 Bacteria 1970
58 Ga0070658_10151735 3300005327 Bacteria 1940
59 Ga0070658_10181443 3300005327 Bacteria 1771
60 Ga0070658_10414802 3300005327 Bacteria 1157
61 Ga0070658_10660111 3300005327 Bacteria 907
62 Ga0070658_10693818 3300005327 Bacteria 883
63 Ga0070658_10747047 3300005327 Bacteria 849
64 Ga0070658_10772191 3300005327 Bacteria 835
65 Ga0070676_10056397 3300005328 Bacteria 2321
66 Ga0070683_100222804 3300005329 Bacteria 1792
67 Ga0070683_100711606 3300005329 Bacteria 962
68 Ga0070690_101245132 3300005330 Bacteria 595
69 Ga0070670_100002763 3300005331 Bacteria 14500
70 Ga0070670_100024275 3300005331 Bacteria 5215
71 Ga0070670_100077325 3300005331 Bacteria 2860
72 Ga0070670_100214326 3300005331 Bacteria 1674
73 Ga0070670_100289018 3300005331 Bacteria 1432
74 Ga0070670_100714672 3300005331 Bacteria 901
75 Ga0070670_100938123 3300005331 Bacteria 785
76 Ga0070670_101076645 3300005331 Bacteria 733
77 Ga0070677_10012449 3300005333 Bacteria 2954
78 Ga0070677_10216068 3300005333 Bacteria 934
79 Ga0070677_10486318 3300005333 Bacteria 667
80 Ga0068869_100534986 3300005334 Bacteria 982
81 Ga0068869_102104140 3300005334 Bacteria 507
82 Ga0070666_10001221 3300005335 Bacteria 15513
83 Ga0070666_10141818 3300005335 Bacteria 1674
84 Ga0070680_100033523 3300005336 Bacteria 4141
85 Ga0070680_100069525 3300005336 Bacteria 2891
86 Ga0070680_100284036 3300005336 Bacteria 1402
87 Ga0070680_100666478 3300005336 Bacteria 894
88 Ga0070682_100708565 3300005337 Bacteria 808
89 Ga0070682_101045239 3300005337 Bacteria 680
90 Ga0070682_102089921 3300005337 Bacteria 500
91 Ga0068868_100063445 3300005338 Bacteria 2930
92 Ga0070660_100023993 3300005339 Bacteria 4523
93 Ga0070660_100028806 3300005339 Bacteria 4158
94 Ga0070660_100038292 3300005339 Bacteria 3640
95 Ga0070660_100057901 3300005339 Bacteria 3003
96 Ga0070660_100060466 3300005339 Bacteria 2940
97 Ga0070660_100076515 3300005339 Bacteria 2621
98 Ga0070660_100307521 3300005339 Bacteria 1300
99 Ga0070660_101878046 3300005339 Bacteria 510
100 Ga0070691_10670371 3300005341 Bacteria 619
101 Ga0070661_100016703 3300005344 Bacteria 5194
102 Ga0070661_100041801 3300005344 Bacteria 3345
103 Ga0070661_100083669 3300005344 Bacteria 2357
104 Ga0070661_100156151 3300005344 Bacteria 1726
105 Ga0070661_100185779 3300005344 Bacteria 1583
106 Ga0070661_100267229 3300005344 Bacteria 1324
107 Ga0070661_100281828 3300005344 Bacteria 1289
108 Ga0070661_100485118 3300005344 Bacteria 987
109 Ga0070661_100960141 3300005344 Bacteria 707
110 Ga0070661_101572159 3300005344 Bacteria 556
111 Ga0070692_10038561 3300005345 Bacteria 2436
112 Ga0070692_10050904 3300005345 Bacteria 2153
113 Ga0070692_10224230 3300005345 Bacteria 1112
114 Ga0070668_100000831 3300005347 Bacteria 21324
115 Ga0070668_100046306 3300005347 Bacteria 3339
116 Ga0070668_100051441 3300005347 Bacteria 3174
117 Ga0070668_100143128 3300005347 Bacteria 1928
118 Ga0070668_101096050 3300005347 Bacteria 718
119 Ga0070669_100000096 3300005353 Bacteria 86930
120 Ga0070669_100002856 3300005353 Bacteria 12479
121 Ga0070669_100033975 3300005353 Bacteria 3691
122 Ga0070669_100268035 3300005353 Bacteria 1364
123 Ga0070669_100497699 3300005353 Bacteria 1011
124 Ga0070669_101999198 3300005353 Bacteria 507
125 Ga0070675_100021317 3300005354 Bacteria 5177
126 Ga0070675_100069477 3300005354 Bacteria 2918
127 Ga0070675_101077801 3300005354 Bacteria 738
128 Ga0070671_100000045 3300005355 Bacteria 85779
129 Ga0070671_100002671 3300005355 Bacteria 13821
130 Ga0070671_100075015 3300005355 Bacteria 2825
131 Ga0070671_100089401 3300005355 Bacteria 2578
132 Ga0070671_100222605 3300005355 Bacteria 1601
133 Ga0070674_100070716 3300005356 Bacteria 2466
134 Ga0070673_100034662 3300005364 Bacteria 3821
135 Ga0070673_100948209 3300005364 Bacteria 799
136 Ga0070673_101360880 3300005364 Bacteria 667
137 Ga0070659_100016977 3300005366 Bacteria 5471
138 Ga0070659_100024658 3300005366 Bacteria 4613
139 Ga0070659_100121318 3300005366 Bacteria 2117
140 Ga0070659_100166032 3300005366 Bacteria 1806
141 Ga0070659_100331646 3300005366 Bacteria 1273
142 Ga0070659_100606645 3300005366 Bacteria 941
143 Ga0070659_100808624 3300005366 Bacteria 815
144 Ga0070659_100830908 3300005366 Bacteria 804
145 Ga0070659_101866823 3300005366 Bacteria 539
146 Ga0070659_102134472 3300005366 Bacteria 504
147 Ga0070667_100003534 3300005367 Bacteria 13313
148 Ga0070667_100052979 3300005367 Bacteria 3424
149 Ga0070667_100092578 3300005367 Bacteria 2601
150 Ga0070667_100125062 3300005367 Bacteria 2240
151 Ga0070667_100305375 3300005367 Bacteria 1433
152 Ga0070701_10139054 3300005438 Bacteria 1387
153 Ga0070701_10953549 3300005438 Bacteria 596
154 Ga0070705_100025314 3300005440 Bacteria 3216
155 Ga0070705_100127772 3300005440 Bacteria 1653
156 Ga0070700_100559087 3300005441 Bacteria 890
157 Ga0070708_100101983 3300005445 Bacteria 2629
158 Ga0070663_100058865 3300005455 Bacteria 2760
159 Ga0070663_100063578 3300005455 Bacteria 2665
160 Ga0070663_100253556 3300005455 Bacteria 1393
161 Ga0070663_100380493 3300005455 Bacteria 1149
162 Ga0070663_100388964 3300005455 Bacteria 1137
163 Ga0070663_100838437 3300005455 Bacteria 790
164 Ga0070678_100042212 3300005456 Bacteria 3240
165 Ga0070662_100005957 3300005457 Bacteria 7819
166 Ga0070662_100138242 3300005457 Bacteria 1885
167 Ga0070662_100163343 3300005457 Bacteria 1743
168 Ga0070662_100188525 3300005457 Bacteria 1629
169 Ga0070662_100373351 3300005457 Bacteria 1172
170 Ga0070662_100472094 3300005457 Bacteria 1043
171 Ga0070662_100496502 3300005457 Bacteria 1017
172 Ga0070662_101107281 3300005457 Bacteria 679
173 Ga0070662_101213121 3300005457 Bacteria 649
174 Ga0070681_10088688 3300005458 Bacteria 3045
175 Ga0070681_10177121 3300005458 Bacteria 2054
176 Ga0070681_11264566 3300005458 Bacteria 660
177 Ga0068867_100088936 3300005459 Bacteria 2342
178 Ga0070685_10338871 3300005466 Bacteria 1025
179 Ga0070679_100000873 3300005530 Bacteria 26175
180 Ga0070679_100272454 3300005530 Bacteria 1646
181 Ga0070679_100464363 3300005530 Bacteria 1210
182 Ga0070679_100500972 3300005530 Bacteria 1158
183 Ga0070679_100542586 3300005530 Bacteria 1106
184 Ga0070679_100559293 3300005530 Bacteria 1087
185 Ga0070679_100732699 3300005530 Bacteria 931
186 Ga0070684_100279436 3300005535 Bacteria 1529
187 Ga0070684_101940564 3300005535 Bacteria 556
188 Ga0068853_100000960 3300005539 Bacteria 20266
189 Ga0068853_100075015 3300005539 Bacteria 2951
190 Ga0068853_100107432 3300005539 Bacteria 2474
191 Ga0068853_100404879 3300005539 Bacteria 1277
192 Ga0068853_101643023 3300005539 Bacteria 623
193 Ga0070672_100034217 3300005543 Bacteria 3855
194 Ga0070672_100089112 3300005543 Bacteria 2485
195 Ga0070672_100623524 3300005543 Bacteria 941
196 Ga0070695_101717119 3300005545 Bacteria 526
197 Ga0070665_100001143 3300005548 Bacteria 32613
198 Ga0070665_100277766 3300005548 Bacteria 1677
199 Ga0070665_102140465 3300005548 Bacteria 564
200 Ga0068855_100116496 3300005563 Bacteria 3062
201 Ga0068855_100367274 3300005563 Bacteria 1582
202 Ga0068855_100378198 3300005563 Bacteria 1555
203 Ga0068855_101604438 3300005563 Bacteria 665
204 Ga0068855_101834455 3300005563 Bacteria 615
205 Ga0070664_100071016 3300005564 Bacteria 2983
206 Ga0070664_100288384 3300005564 Bacteria 1481
207 Ga0070664_100498178 3300005564 Bacteria 1122
208 Ga0070664_100616986 3300005564 Bacteria 1006
209 Ga0070664_100919590 3300005564 Bacteria 820
210 Ga0070664_100944155 3300005564 Bacteria 809
211 Ga0070664_101361903 3300005564 Bacteria 670
212 Ga0070664_102386190 3300005564 Bacteria 501
213 Ga0068857_100128809 3300005577 Bacteria 2282
214 Ga0068857_100222421 3300005577 Bacteria 1725
215 Ga0068857_100232146 3300005577 Bacteria 1687
216 Ga0068857_100234824 3300005577 Bacteria 1678
217 Ga0068857_100755108 3300005577 Bacteria 927
218 Ga0068857_101036775 3300005577 Bacteria 790
219 Ga0068857_101125820 3300005577 Bacteria 758
220 Ga0068854_100290859 3300005578 Bacteria 1318
221 Ga0068854_100315773 3300005578 Bacteria 1268
222 Ga0068854_100440919 3300005578 Bacteria 1085
223 Ga0068854_101826752 3300005578 Bacteria 557
224 Ga0068856_100272871 3300005614 Bacteria 1707
225 Ga0068856_100450706 3300005614 Bacteria 1307
226 Ga0068856_100464472 3300005614 Bacteria 1286
227 Ga0068856_100527026 3300005614 Bacteria 1202
228 Ga0068856_100975530 3300005614 Bacteria 866
229 Ga0070702_100249413 3300005615 Bacteria 1202
230 Ga0070702_100808329 3300005615 Bacteria 726
231 Ga0068852_100085271 3300005616 Bacteria 2814
232 Ga0068852_100090864 3300005616 Bacteria 2731
233 Ga0068852_100384355 3300005616 Bacteria 1378
234 Ga0068852_100435529 3300005616 Bacteria 1295
235 Ga0068852_100446513 3300005616 Bacteria 1279
236 Ga0068852_100458987 3300005616 Bacteria 1262
237 Ga0068852_100602980 3300005616 Bacteria 1102
238 Ga0068852_101611652 3300005616 Bacteria 671
239 Ga0068852_101731395 3300005616 Bacteria 647
240 Ga0068852_101943250 3300005616 Bacteria 610
241 Ga0068852_101974323 3300005616 Bacteria 606
242 Ga0068852_102017798 3300005616 Bacteria 599
243 Ga0068859_100000162 3300005617 Bacteria 65033
244 Ga0068859_100003314 3300005617 Bacteria 16364
245 Ga0068859_100006387 3300005617 Bacteria 11959
246 Ga0068859_100056194 3300005617 Bacteria 3960
247 Ga0068859_100197558 3300005617 Bacteria 2096
248 Ga0068859_100355516 3300005617 Bacteria 1560
249 Ga0068864_100000677 3300005618 Bacteria 28506
250 Ga0068864_100002491 3300005618 Bacteria 15219
251 Ga0068864_100014199 3300005618 Bacteria 6612
252 Ga0068864_100188944 3300005618 Bacteria 1887
253 Ga0068864_102418338 3300005618 Bacteria 532
254 Ga0068866_10990043 3300005718 Bacteria 597
255 Ga0068866_11025973 3300005718 Bacteria 587
256 Ga0068861_100001385 3300005719 Bacteria 15218
257 Ga0068861_100002700 3300005719 Bacteria 11613
258 Ga0068861_100248927 3300005719 Bacteria 1515
259 Ga0068861_101504408 3300005719 Bacteria 661
260 Ga0068870_10187152 3300005840 Bacteria 1247
261 Ga0068863_100000017 3300005841 Bacteria 207950
262 Ga0068863_100000784 3300005841 Bacteria 31931
263 Ga0068863_100021286 3300005841 Bacteria 6189
264 Ga0068863_100084537 3300005841 Bacteria 3007
265 Ga0068863_100109631 3300005841 Bacteria 2628
266 Ga0068858_100004068 3300005842 Bacteria 14403
267 Ga0068858_100363754 3300005842 Bacteria 1387
268 Ga0068858_100488747 3300005842 Bacteria 1188
269 Ga0068858_101405465 3300005842 Bacteria 687
270 Ga0068860_100028664 3300005843 Bacteria 5359
271 Ga0068860_100059055 3300005843 Bacteria 3647
272 Ga0068860_100159782 3300005843 Bacteria 2172
273 Ga0068860_100307284 3300005843 Bacteria 1555
274 Ga0068860_100309619 3300005843 Bacteria 1548
275 Ga0068862_100000032 3300005844 Bacteria 179887
276 Ga0068862_100000126 3300005844 Bacteria 89210
277 Ga0068862_100001411 3300005844 Bacteria 22262
278 Ga0068862_100037303 3300005844 Bacteria 4119
279 Ga0068862_100183079 3300005844 Bacteria 1881
280 Ga0068862_100254494 3300005844 Bacteria 1601
281 Ga0068862_100403349 3300005844 Bacteria 1279
282 Ga0068862_100517794 3300005844 Bacteria 1135
283 Ga0068862_100642713 3300005844 Bacteria 1023
284 Ga0068862_100740357 3300005844 Bacteria 955
285 Ga0081455_10000215 3300005937 Bacteria 73808
286 Ga0081539_10024226 3300005985 Bacteria 3945
287 Ga0075363_100000592 3300006048 Bacteria 11936
288 Ga0075364_10039797 3300006051 Bacteria 3048
289 Ga0075362_10000383 3300006177 Bacteria 12678
290 Ga0075367_10034804 3300006178 Bacteria 2912
291 Ga0075369_10007430 3300006186 Bacteria 4172
292 Ga0075369_10207627 3300006186 Bacteria 905
293 Ga0075366_10044214 3300006195 Bacteria 2639
294 Ga0075366_10251147 3300006195 Bacteria 1079
295 Ga0075366_10482922 3300006195 Bacteria 765
296 Ga0075370_10385755 3300006353 Bacteria 839
297 Ga0068871_101615763 3300006358 Bacteria 614
298 Ga0075429_101202087 3300006880 Bacteria 662
299 Ga0068865_101513032 3300006881 Bacteria 602
300 Ga0097620_100000162 3300006931 Bacteria 65033
301 Ga0097620_100003314 3300006931 Bacteria 16364
302 Ga0097620_100006388 3300006931 Bacteria 11959
303 Ga0097620_100056192 3300006931 Bacteria 3960
304 Ga0097620_100197562 3300006931 Bacteria 2096
305 Ga0097620_100355530 3300006931 Bacteria 1560
306 Ga0079104_1061406 3300006946 Bacteria 809
307 Ga0099826_10515445 3300006948 Bacteria 556
308 Ga0105251_10119144 3300009011 Bacteria 1199
309 Ga0105250_10006758 3300009092 Bacteria 4981
310 Ga0105250_10090725 3300009092 Bacteria 1242
311 Ga0105240_10183433 3300009093 Bacteria 2468
312 Ga0105240_10327247 3300009093 Bacteria 1745
313 Ga0105240_10663942 3300009093 Bacteria 1141
314 Ga0105240_11725974 3300009093 Bacteria 653
315 Ga0105240_11889769 3300009093 Bacteria 621
316 Ga0111539_10400226 3300009094 Bacteria 1599
317 Ga0111539_10675436 3300009094 Bacteria 1203
318 Ga0111539_12147524 3300009094 Bacteria 648
319 Ga0105247_10030286 3300009101 Bacteria 3280
320 Ga0105247_10832572 3300009101 Bacteria 707
321 Ga0105247_11057356 3300009101 Bacteria 638
322 Ga0114129_12365235 3300009147 Bacteria 637
323 Ga0105243_10078256 3300009148 Bacteria 2692
324 Ga0105241_10189845 3300009174 Bacteria 1710
325 Ga0105241_10739862 3300009174 Bacteria 901
326 Ga0105241_10858753 3300009174 Bacteria 840
327 Ga0105241_11100455 3300009174 Bacteria 748
328 Ga0105248_10012645 3300009177 Bacteria 9314
329 Ga0105248_10052852 3300009177 Bacteria 4559
330 Ga0105248_10065663 3300009177 Bacteria 4074
331 Ga0105248_10293477 3300009177 Bacteria 1831
332 Ga0105248_10434374 3300009177 Bacteria 1479
333 Ga0105248_11342716 3300009177 Bacteria 809
334 Ga0105248_11346039 3300009177 Bacteria 808
335 Ga0105248_12240059 3300009177 Bacteria 622
336 Ga0105237_10136651 3300009545 Bacteria 2446
337 Ga0105238_10200701 3300009551 Bacteria 1970
338 Ga0105238_10324005 3300009551 Bacteria 1527
339 Ga0105238_10461795 3300009551 Bacteria 1268
340 Ga0105238_10512303 3300009551 Bacteria 1202
341 Ga0105238_11085613 3300009551 Bacteria 823
342 Ga0105238_11187354 3300009551 Bacteria 787
343 Ga0105238_11405512 3300009551 Bacteria 725
344 Ga0105238_11623408 3300009551 Bacteria 677
345 Ga0105249_10000017 3300009553 Bacteria 277115
346 Ga0105249_10001061 3300009553 Bacteria 24372
347 Ga0105249_10198131 3300009553 Bacteria 1964
348 Ga0105249_10295869 3300009553 Bacteria 1622
349 Ga0105249_10829669 3300009553 Bacteria 989
350 Ga0105249_13066452 3300009553 Bacteria 537
351 Ga0105239_10643434 3300010375 Bacteria 1211
352 Ga0105239_11355486 3300010375 Bacteria 821
353 Ga0105239_11583216 3300010375 Bacteria 758
354 Ga0105239_12209445 3300010375 Bacteria 640
355 Ga0105246_10903991 3300011119 Bacteria 792
356 Ga0157373_10025892 3300013100 Bacteria 4239
357 Ga0157373_10094244 3300013100 Bacteria 2108
358 Ga0157373_10227442 3300013100 Bacteria 1317
359 Ga0157373_10435491 3300013100 Bacteria 942
360 Ga0157373_10447762 3300013100 Bacteria 929
361 Ga0157373_11176786 3300013100 Bacteria 577
362 Ga0157371_10004539 3300013102 Bacteria 12094
363 Ga0157371_10028673 3300013102 Bacteria 4030
364 Ga0157371_10137992 3300013102 Bacteria 1737
365 Ga0157371_10547722 3300013102 Bacteria 857
366 Ga0157371_10553536 3300013102 Bacteria 853
367 Ga0157371_10875025 3300013102 Bacteria 680
368 Ga0157371_11409624 3300013102 Bacteria 541
369 Ga0157370_10029812 3300013104 Bacteria 5349
370 Ga0157370_10362128 3300013104 Bacteria 1336
371 Ga0157370_10477761 3300013104 Bacteria 1145
372 Ga0157370_10662166 3300013104 Bacteria 954
373 Ga0157370_11042690 3300013104 Bacteria 740
374 Ga0157370_11208062 3300013104 Bacteria 682
375 Ga0157370_11379634 3300013104 Bacteria 634
376 Ga0157370_11485467 3300013104 Bacteria 609
377 Ga0157369_10006198 3300013105 Bacteria 13875
378 Ga0157369_10060072 3300013105 Bacteria 4100
379 Ga0157369_10224608 3300013105 Bacteria 1965
380 Ga0157369_10226825 3300013105 Bacteria 1954
381 Ga0157369_10238577 3300013105 Bacteria 1899
382 Ga0157369_10888629 3300013105 Bacteria 914
383 Ga0157369_10915875 3300013105 Bacteria 899
384 Ga0157369_12509251 3300013105 Bacteria 522
385 Ga0157374_10010551 3300013296 Bacteria 7953
386 Ga0157374_10367864 3300013296 Bacteria 1431
387 Ga0157374_10604380 3300013296 Bacteria 1107
388 Ga0157374_10645116 3300013296 Bacteria 1070
389 Ga0157378_10974112 3300013297 Bacteria 881
390 Ga0157378_11672718 3300013297 Bacteria 683
391 Ga0163162_10553296 3300013306 Bacteria 1279
392 Ga0163162_11009033 3300013306 Bacteria 941
393 Ga0163162_12754800 3300013306 Bacteria 566
394 Ga0157372_10078683 3300013307 Bacteria 3726
395 Ga0157372_10166269 3300013307 Bacteria 2551
396 Ga0157372_10544908 3300013307 Bacteria 1352
397 Ga0157372_11342906 3300013307 Bacteria 825
398 Ga0157372_11835532 3300013307 Bacteria 697
399 Ga0157375_10583570 3300013308 Bacteria 1278
400 Ga0157375_12141176 3300013308 Bacteria 666
401 Ga0163163_10007592 3300014325 Bacteria 9578
402 Ga0163163_10058122 3300014325 Bacteria 3824
403 Ga0163163_10093123 3300014325 Bacteria 3029
404 Ga0163163_10840836 3300014325 Bacteria 981
405 Ga0157380_10015607 3300014326 Bacteria 5584
406 Ga0157380_10032640 3300014326 Bacteria 4007
407 Ga0157380_10274963 3300014326 Bacteria 1538
408 Ga0157380_11840572 3300014326 Bacteria 665
409 Ga0157380_12216059 3300014326 Bacteria 613
410 Ga0157380_12435952 3300014326 Bacteria 589
411 Ga0182008_10915337 3300014497 Bacteria 517
412 Ga0157379_10191534 3300014968 Bacteria 1848
413 Ga0157379_10489365 3300014968 Bacteria 1139
414 Ga0182006_1319469 3300015261 Bacteria 510
415 Ga0163161_10318399 3300017792 Bacteria 1229
416 Ga0163161_10342924 3300017792 Bacteria 1186
417 Ga0163161_10386121 3300017792 Bacteria 1120
418 Ga0163161_10568245 3300017792 Bacteria 931
419 Ga0163161_10977395 3300017792 Bacteria 721
420 Ga0163161_11528167 3300017792 Bacteria 587
421 Ga0197907_10242937 3300020069 Bacteria 3764
422 Ga0206355_1520041 3300020076 Bacteria 1090
423 Ga0206351_10800997 3300020077 Bacteria 750
424 Ga0206350_10783216 3300020080 Bacteria 547
425 Ga0206350_11209014 3300020080 Bacteria 1185
426 Ga0206353_10409967 3300020082 Bacteria 717
427 Ga0213873_10000021 3300021358 Bacteria 113830
428 Ga0213876_10000050 3300021384 Bacteria 144836
429 Ga0213876_10012794 3300021384 Bacteria 4461
430 Ga0213875_10009078 3300021388 Bacteria 5053
431 Ga0224712_10370067 3300022467 Bacteria 680
432 Ga0209147_100666 3300025229 Bacteria 17803
433 Ga0207673_1052737 3300025290 Bacteria 577
434 Ga0209050_1001064 3300025298 Bacteria 33727
435 Ga0207697_10000357 3300025315 Bacteria 25521
436 Ga0207697_10009568 3300025315 Bacteria 4180
437 Ga0207656_10006798 3300025321 Bacteria 4135
438 Ga0207696_1044417 3300025711 Bacteria 1289
439 Ga0207696_1051971 3300025711 Bacteria 1169
440 Ga0207713_1023315 3300025735 Bacteria 2915
441 Ga0207713_1120151 3300025735 Bacteria 882
442 Ga0207682_10004483 3300025893 Bacteria 5825
443 Ga0207682_10056719 3300025893 Bacteria 1631
444 Ga0207682_10132618 3300025893 Bacteria 1113
445 Ga0207682_10220696 3300025893 Bacteria 877
446 Ga0207642_10696797 3300025899 Bacteria 640
447 Ga0207710_10030890 3300025900 Bacteria 2339
448 Ga0207710_10587716 3300025900 Bacteria 581
449 Ga0207688_10121879 3300025901 Bacteria 1522
450 Ga0207688_10492005 3300025901 Bacteria 767
451 Ga0207680_10000156 3300025903 Bacteria 33323
452 Ga0207680_10218378 3300025903 Bacteria 1306
453 Ga0207647_10008472 3300025904 Bacteria 7370
454 Ga0207647_10009694 3300025904 Bacteria 6833
455 Ga0207647_10137863 3300025904 Bacteria 1431
456 Ga0207647_10249901 3300025904 Bacteria 1017
457 Ga0207647_10282856 3300025904 Bacteria 946
458 Ga0207647_10339741 3300025904 Bacteria 851
459 Ga0207647_10387483 3300025904 Bacteria 788
460 Ga0207647_10612732 3300025904 Bacteria 600
461 Ga0207647_10614215 3300025904 Bacteria 599
462 Ga0207645_10703103 3300025907 Bacteria 687
463 Ga0207643_10134237 3300025908 Bacteria 1474
464 Ga0207705_10000002 3300025909 Bacteria 2046852
465 Ga0207705_10000009 3300025909 Bacteria 576128
466 Ga0207705_10000059 3300025909 Bacteria 155683
467 Ga0207705_10000648 3300025909 Bacteria 28951
468 Ga0207705_10007902 3300025909 Bacteria 7809
469 Ga0207705_10043522 3300025909 Bacteria 3226
470 Ga0207705_10058249 3300025909 Bacteria 2787
471 Ga0207705_10243893 3300025909 Bacteria 1369
472 Ga0207705_10467741 3300025909 Bacteria 978
473 Ga0207705_10877927 3300025909 Bacteria 695
474 Ga0207705_11445779 3300025909 Bacteria 522
475 Ga0207654_10000796 3300025911 Bacteria 17350
476 Ga0207654_10240018 3300025911 Bacteria 1211
477 Ga0207707_10099833 3300025912 Bacteria 2537
478 Ga0207695_10006167 3300025913 Bacteria 15631
479 Ga0207695_10049127 3300025913 Bacteria 4450
480 Ga0207695_10155268 3300025913 Bacteria 2223
481 Ga0207695_10254886 3300025913 Bacteria 1653
482 Ga0207671_10003173 3300025914 Bacteria 16603
483 Ga0207671_10688793 3300025914 Bacteria 813
484 Ga0207660_10011674 3300025917 Bacteria 5728
485 Ga0207660_10235666 3300025917 Bacteria 1440
486 Ga0207660_10643598 3300025917 Bacteria 864
487 Ga0207660_11578567 3300025917 Bacteria 529
488 Ga0207657_10025646 3300025919 Bacteria 5431
489 Ga0207657_10035454 3300025919 Bacteria 4474
490 Ga0207657_10047199 3300025919 Bacteria 3768
491 Ga0207657_10051890 3300025919 Bacteria 3563
492 Ga0207657_10068579 3300025919 Bacteria 3012
493 Ga0207657_10178187 3300025919 Bacteria 1719
494 Ga0207657_10213574 3300025919 Bacteria 1548
495 Ga0207657_10256142 3300025919 Bacteria 1393
496 Ga0207657_10377056 3300025919 Bacteria 1117
497 Ga0207657_10822361 3300025919 Bacteria 718
498 Ga0207649_10000089 3300025920 Bacteria 76923
499 Ga0207649_10000785 3300025920 Bacteria 20599
500 Ga0207649_10208905 3300025920 Bacteria 1384
501 Ga0207649_10387534 3300025920 Bacteria 1043
502 Ga0207649_10568364 3300025920 Bacteria 869
503 Ga0207649_10592923 3300025920 Bacteria 852
504 Ga0207652_10000008 3300025921 Bacteria 286698
505 Ga0207652_10196206 3300025921 Bacteria 1816
506 Ga0207652_10579214 3300025921 Bacteria 1007
507 Ga0207652_11495349 3300025921 Bacteria 579
508 Ga0207652_11660720 3300025921 Bacteria 543
509 Ga0207681_10000005 3300025923 Bacteria 555724
510 Ga0207681_10000030 3300025923 Bacteria 173766
511 Ga0207681_10024920 3300025923 Bacteria 3843
512 Ga0207681_10237408 3300025923 Bacteria 1417
513 Ga0207681_10438802 3300025923 Bacteria 1060
514 Ga0207681_10744080 3300025923 Bacteria 817
515 Ga0207681_10896019 3300025923 Bacteria 743
516 Ga0207681_10896977 3300025923 Bacteria 742
517 Ga0207681_11251936 3300025923 Bacteria 623
518 Ga0207694_10002782 3300025924 Bacteria 14124
519 Ga0207694_10017336 3300025924 Bacteria 5445
520 Ga0207694_10042554 3300025924 Bacteria 3504
521 Ga0207694_10461078 3300025924 Bacteria 1062
522 Ga0207694_10691263 3300025924 Bacteria 860
523 Ga0207650_10000004 3300025925 Bacteria 743372
524 Ga0207650_10003319 3300025925 Bacteria 11082
525 Ga0207650_10129317 3300025925 Bacteria 1974
526 Ga0207650_10252160 3300025925 Bacteria 1429
527 Ga0207650_10376453 3300025925 Bacteria 1172
528 Ga0207650_10590891 3300025925 Bacteria 933
529 Ga0207650_10601662 3300025925 Bacteria 925
530 Ga0207659_10143155 3300025926 Bacteria 1858
531 Ga0207659_10411697 3300025926 Bacteria 1133
532 Ga0207664_10592174 3300025929 Bacteria 996
533 Ga0207664_11354761 3300025929 Bacteria 632
534 Ga0207644_10000017 3300025931 Bacteria 177818
535 Ga0207644_10000145 3300025931 Bacteria 50586
536 Ga0207644_10002200 3300025931 Bacteria 12646
537 Ga0207644_10035625 3300025931 Bacteria 3488
538 Ga0207644_10103807 3300025931 Bacteria 2139
539 Ga0207690_10004087 3300025932 Bacteria 8614
540 Ga0207690_10010225 3300025932 Bacteria 5571
541 Ga0207690_10018583 3300025932 Bacteria 4265
542 Ga0207690_10301811 3300025932 Bacteria 1253
543 Ga0207690_10319063 3300025932 Bacteria 1221
544 Ga0207690_10898366 3300025932 Bacteria 735
545 Ga0207690_11006847 3300025932 Bacteria 693
546 Ga0207690_11517323 3300025932 Bacteria 560
547 Ga0207690_11567916 3300025932 Bacteria 550
548 Ga0207690_11689146 3300025932 Bacteria 529
549 Ga0207706_10006766 3300025933 Bacteria 10600
550 Ga0207706_10018915 3300025933 Bacteria 6194
551 Ga0207706_10059527 3300025933 Bacteria 3363
552 Ga0207706_10091353 3300025933 Bacteria 2677
553 Ga0207706_10470622 3300025933 Bacteria 1086
554 Ga0207706_10667366 3300025933 Bacteria 890
555 Ga0207706_11243318 3300025933 Bacteria 617
556 Ga0207706_11564719 3300025933 Bacteria 535
557 Ga0207709_10340059 3300025935 Bacteria 1129
558 Ga0207669_10012728 3300025937 Bacteria 4147
559 Ga0207669_10819468 3300025937 Bacteria 773
560 Ga0207665_10592010 3300025939 Bacteria 865
561 Ga0207691_10017921 3300025940 Bacteria 6710
562 Ga0207691_10112431 3300025940 Bacteria 2421
563 Ga0207691_10154274 3300025940 Bacteria 2018
564 Ga0207691_10190926 3300025940 Bacteria 1786
565 Ga0207691_10217168 3300025940 Bacteria 1659
566 Ga0207691_10597300 3300025940 Bacteria 934
567 Ga0207711_10000187 3300025941 Bacteria 66307
568 Ga0207711_10001472 3300025941 Bacteria 21955
569 Ga0207711_10042359 3300025941 Bacteria 3879
570 Ga0207711_10502944 3300025941 Bacteria 1129
571 Ga0207711_10716462 3300025941 Bacteria 933
572 Ga0207711_11890537 3300025941 Bacteria 540
573 Ga0207689_10177884 3300025942 Bacteria 1754
574 Ga0207689_10288547 3300025942 Bacteria 1359
575 Ga0207689_10610737 3300025942 Bacteria 918
576 Ga0207661_10040411 3300025944 Bacteria 3666
577 Ga0207661_10809183 3300025944 Bacteria 863
578 Ga0207661_11558456 3300025944 Bacteria 605
579 Ga0207679_10141657 3300025945 Bacteria 1944
580 Ga0207679_10356505 3300025945 Bacteria 1276
581 Ga0207679_10637693 3300025945 Bacteria 963
582 Ga0207679_10732276 3300025945 Bacteria 899
583 Ga0207679_10775286 3300025945 Bacteria 873
584 Ga0207667_10004183 3300025949 Bacteria 17730
585 Ga0207667_10009258 3300025949 Bacteria 11628
586 Ga0207667_10016050 3300025949 Bacteria 8482
587 Ga0207667_10038060 3300025949 Bacteria 5138
588 Ga0207667_10198387 3300025949 Bacteria 2059
589 Ga0207667_10441448 3300025949 Bacteria 1323
590 Ga0207667_10555556 3300025949 Bacteria 1161
591 Ga0207667_10857485 3300025949 Bacteria 902
592 Ga0207651_10061277 3300025960 Bacteria 2616
593 Ga0207651_10704852 3300025960 Bacteria 889
594 Ga0207651_11385965 3300025960 Bacteria 633
595 Ga0207712_10000012 3300025961 Bacteria 392363
596 Ga0207712_10028639 3300025961 Bacteria 3728
597 Ga0207712_10063646 3300025961 Bacteria 2627
598 Ga0207712_10106755 3300025961 Bacteria 2092
599 Ga0207712_10259357 3300025961 Bacteria 1409
600 Ga0207712_11603027 3300025961 Bacteria 583
601 Ga0207668_10000113 3300025972 Bacteria 57453
602 Ga0207668_10001639 3300025972 Bacteria 13068
603 Ga0207668_10038990 3300025972 Bacteria 3193
604 Ga0207668_10097003 3300025972 Bacteria 2180
605 Ga0207668_10123359 3300025972 Bacteria 1965
606 Ga0207668_10225229 3300025972 Bacteria 1508
607 Ga0207668_10384373 3300025972 Bacteria 1182
608 Ga0207640_10014726 3300025981 Bacteria 4508
609 Ga0207640_10159500 3300025981 Bacteria 1667
610 Ga0207640_11190624 3300025981 Bacteria 677
611 Ga0207640_11543698 3300025981 Bacteria 597
612 Ga0207658_10002550 3300025986 Bacteria 13234
613 Ga0207658_10005381 3300025986 Bacteria 8790
614 Ga0207658_10009479 3300025986 Bacteria 6606
615 Ga0207658_10086347 3300025986 Bacteria 2419
616 Ga0207658_10130025 3300025986 Bacteria 2021
617 Ga0207658_10195774 3300025986 Bacteria 1683
618 Ga0207677_10173486 3300026023 Bacteria 1689
619 Ga0207703_10001977 3300026035 Bacteria 18099
620 Ga0207703_10109804 3300026035 Bacteria 2352
621 Ga0207703_10540822 3300026035 Bacteria 1098
622 Ga0207639_10089225 3300026041 Bacteria 2463
623 Ga0207639_10438956 3300026041 Bacteria 1183
624 Ga0207639_11445655 3300026041 Bacteria 645
625 Ga0207678_10014182 3300026067 Bacteria 7006
626 Ga0207678_10062609 3300026067 Bacteria 3197
627 Ga0207678_10081076 3300026067 Bacteria 2777
628 Ga0207678_10086490 3300026067 Bacteria 2679
629 Ga0207678_10361305 3300026067 Bacteria 1253
630 Ga0207678_10361306 3300026067 Bacteria 1253
631 Ga0207678_10368645 3300026067 Bacteria 1240
632 Ga0207678_10481879 3300026067 Bacteria 1080
633 Ga0207678_10752877 3300026067 Bacteria 859
634 Ga0207708_10516679 3300026075 Bacteria 1003
635 Ga0207708_11724839 3300026075 Bacteria 550
636 Ga0207702_10003021 3300026078 Bacteria 15630
637 Ga0207702_10034722 3300026078 Bacteria 4218
638 Ga0207702_10082689 3300026078 Bacteria 2792
639 Ga0207702_10182476 3300026078 Bacteria 1934
640 Ga0207702_10280373 3300026078 Bacteria 1575
641 Ga0207641_10000036 3300026088 Bacteria 213165
642 Ga0207641_10001914 3300026088 Bacteria 19977
643 Ga0207641_10002919 3300026088 Bacteria 15481
644 Ga0207641_10026844 3300026088 Bacteria 4754
645 Ga0207641_10047020 3300026088 Bacteria 3638
646 Ga0207641_10383474 3300026088 Bacteria 1346
647 Ga0207648_10384132 3300026089 Bacteria 1270
648 Ga0207676_10000006 3300026095 Bacteria 681936
649 Ga0207676_10000887 3300026095 Bacteria 23213
650 Ga0207676_10004014 3300026095 Bacteria 10388
651 Ga0207676_10136112 3300026095 Bacteria 2096
652 Ga0207676_11012475 3300026095 Bacteria 819
653 Ga0207674_10037223 3300026116 Bacteria 5063
654 Ga0207674_10122043 3300026116 Bacteria 2572
655 Ga0207674_10152816 3300026116 Bacteria 2265
656 Ga0207674_10374507 3300026116 Bacteria 1376
657 Ga0207674_10480318 3300026116 Bacteria 1201
658 Ga0207674_10531816 3300026116 Bacteria 1136
659 Ga0207674_11701258 3300026116 Bacteria 599
660 Ga0207675_100000221 3300026118 Bacteria 53325
661 Ga0207675_100001117 3300026118 Bacteria 26571
662 Ga0207675_100097949 3300026118 Bacteria 2762
663 Ga0207675_100564088 3300026118 Bacteria 1139
664 Ga0207683_10056958 3300026121 Bacteria 3430
665 Ga0207683_11333115 3300026121 Bacteria 664
666 Ga0207683_12148952 3300026121 Bacteria 506
667 Ga0207698_10001088 3300026142 Bacteria 15791
668 Ga0207698_10001432 3300026142 Bacteria 13858
669 Ga0207698_10016673 3300026142 Bacteria 4962
670 Ga0207698_10587584 3300026142 Bacteria 1096
671 Ga0209281_1042455 3300027111 Bacteria 758
672 Ga0210002_1056761 3300027617 Bacteria 680
673 Ga0209966_1099655 3300027695 Bacteria 656
674 Ga0209998_10186520 3300027717 Bacteria 540
675 Ga0209813_10000047 3300027866 Bacteria 49657
676 Ga0209974_10064225 3300027876 Bacteria 1245
677 Ga0268266_10000879 3300028379 Bacteria 38938
678 Ga0268266_10039920 3300028379 Bacteria 3999
679 Ga0268266_10175097 3300028379 Bacteria 1950
680 Ga0268266_11724146 3300028379 Bacteria 601
681 Ga0268266_11870774 3300028379 Bacteria 574
682 Ga0268265_10000001 3300028380 Bacteria 1230727
683 Ga0268265_10000125 3300028380 Bacteria 96710
684 Ga0268265_10011465 3300028380 Bacteria 5994
685 Ga0268265_10051345 3300028380 Bacteria 3112
686 Ga0268265_10076395 3300028380 Bacteria 2627
687 Ga0268265_10430560 3300028380 Bacteria 1227
688 Ga0268265_11032239 3300028380 Bacteria 813
689 Ga0268265_11922987 3300028380 Bacteria 598
690 Ga0268264_10000347 3300028381 Bacteria 70884
691 Ga0268264_10005218 3300028381 Bacteria 11000
692 Ga0268264_10012633 3300028381 Bacteria 6956
693 Ga0268264_10062575 3300028381 Bacteria 3125
694 Ga0268264_10103721 3300028381 Bacteria 2477
695 Ga0268264_10133809 3300028381 Bacteria 2202
696 Ga0268264_12404327 3300028381 Bacteria 533
697 Ga0265338_10366206 3300028800 Bacteria 1033
698 Ga0316180_1068718 3300030736 Bacteria 1536
699 Ga0307513_10044306 3300031456 Bacteria 4875
700 Ga0307408_100023913 3300031548 Bacteria 4166
701 Ga0307408_100247980 3300031548 Bacteria 1467
702 Ga0307408_100373128 3300031548 Bacteria 1217
703 Ga0307408_100634340 3300031548 Bacteria 953
704 Ga0307408_101461325 3300031548 Bacteria 645
705 Ga0307408_101902476 3300031548 Bacteria 570
706 Ga0307408_101945598 3300031548 Bacteria 564
707 Ga0307408_102466309 3300031548 Bacteria 505
708 Ga0307405_10069109 3300031731 Bacteria 2263
709 Ga0307405_10086456 3300031731 Bacteria 2064
710 Ga0307405_10115978 3300031731 Bacteria 1823
711 Ga0307405_10163033 3300031731 Bacteria 1581
712 Ga0307405_10187789 3300031731 Bacteria 1489
713 Ga0307405_10194213 3300031731 Bacteria 1468
714 Ga0307405_10196596 3300031731 Bacteria 1461
715 Ga0307405_10963409 3300031731 Bacteria 726
716 Ga0307405_11048792 3300031731 Bacteria 698
717 Ga0307405_11731923 3300031731 Bacteria 554
718 Ga0307413_10030876 3300031824 Bacteria 3015
719 Ga0307413_10043026 3300031824 Bacteria 2658
720 Ga0307413_10195307 3300031824 Bacteria 1456
721 Ga0307413_10210075 3300031824 Bacteria 1413
722 Ga0307413_10235334 3300031824 Bacteria 1348
723 Ga0307413_10285628 3300031824 Bacteria 1243
724 Ga0307413_10486341 3300031824 Bacteria 988
725 Ga0307413_11042587 3300031824 Bacteria 703
726 Ga0307413_11426460 3300031824 Bacteria 610
727 Ga0307413_12053999 3300031824 Bacteria 516
728 Ga0307410_10004670 3300031852 Bacteria 7118
729 Ga0307410_10039465 3300031852 Bacteria 3100
730 Ga0307410_10308422 3300031852 Bacteria 1251
731 Ga0307410_10314938 3300031852 Bacteria 1239
732 Ga0307410_10380325 3300031852 Bacteria 1136
733 Ga0307410_10685354 3300031852 Bacteria 862
734 Ga0307410_11530911 3300031852 Bacteria 588
735 Ga0307406_10074475 3300031901 Bacteria 2235
736 Ga0307406_10301492 3300031901 Bacteria 1231
737 Ga0307406_10389877 3300031901 Bacteria 1101
738 Ga0307406_10629288 3300031901 Bacteria 888
739 Ga0307406_10672756 3300031901 Bacteria 861
740 Ga0307406_10838775 3300031901 Bacteria 778
741 Ga0307406_10867521 3300031901 Bacteria 766
742 Ga0307406_11267540 3300031901 Bacteria 642
743 Ga0307406_11587672 3300031901 Bacteria 578
744 Ga0307406_11705939 3300031901 Bacteria 558
745 Ga0307407_10074906 3300031903 Bacteria 2027
746 Ga0307407_10092921 3300031903 Bacteria 1854
747 Ga0307407_10150545 3300031903 Bacteria 1511
748 Ga0307407_10179491 3300031903 Bacteria 1402
749 Ga0307407_10272175 3300031903 Bacteria 1169
750 Ga0307407_10628125 3300031903 Bacteria 802
751 Ga0307412_10000330 3300031911 Bacteria 30088
752 Ga0307412_10077051 3300031911 Bacteria 2292
753 Ga0307412_10110217 3300031911 Bacteria 1964
754 Ga0307412_10423101 3300031911 Bacteria 1090
755 Ga0307412_10505142 3300031911 Bacteria 1007
756 Ga0307412_10800071 3300031911 Bacteria 818
757 Ga0307412_11054315 3300031911 Bacteria 721
758 Ga0307412_11119425 3300031911 Bacteria 701
759 Ga0307412_11316391 3300031911 Bacteria 651
760 Ga0307412_11406462 3300031911 Bacteria 631
761 Ga0307412_11943653 3300031911 Bacteria 544
762 Ga0307412_11985012 3300031911 Bacteria 538
763 Ga0307412_12194471 3300031911 Bacteria 514
764 Ga0307409_100071909 3300031995 Bacteria 2752
765 Ga0307409_100115383 3300031995 Bacteria 2261
766 Ga0307409_100127526 3300031995 Bacteria 2167
767 Ga0307409_100136560 3300031995 Bacteria 2105
768 Ga0307409_100165191 3300031995 Bacteria 1941
769 Ga0307409_100601111 3300031995 Bacteria 1087
770 Ga0307409_102415976 3300031995 Bacteria 555
771 Ga0307416_100030267 3300032002 Bacteria 4059
772 Ga0307416_100222558 3300032002 Bacteria 1811
773 Ga0307416_100877262 3300032002 Bacteria 996
774 Ga0307416_101601608 3300032002 Bacteria 756
775 Ga0307416_101747416 3300032002 Bacteria 726
776 Ga0307416_101822002 3300032002 Bacteria 712
777 Ga0307416_102722320 3300032002 Bacteria 591
778 Ga0307416_103475503 3300032002 Bacteria 527
779 Ga0307414_10000117 3300032004 Bacteria 56697
780 Ga0307414_10033711 3300032004 Bacteria 3387
781 Ga0307414_10075940 3300032004 Bacteria 2440
782 Ga0307414_10094751 3300032004 Bacteria 2229
783 Ga0307414_10154782 3300032004 Bacteria 1813
784 Ga0307414_10995308 3300032004 Bacteria 771
785 Ga0307414_11024731 3300032004 Bacteria 760
786 Ga0307414_11075915 3300032004 Bacteria 742
787 Ga0307414_11312136 3300032004 Bacteria 672
788 Ga0307411_10034694 3300032005 Bacteria 3142
789 Ga0307411_10046564 3300032005 Bacteria 2797
790 Ga0307411_10051008 3300032005 Bacteria 2697
791 Ga0307411_10628963 3300032005 Bacteria 926
792 Ga0307411_10634356 3300032005 Bacteria 923
793 Ga0307411_10807471 3300032005 Bacteria 826
794 Ga0307411_11679718 3300032005 Bacteria 587
795 Ga0307415_100050700 3300032126 Bacteria 2813
796 Ga0307415_100154075 3300032126 Bacteria 1772
797 Ga0307415_100329418 3300032126 Bacteria 1277
798 Ga0307415_100394269 3300032126 Bacteria 1180
799 Ga0307415_100848306 3300032126 Bacteria 838
800 Ga0307415_101208521 3300032126 Bacteria 712
801 Ga0307415_101265530 3300032126 Bacteria 697
802 Ga0307415_101357190 3300032126 Bacteria 675
803 Ga0307415_101829157 3300032126 Bacteria 588
804 Ga0316583_10099043 3300032133 Bacteria 1016
805 Ga0316593_10146762 3300032168 Bacteria 857
806 Ga0373940_0155251 3300035088 Bacteria 732
807 Ga0373932_0021465 3300035112 Bacteria 1705
808 Ga0373953_0113089 3300035117 Bacteria 1149
809 Ga0373954_0089363 3300035118 Bacteria 1478
810 Ga0373956_0024664 3300035119 Bacteria 2593
811 Ga0373957_0027492 3300035120 Bacteria 2067
812 Ga0373955_0008414 3300035172 Bacteria 4791
813 Ga0373931_0322058 3300035691 Bacteria 960
814 Ga0373933_0056561 3300035724 Bacteria 2355
815 Ga0373937_0004874 3300036401 Bacteria 11407
816 Ga0316582_0007349 3300036647 Bacteria 5860
817 Ga0316582_0575591 3300036647 Bacteria 776
818 Ga0316584_0206101 3300036712 Bacteria 1449
819 Ga0395899_0021762 3300037312 Bacteria 4863
820 Ga0395899_0044175 3300037312 Bacteria 3321
821 Ga0395899_0100756 3300037312 Bacteria 2085
822 Ga0395899_0140215 3300037312 Bacteria 1720
823 Ga0395899_0153650 3300037312 Bacteria 1630
824 Ga0395899_0199433 3300037312 Bacteria 1396
825 Ga0395900_0000129 3300037418 Bacteria 126281
826 Ga0395900_0037171 3300037418 Bacteria 5021
827 Ga0395900_0086699 3300037418 Bacteria 3217
828 Ga0395900_0107296 3300037418 Bacteria 2869
829 Ga0395900_0114419 3300037418 Bacteria 2768
830 Ga0395900_0146188 3300037418 Bacteria 2417
831 Ga0395900_0459933 3300037418 Bacteria 1227
832 Ga0395900_0518365 3300037418 Bacteria 1140
833 Ga0395900_0531213 3300037418 Bacteria 1123
834 Ga0395900_0921487 3300037418 Bacteria 796
835 Ga0395900_1290340 3300037418 Bacteria 644
836 Ga0395898_0037825 3300037466 Bacteria 4785
837 Ga0395898_0064833 3300037466 Bacteria 3542
838 Ga0395898_0295219 3300037466 Bacteria 1546
839 Ga0395898_0386003 3300037466 Bacteria 1335
840 Ga0395898_0640393 3300037466 Bacteria 1005
841 Ga0395898_0722819 3300037466 Bacteria 937
842 Ga0395898_1637197 3300037466 Bacteria 567
843 Ga0395905_0025750 3300037471 Bacteria 5546
844 Ga0395905_0046000 3300037471 Bacteria 4093
845 Ga0395905_0130100 3300037471 Bacteria 2367
846 Ga0395905_0155152 3300037471 Bacteria 2153
847 Ga0395905_0352456 3300037471 Bacteria 1364
848 Ga0395905_0597559 3300037471 Bacteria 1005
849 Ga0395905_1415085 3300037471 Bacteria 599
850 Ga0436364_0191800 3300037853 Bacteria 21312
851 Ga0436364_0684712 3300037853 Bacteria 571
852 Ga0395901_0002264 3300038443 Bacteria 19637
853 Ga0395901_0068560 3300038443 Bacteria 3695
854 Ga0395901_0142895 3300038443 Bacteria 2515
855 Ga0395901_0147369 3300038443 Bacteria 2473
856 Ga0395901_0162228 3300038443 Bacteria 2347
857 Ga0395901_0351773 3300038443 Bacteria 1520
858 Ga0395901_0578985 3300038443 Bacteria 1134
859 Ga0395901_0997622 3300038443 Bacteria 813
860 Ga0395901_1275939 3300038443 Bacteria 697
861 Ga0436365_0184497 3300039437 Bacteria 3907
862 Ga0436365_0450653 3300039437 Bacteria 1172
863 Ga0436365_0580131 3300039437 Bacteria 6135
864 Ga0436365_1244318 3300039437 Bacteria 547
865 Ga0436363_0358357 3300039450 Bacteria 888
866 Ga0436362_0385235 3300039453 Bacteria 33119
867 Ga0439465_0334775 3300041413 Bacteria 570
868 Ga0451790_28622 3300041444 Bacteria 568
869 Ga0451807_0011806 3300041486 Bacteria 866
870 Ga0451837_0351521 3300041494 Bacteria 648
871 Ga0451839_1304614 3300041496 Bacteria 666
872 Ga0451846_69758 3300041502 Bacteria 524
873 Ga0451849_0595459 3300041505 Bacteria 745
874 Ga0451843_0138888 3300041509 Bacteria 547
875 Ga0451843_1021534 3300041509 Bacteria 596
876 Ga0451853_3234207 3300041512 Bacteria 1799
877 Ga0451853_3599086 3300041512 Bacteria 851
878 Ga0451853_3947895 3300041512 Bacteria 890
879 Ga0439445_0003060 3300042004 Bacteria 3744
880 Ga0439445_0279442 3300042004 Bacteria 501
881 Ga0439448_0008621 3300042005 Bacteria 2987
882 Ga0439448_0022837 3300042005 Bacteria 1947
883 Ga0439450_083826 3300042008 Bacteria 795
884 Ga0439455_0033721 3300042012 Bacteria 1285
885 Ga0450919_027172 3300042121 Bacteria 651
886 Ga0450922_024105 3300042124 Bacteria 639
887 Ga0450896_035742 3300042133 Bacteria 764
888 Ga0450902_057117 3300042137 Bacteria 673
889 Ga0439446_0344644 3300042156 Bacteria 530
890 Ga0439458_0001304 3300042157 Bacteria 6297
891 Ga0439458_0079831 3300042157 Bacteria 833
892 Ga0450909_036264 3300042185 Bacteria 754
893 Ga0450893_0022040 3300042532 Bacteria 1102
894 Ga0466969_0223310 3300044656 Bacteria 856
895 Ga0466972_0013424 3300044658 Bacteria 4113
896 Ga0466973_0608614 3300044659 Bacteria 570
897 Ga0466965_0309790 3300044683 Bacteria 858
898 Ga0466966_0000003 3300044684 Bacteria 233677
899 Ga0466966_0002392 3300044684 Bacteria 12260
900 Ga0466966_0369278 3300044684 Bacteria 862
901 Ga0466961_0098457 3300044693 Bacteria 1844
902 Ga0466963_0026446 3300044694 Bacteria 3711
903 Ga0466963_0211997 3300044694 Bacteria 1355
904 Ga0466964_0055158 3300044706 Bacteria 1640
905 Ga0466971_0016839 3300044719 Bacteria 3229
906 Ga0466971_0135148 3300044719 Bacteria 1147
907 Ga0466968_0070572 3300044735 Bacteria 1520
908 Ga0466970_0271138 3300044765 Bacteria 953
909 Ga0466970_0422565 3300044765 Bacteria 762
910 Ga0466957_0006798 3300044842 Bacteria 6462
911 Ga0466957_0015092 3300044842 Bacteria 4508
912 Ga0466957_0559603 3300044842 Bacteria 797
913 Ga0466957_0799164 3300044842 Bacteria 670
914 Ga0466960_0036448 3300044901 Bacteria 2303
915 Ga0466960_0147435 3300044901 Bacteria 1254
916 Ga0466960_0455960 3300044901 Bacteria 744
917 Ga0466959_0101644 3300045049 Bacteria 2058
918 Ga0466959_0252297 3300045049 Bacteria 1216
919 Ga0466958_0014358 3300045836 Bacteria 4522
920 Ga0466967_0070609 3300045976 Bacteria 3124
921 Ga0466967_1578940 3300045976 Bacteria 653
922 Ga0495627_000259 3300046453 Bacteria 54358
923 Ga0495627_001182 3300046453 Bacteria 16582
924 Ga0495629_1128117 3300046459 Bacteria 506
925 Ga0495638_0151783 3300046460 Bacteria 1343
926 Ga0495638_0163241 3300046460 Bacteria 1284
927 Ga0495638_0241159 3300046460 Bacteria 1001
928 Ga0495650_0018352 3300046471 Bacteria 3477
929 Ga0495650_0242389 3300046471 Bacteria 615
930 Ga0495584_0069703 3300046491 Bacteria 1767
931 Ga0495584_0595530 3300046491 Bacteria 564
932 Ga0495585_0124421 3300046492 Bacteria 1362
933 Ga0495585_0212795 3300046492 Bacteria 979
934 Ga0495596_0000054 3300046500 Bacteria 83068
935 Ga0495596_0007788 3300046500 Bacteria 4806
936 Ga0495607_0211118 3300046501 Bacteria 955
937 Ga0495583_0164366 3300046506 Bacteria 914
938 Ga0495606_0131411 3300046507 Bacteria 1488
939 Ga0495606_0133485 3300046507 Bacteria 1473
940 Ga0495606_0363718 3300046507 Bacteria 764
941 Ga0495606_0428674 3300046507 Bacteria 682
942 Ga0495610_0002336 3300046512 Bacteria 16035
943 Ga0495610_0107757 3300046512 Bacteria 1238
944 Ga0495620_0016521 3300046515 Bacteria 3700
945 Ga0495620_0047476 3300046515 Bacteria 1848
946 Ga0495620_0052278 3300046515 Bacteria 1736
947 Ga0495631_0113666 3300046518 Bacteria 1164
948 Ga0495632_0000095 3300046519 Bacteria 89499
949 Ga0495632_0111602 3300046519 Bacteria 1283
950 Ga0495637_0010393 3300046520 Bacteria 4503
951 Ga0495637_0291324 3300046520 Bacteria 581
952 Ga0495643_0000038 3300046522 Bacteria 236010
953 Ga0495643_0018247 3300046522 Bacteria 4082
954 Ga0495648_0015595 3300046524 Bacteria 5510
955 Ga0495663_0000028 3300046525 Bacteria 89526
956 Ga0495663_0113344 3300046525 Bacteria 902
957 Ga0495663_0135747 3300046525 Bacteria 832
958 Ga0495654_0013841 3300046530 Bacteria 4306
959 Ga0495654_0114493 3300046530 Bacteria 1227
960 Ga0495598_0189653 3300046537 Bacteria 737
961 Ga0495609_0078741 3300046538 Bacteria 1442
962 Ga0495609_0463555 3300046538 Bacteria 503
963 Ga0495621_0083657 3300046539 Bacteria 1193
964 Ga0495633_0002760 3300046558 Bacteria 12138
965 Ga0495633_0032405 3300046558 Bacteria 2525
966 Ga0495668_0014797 3300046616 Bacteria 4567
967 Ga0495668_0055513 3300046616 Bacteria 2187
968 Ga0495668_0080044 3300046616 Bacteria 1793
969 Ga0495668_0283224 3300046616 Bacteria 908
970 Ga0495625_0067721 3300046660 Bacteria 2512
971 Ga0495625_0068887 3300046660 Bacteria 2486
972 Ga0495625_0599845 3300046660 Bacteria 661
973 Ga0495659_0221508 3300046664 Bacteria 781
974 Ga0495669_0043715 3300046684 Bacteria 1995
975 Ga0495669_0088257 3300046684 Bacteria 1429
976 Ga0495670_0147361 3300046691 Bacteria 1233
977 Ga0495671_0000027 3300046692 Bacteria 236011
978 Ga0495671_0038864 3300046692 Bacteria 2404
979 Ga0495671_0526141 3300046692 Bacteria 563
980 Ga0495589_0442145 3300046794 Bacteria 595
981 Ga0495683_0233532 3300047323 Bacteria 814
982 Ga0495677_0039987 3300047445 Bacteria 1714
983 Ga0495673_0056682 3300047469 Bacteria 1694
984 Ga0495673_0064355 3300047469 Bacteria 1560
985 Ga0495681_0000360 3300047470 Bacteria 35550
986 Ga0495681_0007198 3300047470 Bacteria 7153
987 Ga0495686_0210647 3300047472 Bacteria 1110
988 Ga0495686_0458233 3300047472 Bacteria 676
989 Ga0495602_0018419 3300048088 Bacteria 6974
990 Ga0495615_0000152 3300048090 Bacteria 17446
991 Ga0495615_0116664 3300048090 Bacteria 768
992 Ga0495626_0000356 3300048091 Bacteria 47831
993 Ga0496100_0970557 3300048903 Bacteria 668
994 Ga0496101_1160668 3300048904 Bacteria 606
995 Ga0496102_0000345 3300048905 Bacteria 56618
996 Ga0496102_0299968 3300048905 Bacteria 1514
997 Ga0496102_0734907 3300048905 Bacteria 910
998 Ga0496103_0000276 3300048906 Bacteria 48842
999 Ga0496103_0018485 3300048906 Bacteria 4180
1000 Ga0496105_0299993 3300048908 Bacteria 1292
1001 Ga0496105_1101040 3300048908 Bacteria 590
1002 Ga0496107_0194813 3300048910 Bacteria 1506
1003 Ga0496108_0008106 3300048911 Bacteria 8517
1004 Ga0496108_0828440 3300048911 Bacteria 797
1005 Ga0496110_0839338 3300048913 Bacteria 824
1006 Ga0496111_1163764 3300048914 Bacteria 548
1007 Ga0496116_0000035 3300048919 Bacteria 402424
1008 Ga0496116_0112128 3300048919 Bacteria 1599
1009 Ga0496116_0173431 3300048919 Bacteria 1165
1010 Ga0496117_0000633 3300048920 Bacteria 56618
1011 Ga0496117_0051053 3300048920 Bacteria 2927
1012 Ga0496118_0000654 3300048921 Bacteria 56618
1013 Ga0496118_0051401 3300048921 Bacteria 3153
1014 Ga0496118_0101608 3300048921 Bacteria 1941
1015 Ga0496119_0041645 3300048922 Bacteria 2922
1016 Ga0496120_0022737 3300048923 Bacteria 3941
1017 Ga0496120_0424117 3300048923 Bacteria 583
1018 Ga0496121_0005190 3300048924 Bacteria 16883
1019 Ga0496121_0040965 3300048924 Bacteria 4055
1020 Ga0496121_0065515 3300048924 Bacteria 2955
1021 Ga0496122_0008028 3300048925 Bacteria 11524
1022 Ga0496122_0009631 3300048925 Bacteria 10115
1023 Ga0496122_0253404 3300048925 Bacteria 982
1024 Ga0496123_0003623 3300048926 Bacteria 17095
1025 Ga0496123_0128746 3300048926 Bacteria 1407
1026 Ga0496123_0259398 3300048926 Bacteria 852
1027 Ga0496124_0000664 3300048927 Bacteria 56618
1028 Ga0496124_0005247 3300048927 Bacteria 14676
1029 Ga0496124_0068836 3300048927 Bacteria 2940
1030 Ga0496124_0406309 3300048927 Bacteria 943
1031 Ga0496124_0470881 3300048927 Bacteria 851
1032 Ga0496125_0024671 3300048928 Bacteria 5523
1033 Ga0496125_0070773 3300048928 Bacteria 2729
1034 Ga0496125_0072995 3300048928 Bacteria 2671
1035 Ga0496125_0129339 3300048928 Bacteria 1781
1036 Ga0496126_0000084 3300048929 Bacteria 217111
1037 Ga0496126_0077669 3300048929 Bacteria 2943
1038 Ga0496126_0148093 3300048929 Bacteria 2014
1039 Ga0496126_0954748 3300048929 Bacteria 646
1040 Ga0501306_000053 3300049127 Bacteria 6015
1041 Ga0501306_012159 3300049127 Bacteria 1106
1042 Ga0501306_025058 3300049127 Bacteria 856
1043 Ga0501306_032502 3300049127 Bacteria 781
1044 Ga0501306_063453 3300049127 Bacteria 612
1045 Ga0501308_057456 3300049128 Bacteria 581
1046 Ga0501309_044663 3300049129 Bacteria 684
1047 Ga0501310_007822 3300049130 Bacteria 1149
1048 Ga0501304_012847 3300049160 Bacteria 759
1049 Ga0501304_024531 3300049160 Bacteria 615
1050 Ga0501305_001454 3300049161 Bacteria 2322
1051 Ga0501305_064900 3300049161 Bacteria 634
1052 Ga0501305_066351 3300049161 Bacteria 629
1053 Ga0501307_000852 3300049162 Bacteria 2331
1054 Ga0501307_032560 3300049162 Bacteria 729
1055 Ga0501307_091012 3300049162 Bacteria 509
1056 Ga0495678_085298 3300049459 Bacteria 1125
1057 Ga0495682_0166508 3300049460 Bacteria 785
1058 Ga0501312_007670 3300049528 Bacteria 1381
1059 Ga0501313_004418 3300049529 Bacteria 1444
1060 Ga0501314_000002 3300049530 Bacteria 13192
1061 Ga0501315_043192 3300049531 Bacteria 688
1062 Ga0501315_068769 3300049531 Bacteria 584
1063 Ga0501315_070322 3300049531 Bacteria 580
1064 Ga0501315_074801 3300049531 Bacteria 567
1065 Ga0501316_030404 3300049532 Bacteria 721
1066 Ga0501317_012033 3300049533 Bacteria 1062
1067 Ga0501320_019698 3300049536 Bacteria 771
1068 Ga0501321_020722 3300049537 Bacteria 815
1069 Ga0501322_012811 3300049538 Bacteria 671
1070 Ga0501323_086220 3300049539 Bacteria 519
1071 Ga0501324_045614 3300049540 Bacteria 509
1072 Ga0501325_010463 3300049541 Bacteria 841
1073 Ga0501325_010745 3300049541 Bacteria 836
1074 Ga0501325_018626 3300049541 Bacteria 713
1075 Ga0501336_010484 3300049552 Bacteria 743
1076 Ga0501337_023773 3300049553 Bacteria 509
1077 Ga0501032_0426180 3300049569 Bacteria 851
1078 Ga0501033_1167178 3300049570 Bacteria 511
1079 Ga0501034_0025412 3300049571 Bacteria 6029
1080 Ga0501036_0618656 3300049572 Bacteria 898
1081 Ga0501040_0898140 3300049576 Bacteria 642
1082 Ga0501040_0908845 3300049576 Bacteria 638
1083 Ga0501043_0158164 3300049579 Bacteria 1771
1084 Ga0501043_0933708 3300049579 Bacteria 621
1085 Ga0501047_0050927 3300049581 Bacteria 3999
1086 Ga0501047_0259693 3300049581 Bacteria 1585
1087 Ga0501048_1264682 3300049582 Bacteria 531
1088 Ga0501074_0762731 3300049590 Bacteria 682
1089 Ga0501201_011764 3300049651 Bacteria 867
1090 Ga0501223_000394 3300049663 Bacteria 10743
1091 Ga0501224_000009 3300049664 Bacteria 107191
1092 Ga0501224_000719 3300049664 Bacteria 4156
1093 Ga0501224_027715 3300049664 Bacteria 847
1094 Ga0501227_140768 3300049665 Bacteria 662
1095 Ga0501233_000604 3300049668 Bacteria 5865
1096 Ga0501235_004379 3300049669 Bacteria 3054
1097 Ga0501239_075300 3300049672 Bacteria 532
1098 Ga0501249_001523 3300049679 Bacteria 4750
1099 Ga0501249_010685 3300049679 Bacteria 1923
1100 Ga0501253_010293 3300049683 Bacteria 1404
1101 Ga0501257_161869 3300049686 Bacteria 623
1102 Ga0501258_023728 3300049687 Bacteria 737
1103 Ga0501219_022019 3300049703 Bacteria 559
1104 Ga0501221_033559 3300049704 Bacteria 1084
1105 Ga0501225_0000094 3300049705 Bacteria 28402
1106 Ga0501229_076171 3300049706 Bacteria 531
1107 Ga0501234_001131 3300049707 Bacteria 4213
1108 Ga0501035_0370772 3300049822 Bacteria 1195
1109 Ga0501204_061270 3300049850 Bacteria 599
1110 Ga0501226_000076 3300049853 Bacteria 29950
1111 nmdc:mga03683_594937_c1 3300050489 Bacteria 541
1112 nmdc:mga00v17_3048_c1 3300050491 Bacteria 8615
1113 nmdc:mga0k408_176220_c1 3300050493 Bacteria 1275
1114 nmdc:mga06z11_517_c1 3300050494 Bacteria 14236
1115 nmdc:mga06z11_814486_c1 3300050494 Bacteria 569
1116 nmdc:mga04h51_91_c1 3300050495 Bacteria 28026
1117 nmdc:mga07m45_164_c1 3300050496 Bacteria 26629
1118 nmdc:mga08y16_1224882_c1 3300050511 Bacteria 720
1119 nmdc:mga08y16_134827_c1 3300050511 Bacteria 2566
1120 nmdc:mga08y16_693902_c1 3300050511 Bacteria 1018
1121 nmdc:mga0sz30_167_c1 3300050516 Bacteria 24409
1122 nmdc:mga0sz30_208022_c1 3300050516 Bacteria 869
1123 Ga0500643_000004 3300053087 Bacteria 857484
1124 Ga0500643_009338 3300053087 Bacteria 3754
1125 Ga0500643_065741 3300053087 Bacteria 1011
1126 Ga0500643_065742 3300053087 Bacteria 1011
1127 Ga0500643_217418 3300053087 Bacteria 513
1128 Ga0500647_0087398 3300053091 Bacteria 1494
1129 Ga0500562_030207 3300053108 Bacteria 1427
1130 Ga0500592_028741 3300053116 Bacteria 896
1131 Ga0500594_0254736 3300053118 Bacteria 584
1132 Ga0500607_005191 3300053121 Bacteria 8593
1133 Ga0500608_272960 3300053122 Bacteria 645
1134 Ga0500642_0236906 3300053130 Bacteria 842
1135 Ga0500559_0054969 3300053136 Bacteria 1764
1136 Ga0500568_0081765 3300053139 Bacteria 1226
1137 Ga0500577_0090467 3300053142 Bacteria 1236
1138 Ga0500590_028297 3300053148 Bacteria 2908
1139 Ga0500590_096832 3300053148 Bacteria 1423
1140 Ga0500604_0076435 3300053151 Bacteria 1076
1141 Ga0500616_0047383 3300053153 Bacteria 2282
1142 Ga0500616_0211652 3300053153 Bacteria 851
1143 Ga0500627_0000200 3300053158 Bacteria 17313
1144 Ga0500637_0035961 3300053178 Bacteria 2779
1145 Ga0500611_007703 3300053727 Bacteria 1632
1146 Ga0500645_004674 3300053730 Bacteria 5209
1147 Ga0590071_043319 3300059421 Bacteria 1085
1148 Ga0590071_139620 3300059421 Bacteria 625
1149 Ga0587090_056272 3300059510 Bacteria 734
1150 Ga0587125_054900 3300059607 Bacteria 570
1151 Ga0587101_016307 3300059623 Bacteria 1017
1152 Ga0587101_144166 3300059623 Bacteria 511
1153 Ga0587115_093744 3300059626 Bacteria 548
1154 Ga0587128_013345 3300059630 Bacteria 1158
1155 Ga0587128_041590 3300059630 Bacteria 806
1156 Ga0587128_046280 3300059630 Bacteria 779
1157 Ga0587076_042893 3300059645 Bacteria 852
1158 Ga0587079_104329 3300059647 Bacteria 681
1159 Ga0587107_056217 3300059652 Bacteria 682
1160 Ga0587114_113522 3300059655 Bacteria 541
1161 Ga0587124_013523 3300059660 Bacteria 767
1162 Ga0587071_065086 3300060344 Bacteria 782
1163 Ga0587071_100812 3300060344 Bacteria 668
1164 Ga0466962_0022154 3300061719 Bacteria 3051
1165 Ga0466962_0156175 3300061719 Bacteria 1108

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013306 Ga0163162_12754800 Ga0163162_127548002 89
2 3300046616 Ga0495668_0055513 Ga0495668_0055513_1905_2174 89
3 3300014326 Ga0157380_10274963 Ga0157380_102749632 96
4 3300017792 Ga0163161_10568245 Ga0163161_105682452 96
5 iso_pu_bacteria 3000865235 3000866851 97
6 iso_pu_bacteria 2818991438 2819552564 98
7 iso_pu_bacteria 8054302542 8054304447 98
8 3300025939 Ga0207665_10592010 Ga0207665_105920102 99
9 3300049460 Ga0495682_0166508 Ga0495682_0166508_181_480 99
10 iso_pu_bacteria 2510917021 2511127736 99
11 iso_pu_bacteria 2643221541 2643729044 99
12 iso_pu_bacteria 2643221605 2644039619 99
13 iso_pu_bacteria 2643221606 2644045057 99
14 iso_pu_bacteria 2643221671 2644391230 99
15 3300014326 Ga0157380_11840572 Ga0157380_118405722 100
16 3300037853 Ga0436364_0684712 Ga0436364_0684712_54_362 100
17 3300005327 Ga0070658_10000808 Ga0070658_100008082 101
18 3300005366 Ga0070659_100606645 Ga0070659_1006066452 101
19 3300005539 Ga0068853_100404879 Ga0068853_1004048793 101
20 3300005577 Ga0068857_101125820 Ga0068857_1011258202 101
21 3300005616 Ga0068852_100602980 Ga0068852_1006029802 101
22 3300006353 Ga0075370_10385755 Ga0075370_103857551 101
23 3300006948 Ga0099826_10515445 Ga0099826_105154452 101
24 3300009093 Ga0105240_10327247 Ga0105240_103272472 101
25 3300009551 Ga0105238_10324005 Ga0105238_103240052 101
26 3300013104 Ga0157370_11379634 Ga0157370_113796342 101
27 3300025904 Ga0207647_10009694 Ga0207647_100096943 101
28 3300025909 Ga0207705_10000009 Ga0207705_10000009356 101
29 3300025913 Ga0207695_10254886 Ga0207695_102548862 101
30 3300025924 Ga0207694_10017336 Ga0207694_100173364 101
31 3300025949 Ga0207667_10441448 Ga0207667_104414482 101
32 3300025981 Ga0207640_10014726 Ga0207640_100147264 101
33 3300026041 Ga0207639_11445655 Ga0207639_114456552 101
34 3300026078 Ga0207702_10182476 Ga0207702_101824762 101
35 3300026116 Ga0207674_10480318 Ga0207674_104803182 101
36 3300026142 Ga0207698_10587584 Ga0207698_105875842 101
37 3300028381 Ga0268264_12404327 Ga0268264_124043272 101
38 3300041502 Ga0451846_69758 Ga0451846_69758_118_423 101
39 3300041505 Ga0451849_0595459 Ga0451849_0595459_419_724 101
40 3300041512 Ga0451853_3599086 Ga0451853_3599086_308_613 101
41 3300046460 Ga0495638_0151783 Ga0495638_0151783_612_923 101
42 3300046515 Ga0495620_0047476 Ga0495620_0047476_183_488 101
43 3300049127 Ga0501306_032502 Ga0501306_032502_198_503 101
44 3300049130 Ga0501310_007822 Ga0501310_007822_415_720 101
45 3300049536 Ga0501320_019698 Ga0501320_019698_316_621 101
46 3300049540 Ga0501324_045614 Ga0501324_045614_72_377 101
47 3300049664 Ga0501224_027715 Ga0501224_027715_122_427 101
48 3300049679 Ga0501249_010685 Ga0501249_010685_330_635 101
49 3300049683 Ga0501253_010293 Ga0501253_010293_737_1042 101
50 3300049850 Ga0501204_061270 Ga0501204_061270_84_389 101
51 3300053087 Ga0500643_000004 Ga0500643_000004_605578_605889 101
52 3300053108 Ga0500562_030207 Ga0500562_030207_359_670 101
53 3300053118 Ga0500594_0254736 Ga0500594_0254736_213_524 101
54 3300053121 Ga0500607_005191 Ga0500607_005191_2631_2936 101
55 3300053122 Ga0500608_272960 Ga0500608_272960_240_545 101
56 3300053136 Ga0500559_0054969 Ga0500559_0054969_974_1279 101
57 3300053139 Ga0500568_0081765 Ga0500568_0081765_455_766 101
58 3300053148 Ga0500590_096832 Ga0500590_096832_87_392 101
59 3300053153 Ga0500616_0047383 Ga0500616_0047383_229_540 101
60 3300053178 Ga0500637_0035961 Ga0500637_0035961_2418_2723 101
61 3300053730 Ga0500645_004674 Ga0500645_004674_2054_2359 101
62 iso_pu_bacteria 2830075706 2830079059 101
63 iso_pu_bacteria 2919709256 2919712487 101
64 3300003791 Ga0055530_10027359 Ga0055530_100273593 102
65 3300006195 Ga0075366_10251147 Ga0075366_102511472 102
66 3300025298 Ga0209050_1001064 Ga0209050_100106411 102
67 3300032133 Ga0316583_10099043 Ga0316583_100990432 102
68 3300032168 Ga0316593_10146762 Ga0316593_101467622 102
69 3300036647 Ga0316582_0007349 Ga0316582_0007349_2572_2889 102
70 3300036647 Ga0316582_0575591 Ga0316582_0575591_63_380 102
71 3300036712 Ga0316584_0206101 Ga0316584_0206101_956_1273 102
72 3300048090 Ga0495615_0000152 Ga0495615_0000152_2829_3137 102
73 3300048903 Ga0496100_0970557 Ga0496100_0970557_340_648 102
74 3300048913 Ga0496110_0839338 Ga0496110_0839338_65_373 102
75 3300048914 Ga0496111_1163764 Ga0496111_1163764_175_483 102
76 3300048919 Ga0496116_0000035 Ga0496116_0000035_162283_162591 102
77 3300048921 Ga0496118_0051401 Ga0496118_0051401_80_388 102
78 3300048924 Ga0496121_0040965 Ga0496121_0040965_3548_3856 102
79 3300048925 Ga0496122_0008028 Ga0496122_0008028_10260_10568 102
80 3300048925 Ga0496122_0009631 Ga0496122_0009631_3295_3603 102
81 3300048926 Ga0496123_0003623 Ga0496123_0003623_6745_7053 102
82 3300048926 Ga0496123_0128746 Ga0496123_0128746_143_451 102
83 3300048927 Ga0496124_0005247 Ga0496124_0005247_10865_11173 102
84 3300048927 Ga0496124_0406309 Ga0496124_0406309_550_858 102
85 3300048928 Ga0496125_0129339 Ga0496125_0129339_562_870 102
86 3300048929 Ga0496126_0000084 Ga0496126_0000084_71466_71774 102
87 3300053130 Ga0500642_0236906 Ga0500642_0236906_442_756 102
88 3300002076 JGI24749J21850_1000052 JGI24749J21850_100005233 103
89 3300002459 JGI24751J29686_10000325 JGI24751J29686_100003258 103
90 3300005295 Ga0065707_10007537 Ga0065707_100075374 103
91 3300005331 Ga0070670_100024275 Ga0070670_1000242758 103
92 3300005353 Ga0070669_100033975 Ga0070669_1000339758 103
93 3300005367 Ga0070667_100092578 Ga0070667_1000925783 103
94 3300005617 Ga0068859_100006387 Ga0068859_10000638710 103
95 3300005618 Ga0068864_100014199 Ga0068864_1000141995 103
96 3300005719 Ga0068861_100002700 Ga0068861_1000027005 103
97 3300005841 Ga0068863_100084537 Ga0068863_1000845373 103
98 3300005843 Ga0068860_100159782 Ga0068860_1001597822 103
99 3300005844 Ga0068862_100000126 Ga0068862_1000001269 103
100 3300006931 Ga0097620_100006388 Ga0097620_10000638810 103
101 3300006946 Ga0079104_1061406 Ga0079104_10614062 103
102 3300009148 Ga0105243_10078256 Ga0105243_100782563 103
103 3300009177 Ga0105248_10052852 Ga0105248_100528525 103
104 3300014325 Ga0163163_10093123 Ga0163163_100931232 103
105 3300014326 Ga0157380_10032640 Ga0157380_100326405 103
106 3300025901 Ga0207688_10492005 Ga0207688_104920052 103
107 3300025923 Ga0207681_10000005 Ga0207681_1000000570 103
108 3300025925 Ga0207650_10000004 Ga0207650_10000004651 103
109 3300025935 Ga0207709_10340059 Ga0207709_103400592 103
110 3300025941 Ga0207711_10001472 Ga0207711_100014722 103
111 3300025942 Ga0207689_10610737 Ga0207689_106107372 103
112 3300025972 Ga0207668_10123359 Ga0207668_101233593 103
113 3300025981 Ga0207640_11190624 Ga0207640_111906242 103
114 3300025986 Ga0207658_10002550 Ga0207658_1000255016 103
115 3300025986 Ga0207658_10005381 Ga0207658_100053815 103
116 3300026088 Ga0207641_10047020 Ga0207641_100470206 103
117 3300026089 Ga0207648_10384132 Ga0207648_103841322 103
118 3300026095 Ga0207676_10000006 Ga0207676_1000000661 103
119 3300026118 Ga0207675_100001117 Ga0207675_10000111731 103
120 3300027111 Ga0209281_1042455 Ga0209281_10424552 103
121 3300028380 Ga0268265_10000001 Ga0268265_100000011117 103
122 3300028381 Ga0268264_10133809 Ga0268264_101338093 103
123 3300031548 Ga0307408_100373128 Ga0307408_1003731282 103
124 3300031824 Ga0307413_10235334 Ga0307413_102353342 103
125 3300031901 Ga0307406_11267540 Ga0307406_112675402 103
126 3300031901 Ga0307406_11705939 Ga0307406_117059392 103
127 3300031911 Ga0307412_10423101 Ga0307412_104231011 103
128 3300031911 Ga0307412_11054315 Ga0307412_110543152 103
129 3300031911 Ga0307412_11406462 Ga0307412_114064622 103
130 3300032002 Ga0307416_101822002 Ga0307416_1018220022 103
131 3300032002 Ga0307416_102722320 Ga0307416_1027223201 103
132 3300032004 Ga0307414_11312136 Ga0307414_113121362 103
133 3300032005 Ga0307411_11679718 Ga0307411_116797182 103
134 3300032126 Ga0307415_100848306 Ga0307415_1008483062 103
135 3300041512 Ga0451853_3234207 Ga0451853_3234207_1297_1608 103
136 3300044659 Ga0466973_0608614 Ga0466973_0608614_160_471 103
137 3300046453 Ga0495627_001182 Ga0495627_001182_15135_15446 103
138 3300046459 Ga0495629_1128117 Ga0495629_1128117_118_429 103
139 3300046460 Ga0495638_0163241 Ga0495638_0163241_167_478 103
140 3300046471 Ga0495650_0018352 Ga0495650_0018352_1362_1673 103
141 3300046492 Ga0495585_0212795 Ga0495585_0212795_29_340 103
142 3300046500 Ga0495596_0000054 Ga0495596_0000054_158_469 103
143 3300046500 Ga0495596_0007788 Ga0495596_0007788_4032_4343 103
144 3300046506 Ga0495583_0164366 Ga0495583_0164366_212_523 103
145 3300046507 Ga0495606_0131411 Ga0495606_0131411_150_461 103
146 3300046507 Ga0495606_0363718 Ga0495606_0363718_407_718 103
147 3300046512 Ga0495610_0002336 Ga0495610_0002336_1071_1382 103
148 3300046515 Ga0495620_0016521 Ga0495620_0016521_2844_3155 103
149 3300046519 Ga0495632_0111602 Ga0495632_0111602_793_1104 103
150 3300046520 Ga0495637_0291324 Ga0495637_0291324_235_546 103
151 3300046522 Ga0495643_0018247 Ga0495643_0018247_1399_1710 103
152 3300046530 Ga0495654_0114493 Ga0495654_0114493_144_455 103
153 3300046538 Ga0495609_0078741 Ga0495609_0078741_814_1125 103
154 3300046616 Ga0495668_0080044 Ga0495668_0080044_440_751 103
155 3300046660 Ga0495625_0068887 Ga0495625_0068887_275_586 103
156 3300046660 Ga0495625_0599845 Ga0495625_0599845_327_638 103
157 3300046692 Ga0495671_0526141 Ga0495671_0526141_198_509 103
158 3300047323 Ga0495683_0233532 Ga0495683_0233532_390_701 103
159 3300047470 Ga0495681_0000360 Ga0495681_0000360_5877_6188 103
160 3300047472 Ga0495686_0458233 Ga0495686_0458233_275_586 103
161 3300048091 Ga0495626_0000356 Ga0495626_0000356_21899_22210 103
162 3300048905 Ga0496102_0000345 Ga0496102_0000345_34623_34934 103
163 3300048906 Ga0496103_0000276 Ga0496103_0000276_13928_14239 103
164 3300048919 Ga0496116_0112128 Ga0496116_0112128_879_1190 103
165 3300048920 Ga0496117_0000633 Ga0496117_0000633_21685_21996 103
166 3300048921 Ga0496118_0000654 Ga0496118_0000654_34623_34934 103
167 3300048923 Ga0496120_0424117 Ga0496120_0424117_214_525 103
168 3300048927 Ga0496124_0000664 Ga0496124_0000664_34623_34934 103
169 3300049127 Ga0501306_000053 Ga0501306_000053_3965_4276 103
170 3300049128 Ga0501308_057456 Ga0501308_057456_220_534 103
171 3300049129 Ga0501309_044663 Ga0501309_044663_343_654 103
172 3300049160 Ga0501304_024531 Ga0501304_024531_285_599 103
173 3300049161 Ga0501305_001454 Ga0501305_001454_429_740 103
174 3300049162 Ga0501307_000852 Ga0501307_000852_446_757 103
175 3300049528 Ga0501312_007670 Ga0501312_007670_608_919 103
176 3300049529 Ga0501313_004418 Ga0501313_004418_429_740 103
177 3300049531 Ga0501315_043192 Ga0501315_043192_321_635 103
178 3300049531 Ga0501315_074801 Ga0501315_074801_223_546 103
179 3300049532 Ga0501316_030404 Ga0501316_030404_287_601 103
180 3300049581 Ga0501047_0259693 Ga0501047_0259693_541_852 103
181 3300049590 Ga0501074_0762731 Ga0501074_0762731_164_484 103
182 3300049651 Ga0501201_011764 Ga0501201_011764_534_845 103
183 3300049672 Ga0501239_075300 Ga0501239_075300_174_488 103
184 3300049679 Ga0501249_001523 Ga0501249_001523_263_574 103
185 3300049703 Ga0501219_022019 Ga0501219_022019_51_362 103
186 3300049706 Ga0501229_076171 Ga0501229_076171_193_504 103
187 3300059421 Ga0590071_043319 Ga0590071_043319_66_386 103
188 3300059421 Ga0590071_139620 Ga0590071_139620_126_449 103
189 2162886007 SwRhRL2b_contig_308716 SwRhRL2b_0404.00006530 104
190 2162886007 SwRhRL2b_contig_373569 SwRhRL2b_0225.00006960 104
191 3300001979 JGI24740J21852_10142843 JGI24740J21852_101428432 104
192 3300003911 JGI25405J52794_10005009 JGI25405J52794_100050095 104
193 3300004800 Ga0058861_12019348 Ga0058861_120193485 104
194 3300004803 Ga0058862_12510110 Ga0058862_125101101 104
195 3300005289 Ga0065704_10009321 Ga0065704_100093215 104
196 3300005289 Ga0065704_10133643 Ga0065704_101336432 104
197 3300005289 Ga0065704_10158827 Ga0065704_101588272 104
198 3300005290 Ga0065712_10044080 Ga0065712_100440802 104
199 3300005290 Ga0065712_10520019 Ga0065712_105200192 104
200 3300005295 Ga0065707_10108385 Ga0065707_101083855 104
201 3300005327 Ga0070658_10000172 Ga0070658_1000017273 104
202 3300005327 Ga0070658_10034387 Ga0070658_100343873 104
203 3300005327 Ga0070658_10147154 Ga0070658_101471543 104
204 3300005327 Ga0070658_10181443 Ga0070658_101814432 104
205 3300005327 Ga0070658_10693818 Ga0070658_106938182 104
206 3300005329 Ga0070683_100222804 Ga0070683_1002228042 104
207 3300005331 Ga0070670_100077325 Ga0070670_1000773254 104
208 3300005331 Ga0070670_101076645 Ga0070670_1010766452 104
209 3300005333 Ga0070677_10216068 Ga0070677_102160681 104
210 3300005333 Ga0070677_10486318 Ga0070677_104863182 104
211 3300005334 Ga0068869_102104140 Ga0068869_1021041401 104
212 3300005335 Ga0070666_10141818 Ga0070666_101418182 104
213 3300005336 Ga0070680_100033523 Ga0070680_1000335236 104
214 3300005336 Ga0070680_100284036 Ga0070680_1002840362 104
215 3300005336 Ga0070680_100666478 Ga0070680_1006664782 104
216 3300005337 Ga0070682_101045239 Ga0070682_1010452392 104
217 3300005339 Ga0070660_100023993 Ga0070660_1000239933 104
218 3300005339 Ga0070660_100028806 Ga0070660_1000288065 104
219 3300005339 Ga0070660_100038292 Ga0070660_1000382925 104
220 3300005339 Ga0070660_100060466 Ga0070660_1000604663 104
221 3300005344 Ga0070661_100485118 Ga0070661_1004851182 104
222 3300005345 Ga0070692_10038561 Ga0070692_100385613 104
223 3300005345 Ga0070692_10050904 Ga0070692_100509043 104
224 3300005345 Ga0070692_10224230 Ga0070692_102242301 104
225 3300005347 Ga0070668_100046306 Ga0070668_1000463062 104
226 3300005353 Ga0070669_100002856 Ga0070669_1000028563 104
227 3300005354 Ga0070675_100069477 Ga0070675_1000694775 104
228 3300005355 Ga0070671_100002671 Ga0070671_10000267112 104
229 3300005364 Ga0070673_100948209 Ga0070673_1009482092 104
230 3300005366 Ga0070659_100024658 Ga0070659_10002465810 104
231 3300005366 Ga0070659_100830908 Ga0070659_1008309082 104
232 3300005366 Ga0070659_102134472 Ga0070659_1021344722 104
233 3300005367 Ga0070667_100052979 Ga0070667_1000529792 104
234 3300005440 Ga0070705_100127772 Ga0070705_1001277722 104
235 3300005441 Ga0070700_100559087 Ga0070700_1005590872 104
236 3300005455 Ga0070663_100253556 Ga0070663_1002535562 104
237 3300005457 Ga0070662_100005957 Ga0070662_1000059576 104
238 3300005457 Ga0070662_100373351 Ga0070662_1003733512 104
239 3300005457 Ga0070662_101107281 Ga0070662_1011072811 104
240 3300005458 Ga0070681_10088688 Ga0070681_100886882 104
241 3300005458 Ga0070681_10177121 Ga0070681_101771213 104
242 3300005458 Ga0070681_11264566 Ga0070681_112645661 104
243 3300005466 Ga0070685_10338871 Ga0070685_103388712 104
244 3300005530 Ga0070679_100000873 Ga0070679_1000008736 104
245 3300005530 Ga0070679_100272454 Ga0070679_1002724543 104
246 3300005530 Ga0070679_100464363 Ga0070679_1004643632 104
247 3300005530 Ga0070679_100500972 Ga0070679_1005009721 104
248 3300005530 Ga0070679_100559293 Ga0070679_1005592931 104
249 3300005530 Ga0070679_100732699 Ga0070679_1007326992 104
250 3300005535 Ga0070684_101940564 Ga0070684_1019405642 104
251 3300005539 Ga0068853_100107432 Ga0068853_1001074324 104
252 3300005543 Ga0070672_100089112 Ga0070672_1000891123 104
253 3300005548 Ga0070665_100001143 Ga0070665_1000011438 104
254 3300005563 Ga0068855_100116496 Ga0068855_1001164963 104
255 3300005564 Ga0070664_100288384 Ga0070664_1002883843 104
256 3300005564 Ga0070664_100498178 Ga0070664_1004981782 104
257 3300005564 Ga0070664_100616986 Ga0070664_1006169862 104
258 3300005577 Ga0068857_100222421 Ga0068857_1002224213 104
259 3300005577 Ga0068857_100234824 Ga0068857_1002348242 104
260 3300005616 Ga0068852_101974323 Ga0068852_1019743232 104
261 3300005618 Ga0068864_102418338 Ga0068864_1024183382 104
262 3300005718 Ga0068866_11025973 Ga0068866_110259732 104
263 3300005841 Ga0068863_100109631 Ga0068863_1001096312 104
264 3300005842 Ga0068858_100488747 Ga0068858_1004887472 104
265 3300005843 Ga0068860_100028664 Ga0068860_1000286645 104
266 3300005843 Ga0068860_100307284 Ga0068860_1003072842 104
267 3300005844 Ga0068862_100037303 Ga0068862_1000373035 104
268 3300005937 Ga0081455_10000215 Ga0081455_100002159 104
269 3300006048 Ga0075363_100000592 Ga0075363_1000005929 104
270 3300006051 Ga0075364_10039797 Ga0075364_100397974 104
271 3300006177 Ga0075362_10000383 Ga0075362_1000038319 104
272 3300006178 Ga0075367_10034804 Ga0075367_100348046 104
273 3300006186 Ga0075369_10007430 Ga0075369_100074306 104
274 3300006186 Ga0075369_10207627 Ga0075369_102076272 104
275 3300006195 Ga0075366_10044214 Ga0075366_100442142 104
276 3300006195 Ga0075366_10482922 Ga0075366_104829221 104
277 3300006358 Ga0068871_101615763 Ga0068871_1016157632 104
278 3300006880 Ga0075429_101202087 Ga0075429_1012020872 104
279 3300009094 Ga0111539_10675436 Ga0111539_106754362 104
280 3300009094 Ga0111539_12147524 Ga0111539_121475241 104
281 3300009101 Ga0105247_10832572 Ga0105247_108325722 104
282 3300009177 Ga0105248_10293477 Ga0105248_102934773 104
283 3300009177 Ga0105248_12240059 Ga0105248_122400592 104
284 3300009551 Ga0105238_11187354 Ga0105238_111873542 104
285 3300009553 Ga0105249_13066452 Ga0105249_130664522 104
286 3300013100 Ga0157373_10227442 Ga0157373_102274422 104
287 3300013100 Ga0157373_11176786 Ga0157373_111767861 104
288 3300013102 Ga0157371_10028673 Ga0157371_100286735 104
289 3300013102 Ga0157371_10137992 Ga0157371_101379923 104
290 3300013102 Ga0157371_10547722 Ga0157371_105477221 104
291 3300013104 Ga0157370_10477761 Ga0157370_104777612 104
292 3300013104 Ga0157370_10662166 Ga0157370_106621662 104
293 3300013105 Ga0157369_10006198 Ga0157369_1000619824 104
294 3300013297 Ga0157378_10974112 Ga0157378_109741122 104
295 3300013308 Ga0157375_12141176 Ga0157375_121411762 104
296 3300014325 Ga0163163_10840836 Ga0163163_108408362 104
297 3300014326 Ga0157380_12216059 Ga0157380_122160592 104
298 3300014497 Ga0182008_10915337 Ga0182008_109153372 104
299 3300014968 Ga0157379_10489365 Ga0157379_104893652 104
300 3300017792 Ga0163161_10386121 Ga0163161_103861212 104
301 3300017792 Ga0163161_10977395 Ga0163161_109773952 104
302 3300021358 Ga0213873_10000021 Ga0213873_1000002134 104
303 3300021384 Ga0213876_10000050 Ga0213876_1000005089 104
304 3300021384 Ga0213876_10012794 Ga0213876_100127942 104
305 3300025735 Ga0207713_1023315 Ga0207713_10233155 104
306 3300025893 Ga0207682_10056719 Ga0207682_100567192 104
307 3300025893 Ga0207682_10132618 Ga0207682_101326182 104
308 3300025893 Ga0207682_10220696 Ga0207682_102206962 104
309 3300025901 Ga0207688_10121879 Ga0207688_101218793 104
310 3300025903 Ga0207680_10218378 Ga0207680_102183782 104
311 3300025904 Ga0207647_10339741 Ga0207647_103397412 104
312 3300025909 Ga0207705_10000002 Ga0207705_10000002625 104
313 3300025909 Ga0207705_10000648 Ga0207705_100006489 104
314 3300025909 Ga0207705_10007902 Ga0207705_1000790214 104
315 3300025909 Ga0207705_10243893 Ga0207705_102438932 104
316 3300025912 Ga0207707_10099833 Ga0207707_100998334 104
317 3300025917 Ga0207660_10011674 Ga0207660_100116743 104
318 3300025917 Ga0207660_10643598 Ga0207660_106435982 104
319 3300025919 Ga0207657_10025646 Ga0207657_1002564612 104
320 3300025919 Ga0207657_10035454 Ga0207657_100354543 104
321 3300025919 Ga0207657_10178187 Ga0207657_101781872 104
322 3300025919 Ga0207657_10377056 Ga0207657_103770562 104
323 3300025919 Ga0207657_10822361 Ga0207657_108223612 104
324 3300025921 Ga0207652_10000008 Ga0207652_1000000828 104
325 3300025921 Ga0207652_10196206 Ga0207652_101962063 104
326 3300025921 Ga0207652_10579214 Ga0207652_105792142 104
327 3300025921 Ga0207652_11495349 Ga0207652_114953492 104
328 3300025921 Ga0207652_11660720 Ga0207652_116607202 104
329 3300025923 Ga0207681_10024920 Ga0207681_100249205 104
330 3300025923 Ga0207681_10744080 Ga0207681_107440802 104
331 3300025923 Ga0207681_10896019 Ga0207681_108960192 104
332 3300025923 Ga0207681_11251936 Ga0207681_112519362 104
333 3300025924 Ga0207694_10461078 Ga0207694_104610782 104
334 3300025925 Ga0207650_10129317 Ga0207650_101293172 104
335 3300025925 Ga0207650_10252160 Ga0207650_102521602 104
336 3300025926 Ga0207659_10143155 Ga0207659_101431553 104
337 3300025931 Ga0207644_10002200 Ga0207644_100022006 104
338 3300025932 Ga0207690_10010225 Ga0207690_100102255 104
339 3300025932 Ga0207690_10018583 Ga0207690_100185839 104
340 3300025932 Ga0207690_11517323 Ga0207690_115173231 104
341 3300025932 Ga0207690_11567916 Ga0207690_115679162 104
342 3300025933 Ga0207706_10059527 Ga0207706_100595275 104
343 3300025940 Ga0207691_10112431 Ga0207691_101124314 104
344 3300025940 Ga0207691_10190926 Ga0207691_101909262 104
345 3300025940 Ga0207691_10217168 Ga0207691_102171682 104
346 3300025941 Ga0207711_10042359 Ga0207711_100423592 104
347 3300025942 Ga0207689_10177884 Ga0207689_101778842 104
348 3300025944 Ga0207661_10040411 Ga0207661_100404114 104
349 3300025944 Ga0207661_11558456 Ga0207661_115584562 104
350 3300025945 Ga0207679_10775286 Ga0207679_107752862 104
351 3300025949 Ga0207667_10009258 Ga0207667_1000925820 104
352 3300025949 Ga0207667_10198387 Ga0207667_101983872 104
353 3300025960 Ga0207651_10704852 Ga0207651_107048522 104
354 3300025961 Ga0207712_11603027 Ga0207712_116030272 104
355 3300025972 Ga0207668_10038990 Ga0207668_100389902 104
356 3300025986 Ga0207658_10086347 Ga0207658_100863473 104
357 3300026035 Ga0207703_10109804 Ga0207703_101098044 104
358 3300026067 Ga0207678_10062609 Ga0207678_100626092 104
359 3300026067 Ga0207678_10481879 Ga0207678_104818792 104
360 3300026075 Ga0207708_10516679 Ga0207708_105166792 104
361 3300026088 Ga0207641_10026844 Ga0207641_100268443 104
362 3300026095 Ga0207676_11012475 Ga0207676_110124752 104
363 3300026116 Ga0207674_10122043 Ga0207674_101220432 104
364 3300026116 Ga0207674_10531816 Ga0207674_105318162 104
365 3300026121 Ga0207683_12148952 Ga0207683_121489522 104
366 3300027617 Ga0210002_1056761 Ga0210002_10567612 104
367 3300027717 Ga0209998_10186520 Ga0209998_101865201 104
368 3300027866 Ga0209813_10000047 Ga0209813_1000004741 104
369 3300027876 Ga0209974_10064225 Ga0209974_100642252 104
370 3300028379 Ga0268266_10000879 Ga0268266_1000087936 104
371 3300028380 Ga0268265_10051345 Ga0268265_100513452 104
372 3300028380 Ga0268265_10076395 Ga0268265_100763954 104
373 3300028381 Ga0268264_10062575 Ga0268264_100625755 104
374 3300028381 Ga0268264_10103721 Ga0268264_101037212 104
375 3300031548 Ga0307408_100023913 Ga0307408_1000239134 104
376 3300031548 Ga0307408_100634340 Ga0307408_1006343402 104
377 3300031731 Ga0307405_10086456 Ga0307405_100864562 104
378 3300031731 Ga0307405_10963409 Ga0307405_109634092 104
379 3300031824 Ga0307413_11426460 Ga0307413_114264602 104
380 3300031911 Ga0307412_10000330 Ga0307412_1000033021 104
381 3300031911 Ga0307412_11316391 Ga0307412_113163912 104
382 3300031911 Ga0307412_11943653 Ga0307412_119436532 104
383 3300031911 Ga0307412_12194471 Ga0307412_121944712 104
384 3300032004 Ga0307414_10000117 Ga0307414_1000011746 104
385 3300032004 Ga0307414_10154782 Ga0307414_101547823 104
386 3300032005 Ga0307411_10628963 Ga0307411_106289632 104
387 3300032126 Ga0307415_101357190 Ga0307415_1013571902 104
388 3300037312 Ga0395899_0021762 Ga0395899_0021762_4039_4353 104
389 3300037312 Ga0395899_0044175 Ga0395899_0044175_2684_2998 104
390 3300037312 Ga0395899_0199433 Ga0395899_0199433_1058_1372 104
391 3300037418 Ga0395900_0000129 Ga0395900_0000129_7089_7403 104
392 3300037418 Ga0395900_0114419 Ga0395900_0114419_1044_1358 104
393 3300037418 Ga0395900_0459933 Ga0395900_0459933_311_625 104
394 3300037418 Ga0395900_0531213 Ga0395900_0531213_731_1045 104
395 3300037418 Ga0395900_1290340 Ga0395900_1290340_248_565 104
396 3300037466 Ga0395898_0037825 Ga0395898_0037825_3540_3854 104
397 3300037466 Ga0395898_0722819 Ga0395898_0722819_517_831 104
398 3300037471 Ga0395905_0046000 Ga0395905_0046000_3357_3671 104
399 3300037471 Ga0395905_0130100 Ga0395905_0130100_1543_1857 104
400 3300038443 Ga0395901_0002264 Ga0395901_0002264_6462_6776 104
401 3300038443 Ga0395901_0142895 Ga0395901_0142895_779_1096 104
402 3300038443 Ga0395901_0147369 Ga0395901_0147369_773_1087 104
403 3300038443 Ga0395901_1275939 Ga0395901_1275939_334_648 104
404 3300039437 Ga0436365_0184497 Ga0436365_0184497_1103_1426 104
405 3300039437 Ga0436365_0580131 Ga0436365_0580131_1980_2300 104
406 3300039453 Ga0436362_0385235 Ga0436362_0385235_678_998 104
407 3300041486 Ga0451807_0011806 Ga0451807_0011806_222_536 104
408 3300041494 Ga0451837_0351521 Ga0451837_0351521_249_563 104
409 3300041509 Ga0451843_1021534 Ga0451843_1021534_168_482 104
410 3300041512 Ga0451853_3947895 Ga0451853_3947895_254_568 104
411 3300042005 Ga0439448_0008621 Ga0439448_0008621_2315_2632 104
412 3300042012 Ga0439455_0033721 Ga0439455_0033721_353_670 104
413 3300042121 Ga0450919_027172 Ga0450919_027172_190_504 104
414 3300042124 Ga0450922_024105 Ga0450922_024105_275_589 104
415 3300042133 Ga0450896_035742 Ga0450896_035742_49_363 104
416 3300042137 Ga0450902_057117 Ga0450902_057117_230_544 104
417 3300042157 Ga0439458_0001304 Ga0439458_0001304_3537_3854 104
418 3300042185 Ga0450909_036264 Ga0450909_036264_113_427 104
419 3300042532 Ga0450893_0022040 Ga0450893_0022040_680_994 104
420 3300046460 Ga0495638_0241159 Ga0495638_0241159_580_906 104
421 3300046501 Ga0495607_0211118 Ga0495607_0211118_75_389 104
422 3300046512 Ga0495610_0107757 Ga0495610_0107757_549_863 104
423 3300046525 Ga0495663_0135747 Ga0495663_0135747_351_665 104
424 3300046530 Ga0495654_0013841 Ga0495654_0013841_3516_3830 104
425 3300046616 Ga0495668_0014797 Ga0495668_0014797_200_514 104
426 3300046616 Ga0495668_0283224 Ga0495668_0283224_479_802 104
427 3300046692 Ga0495671_0038864 Ga0495671_0038864_2080_2394 104
428 3300046794 Ga0495589_0442145 Ga0495589_0442145_45_359 104
429 3300047469 Ga0495673_0064355 Ga0495673_0064355_1054_1368 104
430 3300048090 Ga0495615_0116664 Ga0495615_0116664_246_560 104
431 3300048904 Ga0496101_1160668 Ga0496101_1160668_95_409 104
432 3300048905 Ga0496102_0734907 Ga0496102_0734907_378_692 104
433 3300048906 Ga0496103_0018485 Ga0496103_0018485_962_1276 104
434 3300048908 Ga0496105_1101040 Ga0496105_1101040_147_461 104
435 3300048919 Ga0496116_0173431 Ga0496116_0173431_574_888 104
436 3300048920 Ga0496117_0051053 Ga0496117_0051053_2569_2883 104
437 3300048922 Ga0496119_0041645 Ga0496119_0041645_1923_2237 104
438 3300048923 Ga0496120_0022737 Ga0496120_0022737_1605_1919 104
439 3300048924 Ga0496121_0005190 Ga0496121_0005190_12997_13311 104
440 3300048925 Ga0496122_0253404 Ga0496122_0253404_323_637 104
441 3300048926 Ga0496123_0259398 Ga0496123_0259398_256_570 104
442 3300048927 Ga0496124_0068836 Ga0496124_0068836_435_749 104
443 3300048927 Ga0496124_0470881 Ga0496124_0470881_88_402 104
444 3300048928 Ga0496125_0024671 Ga0496125_0024671_599_913 104
445 3300048929 Ga0496126_0148093 Ga0496126_0148093_524_838 104
446 3300048929 Ga0496126_0954748 Ga0496126_0954748_199_513 104
447 3300049127 Ga0501306_063453 Ga0501306_063453_27_344 104
448 3300049162 Ga0501307_032560 Ga0501307_032560_106_420 104
449 3300049459 Ga0495678_085298 Ga0495678_085298_780_1094 104
450 3300049530 Ga0501314_000002 Ga0501314_000002_4305_4619 104
451 3300049533 Ga0501317_012033 Ga0501317_012033_321_635 104
452 3300049537 Ga0501321_020722 Ga0501321_020722_214_528 104
453 3300049541 Ga0501325_010463 Ga0501325_010463_392_706 104
454 3300049553 Ga0501337_023773 Ga0501337_023773_68_382 104
455 3300049569 Ga0501032_0426180 Ga0501032_0426180_85_399 104
456 3300049570 Ga0501033_1167178 Ga0501033_1167178_124_438 104
457 3300049571 Ga0501034_0025412 Ga0501034_0025412_713_1027 104
458 3300049572 Ga0501036_0618656 Ga0501036_0618656_377_691 104
459 3300049576 Ga0501040_0898140 Ga0501040_0898140_218_532 104
460 3300049579 Ga0501043_0158164 Ga0501043_0158164_1206_1520 104
461 3300049579 Ga0501043_0933708 Ga0501043_0933708_176_490 104
462 3300049581 Ga0501047_0050927 Ga0501047_0050927_3516_3830 104
463 3300049663 Ga0501223_000394 Ga0501223_000394_4027_4341 104
464 3300049664 Ga0501224_000009 Ga0501224_000009_4030_4344 104
465 3300049664 Ga0501224_000719 Ga0501224_000719_26_340 104
466 3300049665 Ga0501227_140768 Ga0501227_140768_86_400 104
467 3300049668 Ga0501233_000604 Ga0501233_000604_572_886 104
468 3300049669 Ga0501235_004379 Ga0501235_004379_2526_2840 104
469 3300049705 Ga0501225_0000094 Ga0501225_0000094_22801_23115 104
470 3300049707 Ga0501234_001131 Ga0501234_001131_1307_1621 104
471 3300049822 Ga0501035_0370772 Ga0501035_0370772_92_406 104
472 3300049853 Ga0501226_000076 Ga0501226_000076_25916_26230 104
473 3300050489 nmdc:mga03683_594937_c1 nmdc:mga03683_594937_c1_94_420 104
474 3300050491 nmdc:mga00v17_3048_c1 nmdc:mga00v17_3048_c1_2768_3088 104
475 3300050493 nmdc:mga0k408_176220_c1 nmdc:mga0k408_176220_c1_627_941 104
476 3300050494 nmdc:mga06z11_517_c1 nmdc:mga06z11_517_c1_1160_1480 104
477 3300050494 nmdc:mga06z11_814486_c1 nmdc:mga06z11_814486_c1_203_517 104
478 3300050495 nmdc:mga04h51_91_c1 nmdc:mga04h51_91_c1_15011_15331 104
479 3300050496 nmdc:mga07m45_164_c1 nmdc:mga07m45_164_c1_11446_11766 104
480 3300050511 nmdc:mga08y16_1224882_c1 nmdc:mga08y16_1224882_c1_76_402 104
481 3300050511 nmdc:mga08y16_693902_c1 nmdc:mga08y16_693902_c1_510_824 104
482 3300050516 nmdc:mga0sz30_167_c1 nmdc:mga0sz30_167_c1_13136_13456 104
483 3300050516 nmdc:mga0sz30_208022_c1 nmdc:mga0sz30_208022_c1_91_405 104
484 3300053087 Ga0500643_009338 Ga0500643_009338_3348_3662 104
485 3300053116 Ga0500592_028741 Ga0500592_028741_130_444 104
486 3300053142 Ga0500577_0090467 Ga0500577_0090467_445_759 104
487 3300053148 Ga0500590_028297 Ga0500590_028297_1689_2003 104
488 3300053151 Ga0500604_0076435 Ga0500604_0076435_658_981 104
489 3300053158 Ga0500627_0000200 Ga0500627_0000200_12232_12546 104
490 3300053727 Ga0500611_007703 Ga0500611_007703_87_401 104
491 3300059623 Ga0587101_016307 Ga0587101_016307_172_486 104
492 3300060344 Ga0587071_065086 Ga0587071_065086_17_331 104
493 3300001904 JGI24736J21556_1000017 JGI24736J21556_10000176 105
494 3300001904 JGI24736J21556_1000244 JGI24736J21556_100024412 105
495 3300001904 JGI24736J21556_1020976 JGI24736J21556_10209761 105
496 3300001904 JGI24736J21556_1022190 JGI24736J21556_10221901 105
497 3300001915 JGI24741J21665_1016662 JGI24741J21665_10166623 105
498 3300001979 JGI24740J21852_10008905 JGI24740J21852_100089053 105
499 3300001979 JGI24740J21852_10008925 JGI24740J21852_100089252 105
500 3300001979 JGI24740J21852_10115295 JGI24740J21852_101152952 105
501 3300001989 JGI24739J22299_10017509 JGI24739J22299_100175091 105
502 3300001989 JGI24739J22299_10026040 JGI24739J22299_100260403 105
503 3300001989 JGI24739J22299_10029465 JGI24739J22299_100294651 105
504 3300001989 JGI24739J22299_10065973 JGI24739J22299_100659732 105
505 3300001990 JGI24737J22298_10010075 JGI24737J22298_100100757 105
506 3300001990 JGI24737J22298_10027704 JGI24737J22298_100277044 105
507 3300001990 JGI24737J22298_10057940 JGI24737J22298_100579402 105
508 3300001990 JGI24737J22298_10092202 JGI24737J22298_100922021 105
509 3300001990 JGI24737J22298_10104394 JGI24737J22298_101043941 105
510 3300002067 JGI24735J21928_10003396 JGI24735J21928_100033962 105
511 3300002067 JGI24735J21928_10022535 JGI24735J21928_100225352 105
512 3300002075 JGI24738J21930_10002167 JGI24738J21930_100021673 105
513 3300002075 JGI24738J21930_10013156 JGI24738J21930_100131562 105
514 3300002075 JGI24738J21930_10035086 JGI24738J21930_100350862 105
515 3300005293 Ga0065715_10392675 Ga0065715_103926752 105
516 3300005295 Ga0065707_10426403 Ga0065707_104264032 105
517 3300005327 Ga0070658_10151735 Ga0070658_101517353 105
518 3300005327 Ga0070658_10660111 Ga0070658_106601112 105
519 3300005327 Ga0070658_10772191 Ga0070658_107721912 105
520 3300005329 Ga0070683_100711606 Ga0070683_1007116062 105
521 3300005337 Ga0070682_100708565 Ga0070682_1007085652 105
522 3300005339 Ga0070660_100057901 Ga0070660_1000579014 105
523 3300005339 Ga0070660_100076515 Ga0070660_1000765152 105
524 3300005339 Ga0070660_101878046 Ga0070660_1018780462 105
525 3300005344 Ga0070661_100016703 Ga0070661_1000167038 105
526 3300005344 Ga0070661_100083669 Ga0070661_1000836692 105
527 3300005344 Ga0070661_100156151 Ga0070661_1001561512 105
528 3300005344 Ga0070661_100185779 Ga0070661_1001857793 105
529 3300005344 Ga0070661_100281828 Ga0070661_1002818282 105
530 3300005353 Ga0070669_100497699 Ga0070669_1004976992 105
531 3300005366 Ga0070659_100016977 Ga0070659_1000169772 105
532 3300005366 Ga0070659_100166032 Ga0070659_1001660322 105
533 3300005366 Ga0070659_100331646 Ga0070659_1003316462 105
534 3300005366 Ga0070659_100808624 Ga0070659_1008086242 105
535 3300005438 Ga0070701_10953549 Ga0070701_109535492 105
536 3300005455 Ga0070663_100058865 Ga0070663_1000588652 105
537 3300005455 Ga0070663_100388964 Ga0070663_1003889642 105
538 3300005455 Ga0070663_100838437 Ga0070663_1008384372 105
539 3300005457 Ga0070662_100138242 Ga0070662_1001382424 105
540 3300005457 Ga0070662_100472094 Ga0070662_1004720942 105
541 3300005457 Ga0070662_101213121 Ga0070662_1012131212 105
542 3300005530 Ga0070679_100542586 Ga0070679_1005425862 105
543 3300005535 Ga0070684_100279436 Ga0070684_1002794362 105
544 3300005539 Ga0068853_100000960 Ga0068853_10000096021 105
545 3300005539 Ga0068853_100075015 Ga0068853_1000750154 105
546 3300005548 Ga0070665_102140465 Ga0070665_1021404652 105
547 3300005563 Ga0068855_100367274 Ga0068855_1003672742 105
548 3300005563 Ga0068855_100378198 Ga0068855_1003781982 105
549 3300005563 Ga0068855_101604438 Ga0068855_1016044382 105
550 3300005563 Ga0068855_101834455 Ga0068855_1018344552 105
551 3300005564 Ga0070664_100071016 Ga0070664_1000710163 105
552 3300005577 Ga0068857_100128809 Ga0068857_1001288093 105
553 3300005577 Ga0068857_100232146 Ga0068857_1002321462 105
554 3300005577 Ga0068857_101036775 Ga0068857_1010367752 105
555 3300005578 Ga0068854_100290859 Ga0068854_1002908592 105
556 3300005578 Ga0068854_100315773 Ga0068854_1003157732 105
557 3300005578 Ga0068854_100440919 Ga0068854_1004409192 105
558 3300005614 Ga0068856_100272871 Ga0068856_1002728714 105
559 3300005614 Ga0068856_100450706 Ga0068856_1004507062 105
560 3300005614 Ga0068856_100464472 Ga0068856_1004644722 105
561 3300005614 Ga0068856_100975530 Ga0068856_1009755302 105
562 3300005616 Ga0068852_100085271 Ga0068852_1000852712 105
563 3300005616 Ga0068852_100090864 Ga0068852_1000908643 105
564 3300005616 Ga0068852_100384355 Ga0068852_1003843552 105
565 3300005616 Ga0068852_100435529 Ga0068852_1004355292 105
566 3300005616 Ga0068852_101611652 Ga0068852_1016116522 105
567 3300005616 Ga0068852_101731395 Ga0068852_1017313952 105
568 3300005616 Ga0068852_101943250 Ga0068852_1019432501 105
569 3300005617 Ga0068859_100197558 Ga0068859_1001975582 105
570 3300005840 Ga0068870_10187152 Ga0068870_101871523 105
571 3300005844 Ga0068862_100000032 Ga0068862_100000032158 105
572 3300005844 Ga0068862_100642713 Ga0068862_1006427132 105
573 3300005985 Ga0081539_10024226 Ga0081539_100242265 105
574 3300006931 Ga0097620_100197562 Ga0097620_1001975622 105
575 3300009093 Ga0105240_10183433 Ga0105240_101834332 105
576 3300009093 Ga0105240_10663942 Ga0105240_106639422 105
577 3300009093 Ga0105240_11725974 Ga0105240_117259742 105
578 3300009093 Ga0105240_11889769 Ga0105240_118897691 105
579 3300009101 Ga0105247_11057356 Ga0105247_110573562 105
580 3300009174 Ga0105241_10189845 Ga0105241_101898453 105
581 3300009174 Ga0105241_10739862 Ga0105241_107398621 105
582 3300009174 Ga0105241_11100455 Ga0105241_111004552 105
583 3300009545 Ga0105237_10136651 Ga0105237_101366513 105
584 3300009551 Ga0105238_10200701 Ga0105238_102007012 105
585 3300009551 Ga0105238_10461795 Ga0105238_104617953 105
586 3300009551 Ga0105238_10512303 Ga0105238_105123032 105
587 3300009551 Ga0105238_11085613 Ga0105238_110856132 105
588 3300009551 Ga0105238_11623408 Ga0105238_116234081 105
589 3300009553 Ga0105249_10000017 Ga0105249_10000017123 105
590 3300010375 Ga0105239_10643434 Ga0105239_106434342 105
591 3300010375 Ga0105239_11583216 Ga0105239_115832162 105
592 3300010375 Ga0105239_12209445 Ga0105239_122094452 105
593 3300013100 Ga0157373_10025892 Ga0157373_1002589210 105
594 3300013100 Ga0157373_10094244 Ga0157373_100942445 105
595 3300013100 Ga0157373_10435491 Ga0157373_104354912 105
596 3300013100 Ga0157373_10447762 Ga0157373_104477622 105
597 3300013102 Ga0157371_10004539 Ga0157371_100045392 105
598 3300013102 Ga0157371_10553536 Ga0157371_105535362 105
599 3300013102 Ga0157371_10875025 Ga0157371_108750252 105
600 3300013104 Ga0157370_10029812 Ga0157370_1002981211 105
601 3300013104 Ga0157370_10362128 Ga0157370_103621283 105
602 3300013104 Ga0157370_11042690 Ga0157370_110426902 105
603 3300013104 Ga0157370_11485467 Ga0157370_114854671 105
604 3300013105 Ga0157369_10060072 Ga0157369_100600725 105
605 3300013105 Ga0157369_10224608 Ga0157369_102246081 105
606 3300013105 Ga0157369_10226825 Ga0157369_102268252 105
607 3300013105 Ga0157369_10238577 Ga0157369_102385771 105
608 3300013105 Ga0157369_10888629 Ga0157369_108886292 105
609 3300013105 Ga0157369_10915875 Ga0157369_109158752 105
610 3300013105 Ga0157369_12509251 Ga0157369_125092512 105
611 3300013296 Ga0157374_10367864 Ga0157374_103678642 105
612 3300013307 Ga0157372_10078683 Ga0157372_100786835 105
613 3300013307 Ga0157372_10166269 Ga0157372_101662693 105
614 3300013307 Ga0157372_10544908 Ga0157372_105449081 105
615 3300013307 Ga0157372_11342906 Ga0157372_113429062 105
616 3300013307 Ga0157372_11835532 Ga0157372_118355322 105
617 3300020069 Ga0197907_10242937 Ga0197907_102429375 105
618 3300020076 Ga0206355_1520041 Ga0206355_15200413 105
619 3300020077 Ga0206351_10800997 Ga0206351_108009972 105
620 3300020080 Ga0206350_10783216 Ga0206350_107832162 105
621 3300020080 Ga0206350_11209014 Ga0206350_112090142 105
622 3300020082 Ga0206353_10409967 Ga0206353_104099672 105
623 3300021388 Ga0213875_10009078 Ga0213875_100090782 105
624 3300022467 Ga0224712_10370067 Ga0224712_103700672 105
625 3300025229 Ga0209147_100666 Ga0209147_1006669 105
626 3300025321 Ga0207656_10006798 Ga0207656_100067981 105
627 3300025900 Ga0207710_10587716 Ga0207710_105877162 105
628 3300025904 Ga0207647_10008472 Ga0207647_100084726 105
629 3300025904 Ga0207647_10137863 Ga0207647_101378633 105
630 3300025904 Ga0207647_10249901 Ga0207647_102499011 105
631 3300025904 Ga0207647_10282856 Ga0207647_102828562 105
632 3300025904 Ga0207647_10612732 Ga0207647_106127322 105
633 3300025904 Ga0207647_10614215 Ga0207647_106142151 105
634 3300025908 Ga0207643_10134237 Ga0207643_101342372 105
635 3300025909 Ga0207705_10000059 Ga0207705_10000059106 105
636 3300025909 Ga0207705_10058249 Ga0207705_100582492 105
637 3300025909 Ga0207705_10467741 Ga0207705_104677412 105
638 3300025911 Ga0207654_10000796 Ga0207654_1000079626 105
639 3300025911 Ga0207654_10240018 Ga0207654_102400182 105
640 3300025913 Ga0207695_10006167 Ga0207695_1000616721 105
641 3300025913 Ga0207695_10049127 Ga0207695_100491278 105
642 3300025913 Ga0207695_10155268 Ga0207695_101552685 105
643 3300025914 Ga0207671_10003173 Ga0207671_100031736 105
644 3300025914 Ga0207671_10688793 Ga0207671_106887931 105
645 3300025917 Ga0207660_11578567 Ga0207660_115785672 105
646 3300025919 Ga0207657_10047199 Ga0207657_100471992 105
647 3300025919 Ga0207657_10068579 Ga0207657_100685792 105
648 3300025919 Ga0207657_10213574 Ga0207657_102135742 105
649 3300025919 Ga0207657_10256142 Ga0207657_102561422 105
650 3300025920 Ga0207649_10000089 Ga0207649_100000898 105
651 3300025920 Ga0207649_10000785 Ga0207649_1000078529 105
652 3300025920 Ga0207649_10208905 Ga0207649_102089053 105
653 3300025920 Ga0207649_10387534 Ga0207649_103875342 105
654 3300025923 Ga0207681_10438802 Ga0207681_104388022 105
655 3300025924 Ga0207694_10002782 Ga0207694_100027826 105
656 3300025924 Ga0207694_10042554 Ga0207694_100425544 105
657 3300025924 Ga0207694_10691263 Ga0207694_106912632 105
658 3300025929 Ga0207664_11354761 Ga0207664_113547612 105
659 3300025932 Ga0207690_10004087 Ga0207690_1000408711 105
660 3300025932 Ga0207690_10301811 Ga0207690_103018112 105
661 3300025932 Ga0207690_10898366 Ga0207690_108983662 105
662 3300025932 Ga0207690_11006847 Ga0207690_110068472 105
663 3300025933 Ga0207706_10006766 Ga0207706_100067669 105
664 3300025933 Ga0207706_10091353 Ga0207706_100913532 105
665 3300025933 Ga0207706_10470622 Ga0207706_104706222 105
666 3300025944 Ga0207661_10809183 Ga0207661_108091832 105
667 3300025945 Ga0207679_10356505 Ga0207679_103565053 105
668 3300025949 Ga0207667_10004183 Ga0207667_100041836 105
669 3300025949 Ga0207667_10016050 Ga0207667_1001605018 105
670 3300025949 Ga0207667_10038060 Ga0207667_100380601 105
671 3300025949 Ga0207667_10555556 Ga0207667_105555562 105
672 3300025949 Ga0207667_10857485 Ga0207667_108574852 105
673 3300025961 Ga0207712_10000012 Ga0207712_10000012226 105
674 3300025972 Ga0207668_10225229 Ga0207668_102252292 105
675 3300025981 Ga0207640_10159500 Ga0207640_101595002 105
676 3300025981 Ga0207640_11543698 Ga0207640_115436982 105
677 3300026035 Ga0207703_10540822 Ga0207703_105408222 105
678 3300026041 Ga0207639_10089225 Ga0207639_100892254 105
679 3300026041 Ga0207639_10438956 Ga0207639_104389562 105
680 3300026067 Ga0207678_10014182 Ga0207678_100141823 105
681 3300026067 Ga0207678_10361305 Ga0207678_103613051 105
682 3300026067 Ga0207678_10361306 Ga0207678_103613061 105
683 3300026067 Ga0207678_10752877 Ga0207678_107528772 105
684 3300026078 Ga0207702_10003021 Ga0207702_100030216 105
685 3300026078 Ga0207702_10034722 Ga0207702_100347221 105
686 3300026078 Ga0207702_10082689 Ga0207702_100826892 105
687 3300026078 Ga0207702_10280373 Ga0207702_102803732 105
688 3300026116 Ga0207674_10037223 Ga0207674_1003722310 105
689 3300026116 Ga0207674_10152816 Ga0207674_101528163 105
690 3300026116 Ga0207674_11701258 Ga0207674_117012582 105
691 3300026142 Ga0207698_10001088 Ga0207698_1000108823 105
692 3300026142 Ga0207698_10001432 Ga0207698_100014326 105
693 3300026142 Ga0207698_10016673 Ga0207698_100166733 105
694 3300027695 Ga0209966_1099655 Ga0209966_10996552 105
695 3300028379 Ga0268266_11724146 Ga0268266_117241462 105
696 3300028380 Ga0268265_10000125 Ga0268265_1000012556 105
697 3300028381 Ga0268264_10000347 Ga0268264_1000034774 105
698 3300028800 Ga0265338_10366206 Ga0265338_103662062 105
699 3300031548 Ga0307408_100247980 Ga0307408_1002479802 105
700 3300031731 Ga0307405_10069109 Ga0307405_100691093 105
701 3300031731 Ga0307405_10187789 Ga0307405_101877893 105
702 3300031731 Ga0307405_10194213 Ga0307405_101942132 105
703 3300031824 Ga0307413_10043026 Ga0307413_100430264 105
704 3300031824 Ga0307413_10210075 Ga0307413_102100752 105
705 3300031824 Ga0307413_10285628 Ga0307413_102856282 105
706 3300031852 Ga0307410_10308422 Ga0307410_103084222 105
707 3300031852 Ga0307410_10685354 Ga0307410_106853542 105
708 3300031901 Ga0307406_10301492 Ga0307406_103014922 105
709 3300031901 Ga0307406_10672756 Ga0307406_106727562 105
710 3300031901 Ga0307406_10838775 Ga0307406_108387752 105
711 3300031903 Ga0307407_10092921 Ga0307407_100929212 105
712 3300031903 Ga0307407_10179491 Ga0307407_101794912 105
713 3300031911 Ga0307412_10110217 Ga0307412_101102173 105
714 3300031911 Ga0307412_11119425 Ga0307412_111194252 105
715 3300031995 Ga0307409_100115383 Ga0307409_1001153833 105
716 3300031995 Ga0307409_100165191 Ga0307409_1001651912 105
717 3300031995 Ga0307409_100601111 Ga0307409_1006011112 105
718 3300032002 Ga0307416_100222558 Ga0307416_1002225583 105
719 3300032002 Ga0307416_101601608 Ga0307416_1016016082 105
720 3300032004 Ga0307414_10995308 Ga0307414_109953081 105
721 3300032004 Ga0307414_11024731 Ga0307414_110247312 105
722 3300032005 Ga0307411_10046564 Ga0307411_100465643 105
723 3300032005 Ga0307411_10634356 Ga0307411_106343562 105
724 3300032126 Ga0307415_100050700 Ga0307415_1000507002 105
725 3300035112 Ga0373932_0021465 Ga0373932_0021465_140_457 105
726 3300035691 Ga0373931_0322058 Ga0373931_0322058_586_903 105
727 3300037312 Ga0395899_0100756 Ga0395899_0100756_1547_1864 105
728 3300037312 Ga0395899_0140215 Ga0395899_0140215_500_817 105
729 3300037312 Ga0395899_0153650 Ga0395899_0153650_645_962 105
730 3300037418 Ga0395900_0037171 Ga0395900_0037171_2142_2459 105
731 3300037418 Ga0395900_0086699 Ga0395900_0086699_904_1221 105
732 3300037418 Ga0395900_0146188 Ga0395900_0146188_724_1041 105
733 3300037418 Ga0395900_0518365 Ga0395900_0518365_597_914 105
734 3300037466 Ga0395898_0064833 Ga0395898_0064833_119_436 105
735 3300037466 Ga0395898_0295219 Ga0395898_0295219_452_769 105
736 3300037466 Ga0395898_0386003 Ga0395898_0386003_115_432 105
737 3300037466 Ga0395898_0640393 Ga0395898_0640393_639_956 105
738 3300037471 Ga0395905_0025750 Ga0395905_0025750_4525_4842 105
739 3300037471 Ga0395905_1415085 Ga0395905_1415085_152_469 105
740 3300037853 Ga0436364_0191800 Ga0436364_0191800_1134_1451 105
741 3300038443 Ga0395901_0068560 Ga0395901_0068560_2039_2356 105
742 3300038443 Ga0395901_0162228 Ga0395901_0162228_1856_2173 105
743 3300038443 Ga0395901_0351773 Ga0395901_0351773_809_1126 105
744 3300038443 Ga0395901_0578985 Ga0395901_0578985_680_997 105
745 3300039437 Ga0436365_0450653 Ga0436365_0450653_88_408 105
746 3300039437 Ga0436365_1244318 Ga0436365_1244318_103_420 105
747 3300041413 Ga0439465_0334775 Ga0439465_0334775_158_478 105
748 3300041444 Ga0451790_28622 Ga0451790_28622_217_537 105
749 3300041496 Ga0451839_1304614 Ga0451839_1304614_252_572 105
750 3300042004 Ga0439445_0279442 Ga0439445_0279442_64_384 105
751 3300042005 Ga0439448_0022837 Ga0439448_0022837_274_591 105
752 3300042008 Ga0439450_083826 Ga0439450_083826_420_737 105
753 3300042156 Ga0439446_0344644 Ga0439446_0344644_105_425 105
754 3300042157 Ga0439458_0079831 Ga0439458_0079831_65_382 105
755 3300044656 Ga0466969_0223310 Ga0466969_0223310_360_677 105
756 3300044658 Ga0466972_0013424 Ga0466972_0013424_224_541 105
757 3300044684 Ga0466966_0002392 Ga0466966_0002392_2864_3181 105
758 3300044684 Ga0466966_0369278 Ga0466966_0369278_451_768 105
759 3300044693 Ga0466961_0098457 Ga0466961_0098457_675_992 105
760 3300044694 Ga0466963_0211997 Ga0466963_0211997_171_488 105
761 3300044706 Ga0466964_0055158 Ga0466964_0055158_687_1004 105
762 3300044719 Ga0466971_0016839 Ga0466971_0016839_1975_2292 105
763 3300044719 Ga0466971_0135148 Ga0466971_0135148_151_468 105
764 3300044735 Ga0466968_0070572 Ga0466968_0070572_302_619 105
765 3300044765 Ga0466970_0271138 Ga0466970_0271138_170_487 105
766 3300044842 Ga0466957_0006798 Ga0466957_0006798_4673_4990 105
767 3300044842 Ga0466957_0559603 Ga0466957_0559603_216_533 105
768 3300044842 Ga0466957_0799164 Ga0466957_0799164_189_506 105
769 3300044901 Ga0466960_0036448 Ga0466960_0036448_975_1292 105
770 3300045049 Ga0466959_0101644 Ga0466959_0101644_81_398 105
771 3300045049 Ga0466959_0252297 Ga0466959_0252297_95_412 105
772 3300045836 Ga0466958_0014358 Ga0466958_0014358_36_353 105
773 3300045976 Ga0466967_1578940 Ga0466967_1578940_199_516 105
774 3300046453 Ga0495627_000259 Ga0495627_000259_4673_4990 105
775 3300046471 Ga0495650_0242389 Ga0495650_0242389_106_423 105
776 3300046491 Ga0495584_0069703 Ga0495584_0069703_982_1299 105
777 3300046507 Ga0495606_0133485 Ga0495606_0133485_843_1160 105
778 3300046507 Ga0495606_0428674 Ga0495606_0428674_125_442 105
779 3300046518 Ga0495631_0113666 Ga0495631_0113666_402_719 105
780 3300046519 Ga0495632_0000095 Ga0495632_0000095_11220_11537 105
781 3300046520 Ga0495637_0010393 Ga0495637_0010393_748_1065 105
782 3300046522 Ga0495643_0000038 Ga0495643_0000038_157634_157951 105
783 3300046524 Ga0495648_0015595 Ga0495648_0015595_1712_2029 105
784 3300046525 Ga0495663_0000028 Ga0495663_0000028_11220_11537 105
785 3300046558 Ga0495633_0002760 Ga0495633_0002760_612_929 105
786 3300046660 Ga0495625_0067721 Ga0495625_0067721_1675_1992 105
787 3300046692 Ga0495671_0000027 Ga0495671_0000027_78061_78378 105
788 3300047469 Ga0495673_0056682 Ga0495673_0056682_281_598 105
789 3300047470 Ga0495681_0007198 Ga0495681_0007198_2687_3004 105
790 3300047472 Ga0495686_0210647 Ga0495686_0210647_10_327 105
791 3300048911 Ga0496108_0828440 Ga0496108_0828440_66_383 105
792 3300048921 Ga0496118_0101608 Ga0496118_0101608_534_851 105
793 3300048924 Ga0496121_0065515 Ga0496121_0065515_58_375 105
794 3300048928 Ga0496125_0070773 Ga0496125_0070773_1917_2234 105
795 3300048928 Ga0496125_0072995 Ga0496125_0072995_501_818 105
796 3300048929 Ga0496126_0077669 Ga0496126_0077669_173_490 105
797 3300049127 Ga0501306_012159 Ga0501306_012159_760_1077 105
798 3300049127 Ga0501306_025058 Ga0501306_025058_164_484 105
799 3300049160 Ga0501304_012847 Ga0501304_012847_294_614 105
800 3300049161 Ga0501305_066351 Ga0501305_066351_79_396 105
801 3300049162 Ga0501307_091012 Ga0501307_091012_49_369 105
802 3300049531 Ga0501315_070322 Ga0501315_070322_121_438 105
803 3300049539 Ga0501323_086220 Ga0501323_086220_146_466 105
804 3300049541 Ga0501325_010745 Ga0501325_010745_159_476 105
805 3300049541 Ga0501325_018626 Ga0501325_018626_254_571 105
806 3300049552 Ga0501336_010484 Ga0501336_010484_296_613 105
807 3300049686 Ga0501257_161869 Ga0501257_161869_175_492 105
808 3300049687 Ga0501258_023728 Ga0501258_023728_295_612 105
809 3300049704 Ga0501221_033559 Ga0501221_033559_384_701 105
810 3300053091 Ga0500647_0087398 Ga0500647_0087398_297_614 105
811 3300059510 Ga0587090_056272 Ga0587090_056272_260_580 105
812 3300059623 Ga0587101_144166 Ga0587101_144166_27_344 105
813 3300059626 Ga0587115_093744 Ga0587115_093744_30_347 105
814 3300059630 Ga0587128_041590 Ga0587128_041590_91_408 105
815 3300059655 Ga0587114_113522 Ga0587114_113522_198_515 105
816 3300059660 Ga0587124_013523 Ga0587124_013523_221_538 105
817 3300060344 Ga0587071_100812 Ga0587071_100812_16_333 105
818 3300061719 Ga0466962_0022154 Ga0466962_0022154_386_703 105
819 3300061719 Ga0466962_0156175 Ga0466962_0156175_745_1062 105
820 3300001976 JGI24752J21851_1000810 JGI24752J21851_10008108 106
821 3300002070 JGI24750J21931_1028129 JGI24750J21931_10281291 106
822 3300002076 JGI24749J21850_1001152 JGI24749J21850_10011528 106
823 3300002239 JGI24034J26672_10002744 JGI24034J26672_100027442 106
824 3300005293 Ga0065715_10090134 Ga0065715_100901342 106
825 3300005293 Ga0065715_10617514 Ga0065715_106175141 106
826 3300005295 Ga0065707_10186565 Ga0065707_101865652 106
827 3300005295 Ga0065707_10385618 Ga0065707_103856182 106
828 3300005327 Ga0070658_10414802 Ga0070658_104148021 106
829 3300005328 Ga0070676_10056397 Ga0070676_100563971 106
830 3300005330 Ga0070690_101245132 Ga0070690_1012451322 106
831 3300005331 Ga0070670_100002763 Ga0070670_10000276319 106
832 3300005331 Ga0070670_100289018 Ga0070670_1002890182 106
833 3300005331 Ga0070670_100938123 Ga0070670_1009381232 106
834 3300005333 Ga0070677_10012449 Ga0070677_100124493 106
835 3300005334 Ga0068869_100534986 Ga0068869_1005349862 106
836 3300005335 Ga0070666_10001221 Ga0070666_100012218 106
837 3300005336 Ga0070680_100069525 Ga0070680_1000695252 106
838 3300005338 Ga0068868_100063445 Ga0068868_1000634454 106
839 3300005341 Ga0070691_10670371 Ga0070691_106703712 106
840 3300005344 Ga0070661_100267229 Ga0070661_1002672292 106
841 3300005344 Ga0070661_100960141 Ga0070661_1009601411 106
842 3300005347 Ga0070668_100051441 Ga0070668_1000514414 106
843 3300005347 Ga0070668_100143128 Ga0070668_1001431283 106
844 3300005353 Ga0070669_100000096 Ga0070669_10000009678 106
845 3300005353 Ga0070669_100268035 Ga0070669_1002680352 106
846 3300005354 Ga0070675_100021317 Ga0070675_1000213175 106
847 3300005354 Ga0070675_101077801 Ga0070675_1010778012 106
848 3300005355 Ga0070671_100000045 Ga0070671_10000004534 106
849 3300005355 Ga0070671_100089401 Ga0070671_1000894013 106
850 3300005355 Ga0070671_100222605 Ga0070671_1002226052 106
851 3300005356 Ga0070674_100070716 Ga0070674_1000707162 106
852 3300005364 Ga0070673_100034662 Ga0070673_1000346623 106
853 3300005364 Ga0070673_101360880 Ga0070673_1013608802 106
854 3300005366 Ga0070659_100121318 Ga0070659_1001213181 106
855 3300005366 Ga0070659_101866823 Ga0070659_1018668231 106
856 3300005367 Ga0070667_100003534 Ga0070667_1000035349 106
857 3300005367 Ga0070667_100125062 Ga0070667_1001250622 106
858 3300005367 Ga0070667_100305375 Ga0070667_1003053751 106
859 3300005438 Ga0070701_10139054 Ga0070701_101390542 106
860 3300005440 Ga0070705_100025314 Ga0070705_1000253145 106
861 3300005445 Ga0070708_100101983 Ga0070708_1001019834 106
862 3300005455 Ga0070663_100380493 Ga0070663_1003804932 106
863 3300005456 Ga0070678_100042212 Ga0070678_1000422125 106
864 3300005457 Ga0070662_100188525 Ga0070662_1001885252 106
865 3300005459 Ga0068867_100088936 Ga0068867_1000889363 106
866 3300005539 Ga0068853_101643023 Ga0068853_1016430231 106
867 3300005543 Ga0070672_100034217 Ga0070672_1000342172 106
868 3300005543 Ga0070672_100623524 Ga0070672_1006235242 106
869 3300005548 Ga0070665_100277766 Ga0070665_1002777662 106
870 3300005564 Ga0070664_101361903 Ga0070664_1013619031 106
871 3300005564 Ga0070664_102386190 Ga0070664_1023861902 106
872 3300005577 Ga0068857_100755108 Ga0068857_1007551082 106
873 3300005614 Ga0068856_100527026 Ga0068856_1005270262 106
874 3300005615 Ga0070702_100249413 Ga0070702_1002494132 106
875 3300005615 Ga0070702_100808329 Ga0070702_1008083292 106
876 3300005616 Ga0068852_100458987 Ga0068852_1004589872 106
877 3300005616 Ga0068852_102017798 Ga0068852_1020177982 106
878 3300005617 Ga0068859_100000162 Ga0068859_10000016234 106
879 3300005617 Ga0068859_100003314 Ga0068859_10000331426 106
880 3300005617 Ga0068859_100056194 Ga0068859_1000561943 106
881 3300005618 Ga0068864_100000677 Ga0068864_10000067723 106
882 3300005618 Ga0068864_100002491 Ga0068864_10000249124 106
883 3300005618 Ga0068864_100188944 Ga0068864_1001889442 106
884 3300005718 Ga0068866_10990043 Ga0068866_109900432 106
885 3300005719 Ga0068861_100001385 Ga0068861_1000013856 106
886 3300005719 Ga0068861_100248927 Ga0068861_1002489272 106
887 3300005719 Ga0068861_101504408 Ga0068861_1015044081 106
888 3300005841 Ga0068863_100000784 Ga0068863_10000078421 106
889 3300005841 Ga0068863_100021286 Ga0068863_10002128613 106
890 3300005842 Ga0068858_100004068 Ga0068858_1000040683 106
891 3300005842 Ga0068858_101405465 Ga0068858_1014054652 106
892 3300005843 Ga0068860_100309619 Ga0068860_1003096192 106
893 3300005844 Ga0068862_100001411 Ga0068862_1000014116 106
894 3300005844 Ga0068862_100183079 Ga0068862_1001830792 106
895 3300005844 Ga0068862_100254494 Ga0068862_1002544942 106
896 3300005844 Ga0068862_100403349 Ga0068862_1004033492 106
897 3300006881 Ga0068865_101513032 Ga0068865_1015130322 106
898 3300006931 Ga0097620_100000162 Ga0097620_10000016234 106
899 3300006931 Ga0097620_100003314 Ga0097620_10000331426 106
900 3300006931 Ga0097620_100056192 Ga0097620_1000561923 106
901 3300009011 Ga0105251_10119144 Ga0105251_101191442 106
902 3300009092 Ga0105250_10006758 Ga0105250_100067583 106
903 3300009092 Ga0105250_10090725 Ga0105250_100907252 106
904 3300009094 Ga0111539_10400226 Ga0111539_104002262 106
905 3300009101 Ga0105247_10030286 Ga0105247_100302864 106
906 3300009174 Ga0105241_10858753 Ga0105241_108587532 106
907 3300009177 Ga0105248_10012645 Ga0105248_1001264511 106
908 3300009177 Ga0105248_10065663 Ga0105248_100656632 106
909 3300009177 Ga0105248_10434374 Ga0105248_104343743 106
910 3300009177 Ga0105248_11342716 Ga0105248_113427162 106
911 3300009553 Ga0105249_10001061 Ga0105249_1000106122 106
912 3300009553 Ga0105249_10295869 Ga0105249_102958693 106
913 3300009553 Ga0105249_10829669 Ga0105249_108296692 106
914 3300010375 Ga0105239_11355486 Ga0105239_113554862 106
915 3300011119 Ga0105246_10903991 Ga0105246_109039912 106
916 3300013102 Ga0157371_11409624 Ga0157371_114096242 106
917 3300013296 Ga0157374_10604380 Ga0157374_106043802 106
918 3300013297 Ga0157378_11672718 Ga0157378_116727182 106
919 3300013306 Ga0163162_10553296 Ga0163162_105532962 106
920 3300013306 Ga0163162_11009033 Ga0163162_110090332 106
921 3300013308 Ga0157375_10583570 Ga0157375_105835702 106
922 3300014325 Ga0163163_10007592 Ga0163163_100075925 106
923 3300014325 Ga0163163_10058122 Ga0163163_100581222 106
924 3300014326 Ga0157380_10015607 Ga0157380_100156079 106
925 3300014968 Ga0157379_10191534 Ga0157379_101915342 106
926 3300015261 Ga0182006_1319469 Ga0182006_13194691 106
927 3300017792 Ga0163161_10318399 Ga0163161_103183992 106
928 3300017792 Ga0163161_11528167 Ga0163161_115281672 106
929 3300025315 Ga0207697_10000357 Ga0207697_100003576 106
930 3300025315 Ga0207697_10009568 Ga0207697_100095682 106
931 3300025711 Ga0207696_1044417 Ga0207696_10444172 106
932 3300025735 Ga0207713_1120151 Ga0207713_11201512 106
933 3300025893 Ga0207682_10004483 Ga0207682_100044835 106
934 3300025899 Ga0207642_10696797 Ga0207642_106967971 106
935 3300025900 Ga0207710_10030890 Ga0207710_100308903 106
936 3300025903 Ga0207680_10000156 Ga0207680_1000015627 106
937 3300025907 Ga0207645_10703103 Ga0207645_107031031 106
938 3300025909 Ga0207705_10877927 Ga0207705_108779272 106
939 3300025909 Ga0207705_11445779 Ga0207705_114457792 106
940 3300025917 Ga0207660_10235666 Ga0207660_102356663 106
941 3300025920 Ga0207649_10592923 Ga0207649_105929232 106
942 3300025923 Ga0207681_10000030 Ga0207681_10000030123 106
943 3300025923 Ga0207681_10237408 Ga0207681_102374082 106
944 3300025925 Ga0207650_10003319 Ga0207650_100033196 106
945 3300025925 Ga0207650_10376453 Ga0207650_103764532 106
946 3300025926 Ga0207659_10411697 Ga0207659_104116972 106
947 3300025929 Ga0207664_10592174 Ga0207664_105921742 106
948 3300025931 Ga0207644_10000017 Ga0207644_10000017125 106
949 3300025931 Ga0207644_10035625 Ga0207644_100356255 106
950 3300025931 Ga0207644_10103807 Ga0207644_101038073 106
951 3300025932 Ga0207690_10319063 Ga0207690_103190633 106
952 3300025932 Ga0207690_11689146 Ga0207690_116891461 106
953 3300025933 Ga0207706_10018915 Ga0207706_100189159 106
954 3300025937 Ga0207669_10012728 Ga0207669_100127283 106
955 3300025940 Ga0207691_10017921 Ga0207691_1001792113 106
956 3300025940 Ga0207691_10154274 Ga0207691_101542743 106
957 3300025941 Ga0207711_10000187 Ga0207711_1000018758 106
958 3300025941 Ga0207711_10502944 Ga0207711_105029442 106
959 3300025941 Ga0207711_10716462 Ga0207711_107164622 106
960 3300025942 Ga0207689_10288547 Ga0207689_102885472 106
961 3300025945 Ga0207679_10141657 Ga0207679_101416572 106
962 3300025960 Ga0207651_10061277 Ga0207651_100612773 106
963 3300025961 Ga0207712_10028639 Ga0207712_100286395 106
964 3300025961 Ga0207712_10063646 Ga0207712_100636462 106
965 3300025961 Ga0207712_10259357 Ga0207712_102593572 106
966 3300025972 Ga0207668_10001639 Ga0207668_100016393 106
967 3300025972 Ga0207668_10097003 Ga0207668_100970031 106
968 3300025986 Ga0207658_10009479 Ga0207658_1000947914 106
969 3300025986 Ga0207658_10130025 Ga0207658_101300254 106
970 3300025986 Ga0207658_10195774 Ga0207658_101957743 106
971 3300026023 Ga0207677_10173486 Ga0207677_101734863 106
972 3300026035 Ga0207703_10001977 Ga0207703_1000197726 106
973 3300026067 Ga0207678_10081076 Ga0207678_100810764 106
974 3300026067 Ga0207678_10368645 Ga0207678_103686452 106
975 3300026075 Ga0207708_11724839 Ga0207708_117248392 106
976 3300026088 Ga0207641_10001914 Ga0207641_1000191429 106
977 3300026088 Ga0207641_10002919 Ga0207641_1000291915 106
978 3300026088 Ga0207641_10383474 Ga0207641_103834743 106
979 3300026095 Ga0207676_10000887 Ga0207676_1000088712 106
980 3300026095 Ga0207676_10004014 Ga0207676_1000401419 106
981 3300026095 Ga0207676_10136112 Ga0207676_101361122 106
982 3300026116 Ga0207674_10374507 Ga0207674_103745072 106
983 3300026118 Ga0207675_100000221 Ga0207675_10000022134 106
984 3300026118 Ga0207675_100097949 Ga0207675_1000979494 106
985 3300026118 Ga0207675_100564088 Ga0207675_1005640882 106
986 3300026121 Ga0207683_10056958 Ga0207683_100569582 106
987 3300026121 Ga0207683_11333115 Ga0207683_113331152 106
988 3300028379 Ga0268266_10039920 Ga0268266_100399202 106
989 3300028379 Ga0268266_10175097 Ga0268266_101750973 106
990 3300028379 Ga0268266_11870774 Ga0268266_118707742 106
991 3300028380 Ga0268265_10011465 Ga0268265_100114654 106
992 3300028380 Ga0268265_11032239 Ga0268265_110322391 106
993 3300028380 Ga0268265_11922987 Ga0268265_119229871 106
994 3300028381 Ga0268264_10012633 Ga0268264_100126337 106
995 3300030736 Ga0316180_1068718 Ga0316180_10687183 106
996 3300031456 Ga0307513_10044306 Ga0307513_100443065 106
997 3300031731 Ga0307405_11048792 Ga0307405_110487921 106
998 3300031824 Ga0307413_10486341 Ga0307413_104863412 106
999 3300031824 Ga0307413_12053999 Ga0307413_120539991 106
1000 3300031852 Ga0307410_10380325 Ga0307410_103803252 106
1001 3300031901 Ga0307406_10629288 Ga0307406_106292882 106
1002 3300031901 Ga0307406_11587672 Ga0307406_115876722 106
1003 3300031903 Ga0307407_10272175 Ga0307407_102721753 106
1004 3300031911 Ga0307412_10505142 Ga0307412_105051422 106
1005 3300031911 Ga0307412_11985012 Ga0307412_119850122 106
1006 3300031995 Ga0307409_102415976 Ga0307409_1024159761 106
1007 3300032002 Ga0307416_101747416 Ga0307416_1017474162 106
1008 3300032005 Ga0307411_10807471 Ga0307411_108074712 106
1009 3300032126 Ga0307415_100394269 Ga0307415_1003942692 106
1010 3300032126 Ga0307415_101208521 Ga0307415_1012085212 106
1011 3300035088 Ga0373940_0155251 Ga0373940_0155251_150_470 106
1012 3300035117 Ga0373953_0113089 Ga0373953_0113089_696_1016 106
1013 3300035118 Ga0373954_0089363 Ga0373954_0089363_366_686 106
1014 3300035119 Ga0373956_0024664 Ga0373956_0024664_1105_1425 106
1015 3300035120 Ga0373957_0027492 Ga0373957_0027492_1185_1505 106
1016 3300035172 Ga0373955_0008414 Ga0373955_0008414_841_1161 106
1017 3300035724 Ga0373933_0056561 Ga0373933_0056561_1615_1935 106
1018 3300036401 Ga0373937_0004874 Ga0373937_0004874_2354_2674 106
1019 3300037418 Ga0395900_0107296 Ga0395900_0107296_2321_2641 106
1020 3300037418 Ga0395900_0921487 Ga0395900_0921487_257_577 106
1021 3300037466 Ga0395898_1637197 Ga0395898_1637197_83_403 106
1022 3300037471 Ga0395905_0155152 Ga0395905_0155152_1436_1756 106
1023 3300037471 Ga0395905_0352456 Ga0395905_0352456_448_768 106
1024 3300038443 Ga0395901_0997622 Ga0395901_0997622_17_337 106
1025 3300039450 Ga0436363_0358357 Ga0436363_0358357_167_487 106
1026 3300044683 Ga0466965_0309790 Ga0466965_0309790_165_485 106
1027 3300044694 Ga0466963_0026446 Ga0466963_0026446_927_1247 106
1028 3300044842 Ga0466957_0015092 Ga0466957_0015092_2357_2677 106
1029 3300044901 Ga0466960_0455960 Ga0466960_0455960_80_400 106
1030 3300045976 Ga0466967_0070609 Ga0466967_0070609_1885_2205 106
1031 3300046525 Ga0495663_0113344 Ga0495663_0113344_354_674 106
1032 3300046537 Ga0495598_0189653 Ga0495598_0189653_127_447 106
1033 3300046538 Ga0495609_0463555 Ga0495609_0463555_137_457 106
1034 3300046539 Ga0495621_0083657 Ga0495621_0083657_299_619 106
1035 3300046558 Ga0495633_0032405 Ga0495633_0032405_275_595 106
1036 3300046684 Ga0495669_0043715 Ga0495669_0043715_1612_1932 106
1037 3300047445 Ga0495677_0039987 Ga0495677_0039987_411_731 106
1038 3300048088 Ga0495602_0018419 Ga0495602_0018419_2069_2389 106
1039 3300048905 Ga0496102_0299968 Ga0496102_0299968_341_667 106
1040 3300048908 Ga0496105_0299993 Ga0496105_0299993_516_842 106
1041 3300048910 Ga0496107_0194813 Ga0496107_0194813_100_420 106
1042 3300048911 Ga0496108_0008106 Ga0496108_0008106_463_783 106
1043 3300049531 Ga0501315_068769 Ga0501315_068769_217_537 106
1044 3300049538 Ga0501322_012811 Ga0501322_012811_100_420 106
1045 3300049576 Ga0501040_0908845 Ga0501040_0908845_82_402 106
1046 3300050511 nmdc:mga08y16_134827_c1 nmdc:mga08y16_134827_c1_1184_1504 106
1047 3300053087 Ga0500643_065741 Ga0500643_065741_397_717 106
1048 3300053087 Ga0500643_065742 Ga0500643_065742_397_717 106
1049 3300053087 Ga0500643_217418 Ga0500643_217418_54_374 106
1050 3300053153 Ga0500616_0211652 Ga0500616_0211652_72_392 106
1051 3300059607 Ga0587125_054900 Ga0587125_054900_119_439 106
1052 3300059645 Ga0587076_042893 Ga0587076_042893_179_499 106
1053 3300059647 Ga0587079_104329 Ga0587079_104329_169_489 106
1054 3300059652 Ga0587107_056217 Ga0587107_056217_60_380 106
1055 3300001990 JGI24737J22298_10142305 JGI24737J22298_101423052 107
1056 3300002239 JGI24034J26672_10009328 JGI24034J26672_100093283 107
1057 3300005293 Ga0065715_10446466 Ga0065715_104464662 107
1058 3300005327 Ga0070658_10026506 Ga0070658_100265066 107
1059 3300005327 Ga0070658_10747047 Ga0070658_107470472 107
1060 3300005331 Ga0070670_100214326 Ga0070670_1002143262 107
1061 3300005331 Ga0070670_100714672 Ga0070670_1007146722 107
1062 3300005337 Ga0070682_102089921 Ga0070682_1020899212 107
1063 3300005339 Ga0070660_100307521 Ga0070660_1003075212 107
1064 3300005344 Ga0070661_100041801 Ga0070661_1000418013 107
1065 3300005344 Ga0070661_101572159 Ga0070661_1015721592 107
1066 3300005347 Ga0070668_100000831 Ga0070668_1000008315 107
1067 3300005347 Ga0070668_101096050 Ga0070668_1010960501 107
1068 3300005353 Ga0070669_101999198 Ga0070669_1019991981 107
1069 3300005355 Ga0070671_100075015 Ga0070671_1000750154 107
1070 3300005455 Ga0070663_100063578 Ga0070663_1000635782 107
1071 3300005457 Ga0070662_100163343 Ga0070662_1001633433 107
1072 3300005457 Ga0070662_100496502 Ga0070662_1004965022 107
1073 3300005545 Ga0070695_101717119 Ga0070695_1017171191 107
1074 3300005564 Ga0070664_100919590 Ga0070664_1009195902 107
1075 3300005564 Ga0070664_100944155 Ga0070664_1009441552 107
1076 3300005578 Ga0068854_101826752 Ga0068854_1018267522 107
1077 3300005616 Ga0068852_100446513 Ga0068852_1004465132 107
1078 3300005617 Ga0068859_100355516 Ga0068859_1003555162 107
1079 3300005841 Ga0068863_100000017 Ga0068863_100000017219 107
1080 3300005842 Ga0068858_100363754 Ga0068858_1003637542 107
1081 3300005843 Ga0068860_100059055 Ga0068860_1000590552 107
1082 3300005844 Ga0068862_100517794 Ga0068862_1005177942 107
1083 3300005844 Ga0068862_100740357 Ga0068862_1007403572 107
1084 3300006931 Ga0097620_100355530 Ga0097620_1003555303 107
1085 3300009147 Ga0114129_12365235 Ga0114129_123652352 107
1086 3300009177 Ga0105248_11346039 Ga0105248_113460392 107
1087 3300009551 Ga0105238_11405512 Ga0105238_114055122 107
1088 3300009553 Ga0105249_10198131 Ga0105249_101981312 107
1089 3300013104 Ga0157370_11208062 Ga0157370_112080622 107
1090 3300013296 Ga0157374_10010551 Ga0157374_1001055114 107
1091 3300013296 Ga0157374_10645116 Ga0157374_106451162 107
1092 3300014326 Ga0157380_12435952 Ga0157380_124359522 107
1093 3300017792 Ga0163161_10342924 Ga0163161_103429242 107
1094 3300025290 Ga0207673_1052737 Ga0207673_10527372 107
1095 3300025904 Ga0207647_10387483 Ga0207647_103874832 107
1096 3300025909 Ga0207705_10043522 Ga0207705_100435225 107
1097 3300025919 Ga0207657_10051890 Ga0207657_100518905 107
1098 3300025920 Ga0207649_10568364 Ga0207649_105683642 107
1099 3300025923 Ga0207681_10896977 Ga0207681_108969772 107
1100 3300025925 Ga0207650_10590891 Ga0207650_105908912 107
1101 3300025925 Ga0207650_10601662 Ga0207650_106016622 107
1102 3300025931 Ga0207644_10000145 Ga0207644_1000014538 107
1103 3300025933 Ga0207706_10667366 Ga0207706_106673662 107
1104 3300025933 Ga0207706_11243318 Ga0207706_112433182 107
1105 3300025933 Ga0207706_11564719 Ga0207706_115647192 107
1106 3300025937 Ga0207669_10819468 Ga0207669_108194682 107
1107 3300025940 Ga0207691_10597300 Ga0207691_105973002 107
1108 3300025941 Ga0207711_11890537 Ga0207711_118905372 107
1109 3300025945 Ga0207679_10637693 Ga0207679_106376932 107
1110 3300025945 Ga0207679_10732276 Ga0207679_107322762 107
1111 3300025960 Ga0207651_11385965 Ga0207651_113859651 107
1112 3300025961 Ga0207712_10106755 Ga0207712_101067553 107
1113 3300025972 Ga0207668_10000113 Ga0207668_1000011319 107
1114 3300025972 Ga0207668_10384373 Ga0207668_103843733 107
1115 3300026067 Ga0207678_10086490 Ga0207678_100864905 107
1116 3300026088 Ga0207641_10000036 Ga0207641_10000036214 107
1117 3300028380 Ga0268265_10430560 Ga0268265_104305602 107
1118 3300028381 Ga0268264_10005218 Ga0268264_100052188 107
1119 3300031548 Ga0307408_101461325 Ga0307408_1014613252 107
1120 3300031548 Ga0307408_101902476 Ga0307408_1019024762 107
1121 3300031548 Ga0307408_101945598 Ga0307408_1019455982 107
1122 3300031731 Ga0307405_10115978 Ga0307405_101159783 107
1123 3300031731 Ga0307405_10163033 Ga0307405_101630332 107
1124 3300031731 Ga0307405_10196596 Ga0307405_101965962 107
1125 3300031731 Ga0307405_11731923 Ga0307405_117319232 107
1126 3300031824 Ga0307413_10030876 Ga0307413_100308765 107
1127 3300031824 Ga0307413_10195307 Ga0307413_101953072 107
1128 3300031824 Ga0307413_11042587 Ga0307413_110425872 107
1129 3300031852 Ga0307410_10004670 Ga0307410_100046709 107
1130 3300031852 Ga0307410_10039465 Ga0307410_100394654 107
1131 3300031852 Ga0307410_11530911 Ga0307410_115309112 107
1132 3300031901 Ga0307406_10074475 Ga0307406_100744754 107
1133 3300031901 Ga0307406_10867521 Ga0307406_108675212 107
1134 3300031903 Ga0307407_10074906 Ga0307407_100749063 107
1135 3300031903 Ga0307407_10150545 Ga0307407_101505453 107
1136 3300031911 Ga0307412_10077051 Ga0307412_100770512 107
1137 3300031911 Ga0307412_10800071 Ga0307412_108000712 107
1138 3300031995 Ga0307409_100071909 Ga0307409_1000719094 107
1139 3300031995 Ga0307409_100127526 Ga0307409_1001275262 107
1140 3300031995 Ga0307409_100136560 Ga0307409_1001365602 107
1141 3300032002 Ga0307416_100030267 Ga0307416_1000302675 107
1142 3300032002 Ga0307416_103475503 Ga0307416_1034755032 107
1143 3300032004 Ga0307414_10033711 Ga0307414_100337114 107
1144 3300032004 Ga0307414_10075940 Ga0307414_100759401 107
1145 3300032004 Ga0307414_11075915 Ga0307414_110759152 107
1146 3300032005 Ga0307411_10034694 Ga0307411_100346943 107
1147 3300032005 Ga0307411_10051008 Ga0307411_100510085 107
1148 3300032126 Ga0307415_100154075 Ga0307415_1001540753 107
1149 3300032126 Ga0307415_100329418 Ga0307415_1003294182 107
1150 3300032126 Ga0307415_101265530 Ga0307415_1012655301 107
1151 3300032126 Ga0307415_101829157 Ga0307415_1018291572 107
1152 3300037471 Ga0395905_0597559 Ga0395905_0597559_626_949 107
1153 3300042004 Ga0439445_0003060 Ga0439445_0003060_446_769 107
1154 3300044684 Ga0466966_0000003 Ga0466966_0000003_3967_4290 107
1155 3300044765 Ga0466970_0422565 Ga0466970_0422565_261_584 107
1156 3300044901 Ga0466960_0147435 Ga0466960_0147435_424_747 107
1157 3300046491 Ga0495584_0595530 Ga0495584_0595530_50_373 107
1158 3300046492 Ga0495585_0124421 Ga0495585_0124421_222_545 107
1159 3300046515 Ga0495620_0052278 Ga0495620_0052278_1233_1556 107
1160 3300046664 Ga0495659_0221508 Ga0495659_0221508_150_473 107
1161 3300046684 Ga0495669_0088257 Ga0495669_0088257_945_1268 107
1162 3300046691 Ga0495670_0147361 Ga0495670_0147361_243_566 107
1163 3300049161 Ga0501305_064900 Ga0501305_064900_70_396 107
1164 3300049582 Ga0501048_1264682 Ga0501048_1264682_97_420 107
1165 3300059630 Ga0587128_013345 Ga0587128_013345_442_765 107
1166 3300059630 Ga0587128_046280 Ga0587128_046280_418_741 107
1167 2162886007 SwRhRL2b_contig_1707570 SwRhRL2b_0876.00001890 108
1168 3300025711 Ga0207696_1051971 Ga0207696_10519712 108
1169 3300031548 Ga0307408_102466309 Ga0307408_1024663092 108
1170 3300031852 Ga0307410_10314938 Ga0307410_103149382 108
1171 3300031901 Ga0307406_10389877 Ga0307406_103898772 108
1172 3300031903 Ga0307407_10628125 Ga0307407_106281252 108
1173 3300032002 Ga0307416_100877262 Ga0307416_1008772622 108
1174 3300032004 Ga0307414_10094751 Ga0307414_100947513 108
1175 3300041509 Ga0451843_0138888 Ga0451843_0138888_40_366 108

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00276

Ribosomal_L23

Ribosomal protein L23

19

104

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
8cgd-assembly1.cif.gz_s clindamycin bound to the 50s subunit 0.9284 14 95
8cvm-assembly1.cif.gz_s cutibacterium acnes 50s ribosomal subunit with p-site trna and sarecycline bound in the local refined map 0.9223 15 102
7m4z-assembly1.cif.gz_S a. baumannii ribosome-eravacycline complex: hpf-bound 70s 0.9213 14 99
6spb-assembly1.cif.gz_T pseudomonas aeruginosa 50s ribosome from a clinical isolate with a mutation in ul6 0.9205 13 101
6enj-assembly1.cif.gz_T polyproline-stalled ribosome in the presence of a+p site trna and elongation-factor p (ef-p) 0.9138 11 100
ID Description Score Start End Superfamily
6fu8C00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.8947 14 100 3.30.70.330
6hmaR00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.8923 15 101 3.30.70.330
4garT00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.8892 12 100 3.30.70.330
af_P54016_1_86_3.30.70.330 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.8667 15 99 3.30.70.330
6hmaR00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.8554 15 101 3.30.70.330
ID Description Score Start End GO Terms
AF-A0A0G0GSI5-F1-model_v4 Large ribosomal subunit protein uL23 0.9494 15 102 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A2E1VV25-F1-model_v4 Large ribosomal subunit protein uL23 0.9434 15 101 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A1G2LBI1-F1-model_v4 Large ribosomal subunit protein uL23 0.9434 18 102 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A1V6G130-F1-model_v4 deleted 0.9433 15 102
AF-A0A1U7NLE2-F1-model_v4 Large ribosomal subunit protein uL23 0.9423 15 102 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904

Feature Viewer

pLDDT pTM Quality
79.58 0.68 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map