F491070

General Info

Members Datasets Scaffolds Average Seq Length
1165 524 1073 391

Family's Representative Sequence

Representative Sequence 3300044666|Ga0466977_0002241|Ga0466977_0002241_846_2138
Length 430
Sequence MQVNVGGERCEMREFRRRDFLTFAAGLGAAWLTPLRAMAAARDLSGTLPGTPGAGMAQAGGNYGNLLILIELKGGNDGLNTVIPYGDSLYASLRPNIGIKREKVIQLDGHSGLHPELGALMPMWQAKELAIVQGVGYPQPNLSHFRSIEIWNTASRADEYLRDGWLSRAFAEHAVPAGFDADGVIVGSAELGPLAGGARAVTLTNPAQFLRDAGLASANAAQVSNPALAHVLRVENDIVKAADGLRPRQGQYVLKTSMPSGAFGNVVKTALQVVAAADSSMGVPQPGRGVAVLRLTLNGFDTHQNQPGQQANLLRQLAQGMMALRAGLTELGRWQSTMIVTYAEFGRRPRENQSNGTDHGTVAPHFIAGGRVRGGLYGEVPRLDRLDGNGNLPFAVDFRDVYATVLQRWWGMSAQPVLGGAFQPLDVLRA

Samples

Sample ID Description Type Environment
1 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
2 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
3 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
4 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
5 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
6 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
7 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
8 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
9 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
10 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
11 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
12 2519103095 Burkholderia sp. KJ006 Isolate Nodule
13 2547132103 Chromobacterium sp. C-61 Isolate Rhizosphere
14 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
15 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
16 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
17 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
18 2596583598 Ralstonia sp. UNCCL144 Isolate Unclassified
19 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
20 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
21 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
22 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
23 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
24 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
25 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
26 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
27 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
28 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
29 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
30 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
31 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
32 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
33 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
34 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
35 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
36 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
37 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
38 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
39 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
40 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
41 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
42 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
43 2818991450 Burkholderia sp. 604 Isolate Unclassified
44 2818991452 Burkholderia cepacia 561 Isolate Unclassified
45 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
46 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
47 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
48 2843690924 Chromobacterium rhizoryzae JP2-74 Isolate Rhizosphere
49 2846033681 Chromobacterium sinusclupearum MWU13-2610 Isolate Rhizosphere
50 2846037992 Chromobacterium alticapitis MWU14-2602 Isolate Rhizosphere
51 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
52 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
53 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
54 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
55 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
56 2885266251 Ralstonia sp. SET104 Isolate Nodule
57 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
58 2900577576 Ralstonia sp. TCR112 Isolate Rhizosphere
59 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
60 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
61 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
62 2904564687 Burkholderia sp. 571 Isolate Unclassified
63 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
64 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
65 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
66 2928058823 Ralstonia sp. 1138 Isolate Unclassified
67 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
68 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
69 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
70 2928163908 Burkholderia sp. 567 Isolate Unclassified
71 2928170801 Burkholderia sp. 572 Isolate Unclassified
72 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
73 2928536128 Burkholderia sola 565 Isolate Unclassified
74 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
75 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
76 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
77 2998344455 Vogesella urethralis SLBN-145 Isolate Rhizosphere
78 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
79 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
80 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
81 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
82 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
83 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
84 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
85 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
86 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
87 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
88 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
89 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
90 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
91 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
92 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
93 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
94 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
95 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
96 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
97 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
98 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
99 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
100 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
101 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
102 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
103 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
104 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
105 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
106 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
107 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
108 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
109 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
110 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
111 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
112 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
113 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
114 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
115 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
116 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
117 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
118 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
119 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
120 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
121 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
122 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
123 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
124 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
125 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
126 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
127 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
128 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
129 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
130 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
131 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
132 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
133 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
134 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
135 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
136 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
137 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
138 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
139 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
140 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
141 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
142 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
143 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
144 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
145 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
146 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
147 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
148 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
149 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
150 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
151 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
152 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
153 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
154 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
155 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
156 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
157 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
158 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
159 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
160 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
161 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
162 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
163 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
164 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
165 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
166 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
167 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
168 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
169 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
170 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
171 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
172 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
173 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
174 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
175 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
176 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
177 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
178 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
179 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
180 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
181 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
182 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
183 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
184 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
185 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
186 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
187 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
188 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
189 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
190 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
191 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
192 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
193 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
194 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
195 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
196 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
197 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
198 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
199 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
200 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
201 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
202 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
203 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
204 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
205 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
206 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
207 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
208 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
209 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
210 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
211 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
212 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
213 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
214 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
215 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
216 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
217 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
218 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
219 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
220 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
221 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
222 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
223 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
224 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
225 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
226 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
227 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
228 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
229 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
230 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
231 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
232 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
233 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
234 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
235 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
236 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
237 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
238 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
239 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
240 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
241 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
242 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
243 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
244 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
245 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
246 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
247 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
248 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
249 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
250 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
251 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
264 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
265 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
266 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
267 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
268 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
269 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
270 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
271 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
272 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
273 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
274 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
275 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
276 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
277 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
278 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
279 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
280 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
281 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
282 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
283 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
284 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
285 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
286 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
287 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
288 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
289 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
290 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
291 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
292 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
293 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
294 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
295 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
296 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
297 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
298 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
299 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
300 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
301 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
302 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
303 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
304 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
305 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
306 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
307 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
308 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
309 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
310 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
311 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
312 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
313 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
314 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
315 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
316 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
317 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
318 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
319 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
320 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
321 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
322 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
323 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
324 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
325 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
326 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
327 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
328 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
329 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
330 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
331 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
332 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
333 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
334 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
335 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
336 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
337 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
338 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
339 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
340 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
341 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
342 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
343 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
344 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
345 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
346 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
347 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
348 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
349 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
350 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
351 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
352 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
353 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
354 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
355 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
356 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
357 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
358 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
359 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
360 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
361 3300044666 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E Metagenome Unclassified
362 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
363 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
364 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
365 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
366 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
367 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
368 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
369 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
370 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
371 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
372 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
373 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
374 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
375 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
376 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
377 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
378 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
379 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
380 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
381 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
382 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
383 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
384 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
385 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
386 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
387 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
388 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
389 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
390 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
391 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
392 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
393 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
394 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
395 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
396 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
397 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
398 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
399 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
400 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
401 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
402 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
403 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
404 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
405 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
406 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
407 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
408 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
409 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
410 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
411 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
412 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
413 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
414 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
415 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
416 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
417 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
418 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
419 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
420 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
421 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
422 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
423 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
424 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
425 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
426 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
427 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
428 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
429 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
430 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
431 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
432 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
433 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
434 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
435 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
436 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
437 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
438 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
439 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
440 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
441 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
442 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
443 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
444 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
445 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
446 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
447 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
448 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
449 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
450 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
451 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
452 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
453 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
454 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
455 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
456 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
457 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
458 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
459 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
460 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
461 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
462 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
463 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
464 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
465 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
466 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
467 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
468 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
469 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
470 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
471 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
472 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
473 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
474 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
475 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
476 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
477 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
478 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
479 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
480 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
481 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
482 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
483 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
484 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
485 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
486 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
487 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
488 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
489 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
490 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
491 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
492 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
493 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
494 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
495 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
496 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
497 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
498 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
499 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
500 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
501 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
502 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
503 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
504 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
505 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
506 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
507 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
508 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
509 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
510 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
511 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
512 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
513 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
514 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
515 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
516 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
517 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
518 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
519 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
520 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
521 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified
522 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
523 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere
524 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 91.33
Metatranscriptomes 0.77
Isolates 7.9

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.67
Nodule 1.12
Rhizoplane 2.32
Rhizosphere 80.43
Stem 0
Stem Tuber 0
Unclassified 7.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1001377 3300001915 Bacteria 7019
2 JGI24740J21852_10000041 3300001979 Bacteria 42020
3 JGI24740J21852_10001633 3300001979 Bacteria 10334
4 JGI24740J21852_10003377 3300001979 Bacteria 7034
5 JGI24739J22299_10017073 3300001989 Bacteria 2623
6 JGI24735J21928_10001866 3300002067 Bacteria 7386
7 JGI25156J39149_1000677 3300002705 Bacteria 18399
8 JGI25156J39149_1000900 3300002705 Bacteria 14593
9 JGI25156J39149_1001501 3300002705 Bacteria 9730
10 JGI25156J39149_1001536 3300002705 Bacteria 9555
11 JGI25156J39149_1006506 3300002705 Bacteria 3181
12 JGI25156J39149_1016919 3300002705 Bacteria 1400
13 JGI25154J39366_1001382 3300002738 Bacteria 8794
14 JGI25152J39213_1001685 3300002773 Bacteria 9118
15 JGI25165J46597_1001137 3300003214 Bacteria 16691
16 JGI25153J46596_10001268 3300003215 Bacteria 15174
17 JGI25153J46596_10002290 3300003215 Bacteria 11152
18 rootL2_10018167 3300003322 Bacteria 13420
19 rootH1_10226436 3300003323 Bacteria 1956
20 Ga0006562J51391_1035624 3300003578 Bacteria 3811
21 Ga0055539_1000062 3300003752 Bacteria 141171
22 Ga0055533_1000298 3300003756 Bacteria 24982
23 Ga0055532_1000019 3300003758 Bacteria 286358
24 Ga0055532_1000027 3300003758 Bacteria 234571
25 Ga0055532_1001399 3300003758 Bacteria 6800
26 Ga0055532_1002138 3300003758 Bacteria 4438
27 Ga0055532_1002139 3300003758 Bacteria 4434
28 Ga0055525_1000275 3300003759 Bacteria 47849
29 Ga0055527_1000019 3300003760 Bacteria 234571
30 Ga0055527_1000441 3300003760 Bacteria 16512
31 Ga0055527_1000442 3300003760 Bacteria 16463
32 Ga0055535_1000014 3300003761 Bacteria 286358
33 Ga0055535_1000021 3300003761 Bacteria 234571
34 Ga0055535_1001096 3300003761 Bacteria 16512
35 Ga0055535_1001098 3300003761 Bacteria 16463
36 Ga0055542_1000032 3300003762 Bacteria 234571
37 Ga0055542_1000588 3300003762 Bacteria 31406
38 Ga0055542_1001083 3300003762 Bacteria 16608
39 Ga0055542_1002409 3300003762 Bacteria 6267
40 Ga0055529_1000038 3300003763 Bacteria 234571
41 Ga0055529_1000086 3300003763 Bacteria 140681
42 Ga0055529_1000760 3300003763 Bacteria 20474
43 Ga0055529_1001446 3300003763 Bacteria 7359
44 Ga0055526_1002527 3300003771 Bacteria 12293
45 Ga0055528_1002190 3300003790 Bacteria 10681
46 Ga0055541_1001023 3300003841 Bacteria 6516
47 Ga0065165_1000829 3300005262 Bacteria 40716
48 Ga0065712_10099942 3300005290 Bacteria 2076
49 Ga0070658_10118446 3300005327 Bacteria 2199
50 Ga0070676_10000517 3300005328 Bacteria 18519
51 Ga0070676_10008643 3300005328 Bacteria 5491
52 Ga0070676_10054997 3300005328 Bacteria 2348
53 Ga0070676_10063854 3300005328 Bacteria 2194
54 Ga0070683_100013357 3300005329 Bacteria 7159
55 Ga0070683_100135607 3300005329 Bacteria 2331
56 Ga0070690_100005993 3300005330 Bacteria 6866
57 Ga0070670_100000840 3300005331 Bacteria 24010
58 Ga0070670_100015610 3300005331 Bacteria 6523
59 Ga0070670_100024603 3300005331 Bacteria 5177
60 Ga0070670_100038658 3300005331 Bacteria 4103
61 Ga0070670_100092546 3300005331 Bacteria 2600
62 Ga0070670_100107140 3300005331 Bacteria 2409
63 Ga0070670_100180946 3300005331 Bacteria 1830
64 Ga0070677_10000841 3300005333 Bacteria 10080
65 Ga0070677_10065814 3300005333 Bacteria 1509
66 Ga0068869_100000025 3300005334 Bacteria 63244
67 Ga0068869_100007817 3300005334 Bacteria 6859
68 Ga0068869_100095891 3300005334 Bacteria 2238
69 Ga0070666_10002729 3300005335 Bacteria 10669
70 Ga0070666_10005405 3300005335 Bacteria 7833
71 Ga0070666_10025275 3300005335 Bacteria 3871
72 Ga0070666_10027493 3300005335 Bacteria 3726
73 Ga0070666_10138860 3300005335 Bacteria 1692
74 Ga0070680_100007268 3300005336 Bacteria 8440
75 Ga0070680_100040619 3300005336 Bacteria 3768
76 Ga0070680_100133441 3300005336 Bacteria 2078
77 Ga0070682_100034227 3300005337 Bacteria 3093
78 Ga0068868_100000153 3300005338 Bacteria 44713
79 Ga0068868_100002041 3300005338 Bacteria 13886
80 Ga0068868_100008699 3300005338 Bacteria 7268
81 Ga0068868_100009198 3300005338 Bacteria 7097
82 Ga0068868_100022097 3300005338 Bacteria 4798
83 Ga0068868_100037804 3300005338 Bacteria 3743
84 Ga0068868_100115667 3300005338 Bacteria 2183
85 Ga0070660_100004671 3300005339 Bacteria 9483
86 Ga0070660_100046894 3300005339 Bacteria 3313
87 Ga0070660_100123773 3300005339 Bacteria 2065
88 Ga0070689_100006420 3300005340 Bacteria 8135
89 Ga0070689_100027641 3300005340 Bacteria 4277
90 Ga0070689_100078786 3300005340 Bacteria 2584
91 Ga0070661_100001754 3300005344 Bacteria 15059
92 Ga0070661_100047283 3300005344 Bacteria 3148
93 Ga0070692_10048567 3300005345 Bacteria 2199
94 Ga0070668_100000763 3300005347 Bacteria 22121
95 Ga0070668_100009626 3300005347 Bacteria 7170
96 Ga0070668_100011534 3300005347 Bacteria 6580
97 Ga0070668_100017984 3300005347 Bacteria 5303
98 Ga0070668_100023012 3300005347 Bacteria 4710
99 Ga0070668_100048882 3300005347 Bacteria 3254
100 Ga0070668_100084772 3300005347 Bacteria 2489
101 Ga0070669_100004694 3300005353 Bacteria 9859
102 Ga0070669_100015312 3300005353 Bacteria 5465
103 Ga0070669_100021478 3300005353 Bacteria 4613
104 Ga0070675_100000357 3300005354 Bacteria 30861
105 Ga0070675_100002259 3300005354 Bacteria 14291
106 Ga0070675_100005570 3300005354 Bacteria 9643
107 Ga0070675_100008181 3300005354 Bacteria 8109
108 Ga0070675_100011653 3300005354 Bacteria 6889
109 Ga0070675_100019086 3300005354 Bacteria 5462
110 Ga0070675_100039654 3300005354 Bacteria 3844
111 Ga0070675_100141069 3300005354 Bacteria 2060
112 Ga0070671_100000242 3300005355 Bacteria 36618
113 Ga0070671_100005263 3300005355 Bacteria 10313
114 Ga0070671_100066085 3300005355 Bacteria 3014
115 Ga0070671_100074165 3300005355 Bacteria 2843
116 Ga0070671_100132812 3300005355 Unclassified 2097
117 Ga0070674_100002343 3300005356 Bacteria 10458
118 Ga0070674_100005385 3300005356 Bacteria 7384
119 Ga0070674_100081328 3300005356 Bacteria 2315
120 Ga0070673_100000155 3300005364 Bacteria 32921
121 Ga0070673_100000997 3300005364 Bacteria 16060
122 Ga0070673_100004058 3300005364 Bacteria 9221
123 Ga0070673_100004637 3300005364 Bacteria 8719
124 Ga0070673_100034126 3300005364 Bacteria 3847
125 Ga0070673_100078877 3300005364 Bacteria 2665
126 Ga0070688_100086381 3300005365 Bacteria 2041
127 Ga0070688_100169609 3300005365 Bacteria 1505
128 Ga0070659_100000788 3300005366 Bacteria 23095
129 Ga0070659_100109791 3300005366 Bacteria 2226
130 Ga0070667_100002552 3300005367 Bacteria 15831
131 Ga0070667_100004152 3300005367 Bacteria 12244
132 Ga0070667_100041401 3300005367 Bacteria 3865
133 Ga0070667_100053864 3300005367 Bacteria 3396
134 Ga0070667_100053934 3300005367 Bacteria 3394
135 Ga0070667_100081705 3300005367 Bacteria 2766
136 Ga0070667_100150545 3300005367 Bacteria 2044
137 Ga0070667_100195952 3300005367 Bacteria 1791
138 Ga0070709_10007675 3300005434 Bacteria 5920
139 Ga0070709_10077189 3300005434 Bacteria 2165
140 Ga0070714_100010609 3300005435 Bacteria 7289
141 Ga0070714_100024800 3300005435 Bacteria 4942
142 Ga0070714_100036123 3300005435 Bacteria 4143
143 Ga0070713_100009983 3300005436 Bacteria 6839
144 Ga0070713_100042999 3300005436 Bacteria 3691
145 Ga0070713_100117360 3300005436 Bacteria 2329
146 Ga0070710_10107654 3300005437 Bacteria 1670
147 Ga0070701_10005036 3300005438 Bacteria 5421
148 Ga0070701_10032399 3300005438 Bacteria 2602
149 Ga0070711_100007315 3300005439 Bacteria 6715
150 Ga0070705_100003147 3300005440 Bacteria 8109
151 Ga0070705_100014218 3300005440 Bacteria 4091
152 Ga0070700_100071165 3300005441 Bacteria 2220
153 Ga0070700_100198029 3300005441 Bacteria 1409
154 Ga0070694_100228576 3300005444 Bacteria 1398
155 Ga0070708_100000284 3300005445 Bacteria 38024
156 Ga0070663_100000010 3300005455 Bacteria 158193
157 Ga0070663_100002261 3300005455 Bacteria 10789
158 Ga0070663_100008366 3300005455 Bacteria 6358
159 Ga0070678_100000156 3300005456 Bacteria 28407
160 Ga0070678_100000721 3300005456 Bacteria 16413
161 Ga0070678_100010063 3300005456 Bacteria 5757
162 Ga0070678_100013459 3300005456 Bacteria 5130
163 Ga0070678_100035520 3300005456 Bacteria 3481
164 Ga0070678_100063975 3300005456 Bacteria 2724
165 Ga0070678_100136429 3300005456 Bacteria 1957
166 Ga0070678_100257934 3300005456 Bacteria 1465
167 Ga0070678_100302911 3300005456 Bacteria 1359
168 Ga0070662_100009809 3300005457 Bacteria 6273
169 Ga0070662_100131084 3300005457 Bacteria 1933
170 Ga0070681_10027285 3300005458 Bacteria 5741
171 Ga0070681_10041710 3300005458 Bacteria 4600
172 Ga0070681_10092472 3300005458 Bacteria 2974
173 Ga0068867_100001010 3300005459 Bacteria 19197
174 Ga0068867_100018859 3300005459 Bacteria 4908
175 Ga0068867_100030399 3300005459 Bacteria 3897
176 Ga0068867_100030899 3300005459 Bacteria 3865
177 Ga0068867_100047303 3300005459 Bacteria 3162
178 Ga0068867_100102182 3300005459 Bacteria 2191
179 Ga0068867_100117868 3300005459 Bacteria 2047
180 Ga0068867_100118672 3300005459 Bacteria 2041
181 Ga0070685_10003047 3300005466 Bacteria 8541
182 Ga0070706_100043477 3300005467 Bacteria 4152
183 Ga0070706_100122460 3300005467 Bacteria 2425
184 Ga0070707_100168969 3300005468 Bacteria 2131
185 Ga0070707_100281679 3300005468 Bacteria 1615
186 Ga0070698_100193698 3300005471 Bacteria 1970
187 Ga0070679_100044748 3300005530 Bacteria 4410
188 Ga0070679_100064660 3300005530 Bacteria 3646
189 Ga0070679_100067697 3300005530 Bacteria 3561
190 Ga0070679_100286776 3300005530 Bacteria 1598
191 Ga0070684_100007338 3300005535 Bacteria 8570
192 Ga0070684_100014717 3300005535 Bacteria 6347
193 Ga0070697_100223077 3300005536 Bacteria 1606
194 Ga0068853_100020835 3300005539 Bacteria 5455
195 Ga0068853_100129179 3300005539 Bacteria 2260
196 Ga0070672_100000308 3300005543 Bacteria 27646
197 Ga0070672_100001495 3300005543 Bacteria 14503
198 Ga0070672_100002103 3300005543 Bacteria 12560
199 Ga0070672_100007890 3300005543 Bacteria 7266
200 Ga0070672_100013893 3300005543 Bacteria 5698
201 Ga0070672_100248111 3300005543 Bacteria 1499
202 Ga0070686_100035298 3300005544 Bacteria 3087
203 Ga0070695_100005705 3300005545 Bacteria 7338
204 Ga0070695_100106808 3300005545 Bacteria 1893
205 Ga0070696_100083014 3300005546 Bacteria 2272
206 Ga0070696_100300819 3300005546 Bacteria 1229
207 Ga0070693_100000424 3300005547 Bacteria 19141
208 Ga0070693_100003163 3300005547 Bacteria 7643
209 Ga0070693_100094422 3300005547 Bacteria 1809
210 Ga0070665_100001520 3300005548 Bacteria 26875
211 Ga0070665_100008115 3300005548 Bacteria 10630
212 Ga0070665_100019940 3300005548 Bacteria 6734
213 Ga0070665_100032544 3300005548 Bacteria 5248
214 Ga0070665_100037652 3300005548 Bacteria 4863
215 Ga0070704_100001739 3300005549 Bacteria 11887
216 Ga0068855_100034213 3300005563 Bacteria 6061
217 Ga0068855_100038658 3300005563 Bacteria 5669
218 Ga0068855_100068824 3300005563 Bacteria 4120
219 Ga0068855_100090357 3300005563 Bacteria 3534
220 Ga0068855_100160233 3300005563 Bacteria 2554
221 Ga0070664_100000005 3300005564 Bacteria 222746
222 Ga0070664_100008892 3300005564 Bacteria 8136
223 Ga0070664_100039520 3300005564 Bacteria 3976
224 Ga0070664_100122182 3300005564 Bacteria 2281
225 Ga0070664_100236530 3300005564 Bacteria 1638
226 Ga0068857_100002812 3300005577 Bacteria 14320
227 Ga0068857_100030895 3300005577 Bacteria 4733
228 Ga0068854_100000032 3300005578 Bacteria 106054
229 Ga0068854_100016709 3300005578 Bacteria 4896
230 Ga0068854_100167829 3300005578 Bacteria 1705
231 Ga0068856_100000054 3300005614 Bacteria 104246
232 Ga0068856_100016214 3300005614 Bacteria 7208
233 Ga0068856_100107394 3300005614 Bacteria 2786
234 Ga0068856_100179120 3300005614 Bacteria 2132
235 Ga0068856_100272306 3300005614 Bacteria 1709
236 Ga0070702_100005859 3300005615 Bacteria 5763
237 Ga0068852_100003751 3300005616 Bacteria 10658
238 Ga0068852_100041751 3300005616 Bacteria 3879
239 Ga0068859_100000330 3300005617 Bacteria 47242
240 Ga0068859_100002028 3300005617 Bacteria 20687
241 Ga0068859_100158119 3300005617 Bacteria 2345
242 Ga0068864_100002848 3300005618 Bacteria 14291
243 Ga0068864_100004509 3300005618 Bacteria 11449
244 Ga0068864_100014723 3300005618 Bacteria 6497
245 Ga0068864_100028773 3300005618 Bacteria 4701
246 Ga0068864_100036524 3300005618 Bacteria 4188
247 Ga0068864_100207995 3300005618 Bacteria 1800
248 Ga0068864_100231116 3300005618 Bacteria 1710
249 Ga0068866_10002033 3300005718 Bacteria 8423
250 Ga0068866_10075280 3300005718 Bacteria 1797
251 Ga0068861_100002441 3300005719 Bacteria 12122
252 Ga0068861_100021101 3300005719 Bacteria 4680
253 Ga0068861_100073347 3300005719 Bacteria 2659
254 Ga0068861_100085859 3300005719 Bacteria 2473
255 Ga0068851_10003644 3300005834 Bacteria 6878
256 Ga0068851_10013511 3300005834 Bacteria 3865
257 Ga0068870_10004049 3300005840 Bacteria 6263
258 Ga0068870_10007174 3300005840 Bacteria 4960
259 Ga0068870_10169081 3300005840 Bacteria 1303
260 Ga0068863_100006649 3300005841 Bacteria 11348
261 Ga0068863_100006665 3300005841 Bacteria 11333
262 Ga0068863_100020676 3300005841 Bacteria 6287
263 Ga0068863_100021596 3300005841 Bacteria 6139
264 Ga0068863_100026668 3300005841 Bacteria 5510
265 Ga0068863_100043958 3300005841 Bacteria 4240
266 Ga0068863_100147370 3300005841 Bacteria 2251
267 Ga0068863_100261846 3300005841 Bacteria 1672
268 Ga0068858_100001129 3300005842 Bacteria 27630
269 Ga0068858_100002436 3300005842 Bacteria 18817
270 Ga0068858_100004241 3300005842 Bacteria 14105
271 Ga0068858_100013573 3300005842 Bacteria 7687
272 Ga0068858_100050954 3300005842 Bacteria 3831
273 Ga0068858_100059334 3300005842 Bacteria 3536
274 Ga0068858_100109672 3300005842 Bacteria 2577
275 Ga0068858_100154182 3300005842 Bacteria 2161
276 Ga0068860_100016141 3300005843 Bacteria 7286
277 Ga0068860_100028467 3300005843 Bacteria 5378
278 Ga0068860_100040120 3300005843 Bacteria 4476
279 Ga0068860_100040515 3300005843 Bacteria 4451
280 Ga0068860_100041401 3300005843 Bacteria 4400
281 Ga0068860_100043283 3300005843 Bacteria 4297
282 Ga0068862_100008997 3300005844 Bacteria 8266
283 Ga0068862_100009448 3300005844 Bacteria 8067
284 Ga0068862_100096986 3300005844 Bacteria 2574
285 Ga0081455_10148817 3300005937 Bacteria 1807
286 Ga0081539_10019224 3300005985 Bacteria 4687
287 Ga0070715_10054757 3300006163 Bacteria 1729
288 Ga0070712_100001901 3300006175 Bacteria 12758
289 Ga0075367_10047367 3300006178 Bacteria 2529
290 Ga0075366_10000351 3300006195 Bacteria 21079
291 Ga0075366_10005164 3300006195 Bacteria 7065
292 Ga0075366_10020757 3300006195 Bacteria 3812
293 Ga0097621_100001380 3300006237 Bacteria 16694
294 Ga0097621_100002192 3300006237 Bacteria 13371
295 Ga0097621_100022732 3300006237 Bacteria 4871
296 Ga0097621_100118010 3300006237 Bacteria 2248
297 Ga0097621_100252304 3300006237 Unclassified 1545
298 Ga0075370_10024173 3300006353 Bacteria 3354
299 Ga0068871_100000762 3300006358 Bacteria 21689
300 Ga0068871_100002787 3300006358 Bacteria 11946
301 Ga0068871_100003172 3300006358 Bacteria 11296
302 Ga0068871_100004759 3300006358 Bacteria 9487
303 Ga0068871_100105925 3300006358 Bacteria 2360
304 Ga0068871_100135613 3300006358 Bacteria 2090
305 Ga0068871_100167058 3300006358 Bacteria 1884
306 Ga0075428_100004575 3300006844 Bacteria 15296
307 Ga0075428_100021642 3300006844 Bacteria 7119
308 Ga0075430_100002756 3300006846 Bacteria 14678
309 Ga0075430_100026068 3300006846 Bacteria 4973
310 Ga0075430_100108414 3300006846 Bacteria 2317
311 Ga0075431_100026939 3300006847 Bacteria 5897
312 Ga0075431_100270310 3300006847 Bacteria 1723
313 Ga0075431_100428063 3300006847 Bacteria 1322
314 Ga0075434_100200390 3300006871 Bacteria 2016
315 Ga0075434_100317952 3300006871 Bacteria 1577
316 Ga0075429_100036154 3300006880 Bacteria 4294
317 Ga0068865_100010486 3300006881 Bacteria 5768
318 Ga0068865_100031163 3300006881 Bacteria 3554
319 Ga0068865_100060143 3300006881 Bacteria 2659
320 Ga0068865_100061945 3300006881 Bacteria 2624
321 Ga0068865_100195238 3300006881 Bacteria 1568
322 Ga0068865_100236788 3300006881 Bacteria 1435
323 Ga0075436_100044123 3300006914 Bacteria 3074
324 Ga0075436_100130813 3300006914 Bacteria 1760
325 Ga0097620_100000330 3300006931 Bacteria 47242
326 Ga0097620_100002027 3300006931 Bacteria 20687
327 Ga0097620_100158117 3300006931 Bacteria 2345
328 Ga0075435_100005722 3300007076 Bacteria 8716
329 Ga0075435_100140283 3300007076 Bacteria 2027
330 Ga0105251_10000184 3300009011 Bacteria 62889
331 Ga0105251_10054378 3300009011 Bacteria 1901
332 Ga0105240_10016312 3300009093 Bacteria 10061
333 Ga0105240_10062985 3300009093 Bacteria 4615
334 Ga0105240_10174983 3300009093 Bacteria 2538
335 Ga0111539_10000221 3300009094 Bacteria 68470
336 Ga0111539_10130663 3300009094 Unclassified 2941
337 Ga0105245_10012205 3300009098 Bacteria 7473
338 Ga0105245_10013730 3300009098 Bacteria 7054
339 Ga0105245_10101269 3300009098 Bacteria 2666
340 Ga0105247_10031263 3300009101 Bacteria 3230
341 Ga0114129_10158521 3300009147 Bacteria 3094
342 Ga0114129_10277295 3300009147 Bacteria 2241
343 Ga0105243_10160343 3300009148 Bacteria 1939
344 Ga0105243_10163091 3300009148 Bacteria 1923
345 Ga0105241_10014958 3300009174 Bacteria 5681
346 Ga0105241_10111414 3300009174 Bacteria 2191
347 Ga0105241_10152686 3300009174 Bacteria 1891
348 Ga0105242_10000549 3300009176 Bacteria 29738
349 Ga0105242_10006425 3300009176 Bacteria 9053
350 Ga0105242_10013732 3300009176 Bacteria 6270
351 Ga0105242_10055740 3300009176 Bacteria 3233
352 Ga0105242_10172660 3300009176 Bacteria 1901
353 Ga0105248_10022654 3300009177 Bacteria 6972
354 Ga0105248_10064049 3300009177 Bacteria 4127
355 Ga0105248_10064143 3300009177 Bacteria 4124
356 Ga0105248_10085491 3300009177 Bacteria 3549
357 Ga0105248_10098527 3300009177 Bacteria 3293
358 Ga0105248_10124394 3300009177 Bacteria 2909
359 Ga0105248_10154397 3300009177 Bacteria 2590
360 Ga0105248_10218733 3300009177 Bacteria 2145
361 Ga0105248_10382994 3300009177 Bacteria 1584
362 Ga0105238_10053955 3300009551 Bacteria 4039
363 Ga0105238_10058460 3300009551 Bacteria 3865
364 Ga0105238_10079380 3300009551 Bacteria 3272
365 Ga0105239_10019206 3300010375 Bacteria 7550
366 Ga0105239_10191667 3300010375 Bacteria 2288
367 Ga0157373_10001173 3300013100 Bacteria 20060
368 Ga0157373_10009351 3300013100 Bacteria 7242
369 Ga0157371_10000103 3300013102 Bacteria 128611
370 Ga0157370_10003378 3300013104 Bacteria 18757
371 Ga0157370_10007198 3300013104 Bacteria 12144
372 Ga0157370_10024558 3300013104 Bacteria 5969
373 Ga0157370_10155245 3300013104 Bacteria 2129
374 Ga0157369_10015499 3300013105 Bacteria 8589
375 Ga0157369_10019948 3300013105 Bacteria 7496
376 Ga0157369_10085923 3300013105 Bacteria 3361
377 Ga0157369_10142682 3300013105 Bacteria 2533
378 Ga0157374_10000275 3300013296 Bacteria 47712
379 Ga0157374_10000720 3300013296 Bacteria 28871
380 Ga0157374_10012528 3300013296 Bacteria 7382
381 Ga0157374_10067993 3300013296 Bacteria 3351
382 Ga0157378_10016633 3300013297 Bacteria 6443
383 Ga0157378_10024566 3300013297 Bacteria 5305
384 Ga0157378_10032204 3300013297 Bacteria 4632
385 Ga0157378_10050630 3300013297 Bacteria 3696
386 Ga0157378_10076071 3300013297 Bacteria 3024
387 Ga0163162_10003105 3300013306 Bacteria 15858
388 Ga0163162_10032832 3300013306 Bacteria 5155
389 Ga0163162_10032965 3300013306 Bacteria 5144
390 Ga0163162_10037049 3300013306 Bacteria 4864
391 Ga0163162_10082285 3300013306 Bacteria 3291
392 Ga0163162_10092453 3300013306 Bacteria 3109
393 Ga0163162_10097486 3300013306 Bacteria 3028
394 Ga0163162_10124008 3300013306 Bacteria 2689
395 Ga0163162_10134239 3300013306 Bacteria 2585
396 Ga0157372_10000151 3300013307 Bacteria 75926
397 Ga0157372_10020389 3300013307 Bacteria 7151
398 Ga0157372_10044032 3300013307 Bacteria 4944
399 Ga0157372_10236882 3300013307 Bacteria 2117
400 Ga0157372_10238666 3300013307 Bacteria 2109
401 Ga0157372_10299446 3300013307 Bacteria 1871
402 Ga0157375_10000496 3300013308 Bacteria 35668
403 Ga0157375_10002056 3300013308 Bacteria 17374
404 Ga0157375_10007145 3300013308 Bacteria 9760
405 Ga0157375_10062191 3300013308 Bacteria 3709
406 Ga0157375_10076136 3300013308 Bacteria 3381
407 Ga0157375_10125827 3300013308 Bacteria 2678
408 Ga0157375_10171900 3300013308 Bacteria 2315
409 Ga0163163_10001050 3300014325 Bacteria 23390
410 Ga0163163_10001202 3300014325 Bacteria 21901
411 Ga0163163_10181466 3300014325 Bacteria 2152
412 Ga0163163_10241955 3300014325 Bacteria 1854
413 Ga0157380_10022566 3300014326 Bacteria 4742
414 Ga0157380_10047477 3300014326 Bacteria 3378
415 Ga0157380_10397500 3300014326 Bacteria 1306
416 Ga0157377_10007732 3300014745 Bacteria 5206
417 Ga0157379_10000522 3300014968 Bacteria 31120
418 Ga0157379_10005174 3300014968 Bacteria 11204
419 Ga0157379_10014832 3300014968 Bacteria 6834
420 Ga0157379_10026591 3300014968 Bacteria 5150
421 Ga0157379_10085077 3300014968 Bacteria 2834
422 Ga0157376_10007439 3300014969 Bacteria 7820
423 Ga0157376_10012221 3300014969 Bacteria 6364
424 Ga0157376_10045385 3300014969 Bacteria 3617
425 Ga0157376_10051149 3300014969 Bacteria 3431
426 Ga0157376_10069405 3300014969 Bacteria 2988
427 Ga0157376_10077384 3300014969 Bacteria 2845
428 Ga0157376_10132744 3300014969 Bacteria 2224
429 Ga0182006_1000747 3300015261 Bacteria 22238
430 Ga0182007_10000413 3300015262 Bacteria 26178
431 Ga0163161_10019582 3300017792 Bacteria 4748
432 Ga0163161_10020767 3300017792 Bacteria 4610
433 Ga0163161_10052756 3300017792 Bacteria 2948
434 Ga0163161_10104945 3300017792 Bacteria 2107
435 Ga0197907_10408444 3300020069 Bacteria 5954
436 Ga0206356_10877575 3300020070 Bacteria 1652
437 Ga0206355_1268802 3300020076 Bacteria 5719
438 Ga0206351_10069195 3300020077 Bacteria 11415
439 Ga0154015_1423277 3300020610 Bacteria 27201
440 Ga0213872_10001248 3300021361 Bacteria 17133
441 Ga0213872_10004727 3300021361 Bacteria 7148
442 Ga0213872_10013649 3300021361 Bacteria 3803
443 Ga0213876_10012565 3300021384 Bacteria 4505
444 Ga0224712_10027712 3300022467 Bacteria 2018
445 Ga0209784_100003 3300025224 Bacteria 1379451
446 Ga0209784_100445 3300025224 Bacteria 17752
447 Ga0209566_100002 3300025225 Bacteria 2614868
448 Ga0209566_100236 3300025225 Bacteria 53481
449 Ga0209566_100748 3300025225 Bacteria 17880
450 Ga0209566_100864 3300025225 Bacteria 14915
451 Ga0209674_100005 3300025226 Bacteria 1708125
452 Ga0209674_100008 3300025226 Bacteria 1076909
453 Ga0209674_100239 3300025226 Bacteria 46704
454 Ga0209674_103278 3300025226 Bacteria 3036
455 Ga0209674_104796 3300025226 Bacteria 2130
456 Ga0209672_100001 3300025228 Bacteria 2828210
457 Ga0209672_100014 3300025228 Bacteria 546252
458 Ga0209672_100023 3300025228 Bacteria 371758
459 Ga0209672_101561 3300025228 Bacteria 7826
460 Ga0209147_100001 3300025229 Bacteria 2384371
461 Ga0209147_100002 3300025229 Bacteria 2158988
462 Ga0209147_100094 3300025229 Bacteria 167145
463 Ga0209147_100104 3300025229 Bacteria 158375
464 Ga0209147_100346 3300025229 Bacteria 34091
465 Ga0209563_100004 3300025230 Bacteria 1814108
466 Ga0209563_100316 3300025230 Bacteria 19169
467 Ga0209563_103462 3300025230 Bacteria 3253
468 Ga0207427_102214 3300025231 Bacteria 5498
469 Ga0209258_100001 3300025242 Bacteria 2384269
470 Ga0209258_100002 3300025242 Bacteria 2158988
471 Ga0209258_100040 3300025242 Bacteria 385401
472 Ga0209258_100142 3300025242 Bacteria 165865
473 Ga0207425_1000204 3300025245 Bacteria 47226
474 Ga0209646_1000019 3300025246 Bacteria 475248
475 Ga0209026_1003589 3300025250 Bacteria 5003
476 Ga0209677_100009 3300025253 Bacteria 749530
477 Ga0209677_102213 3300025253 Bacteria 7556
478 Ga0209148_1000003 3300025254 Bacteria 2384288
479 Ga0209148_1000035 3300025254 Bacteria 548413
480 Ga0209148_1000193 3300025254 Bacteria 115649
481 Ga0209148_1000980 3300025254 Bacteria 18450
482 Ga0209759_1000531 3300025256 Bacteria 40446
483 Ga0209759_1000653 3300025256 Bacteria 32280
484 Ga0209759_1001922 3300025256 Bacteria 10157
485 Ga0209759_1006006 3300025256 Bacteria 4144
486 Ga0209759_1006864 3300025256 Bacteria 3763
487 Ga0209129_1000025 3300025258 Bacteria 413639
488 Ga0209233_1000043 3300025261 Bacteria 509723
489 Ga0209455_1000001 3300025272 Bacteria 2384278
490 Ga0209455_1000072 3300025272 Bacteria 293074
491 Ga0209455_1000076 3300025272 Bacteria 284092
492 Ga0209455_1001608 3300025272 Bacteria 9912
493 Ga0209455_1004730 3300025272 Bacteria 4372
494 Ga0209673_1000030 3300025273 Bacteria 351933
495 Ga0209675_1016192 3300025291 Bacteria 2181
496 Ga0209564_1000039 3300025295 Bacteria 413604
497 Ga0209758_1000163 3300025297 Bacteria 151988
498 Ga0209758_1000287 3300025297 Bacteria 99234
499 Ga0209050_1000325 3300025298 Bacteria 95686
500 Ga0207697_10008107 3300025315 Bacteria 4629
501 Ga0207656_10001933 3300025321 Bacteria 6891
502 Ga0207713_1000487 3300025735 Bacteria 41086
503 Ga0207682_10001681 3300025893 Bacteria 10141
504 Ga0207682_10077202 3300025893 Bacteria 1421
505 Ga0207692_10018818 3300025898 Bacteria 3108
506 Ga0207642_10087800 3300025899 Bacteria 1528
507 Ga0207680_10002475 3300025903 Bacteria 8626
508 Ga0207680_10046078 3300025903 Bacteria 2576
509 Ga0207680_10054018 3300025903 Bacteria 2415
510 Ga0207647_10007627 3300025904 Bacteria 7798
511 Ga0207647_10048170 3300025904 Bacteria 2648
512 Ga0207647_10079605 3300025904 Bacteria 1967
513 Ga0207699_10009040 3300025906 Bacteria 4943
514 Ga0207645_10000139 3300025907 Bacteria 55848
515 Ga0207645_10000552 3300025907 Bacteria 31081
516 Ga0207645_10044036 3300025907 Bacteria 2856
517 Ga0207645_10071567 3300025907 Bacteria 2219
518 Ga0207643_10003241 3300025908 Bacteria 8782
519 Ga0207643_10016962 3300025908 Bacteria 3974
520 Ga0207643_10128654 3300025908 Bacteria 1505
521 Ga0207684_10157536 3300025910 Bacteria 1955
522 Ga0207654_10008861 3300025911 Bacteria 5102
523 Ga0207654_10042716 3300025911 Bacteria 2567
524 Ga0207707_10039893 3300025912 Bacteria 4102
525 Ga0207707_10062126 3300025912 Bacteria 3250
526 Ga0207707_10209672 3300025912 Bacteria 1697
527 Ga0207695_10002741 3300025913 Bacteria 25691
528 Ga0207695_10006054 3300025913 Bacteria 15789
529 Ga0207695_10012711 3300025913 Bacteria 10079
530 Ga0207695_10074211 3300025913 Bacteria 3463
531 Ga0207693_10000485 3300025915 Bacteria 36061
532 Ga0207660_10081834 3300025917 Bacteria 2374
533 Ga0207660_10240480 3300025917 Bacteria 1426
534 Ga0207662_10047963 3300025918 Bacteria 2530
535 Ga0207657_10000004 3300025919 Bacteria 247179
536 Ga0207657_10052627 3300025919 Bacteria 3532
537 Ga0207649_10000961 3300025920 Bacteria 17881
538 Ga0207649_10002440 3300025920 Bacteria 10407
539 Ga0207652_10016549 3300025921 Bacteria 6023
540 Ga0207652_10056202 3300025921 Bacteria 3388
541 Ga0207652_10119617 3300025921 Bacteria 2343
542 Ga0207646_10015044 3300025922 Bacteria 7324
543 Ga0207646_10038830 3300025922 Bacteria 4285
544 Ga0207646_10100445 3300025922 Bacteria 2593
545 Ga0207681_10015575 3300025923 Bacteria 4744
546 Ga0207681_10041311 3300025923 Bacteria 3074
547 Ga0207694_10014128 3300025924 Bacteria 6020
548 Ga0207694_10061375 3300025924 Bacteria 2926
549 Ga0207650_10000941 3300025925 Bacteria 21892
550 Ga0207650_10002263 3300025925 Bacteria 13434
551 Ga0207650_10020999 3300025925 Bacteria 4612
552 Ga0207650_10034883 3300025925 Bacteria 3650
553 Ga0207650_10078550 3300025925 Bacteria 2497
554 Ga0207659_10000927 3300025926 Bacteria 17484
555 Ga0207659_10004009 3300025926 Bacteria 8885
556 Ga0207659_10005068 3300025926 Bacteria 7992
557 Ga0207659_10007116 3300025926 Bacteria 6870
558 Ga0207659_10013208 3300025926 Bacteria 5283
559 Ga0207659_10144889 3300025926 Bacteria 1848
560 Ga0207687_10001187 3300025927 Bacteria 17803
561 Ga0207687_10001442 3300025927 Bacteria 16268
562 Ga0207687_10073272 3300025927 Bacteria 2452
563 Ga0207687_10108892 3300025927 Bacteria 2052
564 Ga0207700_10002838 3300025928 Bacteria 9969
565 Ga0207700_10021147 3300025928 Bacteria 4436
566 Ga0207664_10002967 3300025929 Bacteria 11267
567 Ga0207644_10001084 3300025931 Bacteria 17455
568 Ga0207644_10086308 3300025931 Unclassified 2330
569 Ga0207644_10091429 3300025931 Bacteria 2269
570 Ga0207644_10148418 3300025931 Bacteria 1812
571 Ga0207644_10158715 3300025931 Bacteria 1756
572 Ga0207690_10000015 3300025932 Bacteria 257457
573 Ga0207690_10002595 3300025932 Bacteria 10906
574 Ga0207706_10002935 3300025933 Bacteria 16483
575 Ga0207706_10037418 3300025933 Bacteria 4309
576 Ga0207706_10081475 3300025933 Bacteria 2844
577 Ga0207686_10000309 3300025934 Bacteria 35241
578 Ga0207709_10025638 3300025935 Bacteria 3377
579 Ga0207709_10077121 3300025935 Bacteria 2135
580 Ga0207670_10009322 3300025936 Bacteria 5597
581 Ga0207670_10021686 3300025936 Bacteria 3967
582 Ga0207670_10055957 3300025936 Bacteria 2668
583 Ga0207670_10108498 3300025936 Bacteria 1996
584 Ga0207669_10001739 3300025937 Bacteria 9243
585 Ga0207669_10007041 3300025937 Bacteria 5174
586 Ga0207669_10047529 3300025937 Bacteria 2543
587 Ga0207669_10051974 3300025937 Bacteria 2459
588 Ga0207704_10146496 3300025938 Bacteria 1660
589 Ga0207665_10090395 3300025939 Bacteria 2122
590 Ga0207691_10000040 3300025940 Bacteria 106561
591 Ga0207691_10000403 3300025940 Bacteria 43257
592 Ga0207691_10002356 3300025940 Bacteria 18498
593 Ga0207691_10003046 3300025940 Bacteria 16343
594 Ga0207691_10003183 3300025940 Bacteria 16043
595 Ga0207691_10019297 3300025940 Bacteria 6453
596 Ga0207691_10057778 3300025940 Bacteria 3530
597 Ga0207691_10110941 3300025940 Bacteria 2439
598 Ga0207711_10000115 3300025941 Bacteria 83472
599 Ga0207711_10005273 3300025941 Bacteria 10955
600 Ga0207711_10023259 3300025941 Bacteria 5186
601 Ga0207711_10075386 3300025941 Bacteria 2936
602 Ga0207711_10360414 3300025941 Bacteria 1347
603 Ga0207689_10000072 3300025942 Bacteria 82171
604 Ga0207689_10013281 3300025942 Bacteria 7024
605 Ga0207689_10030747 3300025942 Bacteria 4475
606 Ga0207689_10095179 3300025942 Bacteria 2446
607 Ga0207661_10004602 3300025944 Bacteria 9670
608 Ga0207679_10000020 3300025945 Bacteria 225727
609 Ga0207679_10050032 3300025945 Bacteria 3051
610 Ga0207679_10123897 3300025945 Bacteria 2062
611 Ga0207667_10010633 3300025949 Bacteria 10742
612 Ga0207667_10035833 3300025949 Bacteria 5322
613 Ga0207667_10048576 3300025949 Bacteria 4486
614 Ga0207667_10105884 3300025949 Bacteria 2902
615 Ga0207651_10001104 3300025960 Bacteria 11997
616 Ga0207651_10002517 3300025960 Bacteria 8748
617 Ga0207651_10004093 3300025960 Bacteria 7275
618 Ga0207651_10028274 3300025960 Bacteria 3535
619 Ga0207651_10049588 3300025960 Bacteria 2845
620 Ga0207651_10114358 3300025960 Bacteria 2032
621 Ga0207668_10003609 3300025972 Bacteria 9095
622 Ga0207668_10004194 3300025972 Bacteria 8452
623 Ga0207668_10005765 3300025972 Bacteria 7301
624 Ga0207668_10009468 3300025972 Bacteria 5841
625 Ga0207668_10012410 3300025972 Bacteria 5217
626 Ga0207668_10054602 3300025972 Bacteria 2774
627 Ga0207640_10000017 3300025981 Bacteria 208145
628 Ga0207640_10155935 3300025981 Bacteria 1683
629 Ga0207658_10001791 3300025986 Bacteria 16086
630 Ga0207658_10001880 3300025986 Bacteria 15711
631 Ga0207658_10032274 3300025986 Bacteria 3726
632 Ga0207658_10145958 3300025986 Bacteria 1921
633 Ga0207658_10183714 3300025986 Bacteria 1732
634 Ga0207677_10000210 3300026023 Bacteria 47077
635 Ga0207677_10000466 3300026023 Bacteria 26873
636 Ga0207677_10010657 3300026023 Bacteria 5209
637 Ga0207677_10015340 3300026023 Bacteria 4503
638 Ga0207677_10046095 3300026023 Bacteria 2916
639 Ga0207677_10128795 3300026023 Bacteria 1918
640 Ga0207703_10000588 3300026035 Bacteria 36998
641 Ga0207703_10001041 3300026035 Bacteria 26557
642 Ga0207703_10025265 3300026035 Bacteria 4671
643 Ga0207703_10042463 3300026035 Bacteria 3648
644 Ga0207703_10073478 3300026035 Bacteria 2829
645 Ga0207703_10167363 3300026035 Bacteria 1930
646 Ga0207639_10041337 3300026041 Bacteria 3448
647 Ga0207639_10308102 3300026041 Bacteria 1402
648 Ga0207678_10000008 3300026067 Bacteria 168926
649 Ga0207678_10002010 3300026067 Bacteria 18500
650 Ga0207678_10008272 3300026067 Bacteria 9164
651 Ga0207678_10026447 3300026067 Bacteria 5061
652 Ga0207678_10058455 3300026067 Bacteria 3318
653 Ga0207702_10000017 3300026078 Bacteria 222964
654 Ga0207702_10038520 3300026078 Bacteria 4003
655 Ga0207702_10070391 3300026078 Bacteria 3008
656 Ga0207641_10006504 3300026088 Bacteria 9838
657 Ga0207641_10006806 3300026088 Bacteria 9576
658 Ga0207641_10021182 3300026088 Bacteria 5344
659 Ga0207641_10023053 3300026088 Bacteria 5129
660 Ga0207641_10033021 3300026088 Bacteria 4299
661 Ga0207641_10058688 3300026088 Bacteria 3276
662 Ga0207641_10096274 3300026088 Bacteria 2599
663 Ga0207641_10140870 3300026088 Bacteria 2176
664 Ga0207641_10195314 3300026088 Bacteria 1862
665 Ga0207648_10002691 3300026089 Bacteria 18906
666 Ga0207648_10003981 3300026089 Bacteria 15340
667 Ga0207648_10006292 3300026089 Bacteria 11817
668 Ga0207648_10007093 3300026089 Bacteria 11059
669 Ga0207648_10022567 3300026089 Bacteria 5650
670 Ga0207648_10047026 3300026089 Bacteria 3783
671 Ga0207648_10056084 3300026089 Bacteria 3439
672 Ga0207648_10142233 3300026089 Bacteria 2115
673 Ga0207676_10000415 3300026095 Bacteria 36094
674 Ga0207676_10004269 3300026095 Bacteria 10102
675 Ga0207676_10004753 3300026095 Bacteria 9634
676 Ga0207676_10033209 3300026095 Bacteria 3897
677 Ga0207676_10107699 3300026095 Bacteria 2325
678 Ga0207676_10117817 3300026095 Bacteria 2234
679 Ga0207676_10129039 3300026095 Bacteria 2146
680 Ga0207676_10251697 3300026095 Bacteria 1590
681 Ga0207674_10007322 3300026116 Bacteria 12855
682 Ga0207674_10041572 3300026116 Bacteria 4753
683 Ga0207674_10123434 3300026116 Bacteria 2556
684 Ga0207674_10189663 3300026116 Bacteria 2006
685 Ga0207675_100010518 3300026118 Bacteria 8670
686 Ga0207675_100013547 3300026118 Bacteria 7610
687 Ga0207675_100189570 3300026118 Bacteria 1972
688 Ga0207683_10000059 3300026121 Bacteria 83666
689 Ga0207683_10000253 3300026121 Bacteria 47518
690 Ga0207683_10000685 3300026121 Bacteria 31080
691 Ga0207683_10001335 3300026121 Bacteria 22261
692 Ga0207683_10007920 3300026121 Bacteria 9093
693 Ga0207683_10007980 3300026121 Bacteria 9057
694 Ga0207683_10138263 3300026121 Bacteria 2193
695 Ga0207698_10000201 3300026142 Bacteria 37485
696 Ga0207698_10018379 3300026142 Bacteria 4762
697 Ga0209371_1000290 3300027312 Bacteria 57261
698 Ga0209998_10013534 3300027717 Bacteria 1699
699 Ga0209974_10003050 3300027876 Bacteria 6058
700 Ga0207428_10002089 3300027907 Bacteria 20124
701 Ga0207428_10012217 3300027907 Bacteria 7553
702 Ga0268266_10007539 3300028379 Bacteria 9800
703 Ga0268266_10012063 3300028379 Bacteria 7478
704 Ga0268266_10096070 3300028379 Bacteria 2603
705 Ga0268265_10004497 3300028380 Bacteria 9649
706 Ga0268265_10248455 3300028380 Bacteria 1574
707 Ga0268265_10340620 3300028380 Bacteria 1365
708 Ga0268264_10000593 3300028381 Bacteria 43940
709 Ga0268264_10003682 3300028381 Bacteria 13157
710 Ga0268264_10008255 3300028381 Bacteria 8648
711 Ga0268264_10046207 3300028381 Bacteria 3616
712 Ga0268264_10059252 3300028381 Bacteria 3208
713 Ga0268264_10097074 3300028381 Bacteria 2554
714 Ga0268264_10178868 3300028381 Bacteria 1925
715 Ga0265334_10000283 3300028573 Bacteria 28659
716 Ga0265318_10005313 3300028577 Bacteria 6056
717 Ga0265338_10000373 3300028800 Bacteria 80312
718 Ga0268256_1000224 3300030500 Bacteria 61981
719 Ga0307511_10001921 3300030521 Bacteria 21860
720 Ga0265330_10001350 3300031235 Bacteria 14366
721 Ga0265332_10000724 3300031238 Bacteria 20828
722 Ga0265332_10003315 3300031238 Bacteria 7814
723 Ga0265328_10000248 3300031239 Bacteria 24945
724 Ga0265328_10000961 3300031239 Bacteria 13232
725 Ga0265320_10066228 3300031240 Bacteria 1712
726 Ga0265329_10016085 3300031242 Bacteria 2600
727 Ga0265329_10031919 3300031242 Bacteria 1708
728 Ga0265331_10000121 3300031250 Bacteria 102519
729 Ga0265331_10000579 3300031250 Bacteria 32817
730 Ga0265331_10008134 3300031250 Bacteria 5990
731 Ga0265327_10000269 3300031251 Bacteria 102772
732 Ga0265327_10037150 3300031251 Bacteria 2670
733 Ga0265314_10000335 3300031711 Bacteria 66101
734 Ga0265342_10016254 3300031712 Bacteria 4868
735 Ga0307412_10000024 3300031911 Bacteria 235467
736 Ga0307416_100035021 3300032002 Bacteria 3829
737 Ga0307416_100169176 3300032002 Bacteria 2032
738 Ga0307411_10104579 3300032005 Bacteria 2011
739 Ga0307507_10068662 3300033179 Bacteria 3232
740 Ga0316588_1011099 3300033528 Bacteria 1914
741 Ga0373923_0012896 3300035111 Bacteria 3103
742 Ga0373945_0122350 3300035116 Bacteria 1035
743 Ga0373954_0003948 3300035118 Bacteria 6345
744 Ga0373957_0024703 3300035120 Bacteria 2160
745 Ga0373924_0014795 3300035410 Bacteria 2953
746 Ga0373927_0016881 3300035695 Bacteria 4814
747 Ga0373927_0022674 3300035695 Bacteria 4111
748 Ga0373927_0064396 3300035695 Bacteria 2371
749 Ga0373933_0042834 3300035724 Bacteria 2676
750 Ga0373933_0052519 3300035724 Bacteria 2439
751 Ga0373947_0197050 3300035725 Bacteria 1316
752 Ga0373937_0064145 3300036401 Bacteria 3379
753 Ga0373937_0094401 3300036401 Bacteria 2774
754 Ga0373937_0164192 3300036401 Bacteria 2082
755 Ga0373925_0056454 3300037068 Bacteria 2941
756 Ga0395899_0064202 3300037312 Bacteria 2700
757 Ga0395899_0070116 3300037312 Bacteria 2565
758 Ga0395900_0009402 3300037418 Bacteria 10023
759 Ga0395900_0066507 3300037418 Bacteria 3703
760 Ga0395898_0006750 3300037466 Bacteria 12223
761 Ga0395905_0007926 3300037471 Bacteria 10507
762 Ga0395905_0014860 3300037471 Bacteria 7426
763 Ga0395905_0056223 3300037471 Bacteria 3681
764 Ga0395901_0008727 3300038443 Bacteria 10244
765 Ga0400490_58038 3300038726 Bacteria 7395
766 Ga0400488_34059 3300038741 Bacteria 1390
767 Ga0400483_056583 3300039062 Bacteria 2124
768 Ga0400483_097649 3300039062 Bacteria 2838
769 Ga0400483_186689 3300039062 Bacteria 2984
770 Ga0400483_233228 3300039062 Bacteria 4123
771 Ga0436365_1136772 3300039437 Bacteria 28283
772 Ga0436365_1444604 3300039437 Bacteria 6672
773 Ga0436361_0344800 3300039447 Bacteria 62567
774 Ga0436361_0425404 3300039447 Bacteria 1286
775 Ga0436361_0602169 3300039447 Bacteria 3142
776 Ga0436361_0710868 3300039447 Bacteria 4574
777 Ga0436361_0790144 3300039447 Bacteria 6019
778 Ga0436361_1094634 3300039447 Bacteria 10537
779 Ga0439441_001520 3300042001 Bacteria 3067
780 Ga0439441_002052 3300042001 Bacteria 2771
781 Ga0439435_0001559 3300042436 Bacteria 4286
782 Ga0451577_0115563 3300042876 Bacteria 2403
783 Ga0466969_0009926 3300044656 Bacteria 5047
784 Ga0466977_0002241 3300044666 Bacteria 8727
785 Ga0453683_0264697 3300044673 Bacteria 1097
786 Ga0466965_0001301 3300044683 Bacteria 9952
787 Ga0466965_0041104 3300044683 Bacteria 2277
788 Ga0466966_0000061 3300044684 Bacteria 79168
789 Ga0466966_0022688 3300044684 Bacteria 4117
790 Ga0466961_0004882 3300044693 Bacteria 8434
791 Ga0466961_0015370 3300044693 Bacteria 4915
792 Ga0466961_0027876 3300044693 Bacteria 3631
793 Ga0466964_0015632 3300044706 Bacteria 2889
794 Ga0453684_0005034 3300044712 Bacteria 26810
795 Ga0466971_0002146 3300044719 Bacteria 8342
796 Ga0466970_0012329 3300044765 Bacteria 4368
797 Ga0466957_0013768 3300044842 Bacteria 4698
798 Ga0466957_0018721 3300044842 Bacteria 4068
799 Ga0466959_0000534 3300045049 Bacteria 22033
800 Ga0466959_0022986 3300045049 Bacteria 4610
801 Ga0466959_0155859 3300045049 Bacteria 1607
802 Ga0451576_0104340 3300045051 Bacteria 2949
803 Ga0466958_0006210 3300045836 Bacteria 6485
804 Ga0466967_0038242 3300045976 Bacteria 4113
805 Ga0466967_0056315 3300045976 Bacteria 3466
806 Ga0495592_0004828 3300046454 Bacteria 9912
807 Ga0495592_0010112 3300046454 Bacteria 7107
808 Ga0495592_0030711 3300046454 Bacteria 4064
809 Ga0495603_0005929 3300046455 Bacteria 7303
810 Ga0495591_001325 3300046458 Bacteria 15572
811 Ga0495629_0000072 3300046459 Bacteria 88459
812 Ga0495629_0003554 3300046459 Bacteria 11771
813 Ga0495629_0005971 3300046459 Bacteria 9060
814 Ga0495629_0104523 3300046459 Bacteria 1975
815 Ga0495638_0015833 3300046460 Bacteria 5053
816 Ga0495641_0063534 3300046461 Bacteria 1664
817 Ga0495651_0062263 3300046462 Bacteria 2855
818 Ga0495651_0097593 3300046462 Bacteria 2194
819 Ga0495653_0006138 3300046463 Bacteria 9853
820 Ga0495653_0006488 3300046463 Bacteria 9593
821 Ga0495653_0007055 3300046463 Bacteria 9221
822 Ga0495653_0097954 3300046463 Bacteria 2130
823 Ga0495650_0002225 3300046471 Bacteria 16270
824 Ga0495580_0001816 3300046472 Bacteria 18781
825 Ga0495580_0005448 3300046472 Bacteria 10517
826 Ga0495580_0012106 3300046472 Bacteria 6638
827 Ga0495580_0014975 3300046472 Bacteria 5869
828 Ga0495580_0020329 3300046472 Bacteria 4915
829 Ga0495580_0026593 3300046472 Bacteria 4218
830 Ga0495580_0129330 3300046472 Bacteria 1752
831 Ga0495582_0004789 3300046473 Bacteria 7600
832 Ga0495582_0013708 3300046473 Bacteria 4463
833 Ga0495582_0117535 3300046473 Bacteria 1496
834 Ga0495605_0013265 3300046474 Bacteria 4550
835 Ga0495639_0027307 3300046475 Bacteria 2526
836 Ga0495662_0017421 3300046476 Bacteria 3477
837 Ga0495662_0027126 3300046476 Bacteria 2767
838 Ga0495664_0002912 3300046477 Bacteria 9232
839 Ga0495664_0026066 3300046477 Bacteria 3404
840 Ga0495664_0067179 3300046477 Bacteria 2139
841 Ga0495664_0127524 3300046477 Bacteria 1540
842 Ga0495596_0001108 3300046500 Bacteria 15956
843 Ga0495596_0012325 3300046500 Bacteria 3663
844 Ga0495583_0016894 3300046506 Bacteria 3898
845 Ga0495606_0030972 3300046507 Bacteria 3726
846 Ga0495608_0083529 3300046511 Bacteria 2073
847 Ga0495608_0150035 3300046511 Bacteria 1486
848 Ga0495610_0004267 3300046512 Bacteria 10639
849 Ga0495618_0004027 3300046514 Bacteria 9061
850 Ga0495618_0004885 3300046514 Bacteria 8190
851 Ga0495628_0002857 3300046516 Bacteria 15477
852 Ga0495628_0014737 3300046516 Bacteria 6544
853 Ga0495628_0023443 3300046516 Bacteria 5066
854 Ga0495628_0062015 3300046516 Bacteria 2931
855 Ga0495630_0009508 3300046517 Bacteria 6993
856 Ga0495632_0001537 3300046519 Bacteria 19062
857 Ga0495648_0008331 3300046524 Bacteria 8173
858 Ga0495648_0111426 3300046524 Bacteria 1488
859 Ga0495666_0006557 3300046526 Bacteria 5856
860 Ga0495666_0053263 3300046526 Bacteria 1942
861 Ga0495652_0017963 3300046529 Bacteria 6309
862 Ga0495652_0025260 3300046529 Bacteria 5257
863 Ga0495652_0121675 3300046529 Bacteria 2080
864 Ga0495665_0013752 3300046531 Bacteria 4370
865 Ga0495665_0027117 3300046531 Bacteria 3075
866 Ga0495665_0045881 3300046531 Bacteria 2321
867 Ga0495665_0049735 3300046531 Bacteria 2222
868 Ga0495640_0015262 3300046533 Bacteria 5783
869 Ga0495640_0018849 3300046533 Bacteria 5106
870 Ga0495587_0001551 3300046536 Bacteria 15275
871 Ga0495587_0007249 3300046536 Bacteria 7189
872 Ga0495587_0025732 3300046536 Bacteria 3595
873 Ga0495645_0001390 3300046543 Bacteria 16357
874 Ga0495645_0035169 3300046543 Bacteria 3653
875 Ga0495622_0000298 3300046557 Bacteria 37422
876 Ga0495667_0074479 3300046559 Bacteria 2210
877 Ga0495634_0003726 3300046642 Bacteria 12143
878 Ga0495634_0013440 3300046642 Bacteria 5915
879 Ga0495634_0121224 3300046642 Bacteria 1674
880 Ga0495635_0028265 3300046663 Bacteria 3897
881 Ga0495635_0033283 3300046663 Bacteria 3575
882 Ga0495635_0052464 3300046663 Bacteria 2809
883 Ga0495635_0227434 3300046663 Bacteria 1260
884 Ga0495659_0020267 3300046664 Bacteria 2232
885 Ga0495661_0001700 3300046665 Bacteria 17828
886 Ga0495661_0017025 3300046665 Bacteria 4803
887 Ga0495661_0029315 3300046665 Bacteria 3514
888 Ga0495599_0028409 3300046678 Bacteria 3505
889 Ga0495599_0031314 3300046678 Bacteria 3338
890 Ga0495599_0144431 3300046678 Bacteria 1475
891 Ga0495623_0003003 3300046679 Bacteria 11095
892 Ga0495623_0031943 3300046679 Bacteria 3385
893 Ga0495623_0057304 3300046679 Bacteria 2451
894 Ga0495646_0000873 3300046680 Bacteria 17118
895 Ga0495646_0004121 3300046680 Bacteria 9124
896 Ga0495646_0015543 3300046680 Bacteria 4830
897 Ga0495646_0017945 3300046680 Bacteria 4483
898 Ga0495646_0026756 3300046680 Bacteria 3620
899 Ga0495613_0003582 3300046689 Bacteria 11637
900 Ga0495624_0004402 3300046690 Bacteria 10307
901 Ga0495624_0006224 3300046690 Bacteria 8483
902 Ga0495624_0014713 3300046690 Bacteria 5298
903 Ga0495671_0070506 3300046692 Bacteria 1717
904 Ga0495649_0012381 3300046694 Bacteria 4965
905 Ga0495600_0017120 3300046809 Bacteria 4608
906 Ga0495600_0036648 3300046809 Bacteria 3188
907 Ga0495600_0045795 3300046809 Bacteria 2854
908 Ga0495581_0012476 3300047315 Bacteria 4922
909 Ga0495581_0056734 3300047315 Bacteria 2260
910 Ga0495581_0069765 3300047315 Bacteria 2032
911 Ga0495604_0034234 3300047317 Bacteria 4020
912 Ga0495604_0045124 3300047317 Bacteria 3440
913 Ga0495604_0117183 3300047317 Bacteria 1932
914 Ga0495674_0010174 3300047319 Bacteria 8911
915 Ga0495674_0019899 3300047319 Bacteria 6222
916 Ga0495674_0030287 3300047319 Bacteria 4921
917 Ga0495674_0198891 3300047319 Bacteria 1663
918 Ga0495672_0005863 3300047320 Bacteria 9631
919 Ga0495672_0028079 3300047320 Bacteria 3566
920 Ga0495676_0019089 3300047321 Bacteria 6035
921 Ga0495680_0010644 3300047322 Bacteria 8202
922 Ga0495680_0035133 3300047322 Bacteria 4040
923 Ga0495680_0066765 3300047322 Bacteria 2752
924 Ga0495680_0109406 3300047322 Bacteria 2049
925 Ga0495680_0160246 3300047322 Bacteria 1634
926 Ga0495683_0006459 3300047323 Bacteria 6407
927 Ga0495683_0013657 3300047323 Bacteria 4242
928 Ga0495683_0045687 3300047323 Bacteria 2200
929 Ga0495687_022887 3300047443 Bacteria 2993
930 Ga0495687_025139 3300047443 Bacteria 2820
931 Ga0495675_0007474 3300047444 Bacteria 6728
932 Ga0495675_0008305 3300047444 Bacteria 6424
933 Ga0495675_0063451 3300047444 Bacteria 2337
934 Ga0495675_0116388 3300047444 Bacteria 1666
935 Ga0495679_000084 3300047446 Bacteria 86822
936 Ga0495679_002887 3300047446 Bacteria 8510
937 Ga0495679_003489 3300047446 Bacteria 7531
938 Ga0495679_016842 3300047446 Bacteria 2633
939 Ga0495673_0053425 3300047469 Bacteria 1761
940 Ga0495681_0021664 3300047470 Bacteria 3457
941 Ga0495684_0027934 3300047471 Bacteria 4333
942 Ga0495684_0063252 3300047471 Bacteria 2813
943 Ga0495686_0044990 3300047472 Bacteria 2794
944 Ga0495593_0002301 3300047673 Bacteria 11457
945 Ga0495593_0003104 3300047673 Bacteria 9996
946 Ga0495593_0011319 3300047673 Bacteria 5125
947 Ga0495602_0008283 3300048088 Bacteria 10861
948 Ga0495602_0015149 3300048088 Bacteria 7792
949 Ga0495602_0084025 3300048088 Bacteria 2664
950 Ga0495614_0000919 3300048089 Bacteria 12556
951 Ga0495614_0002622 3300048089 Bacteria 7994
952 Ga0495614_0037849 3300048089 Bacteria 2070
953 Ga0496100_0050038 3300048903 Bacteria 2705
954 Ga0496101_0036880 3300048904 Bacteria 3465
955 Ga0496101_0053564 3300048904 Bacteria 2912
956 Ga0496102_0009414 3300048905 Bacteria 8393
957 Ga0496102_0032700 3300048905 Bacteria 4674
958 Ga0496102_0237261 3300048905 Bacteria 1720
959 Ga0496103_0024131 3300048906 Bacteria 3668
960 Ga0496103_0057687 3300048906 Bacteria 2411
961 Ga0496104_0024908 3300048907 Bacteria 5511
962 Ga0496105_0061685 3300048908 Bacteria 3094
963 Ga0496106_0000057 3300048909 Bacteria 90192
964 Ga0496106_0219757 3300048909 Bacteria 1515
965 Ga0496106_0334066 3300048909 Bacteria 1217
966 Ga0496107_0168199 3300048910 Bacteria 1626
967 Ga0496108_0000486 3300048911 Bacteria 31881
968 Ga0496108_0031689 3300048911 Bacteria 4388
969 Ga0496109_0008628 3300048912 Bacteria 8676
970 Ga0496109_0016951 3300048912 Bacteria 6376
971 Ga0496109_0089220 3300048912 Bacteria 2850
972 Ga0496110_0002768 3300048913 Bacteria 13240
973 Ga0496111_0102777 3300048914 Bacteria 2101
974 Ga0496116_0071475 3300048919 Bacteria 2197
975 Ga0496117_0007476 3300048920 Bacteria 10657
976 Ga0496117_0019088 3300048920 Bacteria 5647
977 Ga0496117_0029317 3300048920 Bacteria 4245
978 Ga0496118_0003743 3300048921 Bacteria 18807
979 Ga0496118_0006519 3300048921 Bacteria 12783
980 Ga0496118_0009854 3300048921 Bacteria 9559
981 Ga0496118_0014461 3300048921 Bacteria 7386
982 Ga0496121_0001363 3300048924 Bacteria 41628
983 Ga0496121_0002978 3300048924 Bacteria 24650
984 Ga0496121_0019881 3300048924 Bacteria 6686
985 Ga0496121_0125940 3300048924 Bacteria 1926
986 Ga0496125_0018882 3300048928 Bacteria 6526
987 Ga0496125_0165833 3300048928 Bacteria 1493
988 Ga0496126_0003094 3300048929 Bacteria 21515
989 Ga0496126_0004555 3300048929 Bacteria 16468
990 Ga0496126_0010374 3300048929 Bacteria 9778
991 Ga0495678_030728 3300049459 Bacteria 2245
992 Ga0501034_0029028 3300049571 Bacteria 5624
993 Ga0501036_0093688 3300049572 Bacteria 2538
994 Ga0501036_0094613 3300049572 Bacteria 2525
995 Ga0501037_0213437 3300049573 Bacteria 1360
996 Ga0501038_0111490 3300049574 Bacteria 2266
997 Ga0501039_0010504 3300049575 Bacteria 7056
998 Ga0501040_0010778 3300049576 Bacteria 5974
999 Ga0501041_0022688 3300049577 Bacteria 3759
1000 Ga0501043_0090987 3300049579 Bacteria 2399
1001 Ga0501043_0130587 3300049579 Bacteria 1969
1002 Ga0501047_0004461 3300049581 Bacteria 13170
1003 Ga0501047_0006119 3300049581 Bacteria 11307
1004 Ga0501047_0066305 3300049581 Bacteria 3480
1005 Ga0501047_0107967 3300049581 Bacteria 2665
1006 Ga0501067_0025898 3300049583 Bacteria 3250
1007 Ga0501069_0023492 3300049585 Bacteria 3362
1008 Ga0501069_0032935 3300049585 Bacteria 2853
1009 Ga0501070_0000947 3300049586 Bacteria 26194
1010 Ga0501071_0196666 3300049587 Bacteria 1513
1011 Ga0501072_0003413 3300049588 Bacteria 11966
1012 Ga0501072_0049029 3300049588 Bacteria 3324
1013 Ga0501072_0377954 3300049588 Bacteria 1124
1014 Ga0501073_0002380 3300049589 Bacteria 14074
1015 Ga0501073_0004108 3300049589 Bacteria 10921
1016 Ga0501074_0000154 3300049590 Bacteria 35857
1017 Ga0501074_0055784 3300049590 Bacteria 2847
1018 Ga0501074_0086636 3300049590 Bacteria 2244
1019 Ga0501074_0145498 3300049590 Bacteria 1695
1020 Ga0501075_0016624 3300049591 Bacteria 5304
1021 Ga0501076_0018894 3300049592 Bacteria 5259
1022 Ga0501076_0055560 3300049592 Bacteria 3140
1023 Ga0501079_0012375 3300049741 Bacteria 6511
1024 Ga0501079_0016230 3300049741 Bacteria 5692
1025 Ga0501080_0002945 3300049742 Bacteria 14964
1026 Ga0501080_0007533 3300049742 Bacteria 9836
1027 Ga0501080_0081942 3300049742 Bacteria 2997
1028 Ga0501081_0002208 3300049743 Bacteria 12246
1029 Ga0501081_0134174 3300049743 Bacteria 1771
1030 Ga0501083_0000323 3300049744 Bacteria 30331
1031 Ga0501035_0004624 3300049822 Bacteria 13049
1032 Ga0501044_0175060 3300049823 Bacteria 2115
1033 Ga0501045_0021521 3300049824 Bacteria 4614
1034 nmdc:mga0k408_43_c1 3300050493 Bacteria 51763
1035 nmdc:mga0k408_46374_c1 3300050493 Bacteria 2509
1036 nmdc:mga0k408_5742_c1 3300050493 Bacteria 6602
1037 nmdc:mga07m45_47186_c1 3300050496 Bacteria 2421
1038 nmdc:mga05p37_238957_c1 3300050507 Bacteria 2185
1039 nmdc:mga09592_20118_c1 3300050508 Bacteria 5485
1040 nmdc:mga0qj67_16296_c1 3300050509 Bacteria 5633
1041 nmdc:mga0qj67_198187_c1 3300050509 Bacteria 1632
1042 nmdc:mga0qj67_2813_c1 3300050509 Bacteria 12482
1043 nmdc:mga06r32_119780_c1 3300050510 Bacteria 2595
1044 nmdc:mga08y16_217889_c1 3300050511 Bacteria 1976
1045 nmdc:mga08y16_74968_c1 3300050511 Unclassified 3527
1046 nmdc:mga0n895_225979_c1 3300050512 Bacteria 1900
1047 nmdc:mga08x19_35583_c1 3300050514 Bacteria 3151
1048 nmdc:mga0a205_50873_c1 3300050515 Bacteria 3999
1049 nmdc:mga0a205_56110_c1 3300050515 Bacteria 3804
1050 Ga0495601_0067632 3300053077 Bacteria 2276
1051 Ga0495619_0007000 3300053085 Bacteria 7138
1052 Ga0495619_0025667 3300053085 Bacteria 3786
1053 Ga0500578_0000263 3300053086 Bacteria 65524
1054 Ga0500646_0001369 3300053090 Bacteria 6471
1055 Ga0500583_0000895 3300053092 Bacteria 8563
1056 Ga0500651_0011852 3300053093 Bacteria 5268
1057 Ga0500650_0022196 3300053098 Bacteria 2807
1058 Ga0500593_000307 3300053117 Bacteria 19824
1059 Ga0500652_000222 3300053131 Bacteria 21787
1060 Ga0500658_0053889 3300053134 Bacteria 1651
1061 Ga0500568_0005526 3300053139 Bacteria 6513
1062 Ga0500568_0015983 3300053139 Bacteria 3346
1063 Ga0500604_0002216 3300053151 Bacteria 5333
1064 Ga0500619_000055 3300053154 Bacteria 34804
1065 Ga0500622_0000106 3300053156 Bacteria 85750
1066 Ga0501084_0032083 3300054114 Bacteria 4393
1067 Ga0501084_0157235 3300054114 Bacteria 1917
1068 Ga0587072_002951 3300059643 Bacteria 2341
1069 Ga0501082_0026224 3300060353 Bacteria 5022
1070 Ga0466962_0011801 3300061719 Bacteria 4205
1071 Ga0466962_0012917 3300061719 Bacteria 4016
1072 Ga0466962_0037145 3300061719 Bacteria 2332
1073 Ga0530510_0001787 3300061734 Bacteria 14671

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300027717 Ga0209998_10013534 Ga0209998_100135342 309
2 3300003323 rootH1_10226436 rootH1_102264362 321
3 3300035116 Ga0373945_0122350 Ga0373945_0122350_16_993 321
4 3300047472 Ga0495686_0044990 Ga0495686_0044990_1691_2716 323
5 3300048909 Ga0496106_0000057 Ga0496106_0000057_51154_52233 323
6 3300048924 Ga0496121_0001363 Ga0496121_0001363_71_1150 323
7 iso_pu_bacteria 2744054901 2746098622 326
8 3300025945 Ga0207679_10050032 Ga0207679_100500322 330
9 3300048924 Ga0496121_0125940 Ga0496121_0125940_600_1625 332
10 3300049581 Ga0501047_0006119 Ga0501047_0006119_9927_10973 340
11 3300049585 Ga0501069_0023492 Ga0501069_0023492_1658_2704 340
12 3300049586 Ga0501070_0000947 Ga0501070_0000947_4973_6019 340
13 3300049588 Ga0501072_0377954 Ga0501072_0377954_28_1074 340
14 3300049589 Ga0501073_0004108 Ga0501073_0004108_4287_5333 340
15 3300049590 Ga0501074_0000154 Ga0501074_0000154_160_1206 340
16 3300049741 Ga0501079_0016230 Ga0501079_0016230_3842_4888 340
17 3300049742 Ga0501080_0007533 Ga0501080_0007533_2068_3114 340
18 3300049744 Ga0501083_0000323 Ga0501083_0000323_18105_19151 340
19 3300049823 Ga0501044_0175060 Ga0501044_0175060_966_2012 340
20 3300054114 Ga0501084_0157235 Ga0501084_0157235_83_1129 340
21 3300060353 Ga0501082_0026224 Ga0501082_0026224_671_1717 340
22 3300048921 Ga0496118_0006519 Ga0496118_0006519_10389_11483 341
23 iso_pu_bacteria 642555112 642592781 344
24 3300009177 Ga0105248_10098527 Ga0105248_100985272 345
25 3300044673 Ga0453683_0264697 Ga0453683_0264697_35_1087 346
26 3300046519 Ga0495632_0001537 Ga0495632_0001537_4761_5948 346
27 iso_pu_bacteria 2791355137 2792836360 346
28 iso_pu_bacteria 2904615490 2904617192 346
29 3300025941 Ga0207711_10075386 Ga0207711_100753862 347
30 3300048903 Ga0496100_0050038 Ga0496100_0050038_534_1703 347
31 3300048919 Ga0496116_0071475 Ga0496116_0071475_995_2170 347
32 3300048920 Ga0496117_0029317 Ga0496117_0029317_1392_2603 347
33 3300048929 Ga0496126_0010374 Ga0496126_0010374_6741_7952 347
34 3300026035 Ga0207703_10167363 Ga0207703_101673631 348
35 3300053093 Ga0500651_0011852 Ga0500651_0011852_3860_5047 348
36 3300053131 Ga0500652_000222 Ga0500652_000222_18054_19241 348
37 3300053156 Ga0500622_0000106 Ga0500622_0000106_62733_63920 348
38 3300005548 Ga0070665_100019940 Ga0070665_1000199402 351
39 3300009177 Ga0105248_10022654 Ga0105248_100226544 351
40 3300005355 Ga0070671_100005263 Ga0070671_1000052635 352
41 3300006881 Ga0068865_100195238 Ga0068865_1001952382 352
42 3300005262 Ga0065165_1000829 Ga0065165_100082913 353
43 3300005335 Ga0070666_10002729 Ga0070666_100027292 353
44 3300005364 Ga0070673_100000997 Ga0070673_1000009977 353
45 3300005719 Ga0068861_100073347 Ga0068861_1000733472 353
46 3300006353 Ga0075370_10024173 Ga0075370_100241733 353
47 3300009177 Ga0105248_10382994 Ga0105248_103829942 353
48 3300013306 Ga0163162_10124008 Ga0163162_101240082 353
49 3300026088 Ga0207641_10006504 Ga0207641_100065042 353
50 3300026095 Ga0207676_10004269 Ga0207676_1000426910 353
51 3300025298 Ga0209050_1000325 Ga0209050_100032521 354
52 3300025941 Ga0207711_10023259 Ga0207711_100232595 354
53 3300053086 Ga0500578_0000263 Ga0500578_0000263_61339_62553 354
54 3300005530 Ga0070679_100064660 Ga0070679_1000646605 355
55 3300005539 Ga0068853_100020835 Ga0068853_1000208355 355
56 3300009174 Ga0105241_10014958 Ga0105241_100149584 355
57 3300025911 Ga0207654_10042716 Ga0207654_100427162 355
58 3300025921 Ga0207652_10056202 Ga0207652_100562025 355
59 3300038741 Ga0400488_34059 Ga0400488_34059_127_1245 355
60 3300046472 Ga0495580_0005448 Ga0495580_0005448_5913_7118 355
61 3300046678 Ga0495599_0028409 Ga0495599_0028409_734_1939 355
62 3300046680 Ga0495646_0017945 Ga0495646_0017945_1309_2514 355
63 iso_pu_bacteria 2515154122 2515679593 356
64 iso_pu_bacteria 2902682994 2902689762 356
65 3300005328 Ga0070676_10000517 Ga0070676_100005179 357
66 3300005333 Ga0070677_10000841 Ga0070677_100008411 357
67 3300005338 Ga0068868_100008699 Ga0068868_1000086992 357
68 3300005347 Ga0070668_100000763 Ga0070668_10000076318 357
69 3300005354 Ga0070675_100002259 Ga0070675_1000022592 357
70 3300005356 Ga0070674_100002343 Ga0070674_1000023437 357
71 3300005367 Ga0070667_100041401 Ga0070667_1000414012 357
72 3300005455 Ga0070663_100002261 Ga0070663_1000022618 357
73 3300005456 Ga0070678_100035520 Ga0070678_1000355202 357
74 3300005459 Ga0068867_100030399 Ga0068867_1000303993 357
75 3300005543 Ga0070672_100001495 Ga0070672_10000149510 357
76 3300005578 Ga0068854_100167829 Ga0068854_1001678292 357
77 3300005618 Ga0068864_100004509 Ga0068864_10000450910 357
78 3300005834 Ga0068851_10013511 Ga0068851_100135112 357
79 3300005840 Ga0068870_10004049 Ga0068870_100040493 357
80 3300005841 Ga0068863_100021596 Ga0068863_1000215963 357
81 3300005842 Ga0068858_100109672 Ga0068858_1001096721 357
82 3300013308 Ga0157375_10007145 Ga0157375_1000714510 357
83 3300017792 Ga0163161_10019582 Ga0163161_100195823 357
84 3300025893 Ga0207682_10001681 Ga0207682_100016811 357
85 3300025907 Ga0207645_10000139 Ga0207645_1000013910 357
86 3300025908 Ga0207643_10003241 Ga0207643_100032414 357
87 3300025937 Ga0207669_10007041 Ga0207669_100070412 357
88 3300025940 Ga0207691_10000040 Ga0207691_100000406 357
89 3300025960 Ga0207651_10001104 Ga0207651_100011043 357
90 3300025972 Ga0207668_10004194 Ga0207668_100041949 357
91 3300025986 Ga0207658_10001791 Ga0207658_100017917 357
92 3300026023 Ga0207677_10010657 Ga0207677_100106575 357
93 3300026041 Ga0207639_10041337 Ga0207639_100413372 357
94 3300026067 Ga0207678_10008272 Ga0207678_100082722 357
95 3300026089 Ga0207648_10002691 Ga0207648_100026919 357
96 3300026121 Ga0207683_10000059 Ga0207683_1000005965 357
97 3300028379 Ga0268266_10096070 Ga0268266_100960702 357
98 3300038726 Ga0400490_58038 Ga0400490_58038_839_1972 358
99 3300039062 Ga0400483_097649 Ga0400483_097649_432_1562 358
100 3300039062 Ga0400483_186689 Ga0400483_186689_1672_2805 358
101 3300050509 nmdc:mga0qj67_16296_c1 nmdc:mga0qj67_16296_c1_3972_5060 358
102 3300050510 nmdc:mga06r32_119780_c1 nmdc:mga06r32_119780_c1_1196_2284 358
103 3300048928 Ga0496125_0165833 Ga0496125_0165833_11_1105 359
104 3300003756 Ga0055533_1000298 Ga0055533_100029814 360
105 3300006195 Ga0075366_10005164 Ga0075366_100051644 360
106 3300006871 Ga0075434_100317952 Ga0075434_1003179521 360
107 3300032002 Ga0307416_100035021 Ga0307416_1000350215 360
108 3300050493 nmdc:mga0k408_5742_c1 nmdc:mga0k408_5742_c1_2808_3965 360
109 3300050512 nmdc:mga0n895_225979_c1 nmdc:mga0n895_225979_c1_185_1348 360
110 3300005336 Ga0070680_100040619 Ga0070680_1000406191 362
111 3300005434 Ga0070709_10077189 Ga0070709_100771892 362
112 3300005458 Ga0070681_10027285 Ga0070681_100272855 362
113 3300005530 Ga0070679_100044748 Ga0070679_1000447482 362
114 3300005563 Ga0068855_100090357 Ga0068855_1000903572 362
115 3300005614 Ga0068856_100179120 Ga0068856_1001791202 362
116 3300025912 Ga0207707_10039893 Ga0207707_100398933 362
117 3300025917 Ga0207660_10240480 Ga0207660_102404802 362
118 3300025921 Ga0207652_10016549 Ga0207652_100165493 362
119 3300026116 Ga0207674_10189663 Ga0207674_101896632 362
120 3300046663 Ga0495635_0227434 Ga0495635_0227434_26_1174 362
121 3300049824 Ga0501045_0021521 Ga0501045_0021521_1731_2927 362
122 3300025981 Ga0207640_10155935 Ga0207640_101559351 363
123 3300048909 Ga0496106_0334066 Ga0496106_0334066_42_1187 363
124 3300028380 Ga0268265_10248455 Ga0268265_102484552 364
125 3300033528 Ga0316588_1011099 Ga0316588_10110991 364
126 iso_pu_bacteria 2738541296 2738820840 364
127 iso_pu_bacteria 2738541298 2738833321 364
128 iso_pu_bacteria 2738541306 2738874848 364
129 iso_pu_bacteria 2738543002 2739186478 364
130 iso_pu_bacteria 2738543008 2739221446 364
131 iso_pu_bacteria 2904483920 2904484998 364
132 iso_pu_bacteria 2919527303 2919530722 364
133 iso_pu_bacteria 2945934425 2945936873 364
134 iso_pu_bacteria 2990703756 2990706401 364
135 iso_pu_bacteria 641736151 642423220 364
136 iso_pu_bacteria 8055301274 8055302481 364
137 3300031239 Ga0265328_10000248 Ga0265328_1000024814 365
138 3300031250 Ga0265331_10000121 Ga0265331_1000012134 365
139 3300031251 Ga0265327_10000269 Ga0265327_1000026934 365
140 3300046529 Ga0495652_0121675 Ga0495652_0121675_877_2007 365
141 3300009177 Ga0105248_10218733 Ga0105248_102187332 366
142 3300028573 Ga0265334_10000283 Ga0265334_100002838 366
143 3300039062 Ga0400483_056583 Ga0400483_056583_623_1786 366
144 3300039062 Ga0400483_233228 Ga0400483_233228_531_1694 366
145 3300013308 Ga0157375_10076136 Ga0157375_100761362 367
146 3300049581 Ga0501047_0004461 Ga0501047_0004461_725_1888 367
147 iso_pu_bacteria 2510065045 2510250960 367
148 iso_pu_bacteria 2718217991 2719640094 367
149 3300001979 JGI24740J21852_10001633 JGI24740J21852_100016339 368
150 3300001989 JGI24739J22299_10017073 JGI24739J22299_100170732 368
151 3300002067 JGI24735J21928_10001866 JGI24735J21928_100018667 368
152 3300002705 JGI25156J39149_1001536 JGI25156J39149_10015363 368
153 3300003214 JGI25165J46597_1001137 JGI25165J46597_100113712 368
154 3300003758 Ga0055532_1000027 Ga0055532_1000027117 368
155 3300003760 Ga0055527_1000019 Ga0055527_100001983 368
156 3300003761 Ga0055535_1000021 Ga0055535_100002183 368
157 3300003762 Ga0055542_1000032 Ga0055542_1000032117 368
158 3300003763 Ga0055529_1000038 Ga0055529_100003883 368
159 3300014968 Ga0157379_10014832 Ga0157379_100148323 368
160 3300025226 Ga0209674_100005 Ga0209674_100005287 368
161 3300025228 Ga0209672_100001 Ga0209672_100001749 368
162 3300025229 Ga0209147_100001 Ga0209147_100001749 368
163 3300025230 Ga0209563_100316 Ga0209563_1003167 368
164 3300025231 Ga0207427_102214 Ga0207427_1022142 368
165 3300025242 Ga0209258_100001 Ga0209258_100001749 368
166 3300025254 Ga0209148_1000003 Ga0209148_1000003749 368
167 3300025256 Ga0209759_1000653 Ga0209759_100065314 368
168 3300025261 Ga0209233_1000043 Ga0209233_1000043173 368
169 3300025272 Ga0209455_1000001 Ga0209455_1000001749 368
170 3300025904 Ga0207647_10079605 Ga0207647_100796052 368
171 3300031911 Ga0307412_10000024 Ga0307412_1000002484 368
172 3300037312 Ga0395899_0064202 Ga0395899_0064202_337_1488 368
173 3300037418 Ga0395900_0066507 Ga0395900_0066507_1846_2997 368
174 3300037466 Ga0395898_0006750 Ga0395898_0006750_5775_6926 368
175 3300037471 Ga0395905_0007926 Ga0395905_0007926_3900_5051 368
176 3300037471 Ga0395905_0056223 Ga0395905_0056223_2040_3191 368
177 3300038443 Ga0395901_0008727 Ga0395901_0008727_8153_9304 368
178 3300044712 Ga0453684_0005034 Ga0453684_0005034_16459_17610 368
179 3300046454 Ga0495592_0004828 Ga0495592_0004828_3275_4438 368
180 3300046459 Ga0495629_0005971 Ga0495629_0005971_5882_7045 368
181 3300046461 Ga0495641_0063534 Ga0495641_0063534_228_1391 368
182 3300046463 Ga0495653_0006138 Ga0495653_0006138_3343_4506 368
183 3300046473 Ga0495582_0013708 Ga0495582_0013708_1542_2705 368
184 3300046474 Ga0495605_0013265 Ga0495605_0013265_1851_3053 368
185 3300046500 Ga0495596_0012325 Ga0495596_0012325_2185_3387 368
186 3300046507 Ga0495606_0030972 Ga0495606_0030972_1560_2723 368
187 3300046512 Ga0495610_0004267 Ga0495610_0004267_6201_7403 368
188 3300046514 Ga0495618_0004885 Ga0495618_0004885_3397_4560 368
189 3300046516 Ga0495628_0023443 Ga0495628_0023443_564_1727 368
190 3300046516 Ga0495628_0062015 Ga0495628_0062015_580_1743 368
191 3300046517 Ga0495630_0009508 Ga0495630_0009508_4303_5466 368
192 3300046529 Ga0495652_0025260 Ga0495652_0025260_3705_4868 368
193 3300046531 Ga0495665_0027117 Ga0495665_0027117_1280_2443 368
194 3300046533 Ga0495640_0015262 Ga0495640_0015262_2946_4109 368
195 3300046642 Ga0495634_0013440 Ga0495634_0013440_1620_2783 368
196 3300046663 Ga0495635_0052464 Ga0495635_0052464_335_1498 368
197 3300046679 Ga0495623_0003003 Ga0495623_0003003_5348_6511 368
198 3300046680 Ga0495646_0000873 Ga0495646_0000873_10286_11449 368
199 3300046690 Ga0495624_0014713 Ga0495624_0014713_3503_4666 368
200 3300046694 Ga0495649_0012381 Ga0495649_0012381_1932_3095 368
201 3300046809 Ga0495600_0017120 Ga0495600_0017120_3239_4402 368
202 3300047315 Ga0495581_0012476 Ga0495581_0012476_1913_3076 368
203 3300047317 Ga0495604_0045124 Ga0495604_0045124_558_1721 368
204 3300047322 Ga0495680_0010644 Ga0495680_0010644_3468_4631 368
205 3300047323 Ga0495683_0006459 Ga0495683_0006459_1194_2357 368
206 3300047323 Ga0495683_0045687 Ga0495683_0045687_221_1384 368
207 3300047443 Ga0495687_022887 Ga0495687_022887_173_1336 368
208 3300047444 Ga0495675_0063451 Ga0495675_0063451_303_1466 368
209 3300047673 Ga0495593_0011319 Ga0495593_0011319_151_1314 368
210 3300048089 Ga0495614_0000919 Ga0495614_0000919_3831_4994 368
211 3300005331 Ga0070670_100092546 Ga0070670_1000925462 369
212 3300030521 Ga0307511_10001921 Ga0307511_1000192112 369
213 3300009147 Ga0114129_10158521 Ga0114129_101585212 370
214 3300049575 Ga0501039_0010504 Ga0501039_0010504_3221_4360 370
215 3300049579 Ga0501043_0130587 Ga0501043_0130587_74_1213 370
216 3300049743 Ga0501081_0134174 Ga0501081_0134174_397_1536 370
217 3300050509 nmdc:mga0qj67_198187_c1 nmdc:mga0qj67_198187_c1_15_1151 370
218 3300005547 Ga0070693_100094422 Ga0070693_1000944222 371
219 3300005842 Ga0068858_100013573 Ga0068858_1000135735 371
220 3300006846 Ga0075430_100002756 Ga0075430_1000027569 371
221 3300006847 Ga0075431_100026939 Ga0075431_1000269392 371
222 3300006847 Ga0075431_100270310 Ga0075431_1002703102 371
223 3300009148 Ga0105243_10163091 Ga0105243_101630912 371
224 3300009176 Ga0105242_10000549 Ga0105242_1000054923 371
225 3300013306 Ga0163162_10032832 Ga0163162_100328325 371
226 3300021384 Ga0213876_10012565 Ga0213876_100125654 371
227 3300025935 Ga0207709_10025638 Ga0207709_100256382 371
228 3300031251 Ga0265327_10037150 Ga0265327_100371502 371
229 3300033179 Ga0307507_10068662 Ga0307507_100686623 371
230 3300039437 Ga0436365_1136772 Ga0436365_1136772_2923_4104 371
231 3300042001 Ga0439441_002052 Ga0439441_002052_422_1564 371
232 3300042436 Ga0439435_0001559 Ga0439435_0001559_2054_3196 371
233 3300049572 Ga0501036_0094613 Ga0501036_0094613_1363_2505 371
234 3300049573 Ga0501037_0213437 Ga0501037_0213437_138_1280 371
235 3300049574 Ga0501038_0111490 Ga0501038_0111490_793_1935 371
236 3300049576 Ga0501040_0010778 Ga0501040_0010778_1500_2642 371
237 3300049577 Ga0501041_0022688 Ga0501041_0022688_1540_2682 371
238 3300049579 Ga0501043_0090987 Ga0501043_0090987_121_1263 371
239 3300049587 Ga0501071_0196666 Ga0501071_0196666_234_1376 371
240 3300049588 Ga0501072_0003413 Ga0501072_0003413_544_1686 371
241 3300049590 Ga0501074_0055784 Ga0501074_0055784_298_1440 371
242 3300049591 Ga0501075_0016624 Ga0501075_0016624_2221_3363 371
243 3300049592 Ga0501076_0018894 Ga0501076_0018894_171_1313 371
244 3300049741 Ga0501079_0012375 Ga0501079_0012375_3910_5052 371
245 3300049742 Ga0501080_0081942 Ga0501080_0081942_1536_2678 371
246 3300049743 Ga0501081_0002208 Ga0501081_0002208_7360_8502 371
247 3300050496 nmdc:mga07m45_47186_c1 nmdc:mga07m45_47186_c1_1116_2273 371
248 3300050509 nmdc:mga0qj67_2813_c1 nmdc:mga0qj67_2813_c1_7093_8232 371
249 3300053134 Ga0500658_0053889 Ga0500658_0053889_254_1435 371
250 3300053139 Ga0500568_0005526 Ga0500568_0005526_1558_2739 371
251 3300054114 Ga0501084_0032083 Ga0501084_0032083_1580_2722 371
252 3300061719 Ga0466962_0037145 Ga0466962_0037145_22_1164 371
253 3300061734 Ga0530510_0001787 Ga0530510_0001787_11218_12360 371
254 3300005340 Ga0070689_100027641 Ga0070689_1000276415 372
255 3300005345 Ga0070692_10048567 Ga0070692_100485672 372
256 3300005456 Ga0070678_100257934 Ga0070678_1002579342 372
257 3300005545 Ga0070695_100005705 Ga0070695_1000057052 372
258 3300005546 Ga0070696_100300819 Ga0070696_1003008191 372
259 3300005547 Ga0070693_100003163 Ga0070693_10000316310 372
260 3300005549 Ga0070704_100001739 Ga0070704_1000017398 372
261 3300005614 Ga0068856_100272306 Ga0068856_1002723062 372
262 3300005842 Ga0068858_100050954 Ga0068858_1000509544 372
263 3300005842 Ga0068858_100059334 Ga0068858_1000593343 372
264 3300006237 Ga0097621_100002192 Ga0097621_1000021927 372
265 3300006358 Ga0068871_100002787 Ga0068871_1000027876 372
266 3300006358 Ga0068871_100004759 Ga0068871_1000047595 372
267 3300006358 Ga0068871_100105925 Ga0068871_1001059252 372
268 3300006846 Ga0075430_100026068 Ga0075430_1000260686 372
269 3300006881 Ga0068865_100010486 Ga0068865_1000104865 372
270 3300009147 Ga0114129_10277295 Ga0114129_102772952 372
271 3300009148 Ga0105243_10160343 Ga0105243_101603432 372
272 3300009176 Ga0105242_10013732 Ga0105242_100137325 372
273 3300009177 Ga0105248_10064049 Ga0105248_100640493 372
274 3300013296 Ga0157374_10067993 Ga0157374_100679932 372
275 3300014745 Ga0157377_10007732 Ga0157377_100077326 372
276 3300014969 Ga0157376_10051149 Ga0157376_100511492 372
277 3300025927 Ga0207687_10108892 Ga0207687_101088922 372
278 3300025931 Ga0207644_10086308 Ga0207644_100863082 372
279 3300025936 Ga0207670_10021686 Ga0207670_100216865 372
280 3300025936 Ga0207670_10055957 Ga0207670_100559572 372
281 3300025937 Ga0207669_10001739 Ga0207669_100017395 372
282 3300025941 Ga0207711_10360414 Ga0207711_103604142 372
283 3300026035 Ga0207703_10025265 Ga0207703_100252652 372
284 3300026116 Ga0207674_10123434 Ga0207674_101234342 372
285 3300035120 Ga0373957_0024703 Ga0373957_0024703_957_2108 372
286 3300035410 Ga0373924_0014795 Ga0373924_0014795_1582_2745 372
287 3300035724 Ga0373933_0042834 Ga0373933_0042834_1353_2504 372
288 3300036401 Ga0373937_0064145 Ga0373937_0064145_931_2082 372
289 3300036401 Ga0373937_0094401 Ga0373937_0094401_613_1764 372
290 3300046454 Ga0495592_0030711 Ga0495592_0030711_547_1698 372
291 3300046462 Ga0495651_0062263 Ga0495651_0062263_227_1378 372
292 3300046536 Ga0495587_0025732 Ga0495587_0025732_1450_2601 372
293 3300046543 Ga0495645_0001390 Ga0495645_0001390_3215_4366 372
294 3300046678 Ga0495599_0031314 Ga0495599_0031314_626_1777 372
295 3300046679 Ga0495623_0057304 Ga0495623_0057304_1287_2438 372
296 3300046809 Ga0495600_0036648 Ga0495600_0036648_597_1748 372
297 3300049572 Ga0501036_0093688 Ga0501036_0093688_1036_2175 372
298 3300049592 Ga0501076_0055560 Ga0501076_0055560_121_1317 372
299 3300050507 nmdc:mga05p37_238957_c1 nmdc:mga05p37_238957_c1_701_1852 372
300 3300050515 nmdc:mga0a205_50873_c1 nmdc:mga0a205_50873_c1_1945_3096 372
301 3300053077 Ga0495601_0067632 Ga0495601_0067632_111_1262 372
302 3300053085 Ga0495619_0007000 Ga0495619_0007000_1151_2302 372
303 3300053117 Ga0500593_000307 Ga0500593_000307_8129_9349 372
304 iso_pu_bacteria 2846033681 2846034663 372
305 iso_pu_bacteria 2846037992 2846042412 372
306 3300005546 Ga0070696_100083014 Ga0070696_1000830141 373
307 3300006844 Ga0075428_100021642 Ga0075428_1000216426 373
308 3300006914 Ga0075436_100044123 Ga0075436_1000441233 373
309 3300009094 Ga0111539_10000221 Ga0111539_1000022127 373
310 3300009174 Ga0105241_10152686 Ga0105241_101526862 373
311 3300009176 Ga0105242_10172660 Ga0105242_101726602 373
312 3300013105 Ga0157369_10085923 Ga0157369_100859233 373
313 3300013307 Ga0157372_10020389 Ga0157372_100203892 373
314 3300027876 Ga0209974_10003050 Ga0209974_100030505 373
315 3300027907 Ga0207428_10002089 Ga0207428_1000208918 373
316 3300039437 Ga0436365_1444604 Ga0436365_1444604_3245_4408 373
317 3300042001 Ga0439441_001520 Ga0439441_001520_1403_2563 373
318 3300044693 Ga0466961_0027876 Ga0466961_0027876_2425_3591 373
319 3300049581 Ga0501047_0107967 Ga0501047_0107967_41_1198 373
320 iso_pu_bacteria 2547132103 2547373400 373
321 iso_pu_bacteria 2843690924 2843693644 373
322 iso_pu_bacteria 2998344455 2998346477 373
323 3300002773 JGI25152J39213_1001685 JGI25152J39213_10016856 374
324 3300003215 JGI25153J46596_10002290 JGI25153J46596_100022905 374
325 3300003322 rootL2_10018167 rootL2_1001816711 374
326 3300003771 Ga0055526_1002527 Ga0055526_100252712 374
327 3300005328 Ga0070676_10054997 Ga0070676_100549973 374
328 3300005347 Ga0070668_100048882 Ga0070668_1000488822 374
329 3300005354 Ga0070675_100005570 Ga0070675_1000055707 374
330 3300005354 Ga0070675_100141069 Ga0070675_1001410691 374
331 3300005364 Ga0070673_100078877 Ga0070673_1000788773 374
332 3300005435 Ga0070714_100010609 Ga0070714_1000106095 374
333 3300005438 Ga0070701_10005036 Ga0070701_100050363 374
334 3300005456 Ga0070678_100136429 Ga0070678_1001364292 374
335 3300005468 Ga0070707_100168969 Ga0070707_1001689692 374
336 3300005536 Ga0070697_100223077 Ga0070697_1002230772 374
337 3300005543 Ga0070672_100248111 Ga0070672_1002481112 374
338 3300005563 Ga0068855_100034213 Ga0068855_1000342135 374
339 3300005563 Ga0068855_100038658 Ga0068855_1000386585 374
340 3300005563 Ga0068855_100068824 Ga0068855_1000688242 374
341 3300005842 Ga0068858_100154182 Ga0068858_1001541822 374
342 3300005937 Ga0081455_10148817 Ga0081455_101488172 374
343 3300006844 Ga0075428_100004575 Ga0075428_10000457510 374
344 3300006847 Ga0075431_100428063 Ga0075431_1004280631 374
345 3300006880 Ga0075429_100036154 Ga0075429_1000361542 374
346 3300006914 Ga0075436_100130813 Ga0075436_1001308132 374
347 3300007076 Ga0075435_100005722 Ga0075435_1000057227 374
348 3300009093 Ga0105240_10062985 Ga0105240_100629855 374
349 3300009094 Ga0111539_10130663 Ga0111539_101306632 374
350 3300013104 Ga0157370_10003378 Ga0157370_100033784 374
351 3300013306 Ga0163162_10092453 Ga0163162_100924532 374
352 3300013307 Ga0157372_10044032 Ga0157372_100440324 374
353 3300013307 Ga0157372_10236882 Ga0157372_102368822 374
354 3300014326 Ga0157380_10397500 Ga0157380_103975001 374
355 3300021361 Ga0213872_10001248 Ga0213872_1000124817 374
356 3300025245 Ga0207425_1000204 Ga0207425_100020419 374
357 3300025258 Ga0209129_1000025 Ga0209129_1000025302 374
358 3300025295 Ga0209564_1000039 Ga0209564_1000039302 374
359 3300025297 Ga0209758_1000163 Ga0209758_100016362 374
360 3300025907 Ga0207645_10044036 Ga0207645_100440362 374
361 3300025913 Ga0207695_10074211 Ga0207695_100742112 374
362 3300025922 Ga0207646_10015044 Ga0207646_100150444 374
363 3300025926 Ga0207659_10005068 Ga0207659_100050682 374
364 3300025926 Ga0207659_10144889 Ga0207659_101448892 374
365 3300025940 Ga0207691_10110941 Ga0207691_101109412 374
366 3300025949 Ga0207667_10010633 Ga0207667_100106339 374
367 3300025949 Ga0207667_10035833 Ga0207667_100358332 374
368 3300026035 Ga0207703_10042463 Ga0207703_100424632 374
369 3300026067 Ga0207678_10058455 Ga0207678_100584552 374
370 3300026121 Ga0207683_10138263 Ga0207683_101382632 374
371 3300027907 Ga0207428_10012217 Ga0207428_100122173 374
372 3300028380 Ga0268265_10340620 Ga0268265_103406201 374
373 3300032002 Ga0307416_100169176 Ga0307416_1001691762 374
374 3300035725 Ga0373947_0197050 Ga0373947_0197050_98_1261 374
375 3300037068 Ga0373925_0056454 Ga0373925_0056454_644_1795 374
376 3300045051 Ga0451576_0104340 Ga0451576_0104340_905_2131 374
377 3300048924 Ga0496121_0002978 Ga0496121_0002978_13783_15036 374
378 3300048929 Ga0496126_0003094 Ga0496126_0003094_6676_7929 374
379 3300050508 nmdc:mga09592_20118_c1 nmdc:mga09592_20118_c1_2151_3302 374
380 3300050511 nmdc:mga08y16_74968_c1 nmdc:mga08y16_74968_c1_2105_3256 374
381 3300050514 nmdc:mga08x19_35583_c1 nmdc:mga08x19_35583_c1_302_1477 374
382 3300050515 nmdc:mga0a205_56110_c1 nmdc:mga0a205_56110_c1_1250_2425 374
383 3300005290 Ga0065712_10099942 Ga0065712_100999422 375
384 3300005329 Ga0070683_100013357 Ga0070683_1000133578 375
385 3300005331 Ga0070670_100038658 Ga0070670_1000386582 375
386 3300005331 Ga0070670_100180946 Ga0070670_1001809462 375
387 3300005333 Ga0070677_10065814 Ga0070677_100658142 375
388 3300005335 Ga0070666_10138860 Ga0070666_101388601 375
389 3300005338 Ga0068868_100000153 Ga0068868_10000015347 375
390 3300005338 Ga0068868_100037804 Ga0068868_1000378042 375
391 3300005340 Ga0070689_100078786 Ga0070689_1000787862 375
392 3300005354 Ga0070675_100000357 Ga0070675_10000035718 375
393 3300005354 Ga0070675_100039654 Ga0070675_1000396542 375
394 3300005355 Ga0070671_100000242 Ga0070671_10000024239 375
395 3300005364 Ga0070673_100000155 Ga0070673_1000001556 375
396 3300005366 Ga0070659_100109791 Ga0070659_1001097912 375
397 3300005367 Ga0070667_100053864 Ga0070667_1000538643 375
398 3300005440 Ga0070705_100014218 Ga0070705_1000142181 375
399 3300005456 Ga0070678_100000156 Ga0070678_10000015619 375
400 3300005458 Ga0070681_10041710 Ga0070681_100417101 375
401 3300005458 Ga0070681_10092472 Ga0070681_100924722 375
402 3300005459 Ga0068867_100047303 Ga0068867_1000473032 375
403 3300005459 Ga0068867_100118672 Ga0068867_1001186722 375
404 3300005467 Ga0070706_100043477 Ga0070706_1000434771 375
405 3300005468 Ga0070707_100281679 Ga0070707_1002816791 375
406 3300005530 Ga0070679_100286776 Ga0070679_1002867761 375
407 3300005535 Ga0070684_100014717 Ga0070684_1000147175 375
408 3300005543 Ga0070672_100002103 Ga0070672_1000021037 375
409 3300005564 Ga0070664_100008892 Ga0070664_1000088925 375
410 3300005564 Ga0070664_100039520 Ga0070664_1000395204 375
411 3300005564 Ga0070664_100236530 Ga0070664_1002365302 375
412 3300005616 Ga0068852_100003751 Ga0068852_1000037516 375
413 3300005618 Ga0068864_100014723 Ga0068864_1000147232 375
414 3300005618 Ga0068864_100036524 Ga0068864_1000365243 375
415 3300005834 Ga0068851_10003644 Ga0068851_100036445 375
416 3300005841 Ga0068863_100020676 Ga0068863_1000206762 375
417 3300005841 Ga0068863_100026668 Ga0068863_1000266683 375
418 3300006178 Ga0075367_10047367 Ga0075367_100473672 375
419 3300006195 Ga0075366_10020757 Ga0075366_100207574 375
420 3300006237 Ga0097621_100001380 Ga0097621_1000013806 375
421 3300006237 Ga0097621_100118010 Ga0097621_1001180102 375
422 3300006358 Ga0068871_100000762 Ga0068871_1000007622 375
423 3300006871 Ga0075434_100200390 Ga0075434_1002003902 375
424 3300009177 Ga0105248_10124394 Ga0105248_101243942 375
425 3300013296 Ga0157374_10000275 Ga0157374_100002756 375
426 3300013306 Ga0163162_10032965 Ga0163162_100329654 375
427 3300013308 Ga0157375_10000496 Ga0157375_1000049629 375
428 3300014969 Ga0157376_10007439 Ga0157376_100074395 375
429 3300021361 Ga0213872_10013649 Ga0213872_100136492 375
430 3300025321 Ga0207656_10001933 Ga0207656_100019335 375
431 3300025893 Ga0207682_10077202 Ga0207682_100772021 375
432 3300025912 Ga0207707_10062126 Ga0207707_100621262 375
433 3300025912 Ga0207707_10209672 Ga0207707_102096722 375
434 3300025920 Ga0207649_10002440 Ga0207649_100024403 375
435 3300025922 Ga0207646_10100445 Ga0207646_101004451 375
436 3300025925 Ga0207650_10000941 Ga0207650_100009415 375
437 3300025925 Ga0207650_10078550 Ga0207650_100785502 375
438 3300025926 Ga0207659_10000927 Ga0207659_1000092717 375
439 3300025926 Ga0207659_10013208 Ga0207659_100132085 375
440 3300025931 Ga0207644_10001084 Ga0207644_1000108415 375
441 3300025940 Ga0207691_10003183 Ga0207691_100031839 375
442 3300025940 Ga0207691_10057778 Ga0207691_100577782 375
443 3300025944 Ga0207661_10004602 Ga0207661_100046027 375
444 3300025960 Ga0207651_10004093 Ga0207651_100040933 375
445 3300025986 Ga0207658_10032274 Ga0207658_100322744 375
446 3300026023 Ga0207677_10000466 Ga0207677_1000046626 375
447 3300026023 Ga0207677_10128795 Ga0207677_101287952 375
448 3300026041 Ga0207639_10308102 Ga0207639_103081022 375
449 3300026088 Ga0207641_10021182 Ga0207641_100211822 375
450 3300026088 Ga0207641_10096274 Ga0207641_100962742 375
451 3300026089 Ga0207648_10142233 Ga0207648_101422332 375
452 3300026095 Ga0207676_10004753 Ga0207676_100047533 375
453 3300026095 Ga0207676_10033209 Ga0207676_100332092 375
454 3300026121 Ga0207683_10000253 Ga0207683_1000025342 375
455 3300026142 Ga0207698_10000201 Ga0207698_1000020137 375
456 3300028381 Ga0268264_10178868 Ga0268264_101788682 375
457 3300028577 Ga0265318_10005313 Ga0265318_100053132 375
458 3300031238 Ga0265332_10003315 Ga0265332_100033156 375
459 3300031239 Ga0265328_10000961 Ga0265328_100009612 375
460 3300031240 Ga0265320_10066228 Ga0265320_100662282 375
461 3300031242 Ga0265329_10031919 Ga0265329_100319192 375
462 3300031250 Ga0265331_10008134 Ga0265331_100081344 375
463 3300031711 Ga0265314_10000335 Ga0265314_1000033568 375
464 3300031712 Ga0265342_10016254 Ga0265342_100162543 375
465 3300039447 Ga0436361_0344800 Ga0436361_0344800_39151_40305 375
466 3300039447 Ga0436361_0425404 Ga0436361_0425404_50_1204 375
467 3300039447 Ga0436361_0790144 Ga0436361_0790144_1772_2926 375
468 3300042876 Ga0451577_0115563 Ga0451577_0115563_192_1352 375
469 3300046679 Ga0495623_0031943 Ga0495623_0031943_1188_2360 375
470 3300048905 Ga0496102_0237261 Ga0496102_0237261_189_1346 375
471 3300048910 Ga0496107_0168199 Ga0496107_0168199_13_1170 375
472 3300048911 Ga0496108_0000486 Ga0496108_0000486_27128_28285 375
473 3300048912 Ga0496109_0016951 Ga0496109_0016951_981_2138 375
474 3300048913 Ga0496110_0002768 Ga0496110_0002768_10400_11557 375
475 3300048914 Ga0496111_0102777 Ga0496111_0102777_892_2049 375
476 3300050511 nmdc:mga08y16_217889_c1 nmdc:mga08y16_217889_c1_576_1736 375
477 3300005328 Ga0070676_10063854 Ga0070676_100638541 376
478 3300005329 Ga0070683_100135607 Ga0070683_1001356072 376
479 3300005331 Ga0070670_100000840 Ga0070670_10000084018 376
480 3300005331 Ga0070670_100107140 Ga0070670_1001071402 376
481 3300005334 Ga0068869_100000025 Ga0068869_10000002554 376
482 3300005336 Ga0070680_100007268 Ga0070680_1000072687 376
483 3300005337 Ga0070682_100034227 Ga0070682_1000342272 376
484 3300005338 Ga0068868_100115667 Ga0068868_1001156672 376
485 3300005339 Ga0070660_100046894 Ga0070660_1000468942 376
486 3300005344 Ga0070661_100047283 Ga0070661_1000472832 376
487 3300005347 Ga0070668_100017984 Ga0070668_1000179842 376
488 3300005347 Ga0070668_100023012 Ga0070668_1000230123 376
489 3300005353 Ga0070669_100004694 Ga0070669_10000469411 376
490 3300005365 Ga0070688_100169609 Ga0070688_1001696092 376
491 3300005367 Ga0070667_100002552 Ga0070667_10000255211 376
492 3300005435 Ga0070714_100036123 Ga0070714_1000361233 376
493 3300005436 Ga0070713_100042999 Ga0070713_1000429994 376
494 3300005440 Ga0070705_100003147 Ga0070705_1000031478 376
495 3300005444 Ga0070694_100228576 Ga0070694_1002285761 376
496 3300005445 Ga0070708_100000284 Ga0070708_10000028432 376
497 3300005457 Ga0070662_100131084 Ga0070662_1001310842 376
498 3300005459 Ga0068867_100001010 Ga0068867_1000010108 376
499 3300005467 Ga0070706_100122460 Ga0070706_1001224602 376
500 3300005535 Ga0070684_100007338 Ga0070684_1000073388 376
501 3300005539 Ga0068853_100129179 Ga0068853_1001291792 376
502 3300005545 Ga0070695_100106808 Ga0070695_1001068082 376
503 3300005563 Ga0068855_100160233 Ga0068855_1001602332 376
504 3300005577 Ga0068857_100030895 Ga0068857_1000308953 376
505 3300005616 Ga0068852_100041751 Ga0068852_1000417512 376
506 3300005617 Ga0068859_100000330 Ga0068859_1000003309 376
507 3300005618 Ga0068864_100002848 Ga0068864_1000028487 376
508 3300005719 Ga0068861_100002441 Ga0068861_1000024414 376
509 3300005719 Ga0068861_100085859 Ga0068861_1000858592 376
510 3300005841 Ga0068863_100147370 Ga0068863_1001473701 376
511 3300005842 Ga0068858_100001129 Ga0068858_10000112923 376
512 3300005843 Ga0068860_100028467 Ga0068860_1000284672 376
513 3300005843 Ga0068860_100043283 Ga0068860_1000432833 376
514 3300005844 Ga0068862_100008997 Ga0068862_1000089975 376
515 3300005844 Ga0068862_100009448 Ga0068862_1000094487 376
516 3300005844 Ga0068862_100096986 Ga0068862_1000969862 376
517 3300006195 Ga0075366_10000351 Ga0075366_1000035116 376
518 3300006846 Ga0075430_100108414 Ga0075430_1001084142 376
519 3300006931 Ga0097620_100000330 Ga0097620_1000003309 376
520 3300009011 Ga0105251_10054378 Ga0105251_100543782 376
521 3300009098 Ga0105245_10101269 Ga0105245_101012693 376
522 3300009101 Ga0105247_10031263 Ga0105247_100312632 376
523 3300009177 Ga0105248_10064143 Ga0105248_100641433 376
524 3300009551 Ga0105238_10058460 Ga0105238_100584604 376
525 3300009551 Ga0105238_10079380 Ga0105238_100793803 376
526 3300010375 Ga0105239_10191667 Ga0105239_101916672 376
527 3300013104 Ga0157370_10024558 Ga0157370_100245585 376
528 3300013105 Ga0157369_10142682 Ga0157369_101426823 376
529 3300013297 Ga0157378_10050630 Ga0157378_100506302 376
530 3300013307 Ga0157372_10238666 Ga0157372_102386661 376
531 3300013307 Ga0157372_10299446 Ga0157372_102994462 376
532 3300014325 Ga0163163_10001202 Ga0163163_100012027 376
533 3300014968 Ga0157379_10000522 Ga0157379_1000052211 376
534 3300025907 Ga0207645_10071567 Ga0207645_100715672 376
535 3300025910 Ga0207684_10157536 Ga0207684_101575362 376
536 3300025913 Ga0207695_10006054 Ga0207695_1000605410 376
537 3300025919 Ga0207657_10052627 Ga0207657_100526273 376
538 3300025922 Ga0207646_10038830 Ga0207646_100388302 376
539 3300025924 Ga0207694_10014128 Ga0207694_100141282 376
540 3300025925 Ga0207650_10002263 Ga0207650_100022637 376
541 3300025927 Ga0207687_10073272 Ga0207687_100732722 376
542 3300025928 Ga0207700_10021147 Ga0207700_100211472 376
543 3300025929 Ga0207664_10002967 Ga0207664_100029672 376
544 3300025933 Ga0207706_10081475 Ga0207706_100814752 376
545 3300025939 Ga0207665_10090395 Ga0207665_100903952 376
546 3300025941 Ga0207711_10005273 Ga0207711_1000527310 376
547 3300025942 Ga0207689_10000072 Ga0207689_100000722 376
548 3300025945 Ga0207679_10123897 Ga0207679_101238972 376
549 3300025949 Ga0207667_10048576 Ga0207667_100485764 376
550 3300025949 Ga0207667_10105884 Ga0207667_101058843 376
551 3300025972 Ga0207668_10005765 Ga0207668_100057653 376
552 3300025986 Ga0207658_10001880 Ga0207658_100018807 376
553 3300026035 Ga0207703_10000588 Ga0207703_1000058821 376
554 3300026078 Ga0207702_10038520 Ga0207702_100385202 376
555 3300026088 Ga0207641_10006806 Ga0207641_100068062 376
556 3300026088 Ga0207641_10058688 Ga0207641_100586882 376
557 3300026088 Ga0207641_10195314 Ga0207641_101953142 376
558 3300026089 Ga0207648_10006292 Ga0207648_100062927 376
559 3300026116 Ga0207674_10007322 Ga0207674_100073223 376
560 3300026116 Ga0207674_10041572 Ga0207674_100415723 376
561 3300026118 Ga0207675_100013547 Ga0207675_1000135473 376
562 3300028380 Ga0268265_10004497 Ga0268265_100044975 376
563 3300028381 Ga0268264_10000593 Ga0268264_1000059325 376
564 3300028381 Ga0268264_10046207 Ga0268264_100462072 376
565 3300031235 Ga0265330_10001350 Ga0265330_1000135011 376
566 3300031238 Ga0265332_10000724 Ga0265332_100007246 376
567 3300031242 Ga0265329_10016085 Ga0265329_100160852 376
568 3300031250 Ga0265331_10000579 Ga0265331_1000057925 376
569 3300035695 Ga0373927_0022674 Ga0373927_0022674_2105_3268 376
570 3300035695 Ga0373927_0064396 Ga0373927_0064396_214_1377 376
571 3300046472 Ga0495580_0129330 Ga0495580_0129330_514_1728 376
572 3300048905 Ga0496102_0032700 Ga0496102_0032700_1929_3116 376
573 3300048909 Ga0496106_0219757 Ga0496106_0219757_60_1232 376
574 3300048911 Ga0496108_0031689 Ga0496108_0031689_1297_2484 376
575 3300048912 Ga0496109_0089220 Ga0496109_0089220_421_1608 376
576 3300050493 nmdc:mga0k408_43_c1 nmdc:mga0k408_43_c1_19179_20354 376
577 3300050493 nmdc:mga0k408_46374_c1 nmdc:mga0k408_46374_c1_949_2121 376
578 3300053090 Ga0500646_0001369 Ga0500646_0001369_4355_5548 376
579 3300053092 Ga0500583_0000895 Ga0500583_0000895_6353_7546 376
580 3300053098 Ga0500650_0022196 Ga0500650_0022196_1293_2486 376
581 3300053139 Ga0500568_0015983 Ga0500568_0015983_592_1785 376
582 3300053151 Ga0500604_0002216 Ga0500604_0002216_694_1887 376
583 3300005328 Ga0070676_10008643 Ga0070676_100086434 377
584 3300005330 Ga0070690_100005993 Ga0070690_1000059937 377
585 3300005331 Ga0070670_100024603 Ga0070670_1000246032 377
586 3300005334 Ga0068869_100007817 Ga0068869_1000078177 377
587 3300005334 Ga0068869_100095891 Ga0068869_1000958912 377
588 3300005335 Ga0070666_10005405 Ga0070666_100054053 377
589 3300005335 Ga0070666_10025275 Ga0070666_100252753 377
590 3300005335 Ga0070666_10027493 Ga0070666_100274931 377
591 3300005338 Ga0068868_100002041 Ga0068868_1000020414 377
592 3300005338 Ga0068868_100009198 Ga0068868_1000091986 377
593 3300005338 Ga0068868_100022097 Ga0068868_1000220973 377
594 3300005340 Ga0070689_100006420 Ga0070689_1000064207 377
595 3300005347 Ga0070668_100009626 Ga0070668_1000096262 377
596 3300005347 Ga0070668_100011534 Ga0070668_1000115344 377
597 3300005347 Ga0070668_100084772 Ga0070668_1000847722 377
598 3300005353 Ga0070669_100015312 Ga0070669_1000153125 377
599 3300005354 Ga0070675_100019086 Ga0070675_1000190866 377
600 3300005355 Ga0070671_100066085 Ga0070671_1000660852 377
601 3300005355 Ga0070671_100132812 Ga0070671_1001328121 377
602 3300005356 Ga0070674_100005385 Ga0070674_1000053853 377
603 3300005356 Ga0070674_100081328 Ga0070674_1000813282 377
604 3300005364 Ga0070673_100004058 Ga0070673_1000040588 377
605 3300005364 Ga0070673_100004637 Ga0070673_1000046378 377
606 3300005365 Ga0070688_100086381 Ga0070688_1000863812 377
607 3300005367 Ga0070667_100004152 Ga0070667_10000415213 377
608 3300005434 Ga0070709_10007675 Ga0070709_100076755 377
609 3300005436 Ga0070713_100009983 Ga0070713_1000099834 377
610 3300005437 Ga0070710_10107654 Ga0070710_101076542 377
611 3300005438 Ga0070701_10032399 Ga0070701_100323992 377
612 3300005439 Ga0070711_100007315 Ga0070711_1000073153 377
613 3300005441 Ga0070700_100198029 Ga0070700_1001980291 377
614 3300005456 Ga0070678_100000721 Ga0070678_1000007217 377
615 3300005456 Ga0070678_100010063 Ga0070678_1000100635 377
616 3300005456 Ga0070678_100013459 Ga0070678_1000134592 377
617 3300005456 Ga0070678_100063975 Ga0070678_1000639752 377
618 3300005457 Ga0070662_100009809 Ga0070662_1000098093 377
619 3300005459 Ga0068867_100018859 Ga0068867_1000188594 377
620 3300005459 Ga0068867_100102182 Ga0068867_1001021821 377
621 3300005459 Ga0068867_100117868 Ga0068867_1001178682 377
622 3300005466 Ga0070685_10003047 Ga0070685_100030474 377
623 3300005471 Ga0070698_100193698 Ga0070698_1001936981 377
624 3300005543 Ga0070672_100013893 Ga0070672_1000138932 377
625 3300005544 Ga0070686_100035298 Ga0070686_1000352981 377
626 3300005547 Ga0070693_100000424 Ga0070693_1000004246 377
627 3300005548 Ga0070665_100001520 Ga0070665_10000152013 377
628 3300005548 Ga0070665_100008115 Ga0070665_1000081156 377
629 3300005548 Ga0070665_100037652 Ga0070665_1000376524 377
630 3300005564 Ga0070664_100122182 Ga0070664_1001221822 377
631 3300005578 Ga0068854_100016709 Ga0068854_1000167095 377
632 3300005614 Ga0068856_100016214 Ga0068856_1000162148 377
633 3300005614 Ga0068856_100107394 Ga0068856_1001073942 377
634 3300005615 Ga0070702_100005859 Ga0070702_1000058592 377
635 3300005617 Ga0068859_100002028 Ga0068859_1000020288 377
636 3300005618 Ga0068864_100028773 Ga0068864_1000287733 377
637 3300005718 Ga0068866_10002033 Ga0068866_100020331 377
638 3300005718 Ga0068866_10075280 Ga0068866_100752802 377
639 3300005719 Ga0068861_100021101 Ga0068861_1000211012 377
640 3300005840 Ga0068870_10169081 Ga0068870_101690811 377
641 3300005841 Ga0068863_100006665 Ga0068863_1000066658 377
642 3300005841 Ga0068863_100261846 Ga0068863_1002618462 377
643 3300005842 Ga0068858_100002436 Ga0068858_10000243615 377
644 3300005842 Ga0068858_100004241 Ga0068858_1000042413 377
645 3300005843 Ga0068860_100040120 Ga0068860_1000401206 377
646 3300005843 Ga0068860_100040515 Ga0068860_1000405152 377
647 3300005985 Ga0081539_10019224 Ga0081539_100192241 377
648 3300006163 Ga0070715_10054757 Ga0070715_100547572 377
649 3300006175 Ga0070712_100001901 Ga0070712_1000019018 377
650 3300006237 Ga0097621_100252304 Ga0097621_1002523042 377
651 3300006358 Ga0068871_100003172 Ga0068871_1000031722 377
652 3300006358 Ga0068871_100167058 Ga0068871_1001670582 377
653 3300006881 Ga0068865_100031163 Ga0068865_1000311632 377
654 3300006881 Ga0068865_100060143 Ga0068865_1000601432 377
655 3300006881 Ga0068865_100236788 Ga0068865_1002367882 377
656 3300006931 Ga0097620_100002027 Ga0097620_1000020278 377
657 3300007076 Ga0075435_100140283 Ga0075435_1001402832 377
658 3300009098 Ga0105245_10012205 Ga0105245_100122056 377
659 3300009098 Ga0105245_10013730 Ga0105245_100137307 377
660 3300009174 Ga0105241_10111414 Ga0105241_101114142 377
661 3300009176 Ga0105242_10006425 Ga0105242_100064255 377
662 3300009177 Ga0105248_10085491 Ga0105248_100854912 377
663 3300009177 Ga0105248_10154397 Ga0105248_101543972 377
664 3300013100 Ga0157373_10001173 Ga0157373_1000117312 377
665 3300013104 Ga0157370_10155245 Ga0157370_101552452 377
666 3300013296 Ga0157374_10000720 Ga0157374_100007202 377
667 3300013296 Ga0157374_10012528 Ga0157374_100125283 377
668 3300013297 Ga0157378_10016633 Ga0157378_100166337 377
669 3300013297 Ga0157378_10024566 Ga0157378_100245665 377
670 3300013297 Ga0157378_10032204 Ga0157378_100322044 377
671 3300013306 Ga0163162_10003105 Ga0163162_100031053 377
672 3300013306 Ga0163162_10037049 Ga0163162_100370493 377
673 3300013306 Ga0163162_10097486 Ga0163162_100974863 377
674 3300013308 Ga0157375_10062191 Ga0157375_100621913 377
675 3300013308 Ga0157375_10125827 Ga0157375_101258272 377
676 3300014325 Ga0163163_10001050 Ga0163163_1000105018 377
677 3300014325 Ga0163163_10181466 Ga0163163_101814662 377
678 3300014325 Ga0163163_10241955 Ga0163163_102419552 377
679 3300014326 Ga0157380_10022566 Ga0157380_100225662 377
680 3300014968 Ga0157379_10005174 Ga0157379_100051748 377
681 3300014968 Ga0157379_10026591 Ga0157379_100265916 377
682 3300014968 Ga0157379_10085077 Ga0157379_100850772 377
683 3300014969 Ga0157376_10012221 Ga0157376_100122217 377
684 3300014969 Ga0157376_10045385 Ga0157376_100453853 377
685 3300014969 Ga0157376_10069405 Ga0157376_100694052 377
686 3300017792 Ga0163161_10020767 Ga0163161_100207674 377
687 3300017792 Ga0163161_10052756 Ga0163161_100527563 377
688 3300021361 Ga0213872_10004727 Ga0213872_100047276 377
689 3300025315 Ga0207697_10008107 Ga0207697_100081072 377
690 3300025899 Ga0207642_10087800 Ga0207642_100878002 377
691 3300025903 Ga0207680_10002475 Ga0207680_100024756 377
692 3300025903 Ga0207680_10046078 Ga0207680_100460782 377
693 3300025903 Ga0207680_10054018 Ga0207680_100540182 377
694 3300025906 Ga0207699_10009040 Ga0207699_100090405 377
695 3300025907 Ga0207645_10000552 Ga0207645_1000055218 377
696 3300025908 Ga0207643_10128654 Ga0207643_101286542 377
697 3300025911 Ga0207654_10008861 Ga0207654_100088613 377
698 3300025915 Ga0207693_10000485 Ga0207693_1000048520 377
699 3300025918 Ga0207662_10047963 Ga0207662_100479632 377
700 3300025923 Ga0207681_10015575 Ga0207681_100155754 377
701 3300025925 Ga0207650_10034883 Ga0207650_100348833 377
702 3300025926 Ga0207659_10004009 Ga0207659_100040092 377
703 3300025927 Ga0207687_10001187 Ga0207687_1000118713 377
704 3300025927 Ga0207687_10001442 Ga0207687_100014422 377
705 3300025928 Ga0207700_10002838 Ga0207700_100028387 377
706 3300025931 Ga0207644_10091429 Ga0207644_100914292 377
707 3300025931 Ga0207644_10148418 Ga0207644_101484182 377
708 3300025931 Ga0207644_10158715 Ga0207644_101587152 377
709 3300025933 Ga0207706_10002935 Ga0207706_100029355 377
710 3300025934 Ga0207686_10000309 Ga0207686_1000030914 377
711 3300025935 Ga0207709_10077121 Ga0207709_100771212 377
712 3300025936 Ga0207670_10009322 Ga0207670_100093225 377
713 3300025937 Ga0207669_10047529 Ga0207669_100475292 377
714 3300025937 Ga0207669_10051974 Ga0207669_100519741 377
715 3300025938 Ga0207704_10146496 Ga0207704_101464962 377
716 3300025940 Ga0207691_10002356 Ga0207691_100023563 377
717 3300025940 Ga0207691_10019297 Ga0207691_100192974 377
718 3300025941 Ga0207711_10000115 Ga0207711_1000011541 377
719 3300025942 Ga0207689_10030747 Ga0207689_100307474 377
720 3300025942 Ga0207689_10095179 Ga0207689_100951792 377
721 3300025960 Ga0207651_10002517 Ga0207651_100025179 377
722 3300025960 Ga0207651_10049588 Ga0207651_100495882 377
723 3300025972 Ga0207668_10003609 Ga0207668_100036097 377
724 3300025972 Ga0207668_10009468 Ga0207668_100094682 377
725 3300025972 Ga0207668_10012410 Ga0207668_100124104 377
726 3300025972 Ga0207668_10054602 Ga0207668_100546022 377
727 3300025986 Ga0207658_10145958 Ga0207658_101459582 377
728 3300025986 Ga0207658_10183714 Ga0207658_101837141 377
729 3300026023 Ga0207677_10000210 Ga0207677_100002108 377
730 3300026023 Ga0207677_10015340 Ga0207677_100153403 377
731 3300026023 Ga0207677_10046095 Ga0207677_100460952 377
732 3300026035 Ga0207703_10001041 Ga0207703_1000104110 377
733 3300026035 Ga0207703_10073478 Ga0207703_100734783 377
734 3300026067 Ga0207678_10026447 Ga0207678_100264473 377
735 3300026078 Ga0207702_10070391 Ga0207702_100703913 377
736 3300026089 Ga0207648_10007093 Ga0207648_100070939 377
737 3300026089 Ga0207648_10022567 Ga0207648_100225675 377
738 3300026089 Ga0207648_10056084 Ga0207648_100560843 377
739 3300026095 Ga0207676_10000415 Ga0207676_1000041515 377
740 3300026095 Ga0207676_10129039 Ga0207676_101290392 377
741 3300026118 Ga0207675_100189570 Ga0207675_1001895702 377
742 3300026121 Ga0207683_10000685 Ga0207683_100006853 377
743 3300026121 Ga0207683_10001335 Ga0207683_1000133514 377
744 3300026121 Ga0207683_10007920 Ga0207683_100079205 377
745 3300026121 Ga0207683_10007980 Ga0207683_100079803 377
746 3300028379 Ga0268266_10007539 Ga0268266_100075394 377
747 3300028379 Ga0268266_10012063 Ga0268266_100120633 377
748 3300028381 Ga0268264_10003682 Ga0268264_100036825 377
749 3300028381 Ga0268264_10008255 Ga0268264_100082552 377
750 3300035111 Ga0373923_0012896 Ga0373923_0012896_823_2004 377
751 3300035118 Ga0373954_0003948 Ga0373954_0003948_4053_5231 377
752 3300035695 Ga0373927_0016881 Ga0373927_0016881_212_1393 377
753 3300035724 Ga0373933_0052519 Ga0373933_0052519_42_1223 377
754 3300036401 Ga0373937_0164192 Ga0373937_0164192_207_1388 377
755 3300039447 Ga0436361_0710868 Ga0436361_0710868_1093_2280 377
756 3300039447 Ga0436361_1094634 Ga0436361_1094634_2350_3537 377
757 3300046463 Ga0495653_0097954 Ga0495653_0097954_509_1690 377
758 3300046475 Ga0495639_0027307 Ga0495639_0027307_391_1572 377
759 3300046476 Ga0495662_0027126 Ga0495662_0027126_872_2053 377
760 3300046477 Ga0495664_0026066 Ga0495664_0026066_837_2015 377
761 3300046477 Ga0495664_0127524 Ga0495664_0127524_300_1481 377
762 3300046511 Ga0495608_0150035 Ga0495608_0150035_46_1227 377
763 3300046543 Ga0495645_0035169 Ga0495645_0035169_361_1539 377
764 3300046559 Ga0495667_0074479 Ga0495667_0074479_607_1788 377
765 3300046663 Ga0495635_0033283 Ga0495635_0033283_1139_2320 377
766 3300046664 Ga0495659_0020267 Ga0495659_0020267_642_1820 377
767 3300046678 Ga0495599_0144431 Ga0495599_0144431_166_1344 377
768 3300047315 Ga0495581_0056734 Ga0495581_0056734_766_1947 377
769 3300047322 Ga0495680_0066765 Ga0495680_0066765_1429_2610 377
770 3300047471 Ga0495684_0063252 Ga0495684_0063252_461_1642 377
771 3300048904 Ga0496101_0036880 Ga0496101_0036880_1810_2991 377
772 3300048904 Ga0496101_0053564 Ga0496101_0053564_354_1544 377
773 3300048907 Ga0496104_0024908 Ga0496104_0024908_1790_2971 377
774 3300048908 Ga0496105_0061685 Ga0496105_0061685_1239_2420 377
775 3300048912 Ga0496109_0008628 Ga0496109_0008628_4021_5202 377
776 3300053085 Ga0495619_0025667 Ga0495619_0025667_1037_2218 377
777 iso_pu_bacteria 2585428057 2587726811 377
778 iso_pu_bacteria 2585428058 2587732255 377
779 iso_pu_bacteria 2588253510 2588292226 377
780 iso_pu_bacteria 2643221592 2643971862 377
781 iso_pu_bacteria 2643221625 2644139351 377
782 iso_pu_bacteria 2643221648 2644274961 377
783 3300005331 Ga0070670_100015610 Ga0070670_1000156103 378
784 3300005354 Ga0070675_100011653 Ga0070675_1000116532 378
785 3300005355 Ga0070671_100074165 Ga0070671_1000741652 378
786 3300005367 Ga0070667_100053934 Ga0070667_1000539343 378
787 3300005367 Ga0070667_100195952 Ga0070667_1001959522 378
788 3300005441 Ga0070700_100071165 Ga0070700_1000711652 378
789 3300005456 Ga0070678_100302911 Ga0070678_1003029111 378
790 3300005543 Ga0070672_100007890 Ga0070672_1000078907 378
791 3300005548 Ga0070665_100032544 Ga0070665_1000325445 378
792 3300005617 Ga0068859_100158119 Ga0068859_1001581191 378
793 3300005618 Ga0068864_100207995 Ga0068864_1002079952 378
794 3300005618 Ga0068864_100231116 Ga0068864_1002311162 378
795 3300005840 Ga0068870_10007174 Ga0068870_100071742 378
796 3300005841 Ga0068863_100006649 Ga0068863_1000066493 378
797 3300005843 Ga0068860_100041401 Ga0068860_1000414015 378
798 3300006237 Ga0097621_100022732 Ga0097621_1000227323 378
799 3300006358 Ga0068871_100135613 Ga0068871_1001356132 378
800 3300006881 Ga0068865_100061945 Ga0068865_1000619453 378
801 3300006931 Ga0097620_100158117 Ga0097620_1001581171 378
802 3300009176 Ga0105242_10055740 Ga0105242_100557402 378
803 3300013297 Ga0157378_10076071 Ga0157378_100760712 378
804 3300013306 Ga0163162_10082285 Ga0163162_100822853 378
805 3300013308 Ga0157375_10171900 Ga0157375_101719002 378
806 3300014326 Ga0157380_10047477 Ga0157380_100474773 378
807 3300014969 Ga0157376_10132744 Ga0157376_101327442 378
808 3300017792 Ga0163161_10104945 Ga0163161_101049452 378
809 3300025908 Ga0207643_10016962 Ga0207643_100169623 378
810 3300025925 Ga0207650_10020999 Ga0207650_100209992 378
811 3300025936 Ga0207670_10108498 Ga0207670_101084982 378
812 3300025940 Ga0207691_10003046 Ga0207691_100030469 378
813 3300025942 Ga0207689_10013281 Ga0207689_100132812 378
814 3300025960 Ga0207651_10028274 Ga0207651_100282744 378
815 3300026088 Ga0207641_10033021 Ga0207641_100330214 378
816 3300026088 Ga0207641_10140870 Ga0207641_101408702 378
817 3300026089 Ga0207648_10003981 Ga0207648_100039812 378
818 3300026095 Ga0207676_10107699 Ga0207676_101076993 378
819 3300026095 Ga0207676_10117817 Ga0207676_101178172 378
820 3300026095 Ga0207676_10251697 Ga0207676_102516971 378
821 3300026118 Ga0207675_100010518 Ga0207675_1000105187 378
822 3300028381 Ga0268264_10097074 Ga0268264_100970742 378
823 3300049590 Ga0501074_0086636 Ga0501074_0086636_779_1942 378
824 3300003215 JGI25153J46596_10001268 JGI25153J46596_100012689 379
825 3300005336 Ga0070680_100133441 Ga0070680_1001334412 379
826 3300005353 Ga0070669_100021478 Ga0070669_1000214782 379
827 3300005354 Ga0070675_100008181 Ga0070675_1000081819 379
828 3300005364 Ga0070673_100034126 Ga0070673_1000341262 379
829 3300005367 Ga0070667_100081705 Ga0070667_1000817052 379
830 3300005459 Ga0068867_100030899 Ga0068867_1000308992 379
831 3300005543 Ga0070672_100000308 Ga0070672_10000030822 379
832 3300005841 Ga0068863_100043958 Ga0068863_1000439584 379
833 3300005843 Ga0068860_100016141 Ga0068860_1000161412 379
834 3300013306 Ga0163162_10134239 Ga0163162_101342393 379
835 3300013308 Ga0157375_10002056 Ga0157375_1000205610 379
836 3300014969 Ga0157376_10077384 Ga0157376_100773842 379
837 3300025297 Ga0209758_1000287 Ga0209758_100028725 379
838 3300025917 Ga0207660_10081834 Ga0207660_100818342 379
839 3300025923 Ga0207681_10041311 Ga0207681_100413112 379
840 3300025926 Ga0207659_10007116 Ga0207659_100071166 379
841 3300025933 Ga0207706_10037418 Ga0207706_100374182 379
842 3300025940 Ga0207691_10000403 Ga0207691_1000040339 379
843 3300025960 Ga0207651_10114358 Ga0207651_101143582 379
844 3300026088 Ga0207641_10023053 Ga0207641_100230535 379
845 3300026089 Ga0207648_10047026 Ga0207648_100470262 379
846 3300028381 Ga0268264_10059252 Ga0268264_100592523 379
847 3300049571 Ga0501034_0029028 Ga0501034_0029028_1635_2858 379
848 3300049581 Ga0501047_0066305 Ga0501047_0066305_1370_2593 379
849 3300049583 Ga0501067_0025898 Ga0501067_0025898_1275_2498 379
850 3300049585 Ga0501069_0032935 Ga0501069_0032935_94_1317 379
851 3300049588 Ga0501072_0049029 Ga0501072_0049029_625_1848 379
852 3300049589 Ga0501073_0002380 Ga0501073_0002380_5726_6949 379
853 3300049590 Ga0501074_0145498 Ga0501074_0145498_403_1626 379
854 3300049742 Ga0501080_0002945 Ga0501080_0002945_13647_14870 379
855 3300053154 Ga0500619_000055 Ga0500619_000055_7962_9167 379
856 3300005435 Ga0070714_100024800 Ga0070714_1000248002 380
857 3300005436 Ga0070713_100117360 Ga0070713_1001173602 380
858 3300005530 Ga0070679_100067697 Ga0070679_1000676973 380
859 3300025898 Ga0207692_10018818 Ga0207692_100188183 380
860 3300025921 Ga0207652_10119617 Ga0207652_101196172 380
861 3300047319 Ga0495674_0198891 Ga0495674_0198891_124_1317 382
862 3300047320 Ga0495672_0005863 Ga0495672_0005863_362_1573 382
863 3300028800 Ga0265338_10000373 Ga0265338_1000037341 384
864 3300003763 Ga0055529_1001446 Ga0055529_10014462 385
865 3300025272 Ga0209455_1001608 Ga0209455_10016082 385
866 3300046454 Ga0495592_0010112 Ga0495592_0010112_412_1641 385
867 3300046458 Ga0495591_001325 Ga0495591_001325_634_1863 385
868 3300046459 Ga0495629_0104523 Ga0495629_0104523_96_1325 385
869 3300046472 Ga0495580_0026593 Ga0495580_0026593_1257_2486 385
870 3300046473 Ga0495582_0117535 Ga0495582_0117535_193_1422 385
871 3300046477 Ga0495664_0067179 Ga0495664_0067179_36_1265 385
872 3300046500 Ga0495596_0001108 Ga0495596_0001108_9818_11047 385
873 3300046511 Ga0495608_0083529 Ga0495608_0083529_493_1722 385
874 3300046526 Ga0495666_0053263 Ga0495666_0053263_473_1702 385
875 3300046531 Ga0495665_0049735 Ga0495665_0049735_978_2207 385
876 3300046536 Ga0495587_0007249 Ga0495587_0007249_186_1415 385
877 3300046642 Ga0495634_0121224 Ga0495634_0121224_353_1582 385
878 3300046665 Ga0495661_0029315 Ga0495661_0029315_627_1856 385
879 3300046680 Ga0495646_0026756 Ga0495646_0026756_1671_2900 385
880 3300046692 Ga0495671_0070506 Ga0495671_0070506_283_1512 385
881 3300046809 Ga0495600_0045795 Ga0495600_0045795_1261_2490 385
882 3300047322 Ga0495680_0109406 Ga0495680_0109406_103_1332 385
883 3300047323 Ga0495683_0013657 Ga0495683_0013657_569_1798 385
884 3300047444 Ga0495675_0007474 Ga0495675_0007474_270_1499 385
885 3300047446 Ga0495679_003489 Ga0495679_003489_3887_5116 385
886 3300047469 Ga0495673_0053425 Ga0495673_0053425_469_1698 385
887 3300047673 Ga0495593_0003104 Ga0495593_0003104_921_2150 385
888 3300048089 Ga0495614_0037849 Ga0495614_0037849_747_1976 385
889 3300048905 Ga0496102_0009414 Ga0496102_0009414_6133_7362 385
890 3300048906 Ga0496103_0024131 Ga0496103_0024131_1216_2445 385
891 3300048920 Ga0496117_0007476 Ga0496117_0007476_8164_9393 385
892 3300048921 Ga0496118_0009854 Ga0496118_0009854_2327_3556 385
893 3300049822 Ga0501035_0004624 Ga0501035_0004624_7068_8285 385
894 iso_pu_bacteria 2599185239 2599736585 385
895 iso_pu_bacteria 2818991452 2819631069 385
896 iso_pu_bacteria 2928170801 2928171816 385
897 iso_pu_bacteria 8018845410 8018851456 385
898 iso_pu_bacteria 8021120328 8021122291 385
899 iso_pu_bacteria 8039098773 8039102465 385
900 iso_pu_bacteria 2582581311 2585291483 386
901 iso_pu_bacteria 2600255067 2600809675 386
902 iso_pu_bacteria 2744054900 2746087517 386
903 iso_pu_bacteria 2816332253 2817261289 386
904 iso_pu_bacteria 2816332256 2817278966 386
905 iso_pu_bacteria 2816332286 2817451310 386
906 iso_pu_bacteria 2818991450 2819620280 386
907 iso_pu_bacteria 2842324504 2842328218 386
908 iso_pu_bacteria 2842348783 2842352535 386
909 iso_pu_bacteria 2842454564 2842459571 386
910 iso_pu_bacteria 2856287931 2856293577 386
911 iso_pu_bacteria 2857357740 2857360735 386
912 iso_pu_bacteria 2900634093 2900634972 386
913 iso_pu_bacteria 2928108538 2928110158 386
914 iso_pu_bacteria 2928135762 2928138708 386
915 iso_pu_bacteria 2928157003 2928160119 386
916 iso_pu_bacteria 2928163908 2928168560 386
917 iso_pu_bacteria 2928503688 2928505205 386
918 iso_pu_bacteria 2981990288 2981994726 386
919 iso_pu_bacteria 641736154 642416751 386
920 iso_pu_bacteria 642555113 642621445 386
921 iso_pu_bacteria 8020807995 8020811725 386
922 iso_pu_bacteria 8040167225 8040168864 386
923 iso_pu_bacteria 8040173305 8040174790 386
924 3300037471 Ga0395905_0014860 Ga0395905_0014860_5493_6668 387
925 iso_pu_bacteria 2501025502 2501078965 387
926 iso_pu_bacteria 2510917013 2511086549 387
927 iso_pu_bacteria 2599185240 2599744644 387
928 iso_pu_bacteria 2599185355 2600205995 387
929 iso_pu_bacteria 2675903129 2676742770 387
930 iso_pu_bacteria 2863421361 2863424828 387
931 iso_pu_bacteria 2870068957 2870071092 387
932 iso_pu_bacteria 2885270888 2885278660 387
933 iso_pu_bacteria 2904564687 2904571056 387
934 iso_pu_bacteria 2904571731 2904575894 387
935 iso_pu_bacteria 2928536128 2928539969 387
936 iso_pu_bacteria 8020938398 8020945107 387
937 iso_pu_bacteria 8020945358 8020952655 387
938 iso_pu_bacteria 8020953355 8020956856 387
939 3300013105 Ga0157369_10019948 Ga0157369_100199484 388
940 3300046690 Ga0495624_0004402 Ga0495624_0004402_5849_7054 388
941 3300048929 Ga0496126_0004555 Ga0496126_0004555_3481_4686 388
942 iso_pu_bacteria 2501025501 2501074167 388
943 iso_pu_bacteria 2501025504 2501410898 388
944 iso_pu_bacteria 2510917014 2511096644 388
945 iso_pu_bacteria 2510917015 2511102719 388
946 iso_pu_bacteria 2513237082 2513555839 388
947 iso_pu_bacteria 2513237083 2513563719 388
948 iso_pu_bacteria 2515154189 2516022744 388
949 iso_pu_bacteria 2808606384 2808972299 388
950 iso_pu_bacteria 2808606390 2809007128 388
951 iso_pu_bacteria 2808606391 2809014266 388
952 iso_pu_bacteria 2883087390 2883091239 388
953 iso_pu_bacteria 8003955200 8003955378 388
954 3300003758 Ga0055532_1002139 Ga0055532_10021393 389
955 3300025225 Ga0209566_100236 Ga0209566_10023614 389
956 3300025226 Ga0209674_103278 Ga0209674_1032782 389
957 3300025229 Ga0209147_100346 Ga0209147_10034615 389
958 3300047322 Ga0495680_0160246 Ga0495680_0160246_34_1281 389
959 3300048088 Ga0495602_0008283 Ga0495602_0008283_2941_4188 389
960 3300002705 JGI25156J39149_1000677 JGI25156J39149_10006779 390
961 3300002705 JGI25156J39149_1000900 JGI25156J39149_10009004 390
962 3300005327 Ga0070658_10118446 Ga0070658_101184462 390
963 3300005339 Ga0070660_100004671 Ga0070660_1000046718 390
964 3300005366 Ga0070659_100000788 Ga0070659_10000078811 390
965 3300005367 Ga0070667_100150545 Ga0070667_1001505452 390
966 3300005455 Ga0070663_100008366 Ga0070663_1000083665 390
967 3300009011 Ga0105251_10000184 Ga0105251_1000018418 390
968 3300009551 Ga0105238_10053955 Ga0105238_100539552 390
969 3300010375 Ga0105239_10019206 Ga0105239_100192068 390
970 3300015262 Ga0182007_10000413 Ga0182007_100004135 390
971 3300025256 Ga0209759_1000531 Ga0209759_100053132 390
972 3300025735 Ga0207713_1000487 Ga0207713_100048718 390
973 3300025904 Ga0207647_10007627 Ga0207647_100076277 390
974 3300025904 Ga0207647_10048170 Ga0207647_100481702 390
975 3300025919 Ga0207657_10000004 Ga0207657_10000004136 390
976 3300025924 Ga0207694_10061375 Ga0207694_100613753 390
977 3300025932 Ga0207690_10000015 Ga0207690_10000015156 390
978 3300026067 Ga0207678_10002010 Ga0207678_1000201014 390
979 3300032005 Ga0307411_10104579 Ga0307411_101045791 390
980 3300039447 Ga0436361_0602169 Ga0436361_0602169_647_1888 390
981 3300044656 Ga0466969_0009926 Ga0466969_0009926_801_2027 390
982 3300044683 Ga0466965_0001301 Ga0466965_0001301_5117_6343 390
983 3300044684 Ga0466966_0000061 Ga0466966_0000061_47893_49122 390
984 3300044684 Ga0466966_0022688 Ga0466966_0022688_119_1345 390
985 3300044693 Ga0466961_0004882 Ga0466961_0004882_3808_5037 390
986 3300044719 Ga0466971_0002146 Ga0466971_0002146_5830_7056 390
987 3300044842 Ga0466957_0013768 Ga0466957_0013768_1438_2664 390
988 3300045049 Ga0466959_0000534 Ga0466959_0000534_7678_8904 390
989 3300045049 Ga0466959_0155859 Ga0466959_0155859_138_1367 390
990 3300045836 Ga0466958_0006210 Ga0466958_0006210_2868_4097 390
991 3300046455 Ga0495603_0005929 Ga0495603_0005929_1539_2756 390
992 3300046459 Ga0495629_0000072 Ga0495629_0000072_48433_49677 390
993 3300046459 Ga0495629_0003554 Ga0495629_0003554_4574_5791 390
994 3300046460 Ga0495638_0015833 Ga0495638_0015833_1796_3040 390
995 3300046462 Ga0495651_0097593 Ga0495651_0097593_410_1654 390
996 3300046463 Ga0495653_0006488 Ga0495653_0006488_6988_8232 390
997 3300046463 Ga0495653_0007055 Ga0495653_0007055_5949_7166 390
998 3300046471 Ga0495650_0002225 Ga0495650_0002225_2189_3433 390
999 3300046472 Ga0495580_0001816 Ga0495580_0001816_1185_2402 390
1000 3300046472 Ga0495580_0012106 Ga0495580_0012106_2281_3525 390
1001 3300046472 Ga0495580_0014975 Ga0495580_0014975_2354_3571 390
1002 3300046472 Ga0495580_0020329 Ga0495580_0020329_2276_3520 390
1003 3300046473 Ga0495582_0004789 Ga0495582_0004789_425_1642 390
1004 3300046476 Ga0495662_0017421 Ga0495662_0017421_872_2089 390
1005 3300046477 Ga0495664_0002912 Ga0495664_0002912_5972_7189 390
1006 3300046506 Ga0495583_0016894 Ga0495583_0016894_1110_2354 390
1007 3300046514 Ga0495618_0004027 Ga0495618_0004027_1840_3057 390
1008 3300046516 Ga0495628_0002857 Ga0495628_0002857_9768_10985 390
1009 3300046516 Ga0495628_0014737 Ga0495628_0014737_3042_4286 390
1010 3300046524 Ga0495648_0008331 Ga0495648_0008331_976_2193 390
1011 3300046524 Ga0495648_0111426 Ga0495648_0111426_123_1367 390
1012 3300046526 Ga0495666_0006557 Ga0495666_0006557_4312_5529 390
1013 3300046529 Ga0495652_0017963 Ga0495652_0017963_728_1945 390
1014 3300046531 Ga0495665_0013752 Ga0495665_0013752_1621_2865 390
1015 3300046531 Ga0495665_0045881 Ga0495665_0045881_360_1577 390
1016 3300046533 Ga0495640_0018849 Ga0495640_0018849_1468_2685 390
1017 3300046536 Ga0495587_0001551 Ga0495587_0001551_6616_7833 390
1018 3300046557 Ga0495622_0000298 Ga0495622_0000298_6871_8118 390
1019 3300046642 Ga0495634_0003726 Ga0495634_0003726_4543_5760 390
1020 3300046663 Ga0495635_0028265 Ga0495635_0028265_1098_2315 390
1021 3300046665 Ga0495661_0001700 Ga0495661_0001700_5574_6791 390
1022 3300046665 Ga0495661_0017025 Ga0495661_0017025_839_2083 390
1023 3300046680 Ga0495646_0004121 Ga0495646_0004121_7451_8668 390
1024 3300046680 Ga0495646_0015543 Ga0495646_0015543_205_1449 390
1025 3300046689 Ga0495613_0003582 Ga0495613_0003582_6056_7273 390
1026 3300046690 Ga0495624_0006224 Ga0495624_0006224_6539_7756 390
1027 3300047315 Ga0495581_0069765 Ga0495581_0069765_360_1577 390
1028 3300047317 Ga0495604_0034234 Ga0495604_0034234_1728_2945 390
1029 3300047317 Ga0495604_0117183 Ga0495604_0117183_505_1749 390
1030 3300047319 Ga0495674_0010174 Ga0495674_0010174_2276_3520 390
1031 3300047319 Ga0495674_0019899 Ga0495674_0019899_328_1545 390
1032 3300047319 Ga0495674_0030287 Ga0495674_0030287_1397_2641 390
1033 3300047320 Ga0495672_0028079 Ga0495672_0028079_2018_3262 390
1034 3300047321 Ga0495676_0019089 Ga0495676_0019089_3623_4840 390
1035 3300047322 Ga0495680_0035133 Ga0495680_0035133_2157_3374 390
1036 3300047443 Ga0495687_025139 Ga0495687_025139_1118_2362 390
1037 3300047444 Ga0495675_0008305 Ga0495675_0008305_1971_3215 390
1038 3300047444 Ga0495675_0116388 Ga0495675_0116388_98_1315 390
1039 3300047446 Ga0495679_000084 Ga0495679_000084_80307_81551 390
1040 3300047446 Ga0495679_002887 Ga0495679_002887_1313_2530 390
1041 3300047446 Ga0495679_016842 Ga0495679_016842_848_2065 390
1042 3300047470 Ga0495681_0021664 Ga0495681_0021664_1541_2758 390
1043 3300047471 Ga0495684_0027934 Ga0495684_0027934_1566_2783 390
1044 3300047673 Ga0495593_0002301 Ga0495593_0002301_7460_8704 390
1045 3300048088 Ga0495602_0015149 Ga0495602_0015149_2025_3242 390
1046 3300048088 Ga0495602_0084025 Ga0495602_0084025_587_1831 390
1047 3300048089 Ga0495614_0002622 Ga0495614_0002622_5239_6456 390
1048 3300048906 Ga0496103_0057687 Ga0496103_0057687_968_2212 390
1049 3300048920 Ga0496117_0019088 Ga0496117_0019088_406_1650 390
1050 3300048921 Ga0496118_0003743 Ga0496118_0003743_7534_8778 390
1051 3300048921 Ga0496118_0014461 Ga0496118_0014461_4601_5845 390
1052 3300048924 Ga0496121_0019881 Ga0496121_0019881_3007_4251 390
1053 3300049459 Ga0495678_030728 Ga0495678_030728_277_1521 390
1054 3300061719 Ga0466962_0011801 Ga0466962_0011801_2385_3611 390
1055 iso_pu_bacteria 2519103095 2519458994 390
1056 iso_pu_bacteria 2596583598 2597032315 390
1057 iso_pu_bacteria 2599185178 2599444306 390
1058 iso_pu_bacteria 2885266251 2885268517 390
1059 iso_pu_bacteria 2900577576 2900581006 390
1060 iso_pu_bacteria 2928058823 2928063211 390
1061 3300003758 Ga0055532_1001399 Ga0055532_10013994 391
1062 3300003758 Ga0055532_1002138 Ga0055532_10021383 391
1063 3300003760 Ga0055527_1000441 Ga0055527_10004416 391
1064 3300003760 Ga0055527_1000442 Ga0055527_10004426 391
1065 3300003761 Ga0055535_1001096 Ga0055535_10010966 391
1066 3300003761 Ga0055535_1001098 Ga0055535_10010986 391
1067 3300003762 Ga0055542_1001083 Ga0055542_10010836 391
1068 3300003762 Ga0055542_1002409 Ga0055542_10024097 391
1069 3300003763 Ga0055529_1000760 Ga0055529_100076010 391
1070 3300003790 Ga0055528_1002190 Ga0055528_10021906 391
1071 3300009093 Ga0105240_10016312 Ga0105240_100163125 391
1072 3300025228 Ga0209672_100014 Ga0209672_100014265 391
1073 3300025228 Ga0209672_100023 Ga0209672_100023287 391
1074 3300025229 Ga0209147_100094 Ga0209147_10009455 391
1075 3300025229 Ga0209147_100104 Ga0209147_10010416 391
1076 3300025242 Ga0209258_100040 Ga0209258_100040240 391
1077 3300025242 Ga0209258_100142 Ga0209258_10014244 391
1078 3300025254 Ga0209148_1000035 Ga0209148_1000035240 391
1079 3300025254 Ga0209148_1000980 Ga0209148_10009806 391
1080 3300025256 Ga0209759_1001922 Ga0209759_10019223 391
1081 3300025272 Ga0209455_1000072 Ga0209455_1000072212 391
1082 3300025272 Ga0209455_1004730 Ga0209455_10047302 391
1083 3300025273 Ga0209673_1000030 Ga0209673_1000030176 391
1084 3300025291 Ga0209675_1016192 Ga0209675_10161922 391
1085 3300025913 Ga0207695_10012711 Ga0207695_100127118 391
1086 3300027312 Ga0209371_1000290 Ga0209371_100029041 391
1087 3300030500 Ga0268256_1000224 Ga0268256_100022447 391
1088 3300037312 Ga0395899_0070116 Ga0395899_0070116_1111_2343 391
1089 3300044666 Ga0466977_0002241 Ga0466977_0002241_846_2138 391
1090 3300001915 JGI24741J21665_1001377 JGI24741J21665_10013772 394
1091 3300001979 JGI24740J21852_10000041 JGI24740J21852_1000004132 394
1092 3300001979 JGI24740J21852_10003377 JGI24740J21852_100033772 394
1093 3300002705 JGI25156J39149_1001501 JGI25156J39149_10015015 394
1094 3300002705 JGI25156J39149_1006506 JGI25156J39149_10065062 394
1095 3300002705 JGI25156J39149_1016919 JGI25156J39149_10169191 394
1096 3300002738 JGI25154J39366_1001382 JGI25154J39366_10013825 394
1097 3300003578 Ga0006562J51391_1035624 Ga0006562J51391_10356243 394
1098 3300003752 Ga0055539_1000062 Ga0055539_100006277 394
1099 3300003758 Ga0055532_1000019 Ga0055532_1000019180 394
1100 3300003759 Ga0055525_1000275 Ga0055525_100027521 394
1101 3300003761 Ga0055535_1000014 Ga0055535_1000014100 394
1102 3300003762 Ga0055542_1000588 Ga0055542_100058824 394
1103 3300003763 Ga0055529_1000086 Ga0055529_100008679 394
1104 3300003841 Ga0055541_1001023 Ga0055541_10010234 394
1105 3300005339 Ga0070660_100123773 Ga0070660_1001237731 394
1106 3300005344 Ga0070661_100001754 Ga0070661_10000175412 394
1107 3300005455 Ga0070663_100000010 Ga0070663_10000001082 394
1108 3300005564 Ga0070664_100000005 Ga0070664_100000005116 394
1109 3300005577 Ga0068857_100002812 Ga0068857_1000028124 394
1110 3300005578 Ga0068854_100000032 Ga0068854_10000003210 394
1111 3300005614 Ga0068856_100000054 Ga0068856_10000005483 394
1112 3300009093 Ga0105240_10174983 Ga0105240_101749832 394
1113 3300013100 Ga0157373_10009351 Ga0157373_100093512 394
1114 3300013102 Ga0157371_10000103 Ga0157371_1000010331 394
1115 3300013104 Ga0157370_10007198 Ga0157370_1000719810 394
1116 3300013105 Ga0157369_10015499 Ga0157369_100154994 394
1117 3300013307 Ga0157372_10000151 Ga0157372_1000015138 394
1118 3300015261 Ga0182006_1000747 Ga0182006_100074715 394
1119 3300020069 Ga0197907_10408444 Ga0197907_104084445 394
1120 3300020070 Ga0206356_10877575 Ga0206356_108775752 394
1121 3300020076 Ga0206355_1268802 Ga0206355_12688022 394
1122 3300020077 Ga0206351_10069195 Ga0206351_100691954 394
1123 3300020610 Ga0154015_1423277 Ga0154015_142327716 394
1124 3300022467 Ga0224712_10027712 Ga0224712_100277122 394
1125 3300025224 Ga0209784_100003 Ga0209784_1000031177 394
1126 3300025224 Ga0209784_100445 Ga0209784_10044512 394
1127 3300025225 Ga0209566_100002 Ga0209566_1000022131 394
1128 3300025225 Ga0209566_100748 Ga0209566_1007486 394
1129 3300025225 Ga0209566_100864 Ga0209566_1008649 394
1130 3300025226 Ga0209674_100008 Ga0209674_10000854 394
1131 3300025226 Ga0209674_100239 Ga0209674_1002394 394
1132 3300025226 Ga0209674_104796 Ga0209674_1047962 394
1133 3300025228 Ga0209672_101561 Ga0209672_1015612 394
1134 3300025229 Ga0209147_100002 Ga0209147_1000021237 394
1135 3300025230 Ga0209563_100004 Ga0209563_1000041548 394
1136 3300025230 Ga0209563_103462 Ga0209563_1034622 394
1137 3300025242 Ga0209258_100002 Ga0209258_1000021237 394
1138 3300025246 Ga0209646_1000019 Ga0209646_100001950 394
1139 3300025250 Ga0209026_1003589 Ga0209026_10035894 394
1140 3300025253 Ga0209677_100009 Ga0209677_10000984 394
1141 3300025253 Ga0209677_102213 Ga0209677_1022134 394
1142 3300025254 Ga0209148_1000193 Ga0209148_100019335 394
1143 3300025256 Ga0209759_1006006 Ga0209759_10060063 394
1144 3300025256 Ga0209759_1006864 Ga0209759_10068644 394
1145 3300025272 Ga0209455_1000076 Ga0209455_1000076179 394
1146 3300025913 Ga0207695_10002741 Ga0207695_1000274116 394
1147 3300025920 Ga0207649_10000961 Ga0207649_1000096112 394
1148 3300025932 Ga0207690_10002595 Ga0207690_100025954 394
1149 3300025945 Ga0207679_10000020 Ga0207679_10000020113 394
1150 3300025981 Ga0207640_10000017 Ga0207640_1000001710 394
1151 3300026067 Ga0207678_10000008 Ga0207678_10000008113 394
1152 3300026078 Ga0207702_10000017 Ga0207702_10000017113 394
1153 3300026142 Ga0207698_10018379 Ga0207698_100183794 394
1154 3300037418 Ga0395900_0009402 Ga0395900_0009402_3225_4409 394
1155 3300044683 Ga0466965_0041104 Ga0466965_0041104_516_1700 394
1156 3300044693 Ga0466961_0015370 Ga0466961_0015370_812_1996 394
1157 3300044706 Ga0466964_0015632 Ga0466964_0015632_727_1911 394
1158 3300044765 Ga0466970_0012329 Ga0466970_0012329_2456_3640 394
1159 3300044842 Ga0466957_0018721 Ga0466957_0018721_2820_4004 394
1160 3300045049 Ga0466959_0022986 Ga0466959_0022986_812_1996 394
1161 3300045976 Ga0466967_0038242 Ga0466967_0038242_2526_3710 394
1162 3300045976 Ga0466967_0056315 Ga0466967_0056315_68_1252 394
1163 3300048928 Ga0496125_0018882 Ga0496125_0018882_2402_3586 394
1164 3300059643 Ga0587072_002951 Ga0587072_002951_141_1325 394
1165 3300061719 Ga0466962_0012917 Ga0466962_0012917_2244_3428 394

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07394

DUF1501

Protein of unknown function (DUF1501)

65

419

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
1o98-assembly1.cif.gz_A 1.4a crystal structure of phosphoglycerate mutase from bacillus stearothermophilus complexed with 2-phosphoglycerate 0.6592 236 389
4nwx-assembly1.cif.gz_A crystal structure of phosphoglycerate mutase from staphylococcus aureus in 2-phosphoglyceric acid bound form 0.6472 236 390
7tl8-assembly1.cif.gz_A 1.95a resolution structure of independent phosphoglycerate mutase from s. aureus in complex with a macrocyclic peptide inhibitor (sa-d3) 0.6262 253 390
4cyr-assembly1.cif.gz_A g4 mutant of pas, arylsulfatase from pseudomonas aeruginosa 0.6068 271 317
7ozc-assembly1.cif.gz_AAA sulfated host glycan recognition by carbohydrate sulfatases of the human gut microbiota (bt3109_s1_15) 0.601 236 340
ID Description Score Start End Superfamily
af_P40367_51_359_3.40.720.10 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.6132 36 334 3.40.720.10
af_O13663_68_356_3.40.720.10 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.5913 36 389 3.40.720.10
af_A1ZB84_62_350_3.40.720.10 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.591 31 375 3.40.720.10
1ejjA02 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.5738 36 389 3.40.720.10
5kglB01 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.5709 36 392 3.40.720.10
ID Description Score Start End GO Terms
AF-A0A6A7LWF4-F1-model_v4 DUF1501 domain-containing protein 0.9775 262 392
AF-A0A6N4TR86-F1-model_v4 deleted 0.9651 36 394
AF-A0A7W8SX43-F1-model_v4 Uncharacterized protein (DUF1501 family) 0.9621 289 394
AF-A0A2V6WT51-F1-model_v4 DUF1501 domain-containing protein 0.959 265 392
AF-A0A535GMT8-F1-model_v4 DUF1501 domain-containing protein 0.9565 261 392

Feature Viewer

pLDDT pTM Quality
86.61 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map