F491051

General Info

Members Datasets Scaffolds Average Seq Length
1164 282 1164 112

Family's Representative Sequence

Representative Sequence 3300036401|Ga0373937_0683389|Ga0373937_0683389_368_754
Length 128
Sequence MIILPFEKVSLTSMSSQPILMSMVQAAPAGQSNGTAGMLIGILPWLLIFAIFYILMIRPQQRRVKEHQNAIAAVKKGDDVITGGGIRGRVTKVSDDEAEVEIAQGVKIRVIKSTISQVLTGNTKPAND

Samples

Sample ID Description Type Environment
1 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
8 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
9 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
10 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
11 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
27 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
28 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
29 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
30 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
31 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
32 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
33 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
36 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
37 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
38 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
39 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
40 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
41 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
42 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
43 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
49 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
55 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
56 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
57 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
60 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
61 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
62 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
63 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
64 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
65 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
66 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
67 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
68 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
69 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
70 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
71 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
72 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
73 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
74 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
75 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
76 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
77 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
79 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
80 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
81 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
82 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
83 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
84 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
86 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
87 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
88 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
89 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
90 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
91 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
92 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
93 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
94 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
95 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
96 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
97 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
98 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
99 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
100 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
101 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
102 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
103 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
104 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
105 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
106 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
107 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
108 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
109 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
110 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
111 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
112 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
113 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
114 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
115 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
116 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
117 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
119 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
185 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
186 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
187 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
188 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
189 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
190 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
191 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
192 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
193 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
194 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
195 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
196 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
197 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
198 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
199 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
200 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
201 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
202 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
203 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
204 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
205 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
206 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
207 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
208 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
209 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
210 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
211 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
212 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
213 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
214 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
215 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
216 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
217 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
218 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
219 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
220 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
221 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
222 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
223 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
224 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
225 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
226 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
227 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
228 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
229 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
230 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
231 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
232 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
233 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
234 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
235 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
236 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
237 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
238 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
239 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
240 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
241 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
242 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
243 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
244 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
245 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
246 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
247 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
248 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
249 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
250 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
251 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
252 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
253 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
254 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
255 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
256 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
257 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
258 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
259 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
260 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
261 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
262 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
263 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
264 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
265 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
266 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
267 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
269 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
270 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
271 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
272 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
273 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
274 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
275 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
276 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
277 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
278 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
279 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
280 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
281 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
282 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.83
Metatranscriptomes 0.17
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.52
Nodule 0
Rhizoplane 3.61
Rhizosphere 95.36
Stem 0
Stem Tuber 0
Unclassified 0.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1028504 3300001904 Bacteria 864
2 JGI24741J21665_1017066 3300001915 Bacteria 1177
3 JGI24741J21665_1030044 3300001915 Bacteria 816
4 JGI24747J21853_1049263 3300001978 Bacteria 511
5 JGI24740J21852_10008648 3300001979 Bacteria 4043
6 JGI24740J21852_10090441 3300001979 Bacteria 790
7 JGI24740J21852_10123558 3300001979 Bacteria 648
8 JGI24739J22299_10008731 3300001989 Bacteria 3779
9 JGI24737J22298_10005413 3300001990 Bacteria 4411
10 JGI24737J22298_10045001 3300001990 Bacteria 1349
11 JGI24743J22301_10142795 3300001991 Bacteria 533
12 JGI24735J21928_10137195 3300002067 Bacteria 705
13 JGI24735J21928_10146226 3300002067 Bacteria 682
14 JGI24750J21931_1020924 3300002070 Bacteria 915
15 JGI24738J21930_10078752 3300002075 Bacteria 688
16 JGI24035J26624_1017087 3300002126 Unclassified 751
17 Ga0065715_10236176 3300005293 Bacteria 1206
18 Ga0065715_10568368 3300005293 Bacteria 729
19 Ga0065707_10236857 3300005295 Bacteria 1169
20 Ga0070658_10015564 3300005327 Bacteria 6082
21 Ga0070658_10050581 3300005327 Bacteria 3368
22 Ga0070658_10135214 3300005327 Bacteria 2056
23 Ga0070658_10203110 3300005327 Bacteria 1673
24 Ga0070658_10523306 3300005327 Bacteria 1025
25 Ga0070658_10810413 3300005327 Bacteria 813
26 Ga0070658_11343477 3300005327 Bacteria 620
27 Ga0070658_11600143 3300005327 Bacteria 564
28 Ga0070676_10001271 3300005328 Bacteria 12677
29 Ga0070676_10003276 3300005328 Bacteria 8410
30 Ga0070676_10092344 3300005328 Bacteria 1856
31 Ga0070676_10208961 3300005328 Bacteria 1283
32 Ga0070676_10327606 3300005328 Bacteria 1046
33 Ga0070676_10375164 3300005328 Bacteria 984
34 Ga0070676_10614157 3300005328 Bacteria 785
35 Ga0070676_11366081 3300005328 Bacteria 542
36 Ga0070683_100025127 3300005329 Bacteria 5346
37 Ga0070683_101189385 3300005329 Bacteria 733
38 Ga0070683_101712373 3300005329 Bacteria 604
39 Ga0070690_100000870 3300005330 Bacteria 15367
40 Ga0070690_100533438 3300005330 Bacteria 882
41 Ga0070690_101384844 3300005330 Bacteria 565
42 Ga0070670_100004152 3300005331 Bacteria 12112
43 Ga0070670_100022285 3300005331 Bacteria 5452
44 Ga0070670_100023107 3300005331 Bacteria 5351
45 Ga0070670_100122913 3300005331 Bacteria 2239
46 Ga0070670_100273741 3300005331 Bacteria 1474
47 Ga0070670_100286179 3300005331 Bacteria 1440
48 Ga0070670_100709258 3300005331 Bacteria 905
49 Ga0070670_101689272 3300005331 Bacteria 582
50 Ga0070677_10024658 3300005333 Bacteria 2239
51 Ga0068869_100000074 3300005334 Bacteria 45153
52 Ga0068869_100250814 3300005334 Bacteria 1413
53 Ga0068869_100404430 3300005334 Bacteria 1124
54 Ga0068869_100807768 3300005334 Bacteria 806
55 Ga0068869_102051522 3300005334 Bacteria 514
56 Ga0070666_10000421 3300005335 Bacteria 26263
57 Ga0070666_10006159 3300005335 Bacteria 7375
58 Ga0070666_10024772 3300005335 Bacteria 3911
59 Ga0070666_10340683 3300005335 Bacteria 1071
60 Ga0070666_10526311 3300005335 Bacteria 858
61 Ga0070680_100186834 3300005336 Bacteria 1746
62 Ga0070680_100198309 3300005336 Bacteria 1692
63 Ga0070680_100616626 3300005336 Bacteria 931
64 Ga0070682_100054836 3300005337 Bacteria 2502
65 Ga0070682_101375269 3300005337 Bacteria 602
66 Ga0070682_101824789 3300005337 Bacteria 531
67 Ga0068868_100000398 3300005338 Bacteria 29556
68 Ga0068868_100000688 3300005338 Bacteria 22698
69 Ga0068868_100045136 3300005338 Bacteria 3447
70 Ga0068868_100067926 3300005338 Bacteria 2837
71 Ga0068868_100240294 3300005338 Bacteria 1521
72 Ga0068868_101688206 3300005338 Bacteria 597
73 Ga0070660_100003127 3300005339 Bacteria 11374
74 Ga0070660_100013461 3300005339 Bacteria 5869
75 Ga0070660_100025778 3300005339 Bacteria 4372
76 Ga0070660_100046452 3300005339 Bacteria 3328
77 Ga0070660_100061354 3300005339 Bacteria 2919
78 Ga0070660_100091291 3300005339 Bacteria 2402
79 Ga0070660_100597382 3300005339 Bacteria 923
80 Ga0070689_100831743 3300005340 Bacteria 813
81 Ga0070691_10001768 3300005341 Bacteria 9399
82 Ga0070687_100067216 3300005343 Bacteria 1912
83 Ga0070687_100545354 3300005343 Bacteria 788
84 Ga0070661_100057173 3300005344 Bacteria 2858
85 Ga0070661_100077189 3300005344 Bacteria 2455
86 Ga0070661_100089555 3300005344 Bacteria 2278
87 Ga0070661_100103285 3300005344 Bacteria 2122
88 Ga0070661_100206773 3300005344 Bacteria 1501
89 Ga0070661_100215329 3300005344 Bacteria 1471
90 Ga0070661_100230355 3300005344 Bacteria 1424
91 Ga0070661_100257754 3300005344 Bacteria 1347
92 Ga0070661_100262148 3300005344 Bacteria 1336
93 Ga0070661_100284364 3300005344 Bacteria 1284
94 Ga0070661_100431688 3300005344 Bacteria 1046
95 Ga0070661_100464510 3300005344 Bacteria 1008
96 Ga0070661_101215824 3300005344 Bacteria 630
97 Ga0070692_10067350 3300005345 Bacteria 1900
98 Ga0070692_10147116 3300005345 Bacteria 1338
99 Ga0070692_11144056 3300005345 Bacteria 551
100 Ga0070668_100001938 3300005347 Bacteria 15107
101 Ga0070668_100007633 3300005347 Bacteria 8026
102 Ga0070668_100092409 3300005347 Bacteria 2386
103 Ga0070668_100838702 3300005347 Bacteria 818
104 Ga0070668_101111657 3300005347 Bacteria 714
105 Ga0070669_100000197 3300005353 Bacteria 52472
106 Ga0070669_100014352 3300005353 Bacteria 5637
107 Ga0070669_100017462 3300005353 Bacteria 5117
108 Ga0070669_100023618 3300005353 Bacteria 4403
109 Ga0070669_100075855 3300005353 Bacteria 2494
110 Ga0070669_100436838 3300005353 Bacteria 1077
111 Ga0070669_100437641 3300005353 Bacteria 1076
112 Ga0070669_100519625 3300005353 Bacteria 990
113 Ga0070669_100811533 3300005353 Bacteria 795
114 Ga0070669_100957488 3300005353 Bacteria 733
115 Ga0070675_100079086 3300005354 Bacteria 2739
116 Ga0070675_100109100 3300005354 Bacteria 2338
117 Ga0070675_100129324 3300005354 Bacteria 2151
118 Ga0070675_100170296 3300005354 Bacteria 1877
119 Ga0070675_100298639 3300005354 Bacteria 1418
120 Ga0070675_100681224 3300005354 Bacteria 936
121 Ga0070675_100684187 3300005354 Bacteria 933
122 Ga0070675_101069189 3300005354 Bacteria 742
123 Ga0070675_101865043 3300005354 Bacteria 554
124 Ga0070671_100006644 3300005355 Bacteria 9247
125 Ga0070671_100009654 3300005355 Bacteria 7753
126 Ga0070671_100023695 3300005355 Bacteria 5025
127 Ga0070671_100033979 3300005355 Bacteria 4220
128 Ga0070671_100115008 3300005355 Bacteria 2261
129 Ga0070671_100282169 3300005355 Bacteria 1413
130 Ga0070671_100452710 3300005355 Bacteria 1101
131 Ga0070671_100513317 3300005355 Bacteria 1031
132 Ga0070671_100981509 3300005355 Bacteria 740
133 Ga0070671_102111229 3300005355 Bacteria 502
134 Ga0070674_100007352 3300005356 Bacteria 6495
135 Ga0070674_100014055 3300005356 Bacteria 4968
136 Ga0070674_100016981 3300005356 Bacteria 4568
137 Ga0070674_100058974 3300005356 Bacteria 2670
138 Ga0070674_100066462 3300005356 Bacteria 2533
139 Ga0070674_100214329 3300005356 Bacteria 1494
140 Ga0070674_100427947 3300005356 Bacteria 1088
141 Ga0070673_100001014 3300005364 Bacteria 15911
142 Ga0070673_100007010 3300005364 Bacteria 7388
143 Ga0070673_100082178 3300005364 Bacteria 2614
144 Ga0070673_100112325 3300005364 Bacteria 2261
145 Ga0070673_100125580 3300005364 Bacteria 2146
146 Ga0070673_100186819 3300005364 Bacteria 1777
147 Ga0070673_100247483 3300005364 Bacteria 1552
148 Ga0070673_100390458 3300005364 Bacteria 1242
149 Ga0070673_100443617 3300005364 Bacteria 1167
150 Ga0070673_100505408 3300005364 Bacteria 1094
151 Ga0070673_100649319 3300005364 Bacteria 966
152 Ga0070673_100660478 3300005364 Bacteria 958
153 Ga0070673_100956909 3300005364 Bacteria 796
154 Ga0070688_100215133 3300005365 Bacteria 1352
155 Ga0070688_100388320 3300005365 Bacteria 1030
156 Ga0070688_100717628 3300005365 Bacteria 776
157 Ga0070659_100000791 3300005366 Bacteria 23054
158 Ga0070659_100003440 3300005366 Bacteria 11273
159 Ga0070659_100051114 3300005366 Bacteria 3248
160 Ga0070659_100124315 3300005366 Bacteria 2092
161 Ga0070659_100127228 3300005366 Bacteria 2067
162 Ga0070659_100208157 3300005366 Bacteria 1611
163 Ga0070659_100216036 3300005366 Bacteria 1581
164 Ga0070659_100389156 3300005366 Bacteria 1175
165 Ga0070659_100493150 3300005366 Bacteria 1043
166 Ga0070659_100725893 3300005366 Bacteria 860
167 Ga0070659_101198102 3300005366 Bacteria 671
168 Ga0070667_100000876 3300005367 Bacteria 27838
169 Ga0070667_100006803 3300005367 Bacteria 9498
170 Ga0070667_100011319 3300005367 Bacteria 7378
171 Ga0070667_100154521 3300005367 Bacteria 2017
172 Ga0070667_100285355 3300005367 Bacteria 1483
173 Ga0070667_100486230 3300005367 Bacteria 1130
174 Ga0070667_100842069 3300005367 Bacteria 852
175 Ga0070667_101121381 3300005367 Bacteria 735
176 Ga0070667_101497663 3300005367 Bacteria 634
177 Ga0070667_101576383 3300005367 Bacteria 617
178 Ga0070714_100022621 3300005435 Bacteria 5154
179 Ga0070714_100211617 3300005435 Bacteria 1777
180 Ga0070701_10445937 3300005438 Bacteria 830
181 Ga0070701_10955306 3300005438 Bacteria 595
182 Ga0070694_100013344 3300005444 Bacteria 5132
183 Ga0070694_100099652 3300005444 Bacteria 2054
184 Ga0070694_100923370 3300005444 Bacteria 721
185 Ga0070663_100005994 3300005455 Bacteria 7272
186 Ga0070663_100016402 3300005455 Bacteria 4810
187 Ga0070663_100049418 3300005455 Bacteria 2986
188 Ga0070663_100105849 3300005455 Bacteria 2106
189 Ga0070663_100210412 3300005455 Bacteria 1522
190 Ga0070663_100319809 3300005455 Bacteria 1247
191 Ga0070663_100350193 3300005455 Bacteria 1196
192 Ga0070663_100487541 3300005455 Bacteria 1021
193 Ga0070663_100536152 3300005455 Bacteria 976
194 Ga0070663_100541776 3300005455 Bacteria 972
195 Ga0070663_101864482 3300005455 Bacteria 540
196 Ga0070663_102015669 3300005455 Bacteria 519
197 Ga0070678_100001009 3300005456 Bacteria 14629
198 Ga0070678_100434828 3300005456 Bacteria 1146
199 Ga0070678_100583077 3300005456 Bacteria 996
200 Ga0070678_101318721 3300005456 Bacteria 672
201 Ga0070662_100000334 3300005457 Bacteria 28255
202 Ga0070662_100059145 3300005457 Bacteria 2791
203 Ga0070662_100059189 3300005457 Bacteria 2790
204 Ga0070662_100073947 3300005457 Bacteria 2519
205 Ga0070662_100128827 3300005457 Bacteria 1948
206 Ga0070662_100138399 3300005457 Bacteria 1884
207 Ga0070662_100158288 3300005457 Bacteria 1770
208 Ga0070662_100251709 3300005457 Bacteria 1420
209 Ga0070662_100253534 3300005457 Bacteria 1415
210 Ga0070662_100291102 3300005457 Bacteria 1324
211 Ga0070662_100361315 3300005457 Bacteria 1191
212 Ga0070662_100372112 3300005457 Bacteria 1174
213 Ga0070662_100415158 3300005457 Bacteria 1112
214 Ga0070662_100572995 3300005457 Bacteria 948
215 Ga0070662_100727699 3300005457 Bacteria 841
216 Ga0070662_100976490 3300005457 Bacteria 725
217 Ga0070662_101313349 3300005457 Bacteria 623
218 Ga0070662_101389651 3300005457 Bacteria 605
219 Ga0070681_10066272 3300005458 Bacteria 3580
220 Ga0070681_10307135 3300005458 Bacteria 1496
221 Ga0070681_10559208 3300005458 Bacteria 1058
222 Ga0070681_11271263 3300005458 Bacteria 658
223 Ga0070681_11532008 3300005458 Bacteria 591
224 Ga0068867_100000836 3300005459 Bacteria 20707
225 Ga0068867_100006028 3300005459 Bacteria 8592
226 Ga0068867_100014225 3300005459 Bacteria 5637
227 Ga0068867_100017848 3300005459 Bacteria 5040
228 Ga0068867_100239537 3300005459 Bacteria 1471
229 Ga0068867_100393050 3300005459 Bacteria 1168
230 Ga0068867_100604837 3300005459 Bacteria 956
231 Ga0068867_101037122 3300005459 Bacteria 745
232 Ga0068867_101629007 3300005459 Bacteria 604
233 Ga0070685_10081857 3300005466 Bacteria 1936
234 Ga0070685_11209175 3300005466 Bacteria 575
235 Ga0070706_100365646 3300005467 Bacteria 1344
236 Ga0070679_100246224 3300005530 Bacteria 1744
237 Ga0070679_100708473 3300005530 Bacteria 949
238 Ga0070679_100841590 3300005530 Bacteria 861
239 Ga0070679_101148902 3300005530 Bacteria 721
240 Ga0070684_100008372 3300005535 Bacteria 8078
241 Ga0070684_101892493 3300005535 Bacteria 563
242 Ga0068853_100001079 3300005539 Bacteria 19279
243 Ga0068853_100031943 3300005539 Bacteria 4457
244 Ga0068853_100179487 3300005539 Bacteria 1919
245 Ga0068853_100415761 3300005539 Bacteria 1260
246 Ga0068853_100583188 3300005539 Bacteria 1061
247 Ga0068853_100717222 3300005539 Bacteria 954
248 Ga0068853_100793663 3300005539 Bacteria 906
249 Ga0068853_100913466 3300005539 Bacteria 843
250 Ga0068853_101051461 3300005539 Bacteria 784
251 Ga0068853_101294249 3300005539 Bacteria 704
252 Ga0070672_100000227 3300005543 Bacteria 31347
253 Ga0070672_100021430 3300005543 Bacteria 4728
254 Ga0070672_100043910 3300005543 Bacteria 3450
255 Ga0070672_100069784 3300005543 Bacteria 2791
256 Ga0070672_100077932 3300005543 Bacteria 2651
257 Ga0070672_100267612 3300005543 Bacteria 1442
258 Ga0070672_100577413 3300005543 Bacteria 978
259 Ga0070686_100008537 3300005544 Bacteria 5740
260 Ga0070686_100185118 3300005544 Bacteria 1482
261 Ga0070695_100008395 3300005545 Bacteria 6132
262 Ga0070695_100554008 3300005545 Bacteria 897
263 Ga0070695_101651290 3300005545 Bacteria 536
264 Ga0070696_100004732 3300005546 Bacteria 9096
265 Ga0070696_100007123 3300005546 Bacteria 7468
266 Ga0070696_100136532 3300005546 Bacteria 1788
267 Ga0070696_100580512 3300005546 Bacteria 902
268 Ga0070693_100034552 3300005547 Bacteria 2798
269 Ga0070693_100137226 3300005547 Bacteria 1535
270 Ga0070693_100278856 3300005547 Bacteria 1119
271 Ga0070693_100549387 3300005547 Bacteria 826
272 Ga0070693_100704636 3300005547 Bacteria 739
273 Ga0070693_101047905 3300005547 Unclassified 619
274 Ga0070665_100000024 3300005548 Bacteria 374559
275 Ga0070665_100036936 3300005548 Bacteria 4912
276 Ga0070665_100315832 3300005548 Bacteria 1566
277 Ga0070665_100600558 3300005548 Bacteria 1113
278 Ga0070665_102250179 3300005548 Bacteria 548
279 Ga0068855_100001413 3300005563 Bacteria 29812
280 Ga0068855_100057746 3300005563 Bacteria 4548
281 Ga0068855_100137353 3300005563 Bacteria 2788
282 Ga0068855_100232314 3300005563 Bacteria 2064
283 Ga0068855_100917437 3300005563 Bacteria 924
284 Ga0068855_101465847 3300005563 Bacteria 702
285 Ga0068855_102077726 3300005563 Bacteria 572
286 Ga0070664_100008693 3300005564 Bacteria 8220
287 Ga0070664_100011025 3300005564 Bacteria 7330
288 Ga0070664_100013789 3300005564 Bacteria 6589
289 Ga0070664_100067425 3300005564 Bacteria 3058
290 Ga0070664_100072567 3300005564 Bacteria 2952
291 Ga0070664_100155792 3300005564 Bacteria 2018
292 Ga0070664_100183381 3300005564 Bacteria 1861
293 Ga0070664_100247239 3300005564 Bacteria 1602
294 Ga0070664_100375238 3300005564 Bacteria 1297
295 Ga0070664_100406500 3300005564 Bacteria 1245
296 Ga0070664_100508078 3300005564 Bacteria 1111
297 Ga0070664_100964443 3300005564 Bacteria 801
298 Ga0070664_101165735 3300005564 Bacteria 726
299 Ga0070664_101301121 3300005564 Bacteria 686
300 Ga0068857_100006851 3300005577 Bacteria 9805
301 Ga0068857_100032752 3300005577 Bacteria 4594
302 Ga0068857_100083227 3300005577 Bacteria 2858
303 Ga0068857_100109876 3300005577 Bacteria 2478
304 Ga0068857_100121854 3300005577 Bacteria 2348
305 Ga0068857_100895845 3300005577 Bacteria 850
306 Ga0068857_102484136 3300005577 Bacteria 509
307 Ga0068854_100000549 3300005578 Bacteria 22654
308 Ga0068854_100073079 3300005578 Bacteria 2512
309 Ga0068854_100164043 3300005578 Bacteria 1723
310 Ga0068854_100226910 3300005578 Bacteria 1480
311 Ga0068854_100244736 3300005578 Bacteria 1430
312 Ga0068854_100292253 3300005578 Bacteria 1315
313 Ga0068854_100751402 3300005578 Bacteria 846
314 Ga0068854_101091669 3300005578 Bacteria 710
315 Ga0068854_101197082 3300005578 Bacteria 680
316 Ga0068856_100062371 3300005614 Bacteria 3682
317 Ga0068856_100131367 3300005614 Bacteria 2509
318 Ga0068856_100631678 3300005614 Bacteria 1091
319 Ga0068856_100792348 3300005614 Bacteria 967
320 Ga0068856_102034361 3300005614 Bacteria 584
321 Ga0070702_100384527 3300005615 Bacteria 999
322 Ga0070702_100676574 3300005615 Bacteria 784
323 Ga0068852_100000835 3300005616 Bacteria 20409
324 Ga0068852_100037157 3300005616 Bacteria 4081
325 Ga0068852_100040637 3300005616 Bacteria 3925
326 Ga0068852_100095821 3300005616 Bacteria 2666
327 Ga0068852_100117141 3300005616 Bacteria 2432
328 Ga0068852_100171770 3300005616 Bacteria 2033
329 Ga0068852_100387021 3300005616 Bacteria 1373
330 Ga0068852_100475739 3300005616 Bacteria 1240
331 Ga0068852_100485984 3300005616 Bacteria 1228
332 Ga0068852_100549196 3300005616 Bacteria 1155
333 Ga0068852_100871837 3300005616 Bacteria 916
334 Ga0068852_101093178 3300005616 Bacteria 817
335 Ga0068852_102849484 3300005616 Bacteria 501
336 Ga0068859_100001673 3300005617 Bacteria 22582
337 Ga0068859_100003879 3300005617 Bacteria 15277
338 Ga0068859_100033508 3300005617 Bacteria 5158
339 Ga0068859_100070604 3300005617 Bacteria 3528
340 Ga0068859_100346360 3300005617 Bacteria 1580
341 Ga0068859_100488236 3300005617 Bacteria 1327
342 Ga0068859_100565026 3300005617 Bacteria 1231
343 Ga0068864_100000393 3300005618 Bacteria 38029
344 Ga0068864_100012617 3300005618 Bacteria 6985
345 Ga0068864_100022478 3300005618 Bacteria 5288
346 Ga0068864_100059215 3300005618 Bacteria 3313
347 Ga0068864_100376992 3300005618 Bacteria 1343
348 Ga0068864_101211981 3300005618 Bacteria 754
349 Ga0068864_101941282 3300005618 Bacteria 594
350 Ga0068866_10168224 3300005718 Bacteria 1284
351 Ga0068866_10255357 3300005718 Bacteria 1075
352 Ga0068866_10339736 3300005718 Bacteria 951
353 Ga0068866_10813467 3300005718 Bacteria 650
354 Ga0068861_100324309 3300005719 Bacteria 1342
355 Ga0068861_100510232 3300005719 Bacteria 1089
356 Ga0068851_10010021 3300005834 Bacteria 4413
357 Ga0068851_10126269 3300005834 Bacteria 1380
358 Ga0068851_10151082 3300005834 Bacteria 1269
359 Ga0068851_10175795 3300005834 Bacteria 1184
360 Ga0068851_10177055 3300005834 Bacteria 1179
361 Ga0068851_10210537 3300005834 Bacteria 1088
362 Ga0068851_10277389 3300005834 Bacteria 957
363 Ga0068851_10929918 3300005834 Bacteria 546
364 Ga0068851_11053675 3300005834 Bacteria 515
365 Ga0068870_10052512 3300005840 Bacteria 2162
366 Ga0068870_10174740 3300005840 Bacteria 1285
367 Ga0068870_10593555 3300005840 Bacteria 752
368 Ga0068863_100002359 3300005841 Bacteria 18786
369 Ga0068863_100007847 3300005841 Bacteria 10435
370 Ga0068863_100023741 3300005841 Bacteria 5851
371 Ga0068863_100061481 3300005841 Bacteria 3551
372 Ga0068863_100193346 3300005841 Bacteria 1956
373 Ga0068863_101191039 3300005841 Bacteria 767
374 Ga0068863_101736642 3300005841 Bacteria 634
375 Ga0068858_100004688 3300005842 Bacteria 13400
376 Ga0068858_100161086 3300005842 Bacteria 2112
377 Ga0068858_100169471 3300005842 Bacteria 2058
378 Ga0068858_100869630 3300005842 Bacteria 881
379 Ga0068858_100943282 3300005842 Bacteria 844
380 Ga0068860_100006230 3300005843 Bacteria 11985
381 Ga0068860_100010609 3300005843 Bacteria 9098
382 Ga0068860_100012363 3300005843 Bacteria 8410
383 Ga0068860_100022090 3300005843 Bacteria 6159
384 Ga0068860_100062699 3300005843 Bacteria 3532
385 Ga0068860_100110321 3300005843 Bacteria 2629
386 Ga0068862_100007505 3300005844 Bacteria 9034
387 Ga0068862_100033982 3300005844 Bacteria 4313
388 Ga0068862_100286044 3300005844 Bacteria 1512
389 Ga0068862_102192958 3300005844 Bacteria 564
390 Ga0070712_100009693 3300006175 Bacteria 6070
391 Ga0097621_100208139 3300006237 Bacteria 1700
392 Ga0097621_100378668 3300006237 Bacteria 1264
393 Ga0097621_100771013 3300006237 Bacteria 889
394 Ga0097621_101137080 3300006237 Bacteria 734
395 Ga0097621_101217484 3300006237 Bacteria 709
396 Ga0075370_10454718 3300006353 Bacteria 771
397 Ga0068871_100006808 3300006358 Bacteria 8126
398 Ga0068871_100052764 3300006358 Bacteria 3294
399 Ga0068871_100214847 3300006358 Bacteria 1664
400 Ga0068871_101433348 3300006358 Bacteria 652
401 Ga0068871_102119559 3300006358 Bacteria 536
402 Ga0075431_100200375 3300006847 Bacteria 2043
403 Ga0075433_10086504 3300006852 Bacteria 2767
404 Ga0075434_100609706 3300006871 Bacteria 1110
405 Ga0068865_100026937 3300006881 Bacteria 3793
406 Ga0068865_100029527 3300006881 Bacteria 3639
407 Ga0068865_100133171 3300006881 Bacteria 1864
408 Ga0068865_100179213 3300006881 Bacteria 1630
409 Ga0097620_100001673 3300006931 Bacteria 22582
410 Ga0097620_100003878 3300006931 Bacteria 15277
411 Ga0097620_100033508 3300006931 Bacteria 5158
412 Ga0097620_100070609 3300006931 Bacteria 3528
413 Ga0097620_100346368 3300006931 Bacteria 1580
414 Ga0097620_100488225 3300006931 Bacteria 1327
415 Ga0097620_100565067 3300006931 Bacteria 1231
416 Ga0075435_100435736 3300007076 Bacteria 1130
417 Ga0105251_10200521 3300009011 Bacteria 899
418 Ga0105250_10399044 3300009092 Bacteria 610
419 Ga0105240_10050145 3300009093 Bacteria 5265
420 Ga0105240_10459400 3300009093 Bacteria 1423
421 Ga0105240_10675455 3300009093 Bacteria 1130
422 Ga0105240_11976813 3300009093 Bacteria 606
423 Ga0105245_10000068 3300009098 Bacteria 106973
424 Ga0105245_10007967 3300009098 Bacteria 9263
425 Ga0105245_10013523 3300009098 Bacteria 7107
426 Ga0105245_10236419 3300009098 Bacteria 1769
427 Ga0105245_10387028 3300009098 Bacteria 1394
428 Ga0105247_10845577 3300009101 Bacteria 702
429 Ga0105243_10190386 3300009148 Bacteria 1791
430 Ga0105243_10230162 3300009148 Bacteria 1644
431 Ga0105243_10328828 3300009148 Bacteria 1395
432 Ga0105243_10473869 3300009148 Bacteria 1180
433 Ga0105243_10627620 3300009148 Bacteria 1038
434 Ga0105243_11693071 3300009148 Bacteria 661
435 Ga0105243_13092523 3300009148 Bacteria 504
436 Ga0105241_10458408 3300009174 Bacteria 1129
437 Ga0105241_10866408 3300009174 Bacteria 836
438 Ga0105241_11414955 3300009174 Bacteria 666
439 Ga0105242_10009233 3300009176 Bacteria 7566
440 Ga0105242_10072377 3300009176 Bacteria 2862
441 Ga0105242_12205052 3300009176 Bacteria 596
442 Ga0105248_10000575 3300009177 Bacteria 41822
443 Ga0105248_10001005 3300009177 Bacteria 31178
444 Ga0105248_10002609 3300009177 Bacteria 20051
445 Ga0105248_10009936 3300009177 Bacteria 10474
446 Ga0105248_10061315 3300009177 Bacteria 4223
447 Ga0105248_10084281 3300009177 Bacteria 3575
448 Ga0105248_10265775 3300009177 Bacteria 1931
449 Ga0105248_10879880 3300009177 Bacteria 1011
450 Ga0105248_11728560 3300009177 Bacteria 709
451 Ga0105237_10090947 3300009545 Bacteria 3041
452 Ga0105237_10468510 3300009545 Bacteria 1266
453 Ga0105237_11037408 3300009545 Bacteria 827
454 Ga0105238_10079429 3300009551 Bacteria 3271
455 Ga0105238_10180931 3300009551 Bacteria 2085
456 Ga0105238_10273805 3300009551 Bacteria 1669
457 Ga0105238_10332808 3300009551 Bacteria 1506
458 Ga0105238_10428449 3300009551 Bacteria 1318
459 Ga0105238_10443629 3300009551 Bacteria 1294
460 Ga0105238_10582365 3300009551 Bacteria 1126
461 Ga0105238_11248345 3300009551 Bacteria 768
462 Ga0105249_10058427 3300009553 Bacteria 3535
463 Ga0105249_10094596 3300009553 Bacteria 2801
464 Ga0105249_10233260 3300009553 Bacteria 1816
465 Ga0105249_10386550 3300009553 Bacteria 1426
466 Ga0105249_11224829 3300009553 Bacteria 822
467 Ga0105239_10043211 3300010375 Bacteria 4938
468 Ga0105239_10147654 3300010375 Bacteria 2623
469 Ga0105239_10153245 3300010375 Bacteria 2573
470 Ga0105239_11042760 3300010375 Bacteria 941
471 Ga0105239_12525306 3300010375 Bacteria 599
472 Ga0105246_10019547 3300011119 Bacteria 4331
473 Ga0105246_10041891 3300011119 Bacteria 3098
474 Ga0157373_10005655 3300013100 Bacteria 9368
475 Ga0157373_10014420 3300013100 Bacteria 5794
476 Ga0157373_10053721 3300013100 Bacteria 2864
477 Ga0157373_10069512 3300013100 Bacteria 2489
478 Ga0157373_10269315 3300013100 Bacteria 1206
479 Ga0157373_10359114 3300013100 Bacteria 1040
480 Ga0157373_10562111 3300013100 Bacteria 828
481 Ga0157373_10958497 3300013100 Bacteria 637
482 Ga0157371_10003274 3300013102 Bacteria 14842
483 Ga0157371_10272829 3300013102 Bacteria 1221
484 Ga0157371_10386470 3300013102 Bacteria 1022
485 Ga0157371_10542504 3300013102 Bacteria 862
486 Ga0157371_10650388 3300013102 Bacteria 787
487 Ga0157371_10948407 3300013102 Bacteria 654
488 Ga0157371_10985472 3300013102 Bacteria 642
489 Ga0157371_11014383 3300013102 Bacteria 633
490 Ga0157370_10003954 3300013104 Bacteria 17255
491 Ga0157370_10023128 3300013104 Bacteria 6177
492 Ga0157370_10269721 3300013104 Bacteria 1572
493 Ga0157370_10524914 3300013104 Bacteria 1086
494 Ga0157370_10620859 3300013104 Bacteria 989
495 Ga0157370_10637814 3300013104 Bacteria 974
496 Ga0157370_11095465 3300013104 Bacteria 720
497 Ga0157370_11360750 3300013104 Bacteria 639
498 Ga0157369_10064173 3300013105 Bacteria 3955
499 Ga0157369_10116767 3300013105 Bacteria 2833
500 Ga0157369_10340318 3300013105 Bacteria 1558
501 Ga0157369_10616186 3300013105 Bacteria 1120
502 Ga0157369_10782299 3300013105 Bacteria 981
503 Ga0157369_10794069 3300013105 Bacteria 973
504 Ga0157369_11786757 3300013105 Bacteria 624
505 Ga0157374_10012521 3300013296 Bacteria 7383
506 Ga0157374_11909050 3300013296 Bacteria 620
507 Ga0157374_11942331 3300013296 Bacteria 614
508 Ga0157378_10003316 3300013297 Bacteria 14317
509 Ga0157378_10553702 3300013297 Bacteria 1156
510 Ga0157378_10624178 3300013297 Bacteria 1091
511 Ga0157378_10890288 3300013297 Bacteria 920
512 Ga0157378_12325666 3300013297 Bacteria 587
513 Ga0163162_10044059 3300013306 Bacteria 4468
514 Ga0163162_10052258 3300013306 Bacteria 4104
515 Ga0163162_10338634 3300013306 Bacteria 1637
516 Ga0163162_10690187 3300013306 Bacteria 1143
517 Ga0163162_10775033 3300013306 Bacteria 1077
518 Ga0163162_12049168 3300013306 Bacteria 656
519 Ga0157372_10074693 3300013307 Bacteria 3823
520 Ga0157372_10253962 3300013307 Bacteria 2041
521 Ga0157372_10392264 3300013307 Bacteria 1618
522 Ga0157372_10422828 3300013307 Bacteria 1553
523 Ga0157372_10593603 3300013307 Bacteria 1291
524 Ga0157372_11083615 3300013307 Bacteria 927
525 Ga0157375_10013004 3300013308 Bacteria 7394
526 Ga0157375_10068518 3300013308 Bacteria 3550
527 Ga0157375_10302745 3300013308 Bacteria 1762
528 Ga0157375_10861828 3300013308 Bacteria 1052
529 Ga0157375_10944565 3300013308 Bacteria 1004
530 Ga0163163_10214793 3300014325 Bacteria 1972
531 Ga0163163_10883349 3300014325 Bacteria 957
532 Ga0163163_11431272 3300014325 Bacteria 753
533 Ga0157380_10323864 3300014326 Bacteria 1430
534 Ga0157380_10362017 3300014326 Bacteria 1361
535 Ga0157380_12361231 3300014326 Bacteria 597
536 Ga0182008_10197854 3300014497 Bacteria 1022
537 Ga0182008_10489314 3300014497 Bacteria 675
538 Ga0157377_10072902 3300014745 Bacteria 1988
539 Ga0157377_11526499 3300014745 Bacteria 532
540 Ga0157379_10008481 3300014968 Bacteria 8941
541 Ga0157379_10260604 3300014968 Bacteria 1575
542 Ga0157379_11006087 3300014968 Bacteria 795
543 Ga0157376_10018617 3300014969 Bacteria 5330
544 Ga0163161_10156948 3300017792 Bacteria 1733
545 Ga0163161_11972941 3300017792 Bacteria 519
546 Ga0206355_1257199 3300020076 Bacteria 2066
547 Ga0206353_10235959 3300020082 Bacteria 729
548 Ga0213876_10028035 3300021384 Bacteria 2969
549 Ga0207697_10000007 3300025315 Bacteria 81785
550 Ga0207697_10243263 3300025315 Bacteria 795
551 Ga0207656_10010444 3300025321 Bacteria 3479
552 Ga0207656_10071025 3300025321 Bacteria 1547
553 Ga0207656_10095131 3300025321 Bacteria 1358
554 Ga0207656_10247216 3300025321 Bacteria 873
555 Ga0207682_10163163 3300025893 Bacteria 1011
556 Ga0207642_10581916 3300025899 Bacteria 695
557 Ga0207688_10000333 3300025901 Bacteria 21890
558 Ga0207688_10022732 3300025901 Bacteria 3433
559 Ga0207688_10182063 3300025901 Bacteria 1253
560 Ga0207688_10560157 3300025901 Bacteria 719
561 Ga0207680_10000396 3300025903 Bacteria 20730
562 Ga0207680_10022712 3300025903 Bacteria 3416
563 Ga0207680_10192271 3300025903 Bacteria 1386
564 Ga0207680_10222594 3300025903 Bacteria 1294
565 Ga0207680_10353414 3300025903 Bacteria 1033
566 Ga0207647_10001004 3300025904 Bacteria 21904
567 Ga0207647_10007553 3300025904 Bacteria 7843
568 Ga0207647_10027597 3300025904 Bacteria 3699
569 Ga0207647_10029204 3300025904 Bacteria 3571
570 Ga0207647_10272355 3300025904 Bacteria 968
571 Ga0207699_10841608 3300025906 Bacteria 675
572 Ga0207645_10001287 3300025907 Bacteria 20599
573 Ga0207645_10002663 3300025907 Bacteria 13900
574 Ga0207645_10015455 3300025907 Bacteria 5069
575 Ga0207645_10203269 3300025907 Bacteria 1304
576 Ga0207645_10432119 3300025907 Bacteria 888
577 Ga0207645_10558278 3300025907 Bacteria 777
578 Ga0207645_10831998 3300025907 Bacteria 627
579 Ga0207643_10072976 3300025908 Bacteria 1978
580 Ga0207705_10000275 3300025909 Bacteria 49216
581 Ga0207705_10003381 3300025909 Bacteria 12137
582 Ga0207705_10018542 3300025909 Bacteria 4975
583 Ga0207705_10043626 3300025909 Bacteria 3222
584 Ga0207705_10048640 3300025909 Bacteria 3050
585 Ga0207705_10055234 3300025909 Bacteria 2863
586 Ga0207705_10961207 3300025909 Bacteria 661
587 Ga0207684_10481385 3300025910 Bacteria 1065
588 Ga0207654_10557693 3300025911 Bacteria 814
589 Ga0207707_10162245 3300025912 Bacteria 1954
590 Ga0207707_10992699 3300025912 Bacteria 689
591 Ga0207707_11141588 3300025912 Bacteria 633
592 Ga0207695_10048872 3300025913 Bacteria 4464
593 Ga0207695_10199904 3300025913 Bacteria 1913
594 Ga0207671_10117986 3300025914 Bacteria 2026
595 Ga0207663_11488114 3300025916 Bacteria 545
596 Ga0207660_10065595 3300025917 Bacteria 2624
597 Ga0207660_10204020 3300025917 Bacteria 1545
598 Ga0207662_10057527 3300025918 Bacteria 2324
599 Ga0207662_10399798 3300025918 Bacteria 931
600 Ga0207657_10008917 3300025919 Bacteria 10135
601 Ga0207657_10011090 3300025919 Bacteria 8957
602 Ga0207657_10012549 3300025919 Bacteria 8356
603 Ga0207657_10015329 3300025919 Bacteria 7429
604 Ga0207657_10025873 3300025919 Bacteria 5404
605 Ga0207657_10025917 3300025919 Bacteria 5399
606 Ga0207657_10052196 3300025919 Bacteria 3549
607 Ga0207657_10331912 3300025919 Bacteria 1201
608 Ga0207657_10389172 3300025919 Bacteria 1097
609 Ga0207649_10007963 3300025920 Bacteria 5765
610 Ga0207649_10053942 3300025920 Bacteria 2500
611 Ga0207649_10072847 3300025920 Bacteria 2199
612 Ga0207649_10088507 3300025920 Bacteria 2022
613 Ga0207649_10147812 3300025920 Bacteria 1615
614 Ga0207649_10163539 3300025920 Bacteria 1544
615 Ga0207649_10186939 3300025920 Bacteria 1454
616 Ga0207649_10444259 3300025920 Bacteria 978
617 Ga0207649_10608904 3300025920 Bacteria 841
618 Ga0207652_10042152 3300025921 Bacteria 3883
619 Ga0207681_10000695 3300025923 Bacteria 22118
620 Ga0207681_10003463 3300025923 Bacteria 9833
621 Ga0207681_10014053 3300025923 Bacteria 4963
622 Ga0207681_10032517 3300025923 Bacteria 3416
623 Ga0207681_10375492 3300025923 Bacteria 1143
624 Ga0207681_10548517 3300025923 Bacteria 951
625 Ga0207681_10708949 3300025923 Bacteria 837
626 Ga0207681_10824260 3300025923 Bacteria 775
627 Ga0207681_10963174 3300025923 Bacteria 715
628 Ga0207681_11304789 3300025923 Bacteria 610
629 Ga0207694_10122638 3300025924 Bacteria 2076
630 Ga0207694_10122818 3300025924 Bacteria 2074
631 Ga0207694_10279039 3300025924 Bacteria 1372
632 Ga0207694_10814919 3300025924 Bacteria 789
633 Ga0207650_10048005 3300025925 Bacteria 3147
634 Ga0207650_10130877 3300025925 Bacteria 1963
635 Ga0207650_10142769 3300025925 Bacteria 1884
636 Ga0207650_10226027 3300025925 Bacteria 1508
637 Ga0207650_10464158 3300025925 Bacteria 1055
638 Ga0207650_10613071 3300025925 Bacteria 916
639 Ga0207650_10828413 3300025925 Bacteria 785
640 Ga0207659_10031782 3300025926 Bacteria 3617
641 Ga0207659_10055543 3300025926 Bacteria 2833
642 Ga0207659_10104599 3300025926 Bacteria 2141
643 Ga0207659_10147643 3300025926 Bacteria 1833
644 Ga0207659_10157601 3300025926 Bacteria 1779
645 Ga0207687_10000584 3300025927 Bacteria 24620
646 Ga0207687_10101549 3300025927 Bacteria 2117
647 Ga0207687_10185550 3300025927 Bacteria 1614
648 Ga0207687_10206784 3300025927 Bacteria 1538
649 Ga0207687_10339271 3300025927 Bacteria 1221
650 Ga0207687_11491188 3300025927 Bacteria 581
651 Ga0207664_10023960 3300025929 Bacteria 4582
652 Ga0207664_10079985 3300025929 Bacteria 2655
653 Ga0207644_10002049 3300025931 Bacteria 13050
654 Ga0207644_10003050 3300025931 Bacteria 10773
655 Ga0207644_10034223 3300025931 Bacteria 3554
656 Ga0207644_10083742 3300025931 Bacteria 2363
657 Ga0207644_10233275 3300025931 Bacteria 1463
658 Ga0207644_10278030 3300025931 Bacteria 1343
659 Ga0207644_11171315 3300025931 Bacteria 646
660 Ga0207690_10001169 3300025932 Bacteria 16613
661 Ga0207690_10003581 3300025932 Bacteria 9250
662 Ga0207690_10016980 3300025932 Bacteria 4438
663 Ga0207690_10041141 3300025932 Bacteria 3027
664 Ga0207690_10084823 3300025932 Bacteria 2221
665 Ga0207690_10093101 3300025932 Bacteria 2134
666 Ga0207690_10144680 3300025932 Bacteria 1756
667 Ga0207690_10383730 3300025932 Bacteria 1117
668 Ga0207690_10405079 3300025932 Bacteria 1088
669 Ga0207690_10728823 3300025932 Unclassified 816
670 Ga0207690_10875431 3300025932 Bacteria 744
671 Ga0207690_10932031 3300025932 Bacteria 721
672 Ga0207706_10000766 3300025933 Bacteria 33391
673 Ga0207706_10008705 3300025933 Bacteria 9347
674 Ga0207706_10029575 3300025933 Bacteria 4889
675 Ga0207706_10077712 3300025933 Bacteria 2919
676 Ga0207706_10140742 3300025933 Bacteria 2123
677 Ga0207706_10154817 3300025933 Bacteria 2016
678 Ga0207706_10272008 3300025933 Bacteria 1478
679 Ga0207706_10325025 3300025933 Bacteria 1338
680 Ga0207706_10588985 3300025933 Bacteria 956
681 Ga0207706_10648762 3300025933 Bacteria 904
682 Ga0207706_10690079 3300025933 Bacteria 873
683 Ga0207706_10936345 3300025933 Bacteria 730
684 Ga0207686_10126169 3300025934 Bacteria 1749
685 Ga0207686_10203240 3300025934 Bacteria 1420
686 Ga0207686_10716040 3300025934 Bacteria 797
687 Ga0207709_10013384 3300025935 Bacteria 4526
688 Ga0207709_10084719 3300025935 Bacteria 2053
689 Ga0207709_10316307 3300025935 Bacteria 1167
690 Ga0207709_10365619 3300025935 Bacteria 1093
691 Ga0207670_10283257 3300025936 Bacteria 1292
692 Ga0207669_10028721 3300025937 Bacteria 3064
693 Ga0207669_10088504 3300025937 Bacteria 2008
694 Ga0207669_10091991 3300025937 Bacteria 1977
695 Ga0207669_10244440 3300025937 Bacteria 1332
696 Ga0207704_10016566 3300025938 Bacteria 3790
697 Ga0207704_10048680 3300025938 Bacteria 2543
698 Ga0207704_10228169 3300025938 Bacteria 1383
699 Ga0207704_10474285 3300025938 Bacteria 1003
700 Ga0207704_11161177 3300025938 Bacteria 657
701 Ga0207691_10000493 3300025940 Bacteria 39268
702 Ga0207691_10009043 3300025940 Bacteria 9558
703 Ga0207691_10047753 3300025940 Bacteria 3927
704 Ga0207691_10441174 3300025940 Bacteria 1108
705 Ga0207691_10994872 3300025940 Bacteria 700
706 Ga0207711_10000496 3300025941 Bacteria 40666
707 Ga0207711_10000591 3300025941 Bacteria 36753
708 Ga0207711_10007235 3300025941 Bacteria 9303
709 Ga0207711_10026112 3300025941 Bacteria 4899
710 Ga0207711_10178933 3300025941 Bacteria 1927
711 Ga0207711_10212839 3300025941 Bacteria 1766
712 Ga0207689_10000131 3300025942 Bacteria 63353
713 Ga0207689_10066375 3300025942 Bacteria 2967
714 Ga0207689_10128448 3300025942 Bacteria 2085
715 Ga0207689_10136985 3300025942 Bacteria 2016
716 Ga0207661_10602521 3300025944 Bacteria 1008
717 Ga0207661_11050414 3300025944 Bacteria 750
718 Ga0207661_11435078 3300025944 Bacteria 633
719 Ga0207679_10001267 3300025945 Bacteria 16008
720 Ga0207679_10039984 3300025945 Bacteria 3353
721 Ga0207679_10040798 3300025945 Bacteria 3325
722 Ga0207679_10053895 3300025945 Bacteria 2958
723 Ga0207679_10089695 3300025945 Bacteria 2374
724 Ga0207679_10112771 3300025945 Bacteria 2150
725 Ga0207679_10209298 3300025945 Bacteria 1634
726 Ga0207679_10343138 3300025945 Bacteria 1299
727 Ga0207679_10476437 3300025945 Bacteria 1110
728 Ga0207679_10551082 3300025945 Bacteria 1034
729 Ga0207679_10695546 3300025945 Bacteria 922
730 Ga0207679_11092054 3300025945 Bacteria 732
731 Ga0207679_11391043 3300025945 Bacteria 644
732 Ga0207667_10001522 3300025949 Bacteria 29145
733 Ga0207667_10014838 3300025949 Bacteria 8860
734 Ga0207667_10369860 3300025949 Bacteria 1461
735 Ga0207667_10521167 3300025949 Bacteria 1204
736 Ga0207667_10600227 3300025949 Bacteria 1110
737 Ga0207667_11158791 3300025949 Bacteria 754
738 Ga0207667_11710974 3300025949 Bacteria 595
739 Ga0207651_10000221 3300025960 Bacteria 24397
740 Ga0207651_10001650 3300025960 Bacteria 10237
741 Ga0207651_10022235 3300025960 Bacteria 3872
742 Ga0207651_10037997 3300025960 Bacteria 3159
743 Ga0207651_10144012 3300025960 Bacteria 1845
744 Ga0207651_10149359 3300025960 Bacteria 1817
745 Ga0207651_10569057 3300025960 Bacteria 987
746 Ga0207651_11561841 3300025960 Bacteria 594
747 Ga0207651_12009019 3300025960 Bacteria 519
748 Ga0207712_10000974 3300025961 Bacteria 20541
749 Ga0207712_10321624 3300025961 Bacteria 1277
750 Ga0207712_10776038 3300025961 Bacteria 841
751 Ga0207668_10000107 3300025972 Bacteria 59177
752 Ga0207668_10017211 3300025972 Bacteria 4524
753 Ga0207668_10018349 3300025972 Bacteria 4400
754 Ga0207668_10927237 3300025972 Bacteria 776
755 Ga0207668_11206177 3300025972 Bacteria 680
756 Ga0207640_10001011 3300025981 Bacteria 15551
757 Ga0207640_10205274 3300025981 Bacteria 1497
758 Ga0207640_10382128 3300025981 Bacteria 1141
759 Ga0207640_10394719 3300025981 Bacteria 1125
760 Ga0207640_10468433 3300025981 Bacteria 1042
761 Ga0207640_10481793 3300025981 Bacteria 1029
762 Ga0207640_10537075 3300025981 Bacteria 980
763 Ga0207640_10799066 3300025981 Bacteria 817
764 Ga0207640_11283523 3300025981 Bacteria 653
765 Ga0207658_10001593 3300025986 Bacteria 17501
766 Ga0207658_10012445 3300025986 Bacteria 5812
767 Ga0207658_10073001 3300025986 Bacteria 2603
768 Ga0207658_10089033 3300025986 Bacteria 2388
769 Ga0207658_10826975 3300025986 Bacteria 841
770 Ga0207658_10932284 3300025986 Bacteria 791
771 Ga0207677_10000872 3300026023 Bacteria 17147
772 Ga0207677_10013467 3300026023 Bacteria 4742
773 Ga0207677_10016751 3300026023 Bacteria 4350
774 Ga0207677_10065056 3300026023 Bacteria 2542
775 Ga0207677_10531662 3300026023 Bacteria 1022
776 Ga0207703_10004808 3300026035 Bacteria 10997
777 Ga0207703_10006948 3300026035 Bacteria 9009
778 Ga0207703_10017252 3300026035 Bacteria 5633
779 Ga0207703_10031157 3300026035 Bacteria 4215
780 Ga0207703_10046845 3300026035 Bacteria 3484
781 Ga0207639_10002206 3300026041 Bacteria 13118
782 Ga0207639_10069488 3300026041 Bacteria 2748
783 Ga0207639_10095574 3300026041 Bacteria 2388
784 Ga0207639_10122798 3300026041 Bacteria 2136
785 Ga0207639_10461028 3300026041 Bacteria 1155
786 Ga0207639_10476888 3300026041 Bacteria 1136
787 Ga0207639_10547654 3300026041 Bacteria 1062
788 Ga0207639_11857627 3300026041 Bacteria 563
789 Ga0207678_10011515 3300026067 Bacteria 7770
790 Ga0207678_10030342 3300026067 Bacteria 4720
791 Ga0207678_10040911 3300026067 Bacteria 4018
792 Ga0207678_10256755 3300026067 Bacteria 1497
793 Ga0207678_10352971 3300026067 Bacteria 1268
794 Ga0207678_10690401 3300026067 Bacteria 898
795 Ga0207678_10717185 3300026067 Bacteria 881
796 Ga0207678_10751699 3300026067 Bacteria 860
797 Ga0207678_10818197 3300026067 Bacteria 823
798 Ga0207678_10868654 3300026067 Bacteria 797
799 Ga0207708_10318908 3300026075 Bacteria 1268
800 Ga0207702_10005393 3300026078 Bacteria 11203
801 Ga0207702_10031577 3300026078 Bacteria 4414
802 Ga0207702_10062604 3300026078 Bacteria 3178
803 Ga0207702_10104916 3300026078 Bacteria 2502
804 Ga0207702_11085502 3300026078 Bacteria 794
805 Ga0207641_10003184 3300026088 Bacteria 14693
806 Ga0207641_10009658 3300026088 Bacteria 7948
807 Ga0207641_10053286 3300026088 Bacteria 3428
808 Ga0207641_10110874 3300026088 Bacteria 2432
809 Ga0207641_10284439 3300026088 Bacteria 1557
810 Ga0207648_10000752 3300026089 Bacteria 36454
811 Ga0207648_10007924 3300026089 Bacteria 10357
812 Ga0207648_10009606 3300026089 Bacteria 9252
813 Ga0207648_10031541 3300026089 Bacteria 4685
814 Ga0207648_10394435 3300026089 Bacteria 1253
815 Ga0207648_11470027 3300026089 Bacteria 640
816 Ga0207676_10000257 3300026095 Bacteria 46040
817 Ga0207676_10073720 3300026095 Bacteria 2748
818 Ga0207676_10286062 3300026095 Bacteria 1499
819 Ga0207676_10369765 3300026095 Bacteria 1331
820 Ga0207676_12072199 3300026095 Bacteria 567
821 Ga0207676_12110871 3300026095 Bacteria 562
822 Ga0207674_10000804 3300026116 Bacteria 40816
823 Ga0207674_10042596 3300026116 Bacteria 4687
824 Ga0207674_10096231 3300026116 Bacteria 2946
825 Ga0207674_10111486 3300026116 Bacteria 2710
826 Ga0207674_10127190 3300026116 Bacteria 2513
827 Ga0207674_11700970 3300026116 Bacteria 599
828 Ga0207675_100050573 3300026118 Bacteria 3878
829 Ga0207675_100448631 3300026118 Bacteria 1278
830 Ga0207683_10001252 3300026121 Bacteria 23031
831 Ga0207683_10036543 3300026121 Bacteria 4278
832 Ga0207683_10527541 3300026121 Bacteria 1091
833 Ga0207683_11723201 3300026121 Bacteria 576
834 Ga0207683_12143147 3300026121 Bacteria 507
835 Ga0207698_10004354 3300026142 Bacteria 8620
836 Ga0207698_10018020 3300026142 Bacteria 4802
837 Ga0207698_10031299 3300026142 Bacteria 3838
838 Ga0207698_10057194 3300026142 Bacteria 3015
839 Ga0207698_10059474 3300026142 Bacteria 2968
840 Ga0207698_10074821 3300026142 Bacteria 2703
841 Ga0207698_10091719 3300026142 Bacteria 2488
842 Ga0207698_10205648 3300026142 Bacteria 1767
843 Ga0207698_10284000 3300026142 Bacteria 1532
844 Ga0207698_10312790 3300026142 Bacteria 1467
845 Ga0207698_11017274 3300026142 Bacteria 840
846 Ga0207698_11114387 3300026142 Bacteria 802
847 Ga0209983_1035526 3300027665 Bacteria 1069
848 Ga0209974_10010219 3300027876 Bacteria 3168
849 Ga0268266_10000019 3300028379 Bacteria 556465
850 Ga0268266_10014442 3300028379 Bacteria 6789
851 Ga0268266_10018480 3300028379 Bacteria 5941
852 Ga0268266_10033304 3300028379 Bacteria 4380
853 Ga0268266_10192741 3300028379 Bacteria 1861
854 Ga0268266_10374192 3300028379 Bacteria 1342
855 Ga0268266_11489077 3300028379 Bacteria 652
856 Ga0268265_10008343 3300028380 Bacteria 6995
857 Ga0268265_10017102 3300028380 Bacteria 4996
858 Ga0268265_10105184 3300028380 Bacteria 2289
859 Ga0268265_10545331 3300028380 Bacteria 1100
860 Ga0268265_10740076 3300028380 Bacteria 953
861 Ga0268264_10000546 3300028381 Bacteria 47268
862 Ga0268264_10001215 3300028381 Bacteria 24779
863 Ga0268264_10068017 3300028381 Bacteria 3008
864 Ga0268264_10278915 3300028381 Bacteria 1564
865 Ga0268264_10308282 3300028381 Bacteria 1493
866 Ga0268264_10399042 3300028381 Bacteria 1321
867 Ga0265336_10041638 3300028666 Bacteria 1404
868 Ga0316182_1378271 3300030745 Bacteria 534
869 Ga0307408_100251073 3300031548 Bacteria 1459
870 Ga0307408_100354961 3300031548 Bacteria 1245
871 Ga0307408_100589591 3300031548 Bacteria 986
872 Ga0307408_101227339 3300031548 Bacteria 700
873 Ga0307408_101238475 3300031548 Bacteria 697
874 Ga0307408_101361553 3300031548 Bacteria 667
875 Ga0307405_10276337 3300031731 Bacteria 1262
876 Ga0307405_10895690 3300031731 Bacteria 750
877 Ga0307405_11081446 3300031731 Bacteria 688
878 Ga0307413_10111870 3300031824 Bacteria 1829
879 Ga0307413_10135429 3300031824 Bacteria 1693
880 Ga0307413_10185751 3300031824 Bacteria 1487
881 Ga0307413_10216035 3300031824 Bacteria 1397
882 Ga0307413_10325273 3300031824 Bacteria 1176
883 Ga0307413_10387005 3300031824 Bacteria 1091
884 Ga0307413_10940868 3300031824 Bacteria 737
885 Ga0307413_11242670 3300031824 Bacteria 649
886 Ga0307413_11533714 3300031824 Bacteria 590
887 Ga0307410_10011988 3300031852 Bacteria 4987
888 Ga0307410_10055070 3300031852 Bacteria 2699
889 Ga0307410_10070233 3300031852 Bacteria 2425
890 Ga0307410_10070507 3300031852 Bacteria 2421
891 Ga0307410_10076575 3300031852 Bacteria 2335
892 Ga0307410_10204688 3300031852 Bacteria 1509
893 Ga0307410_10830320 3300031852 Bacteria 788
894 Ga0307410_10953828 3300031852 Bacteria 737
895 Ga0307410_11277395 3300031852 Bacteria 641
896 Ga0307406_10022492 3300031901 Bacteria 3741
897 Ga0307406_10048893 3300031901 Bacteria 2674
898 Ga0307406_10148764 3300031901 Bacteria 1668
899 Ga0307406_10156176 3300031901 Bacteria 1634
900 Ga0307406_10736987 3300031901 Bacteria 826
901 Ga0307406_11525935 3300031901 Bacteria 588
902 Ga0307407_10056343 3300031903 Bacteria 2275
903 Ga0307407_10715769 3300031903 Bacteria 755
904 Ga0307412_10157915 3300031911 Bacteria 1681
905 Ga0307412_10172677 3300031911 Bacteria 1618
906 Ga0307412_10260860 3300031911 Bacteria 1351
907 Ga0307412_11263696 3300031911 Bacteria 663
908 Ga0307412_11263887 3300031911 Bacteria 663
909 Ga0307412_11812283 3300031911 Bacteria 561
910 Ga0307409_100009486 3300031995 Bacteria 5982
911 Ga0307409_100009922 3300031995 Bacteria 5881
912 Ga0307409_100010901 3300031995 Bacteria 5691
913 Ga0307409_100112136 3300031995 Bacteria 2289
914 Ga0307409_100720788 3300031995 Bacteria 998
915 Ga0307416_100012537 3300032002 Bacteria 5716
916 Ga0307416_100080701 3300032002 Bacteria 2747
917 Ga0307416_100722950 3300032002 Bacteria 1086
918 Ga0307416_101569448 3300032002 Bacteria 764
919 Ga0307416_102743452 3300032002 Bacteria 589
920 Ga0307414_10003583 3300032004 Bacteria 8312
921 Ga0307414_10182168 3300032004 Bacteria 1690
922 Ga0307414_10366631 3300032004 Bacteria 1241
923 Ga0307411_10004272 3300032005 Bacteria 6810
924 Ga0307411_10032674 3300032005 Bacteria 3218
925 Ga0307411_10129219 3300032005 Bacteria 1843
926 Ga0307411_10215303 3300032005 Bacteria 1486
927 Ga0307411_10315993 3300032005 Bacteria 1259
928 Ga0307411_10318436 3300032005 Bacteria 1255
929 Ga0307411_10540808 3300032005 Bacteria 992
930 Ga0307411_10714585 3300032005 Bacteria 874
931 Ga0307411_11787030 3300032005 Bacteria 570
932 Ga0307411_11811809 3300032005 Bacteria 567
933 Ga0307415_100017753 3300032126 Bacteria 4274
934 Ga0307415_100024406 3300032126 Bacteria 3774
935 Ga0307415_100033049 3300032126 Bacteria 3354
936 Ga0307415_100046414 3300032126 Bacteria 2918
937 Ga0307415_100145041 3300032126 Bacteria 1818
938 Ga0307415_100286814 3300032126 Bacteria 1357
939 Ga0307415_101016559 3300032126 Bacteria 771
940 Ga0307415_101685120 3300032126 Bacteria 611
941 Ga0307415_101962472 3300032126 Bacteria 569
942 Ga0307415_102245018 3300032126 Bacteria 535
943 Ga0373941_0106999 3300035115 Bacteria 981
944 Ga0373941_0187912 3300035115 Bacteria 779
945 Ga0373962_0262216 3300035242 Bacteria 603
946 Ga0373931_0052962 3300035691 Bacteria 2165
947 Ga0373937_0683389 3300036401 Bacteria 973
948 Ga0395899_0011637 3300037312 Bacteria 6732
949 Ga0395899_0041032 3300037312 Bacteria 3459
950 Ga0395899_0201002 3300037312 Bacteria 1389
951 Ga0395899_0217988 3300037312 Bacteria 1323
952 Ga0395899_0249211 3300037312 Bacteria 1219
953 Ga0395899_0293042 3300037312 Bacteria 1103
954 Ga0395899_0302145 3300037312 Bacteria 1082
955 Ga0395899_0388000 3300037312 Bacteria 927
956 Ga0395899_0715469 3300037312 Bacteria 627
957 Ga0395899_0729971 3300037312 Bacteria 618
958 Ga0395900_0000739 3300037418 Bacteria 43430
959 Ga0395900_0049980 3300037418 Bacteria 4307
960 Ga0395900_0089554 3300037418 Bacteria 3163
961 Ga0395900_0168793 3300037418 Bacteria 2229
962 Ga0395900_0179220 3300037418 Bacteria 2154
963 Ga0395900_0215969 3300037418 Bacteria 1935
964 Ga0395900_0237965 3300037418 Bacteria 1827
965 Ga0395900_0463560 3300037418 Bacteria 1221
966 Ga0395900_0464136 3300037418 Bacteria 1220
967 Ga0395900_0465405 3300037418 Bacteria 1218
968 Ga0395900_0676317 3300037418 Bacteria 967
969 Ga0395900_0687337 3300037418 Bacteria 957
970 Ga0395898_0000169 3300037466 Bacteria 168667
971 Ga0395898_0034121 3300037466 Bacteria 5073
972 Ga0395898_0037720 3300037466 Bacteria 4792
973 Ga0395898_0049697 3300037466 Bacteria 4108
974 Ga0395898_0121238 3300037466 Bacteria 2505
975 Ga0395898_0201755 3300037466 Bacteria 1899
976 Ga0395898_0221983 3300037466 Bacteria 1802
977 Ga0395898_0724009 3300037466 Bacteria 936
978 Ga0395898_1204670 3300037466 Bacteria 688
979 Ga0395898_1584120 3300037466 Bacteria 579
980 Ga0395898_1824323 3300037466 Bacteria 529
981 Ga0395905_0000109 3300037471 Bacteria 137754
982 Ga0395905_0003255 3300037471 Bacteria 17461
983 Ga0395905_0003687 3300037471 Bacteria 16217
984 Ga0395905_0011082 3300037471 Bacteria 8726
985 Ga0395905_0011183 3300037471 Bacteria 8677
986 Ga0395905_0013554 3300037471 Bacteria 7810
987 Ga0395905_0014992 3300037471 Bacteria 7390
988 Ga0395905_0025518 3300037471 Bacteria 5573
989 Ga0395905_0041515 3300037471 Bacteria 4316
990 Ga0395905_0041597 3300037471 Bacteria 4312
991 Ga0395905_0055673 3300037471 Bacteria 3702
992 Ga0395905_0081355 3300037471 Bacteria 3035
993 Ga0395905_0083972 3300037471 Bacteria 2983
994 Ga0395905_0105468 3300037471 Bacteria 2646
995 Ga0395905_0138318 3300037471 Bacteria 2291
996 Ga0395905_0147233 3300037471 Bacteria 2216
997 Ga0395905_0154021 3300037471 Bacteria 2162
998 Ga0395905_0169598 3300037471 Bacteria 2050
999 Ga0395905_0219606 3300037471 Bacteria 1779
1000 Ga0395905_0292906 3300037471 Bacteria 1514
1001 Ga0395905_0299450 3300037471 Bacteria 1495
1002 Ga0395905_0309779 3300037471 Bacteria 1467
1003 Ga0395905_0347331 3300037471 Bacteria 1375
1004 Ga0395905_0425462 3300037471 Bacteria 1224
1005 Ga0395905_0426211 3300037471 Bacteria 1223
1006 Ga0395905_0454829 3300037471 Bacteria 1178
1007 Ga0395905_0819450 3300037471 Bacteria 833
1008 Ga0395905_1128316 3300037471 Bacteria 687
1009 Ga0436364_1119123 3300037853 Bacteria 2655
1010 Ga0395901_0002515 3300038443 Bacteria 18556
1011 Ga0395901_0004885 3300038443 Bacteria 13522
1012 Ga0395901_0029318 3300038443 Bacteria 5665
1013 Ga0395901_0074507 3300038443 Bacteria 3541
1014 Ga0395901_0126026 3300038443 Bacteria 2691
1015 Ga0395901_0183107 3300038443 Bacteria 2197
1016 Ga0395901_0327858 3300038443 Bacteria 1583
1017 Ga0395901_0429273 3300038443 Bacteria 1354
1018 Ga0395901_0819009 3300038443 Bacteria 918
1019 Ga0395901_0907336 3300038443 Bacteria 862
1020 Ga0395901_1015341 3300038443 Bacteria 804
1021 Ga0395901_1533404 3300038443 Bacteria 621
1022 Ga0395901_1597606 3300038443 Bacteria 605
1023 Ga0395901_1875628 3300038443 Bacteria 547
1024 Ga0436365_0863121 3300039437 Bacteria 11353
1025 Ga0436363_0986144 3300039450 Bacteria 1074
1026 Ga0436363_1458857 3300039450 Bacteria 821
1027 Ga0436362_0274203 3300039453 Bacteria 647
1028 Ga0451847_0338526 3300041503 Bacteria 712
1029 Ga0439443_000202 3300042003 Bacteria 4429
1030 Ga0439448_0001896 3300042005 Bacteria 5568
1031 Ga0450917_000425 3300042120 Bacteria 3194
1032 Ga0450920_001263 3300042122 Bacteria 4163
1033 Ga0450890_063167 3300042127 Bacteria 582
1034 Ga0450905_000906 3300042142 Bacteria 3709
1035 Ga0450889_000007 3300042144 Bacteria 18930
1036 Ga0450889_042010 3300042144 Bacteria 553
1037 Ga0450907_046185 3300042146 Bacteria 748
1038 Ga0439458_0000089 3300042157 Bacteria 17399
1039 Ga0450918_009773 3300042531 Bacteria 1678
1040 Ga0466969_0012882 3300044656 Bacteria 4406
1041 Ga0466972_0142274 3300044658 Bacteria 1129
1042 Ga0466965_0362881 3300044683 Bacteria 795
1043 Ga0466966_0030294 3300044684 Bacteria 3513
1044 Ga0466966_0843333 3300044684 Unclassified 552
1045 Ga0466961_0016584 3300044693 Bacteria 4736
1046 Ga0466961_0037775 3300044693 Bacteria 3097
1047 Ga0466963_0002624 3300044694 Bacteria 10097
1048 Ga0466963_0064585 3300044694 Bacteria 2452
1049 Ga0466963_0088813 3300044694 Bacteria 2102
1050 Ga0466963_0544144 3300044694 Bacteria 820
1051 Ga0453684_1083656 3300044712 Bacteria 847
1052 Ga0466971_0015532 3300044719 Bacteria 3353
1053 Ga0466971_0036905 3300044719 Bacteria 2191
1054 Ga0466970_0051937 3300044765 Bacteria 2188
1055 Ga0466970_0212072 3300044765 Bacteria 1079
1056 Ga0466970_0402079 3300044765 Bacteria 781
1057 Ga0466957_0053072 3300044842 Bacteria 2470
1058 Ga0466957_0065981 3300044842 Bacteria 2230
1059 Ga0466957_0113182 3300044842 Bacteria 1723
1060 Ga0466957_0439441 3300044842 Unclassified 897
1061 Ga0466960_0037098 3300044901 Bacteria 2285
1062 Ga0466960_0548339 3300044901 Bacteria 682
1063 Ga0466960_0774685 3300044901 Bacteria 579
1064 Ga0466959_0038942 3300045049 Bacteria 3513
1065 Ga0466959_0105342 3300045049 Bacteria 2016
1066 Ga0466959_0291974 3300045049 Bacteria 1118
1067 Ga0466959_1211223 3300045049 Bacteria 502
1068 Ga0466958_0005699 3300045836 Bacteria 6726
1069 Ga0466958_0576523 3300045836 Bacteria 731
1070 Ga0466967_0097062 3300045976 Bacteria 2689
1071 Ga0466967_0236409 3300045976 Bacteria 1741
1072 Ga0466967_0297022 3300045976 Bacteria 1553
1073 Ga0466967_0317872 3300045976 Bacteria 1501
1074 Ga0466967_0326554 3300045976 Bacteria 1481
1075 Ga0466967_0663173 3300045976 Bacteria 1032
1076 Ga0466967_0787099 3300045976 Bacteria 944
1077 Ga0466967_2337100 3300045976 Bacteria 530
1078 Ga0495629_0755065 3300046459 Bacteria 644
1079 Ga0495605_0252249 3300046474 Bacteria 755
1080 Ga0495583_0340283 3300046506 Bacteria 593
1081 Ga0495606_0452314 3300046507 Bacteria 658
1082 Ga0495616_0140747 3300046513 Bacteria 1098
1083 Ga0495632_0191934 3300046519 Bacteria 933
1084 Ga0495663_0166394 3300046525 Bacteria 758
1085 Ga0495663_0208038 3300046525 Bacteria 684
1086 Ga0495642_0008809 3300046528 Bacteria 3858
1087 Ga0495642_0043590 3300046528 Bacteria 1830
1088 Ga0495642_0085663 3300046528 Bacteria 1330
1089 Ga0495654_0118918 3300046530 Bacteria 1198
1090 Ga0495597_0233696 3300046542 Bacteria 727
1091 Ga0495668_0031720 3300046616 Bacteria 2978
1092 Ga0495625_0701583 3300046660 Bacteria 598
1093 Ga0495647_0097774 3300046681 Bacteria 1212
1094 Ga0495669_0000417 3300046684 Bacteria 20552
1095 Ga0495669_0013726 3300046684 Bacteria 3458
1096 Ga0495669_0027072 3300046684 Bacteria 2507
1097 Ga0495669_0056214 3300046684 Bacteria 1773
1098 Ga0495669_0059048 3300046684 Bacteria 1731
1099 Ga0495669_0149789 3300046684 Bacteria 1104
1100 Ga0495669_0195265 3300046684 Bacteria 966
1101 Ga0495677_0058111 3300047445 Bacteria 1430
1102 Ga0495677_0252721 3300047445 Bacteria 689
1103 Ga0495681_0180861 3300047470 Bacteria 866
1104 Ga0496100_0009893 3300048903 Bacteria 5374
1105 Ga0496101_0014346 3300048904 Bacteria 5322
1106 Ga0496101_0016020 3300048904 Bacteria 5059
1107 Ga0496102_0009426 3300048905 Bacteria 8387
1108 Ga0496102_1611058 3300048905 Bacteria 567
1109 Ga0496103_0042935 3300048906 Bacteria 2783
1110 Ga0496103_0360814 3300048906 Bacteria 934
1111 Ga0496104_0051341 3300048907 Bacteria 3892
1112 Ga0496105_0383365 3300048908 Bacteria 1118
1113 Ga0496106_0008793 3300048909 Bacteria 7464
1114 Ga0496106_0111508 3300048909 Bacteria 2130
1115 Ga0496106_0992298 3300048909 Bacteria 661
1116 Ga0496107_0002426 3300048910 Bacteria 12080
1117 Ga0496107_0003734 3300048910 Bacteria 10223
1118 Ga0496107_0126637 3300048910 Bacteria 1884
1119 Ga0496108_0006811 3300048911 Bacteria 9245
1120 Ga0496108_0012667 3300048911 Bacteria 6871
1121 Ga0496108_0034822 3300048911 Bacteria 4184
1122 Ga0496108_1747949 3300048911 Bacteria 511
1123 Ga0496109_0008891 3300048912 Bacteria 8555
1124 Ga0496109_0026430 3300048912 Bacteria 5176
1125 Ga0496109_0130339 3300048912 Bacteria 2346
1126 Ga0496109_0283048 3300048912 Bacteria 1563
1127 Ga0496109_0333661 3300048912 Bacteria 1432
1128 Ga0496109_0432415 3300048912 Bacteria 1243
1129 Ga0496110_0003912 3300048913 Bacteria 11457
1130 Ga0496110_0007429 3300048913 Bacteria 8754
1131 Ga0496110_0238800 3300048913 Bacteria 1653
1132 Ga0496110_0258543 3300048913 Bacteria 1585
1133 Ga0496110_0362219 3300048913 Bacteria 1321
1134 Ga0496111_0003956 3300048914 Bacteria 9299
1135 Ga0496111_0271132 3300048914 Bacteria 1259
1136 Ga0496112_0001628 3300048915 Bacteria 17393
1137 Ga0496112_0014136 3300048915 Bacteria 7394
1138 Ga0496112_0015068 3300048915 Bacteria 7198
1139 Ga0496112_0069251 3300048915 Bacteria 3486
1140 Ga0496112_0188267 3300048915 Bacteria 2026
1141 Ga0496112_0463489 3300048915 Bacteria 1204
1142 Ga0496112_0611459 3300048915 Bacteria 1021
1143 Ga0496113_0013922 3300048916 Bacteria 5468
1144 Ga0496113_0051627 3300048916 Bacteria 3069
1145 Ga0496113_1049710 3300048916 Bacteria 640
1146 Ga0501296_069239 3300049519 Bacteria 545
1147 Ga0501040_0350371 3300049576 Bacteria 1058
1148 Ga0501067_0038834 3300049583 Bacteria 2643
1149 Ga0501279_112314 3300049775 Bacteria 501
1150 Ga0501045_1343461 3300049824 Bacteria 520
1151 nmdc:mga0k408_783224_c1 3300050493 Bacteria 556
1152 nmdc:mga07m45_361108_c1 3300050496 Bacteria 844
1153 nmdc:mga09592_79856_c1 3300050508 Bacteria 2785
1154 nmdc:mga06r32_219565_c1 3300050510 Bacteria 1889
1155 nmdc:mga0n895_1920718_c1 3300050512 Unclassified 551
1156 nmdc:mga0n895_543475_c1 3300050512 Bacteria 1168
1157 nmdc:mga0rr50_338358_c1 3300050513 Bacteria 1264
1158 nmdc:mga0a205_20051_c1 3300050515 Bacteria 6308
1159 Ga0500568_0002269 3300053139 Bacteria 11464
1160 Ga0500604_0000065 3300053151 Bacteria 37746
1161 Ga0500616_0000265 3300053153 Bacteria 79258
1162 Ga0590075_097613 3300059424 Bacteria 764
1163 Ga0466962_0012326 3300061719 Bacteria 4110
1164 Ga0466962_0033509 3300061719 Bacteria 2457

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046528 Ga0495642_0085663 Ga0495642_0085663_932_1279 92
2 3300025932 Ga0207690_10728823 Ga0207690_107288232 93
3 3300025944 Ga0207661_11050414 Ga0207661_110504142 93
4 3300031911 Ga0307412_11263696 Ga0307412_112636961 94
5 3300025961 Ga0207712_10776038 Ga0207712_107760381 95
6 3300005438 Ga0070701_10955306 Ga0070701_109553062 98
7 3300042003 Ga0439443_000202 Ga0439443_000202_4043_4378 98
8 3300031548 Ga0307408_101238475 Ga0307408_1012384752 99
9 3300032002 Ga0307416_101569448 Ga0307416_1015694481 99
10 3300005355 Ga0070671_100282169 Ga0070671_1002821692 100
11 3300005841 Ga0068863_100023741 Ga0068863_10002374110 100
12 3300014325 Ga0163163_11431272 Ga0163163_114312722 100
13 3300025931 Ga0207644_10233275 Ga0207644_102332752 100
14 3300026088 Ga0207641_10110874 Ga0207641_101108744 100
15 3300030745 Ga0316182_1378271 Ga0316182_13782711 102
16 3300032126 Ga0307415_100286814 Ga0307415_1002868142 102
17 3300037471 Ga0395905_0219606 Ga0395905_0219606_1327_1641 104
18 3300005457 Ga0070662_100727699 Ga0070662_1007276991 105
19 3300005539 Ga0068853_100031943 Ga0068853_1000319434 105
20 3300005546 Ga0070696_100580512 Ga0070696_1005805123 105
21 3300005577 Ga0068857_102484136 Ga0068857_1024841361 105
22 3300005616 Ga0068852_100387021 Ga0068852_1003870212 105
23 3300005834 Ga0068851_10929918 Ga0068851_109299182 105
24 3300005834 Ga0068851_11053675 Ga0068851_110536751 105
25 3300009177 Ga0105248_10009936 Ga0105248_100099363 105
26 3300009551 Ga0105238_10079429 Ga0105238_100794298 105
27 3300010375 Ga0105239_11042760 Ga0105239_110427602 105
28 3300013105 Ga0157369_10116767 Ga0157369_101167671 105
29 3300013307 Ga0157372_10422828 Ga0157372_104228282 105
30 3300025927 Ga0207687_11491188 Ga0207687_114911881 105
31 3300026041 Ga0207639_10122798 Ga0207639_101227982 105
32 3300026142 Ga0207698_10031299 Ga0207698_100312992 105
33 3300037312 Ga0395899_0388000 Ga0395899_0388000_28_345 105
34 3300037312 Ga0395899_0715469 Ga0395899_0715469_159_476 105
35 3300037418 Ga0395900_0089554 Ga0395900_0089554_210_554 105
36 3300037471 Ga0395905_0003687 Ga0395905_0003687_15679_15996 105
37 3300037471 Ga0395905_0014992 Ga0395905_0014992_1171_1515 105
38 3300037471 Ga0395905_0083972 Ga0395905_0083972_1042_1359 105
39 3300039450 Ga0436363_1458857 Ga0436363_1458857_188_538 105
40 3300039453 Ga0436362_0274203 Ga0436362_0274203_144_494 105
41 3300048913 Ga0496110_0258543 Ga0496110_0258543_44_367 105
42 3300048915 Ga0496112_0015068 Ga0496112_0015068_5007_5330 105
43 3300005329 Ga0070683_101712373 Ga0070683_1017123732 106
44 3300005344 Ga0070661_101215824 Ga0070661_1012158242 106
45 3300005366 Ga0070659_100051114 Ga0070659_1000511144 106
46 3300005366 Ga0070659_101198102 Ga0070659_1011981022 106
47 3300005444 Ga0070694_100923370 Ga0070694_1009233702 106
48 3300005455 Ga0070663_100541776 Ga0070663_1005417763 106
49 3300005457 Ga0070662_101313349 Ga0070662_1013133492 106
50 3300005458 Ga0070681_10559208 Ga0070681_105592082 106
51 3300005539 Ga0068853_100415761 Ga0068853_1004157612 106
52 3300009148 Ga0105243_10473869 Ga0105243_104738691 106
53 3300009174 Ga0105241_11414955 Ga0105241_114149552 106
54 3300013307 Ga0157372_10074693 Ga0157372_100746934 106
55 3300035115 Ga0373941_0187912 Ga0373941_0187912_260_580 106
56 3300037418 Ga0395900_0179220 Ga0395900_0179220_302_622 106
57 3300037471 Ga0395905_0003255 Ga0395905_0003255_6137_6457 106
58 3300037471 Ga0395905_0025518 Ga0395905_0025518_247_567 106
59 3300037471 Ga0395905_0138318 Ga0395905_0138318_88_408 106
60 3300037471 Ga0395905_0169598 Ga0395905_0169598_1575_1895 106
61 3300037471 Ga0395905_0347331 Ga0395905_0347331_533_880 106
62 3300038443 Ga0395901_0429273 Ga0395901_0429273_726_1046 106
63 3300045976 Ga0466967_0236409 Ga0466967_0236409_1000_1323 106
64 3300046616 Ga0495668_0031720 Ga0495668_0031720_828_1148 106
65 3300001915 JGI24741J21665_1030044 JGI24741J21665_10300442 107
66 3300001979 JGI24740J21852_10008648 JGI24740J21852_100086482 107
67 3300002067 JGI24735J21928_10146226 JGI24735J21928_101462262 107
68 3300005327 Ga0070658_11343477 Ga0070658_113434771 107
69 3300005328 Ga0070676_10375164 Ga0070676_103751642 107
70 3300005329 Ga0070683_100025127 Ga0070683_1000251275 107
71 3300005331 Ga0070670_100286179 Ga0070670_1002861792 107
72 3300005334 Ga0068869_102051522 Ga0068869_1020515221 107
73 3300005337 Ga0070682_100054836 Ga0070682_1000548362 107
74 3300005339 Ga0070660_100091291 Ga0070660_1000912912 107
75 3300005340 Ga0070689_100831743 Ga0070689_1008317432 107
76 3300005344 Ga0070661_100206773 Ga0070661_1002067732 107
77 3300005344 Ga0070661_100262148 Ga0070661_1002621483 107
78 3300005354 Ga0070675_100079086 Ga0070675_1000790862 107
79 3300005364 Ga0070673_100390458 Ga0070673_1003904582 107
80 3300005366 Ga0070659_100127228 Ga0070659_1001272283 107
81 3300005366 Ga0070659_100725893 Ga0070659_1007258932 107
82 3300005455 Ga0070663_100005994 Ga0070663_1000059946 107
83 3300005455 Ga0070663_100536152 Ga0070663_1005361522 107
84 3300005457 Ga0070662_100073947 Ga0070662_1000739472 107
85 3300005457 Ga0070662_100361315 Ga0070662_1003613152 107
86 3300005458 Ga0070681_11271263 Ga0070681_112712631 107
87 3300005459 Ga0068867_101037122 Ga0068867_1010371223 107
88 3300005539 Ga0068853_100179487 Ga0068853_1001794873 107
89 3300005539 Ga0068853_100793663 Ga0068853_1007936632 107
90 3300005545 Ga0070695_101651290 Ga0070695_1016512902 107
91 3300005546 Ga0070696_100007123 Ga0070696_1000071237 107
92 3300005547 Ga0070693_100034552 Ga0070693_1000345522 107
93 3300005563 Ga0068855_100917437 Ga0068855_1009174372 107
94 3300005563 Ga0068855_102077726 Ga0068855_1020777261 107
95 3300005564 Ga0070664_100011025 Ga0070664_1000110253 107
96 3300005564 Ga0070664_100508078 Ga0070664_1005080782 107
97 3300005577 Ga0068857_100006851 Ga0068857_10000685111 107
98 3300005614 Ga0068856_100131367 Ga0068856_1001313673 107
99 3300005614 Ga0068856_102034361 Ga0068856_1020343611 107
100 3300005617 Ga0068859_100003879 Ga0068859_10000387911 107
101 3300005618 Ga0068864_100059215 Ga0068864_1000592153 107
102 3300005719 Ga0068861_100510232 Ga0068861_1005102323 107
103 3300005834 Ga0068851_10210537 Ga0068851_102105372 107
104 3300005841 Ga0068863_100061481 Ga0068863_1000614813 107
105 3300005842 Ga0068858_100161086 Ga0068858_1001610862 107
106 3300005844 Ga0068862_100033982 Ga0068862_1000339824 107
107 3300006358 Ga0068871_101433348 Ga0068871_1014333482 107
108 3300006931 Ga0097620_100003878 Ga0097620_10000387811 107
109 3300009093 Ga0105240_10675455 Ga0105240_106754552 107
110 3300009101 Ga0105247_10845577 Ga0105247_108455773 107
111 3300009148 Ga0105243_10230162 Ga0105243_102301622 107
112 3300009174 Ga0105241_10866408 Ga0105241_108664082 107
113 3300009176 Ga0105242_12205052 Ga0105242_122050521 107
114 3300009545 Ga0105237_10090947 Ga0105237_100909473 107
115 3300009551 Ga0105238_10582365 Ga0105238_105823652 107
116 3300009553 Ga0105249_10058427 Ga0105249_100584273 107
117 3300013100 Ga0157373_10005655 Ga0157373_100056559 107
118 3300013100 Ga0157373_10069512 Ga0157373_100695121 107
119 3300013102 Ga0157371_10948407 Ga0157371_109484072 107
120 3300013104 Ga0157370_10620859 Ga0157370_106208592 107
121 3300013104 Ga0157370_10637814 Ga0157370_106378142 107
122 3300013105 Ga0157369_10616186 Ga0157369_106161862 107
123 3300013105 Ga0157369_10782299 Ga0157369_107822992 107
124 3300013306 Ga0163162_10775033 Ga0163162_107750333 107
125 3300013307 Ga0157372_10253962 Ga0157372_102539622 107
126 3300014326 Ga0157380_12361231 Ga0157380_123612311 107
127 3300014497 Ga0182008_10489314 Ga0182008_104893142 107
128 3300014745 Ga0157377_11526499 Ga0157377_115264992 107
129 3300025321 Ga0207656_10247216 Ga0207656_102472162 107
130 3300025893 Ga0207682_10163163 Ga0207682_101631632 107
131 3300025907 Ga0207645_10015455 Ga0207645_100154552 107
132 3300025919 Ga0207657_10012549 Ga0207657_100125492 107
133 3300025920 Ga0207649_10147812 Ga0207649_101478122 107
134 3300025920 Ga0207649_10186939 Ga0207649_101869392 107
135 3300025923 Ga0207681_10375492 Ga0207681_103754922 107
136 3300025925 Ga0207650_10048005 Ga0207650_100480053 107
137 3300025926 Ga0207659_10055543 Ga0207659_100555433 107
138 3300025932 Ga0207690_10016980 Ga0207690_100169803 107
139 3300025932 Ga0207690_10144680 Ga0207690_101446802 107
140 3300025933 Ga0207706_10648762 Ga0207706_106487622 107
141 3300025936 Ga0207670_10283257 Ga0207670_102832572 107
142 3300025938 Ga0207704_11161177 Ga0207704_111611772 107
143 3300025942 Ga0207689_10066375 Ga0207689_100663754 107
144 3300025944 Ga0207661_11435078 Ga0207661_114350782 107
145 3300025945 Ga0207679_10039984 Ga0207679_100399843 107
146 3300025945 Ga0207679_10053895 Ga0207679_100538952 107
147 3300025949 Ga0207667_10369860 Ga0207667_103698602 107
148 3300025981 Ga0207640_10481793 Ga0207640_104817932 107
149 3300026035 Ga0207703_10031157 Ga0207703_100311574 107
150 3300026067 Ga0207678_10011515 Ga0207678_100115152 107
151 3300026078 Ga0207702_11085502 Ga0207702_110855021 107
152 3300026088 Ga0207641_10053286 Ga0207641_100532863 107
153 3300026089 Ga0207648_11470027 Ga0207648_114700272 107
154 3300026116 Ga0207674_10000804 Ga0207674_1000080423 107
155 3300026116 Ga0207674_11700970 Ga0207674_117009702 107
156 3300026118 Ga0207675_100050573 Ga0207675_1000505733 107
157 3300028380 Ga0268265_10017102 Ga0268265_100171025 107
158 3300028381 Ga0268264_10399042 Ga0268264_103990423 107
159 3300035115 Ga0373941_0106999 Ga0373941_0106999_510_833 107
160 3300037312 Ga0395899_0217988 Ga0395899_0217988_182_505 107
161 3300037312 Ga0395899_0293042 Ga0395899_0293042_173_499 107
162 3300037418 Ga0395900_0464136 Ga0395900_0464136_278_604 107
163 3300037418 Ga0395900_0465405 Ga0395900_0465405_549_872 107
164 3300037466 Ga0395898_1204670 Ga0395898_1204670_196_522 107
165 3300037466 Ga0395898_1584120 Ga0395898_1584120_81_407 107
166 3300037471 Ga0395905_0105468 Ga0395905_0105468_1231_1557 107
167 3300037471 Ga0395905_1128316 Ga0395905_1128316_235_561 107
168 3300038443 Ga0395901_1533404 Ga0395901_1533404_67_390 107
169 3300038443 Ga0395901_1597606 Ga0395901_1597606_107_433 107
170 3300044694 Ga0466963_0088813 Ga0466963_0088813_1534_1860 107
171 3300045976 Ga0466967_0097062 Ga0466967_0097062_178_504 107
172 3300045976 Ga0466967_0663173 Ga0466967_0663173_206_532 107
173 3300046519 Ga0495632_0191934 Ga0495632_0191934_597_923 107
174 3300046684 Ga0495669_0149789 Ga0495669_0149789_542_865 107
175 3300048909 Ga0496106_0992298 Ga0496106_0992298_127_450 107
176 3300048912 Ga0496109_0283048 Ga0496109_0283048_1124_1447 107
177 3300013104 Ga0157370_10003954 Ga0157370_100039542 108
178 3300025912 Ga0207707_11141588 Ga0207707_111415881 108
179 3300025945 Ga0207679_11092054 Ga0207679_110920541 108
180 3300026067 Ga0207678_10818197 Ga0207678_108181972 108
181 3300031824 Ga0307413_11533714 Ga0307413_115337142 108
182 3300001991 JGI24743J22301_10142795 JGI24743J22301_101427951 109
183 3300002075 JGI24738J21930_10078752 JGI24738J21930_100787521 109
184 3300005455 Ga0070663_101864482 Ga0070663_1018644822 109
185 3300005457 Ga0070662_100291102 Ga0070662_1002911022 109
186 3300005459 Ga0068867_100393050 Ga0068867_1003930502 109
187 3300005466 Ga0070685_10081857 Ga0070685_100818574 109
188 3300005535 Ga0070684_101892493 Ga0070684_1018924932 109
189 3300005548 Ga0070665_100600558 Ga0070665_1006005583 109
190 3300005718 Ga0068866_10255357 Ga0068866_102553572 109
191 3300005842 Ga0068858_100943282 Ga0068858_1009432822 109
192 3300005843 Ga0068860_100110321 Ga0068860_1001103212 109
193 3300006237 Ga0097621_101217484 Ga0097621_1012174842 109
194 3300006881 Ga0068865_100179213 Ga0068865_1001792132 109
195 3300009177 Ga0105248_10002609 Ga0105248_100026098 109
196 3300013102 Ga0157371_10985472 Ga0157371_109854721 109
197 3300013296 Ga0157374_11942331 Ga0157374_119423312 109
198 3300025899 Ga0207642_10581916 Ga0207642_105819162 109
199 3300025903 Ga0207680_10000396 Ga0207680_1000039619 109
200 3300025904 Ga0207647_10272355 Ga0207647_102723552 109
201 3300025907 Ga0207645_10432119 Ga0207645_104321192 109
202 3300025918 Ga0207662_10399798 Ga0207662_103997982 109
203 3300025927 Ga0207687_10339271 Ga0207687_103392712 109
204 3300025931 Ga0207644_10278030 Ga0207644_102780302 109
205 3300025937 Ga0207669_10091991 Ga0207669_100919914 109
206 3300025938 Ga0207704_10228169 Ga0207704_102281692 109
207 3300025941 Ga0207711_10000496 Ga0207711_100004969 109
208 3300025960 Ga0207651_10022235 Ga0207651_100222352 109
209 3300025981 Ga0207640_10394719 Ga0207640_103947192 109
210 3300025986 Ga0207658_10001593 Ga0207658_100015937 109
211 3300026023 Ga0207677_10065056 Ga0207677_100650563 109
212 3300026035 Ga0207703_10046845 Ga0207703_100468452 109
213 3300026088 Ga0207641_10284439 Ga0207641_102844391 109
214 3300026089 Ga0207648_10394435 Ga0207648_103944352 109
215 3300026142 Ga0207698_10057194 Ga0207698_100571944 109
216 3300028379 Ga0268266_10018480 Ga0268266_100184803 109
217 3300028381 Ga0268264_10278915 Ga0268264_102789152 109
218 3300031824 Ga0307413_10325273 Ga0307413_103252733 109
219 3300031852 Ga0307410_10204688 Ga0307410_102046882 109
220 3300031995 Ga0307409_100010901 Ga0307409_1000109018 109
221 3300032005 Ga0307411_10215303 Ga0307411_102153032 109
222 3300035242 Ga0373962_0262216 Ga0373962_0262216_62_391 109
223 3300035691 Ga0373931_0052962 Ga0373931_0052962_1376_1705 109
224 3300037312 Ga0395899_0041032 Ga0395899_0041032_342_686 109
225 3300037418 Ga0395900_0463560 Ga0395900_0463560_357_701 109
226 3300037466 Ga0395898_0049697 Ga0395898_0049697_2471_2815 109
227 3300037471 Ga0395905_0154021 Ga0395905_0154021_1156_1491 109
228 3300037471 Ga0395905_0309779 Ga0395905_0309779_141_470 109
229 3300037471 Ga0395905_0819450 Ga0395905_0819450_390_734 109
230 3300037853 Ga0436364_1119123 Ga0436364_1119123_1327_1659 109
231 3300038443 Ga0395901_0126026 Ga0395901_0126026_882_1226 109
232 3300044842 Ga0466957_0113182 Ga0466957_0113182_340_669 109
233 3300045836 Ga0466958_0576523 Ga0466958_0576523_270_599 109
234 3300045976 Ga0466967_0326554 Ga0466967_0326554_44_391 109
235 3300046528 Ga0495642_0008809 Ga0495642_0008809_2467_2796 109
236 3300046684 Ga0495669_0013726 Ga0495669_0013726_2477_2809 109
237 3300046684 Ga0495669_0027072 Ga0495669_0027072_96_425 109
238 3300048903 Ga0496100_0009893 Ga0496100_0009893_1991_2320 109
239 3300048904 Ga0496101_0014346 Ga0496101_0014346_1670_1999 109
240 3300048904 Ga0496101_0016020 Ga0496101_0016020_3974_4303 109
241 3300048905 Ga0496102_0009426 Ga0496102_0009426_8027_8356 109
242 3300048905 Ga0496102_1611058 Ga0496102_1611058_15_344 109
243 3300048906 Ga0496103_0042935 Ga0496103_0042935_1433_1762 109
244 3300048907 Ga0496104_0051341 Ga0496104_0051341_2185_2514 109
245 3300048909 Ga0496106_0008793 Ga0496106_0008793_3812_4141 109
246 3300048909 Ga0496106_0111508 Ga0496106_0111508_234_563 109
247 3300048910 Ga0496107_0002426 Ga0496107_0002426_3324_3653 109
248 3300048910 Ga0496107_0003734 Ga0496107_0003734_3950_4279 109
249 3300048911 Ga0496108_0012667 Ga0496108_0012667_5963_6292 109
250 3300048911 Ga0496108_0034822 Ga0496108_0034822_2867_3196 109
251 3300048912 Ga0496109_0008891 Ga0496109_0008891_3614_3943 109
252 3300048912 Ga0496109_0026430 Ga0496109_0026430_3314_3643 109
253 3300048913 Ga0496110_0003912 Ga0496110_0003912_1870_2199 109
254 3300048913 Ga0496110_0238800 Ga0496110_0238800_1007_1336 109
255 3300048915 Ga0496112_0001628 Ga0496112_0001628_10843_11172 109
256 3300048915 Ga0496112_0069251 Ga0496112_0069251_156_485 109
257 3300048915 Ga0496112_0463489 Ga0496112_0463489_137_466 109
258 3300048916 Ga0496113_0013922 Ga0496113_0013922_1138_1467 109
259 3300048916 Ga0496113_1049710 Ga0496113_1049710_38_367 109
260 3300005293 Ga0065715_10568368 Ga0065715_105683681 110
261 3300005331 Ga0070670_100023107 Ga0070670_1000231077 110
262 3300005331 Ga0070670_100122913 Ga0070670_1001229132 110
263 3300005331 Ga0070670_101689272 Ga0070670_1016892722 110
264 3300005335 Ga0070666_10340683 Ga0070666_103406832 110
265 3300005344 Ga0070661_100284364 Ga0070661_1002843642 110
266 3300005347 Ga0070668_101111657 Ga0070668_1011116572 110
267 3300005353 Ga0070669_100075855 Ga0070669_1000758553 110
268 3300005353 Ga0070669_100436838 Ga0070669_1004368382 110
269 3300005353 Ga0070669_100811533 Ga0070669_1008115331 110
270 3300005354 Ga0070675_100170296 Ga0070675_1001702962 110
271 3300005354 Ga0070675_101865043 Ga0070675_1018650432 110
272 3300005355 Ga0070671_100452710 Ga0070671_1004527102 110
273 3300005355 Ga0070671_100513317 Ga0070671_1005133172 110
274 3300005356 Ga0070674_100427947 Ga0070674_1004279472 110
275 3300005364 Ga0070673_100082178 Ga0070673_1000821782 110
276 3300005364 Ga0070673_100649319 Ga0070673_1006493192 110
277 3300005367 Ga0070667_100486230 Ga0070667_1004862302 110
278 3300005367 Ga0070667_101497663 Ga0070667_1014976632 110
279 3300005457 Ga0070662_100128827 Ga0070662_1001288272 110
280 3300005457 Ga0070662_100415158 Ga0070662_1004151582 110
281 3300005543 Ga0070672_100267612 Ga0070672_1002676124 110
282 3300005564 Ga0070664_100155792 Ga0070664_1001557923 110
283 3300005564 Ga0070664_101301121 Ga0070664_1013011212 110
284 3300005577 Ga0068857_100083227 Ga0068857_1000832272 110
285 3300005615 Ga0070702_100676574 Ga0070702_1006765742 110
286 3300005618 Ga0068864_100376992 Ga0068864_1003769922 110
287 3300005840 Ga0068870_10174740 Ga0068870_101747403 110
288 3300005841 Ga0068863_101736642 Ga0068863_1017366422 110
289 3300009011 Ga0105251_10200521 Ga0105251_102005212 110
290 3300009148 Ga0105243_13092523 Ga0105243_130925231 110
291 3300013100 Ga0157373_10269315 Ga0157373_102693152 110
292 3300013100 Ga0157373_10562111 Ga0157373_105621112 110
293 3300013102 Ga0157371_11014383 Ga0157371_110143832 110
294 3300014326 Ga0157380_10323864 Ga0157380_103238642 110
295 3300014326 Ga0157380_10362017 Ga0157380_103620173 110
296 3300025901 Ga0207688_10182063 Ga0207688_101820632 110
297 3300025903 Ga0207680_10353414 Ga0207680_103534141 110
298 3300025908 Ga0207643_10072976 Ga0207643_100729761 110
299 3300025920 Ga0207649_10444259 Ga0207649_104442591 110
300 3300025923 Ga0207681_10032517 Ga0207681_100325174 110
301 3300025923 Ga0207681_10708949 Ga0207681_107089492 110
302 3300025923 Ga0207681_10824260 Ga0207681_108242602 110
303 3300025925 Ga0207650_10464158 Ga0207650_104641582 110
304 3300025925 Ga0207650_10828413 Ga0207650_108284132 110
305 3300025926 Ga0207659_10157601 Ga0207659_101576014 110
306 3300025931 Ga0207644_10083742 Ga0207644_100837422 110
307 3300025931 Ga0207644_11171315 Ga0207644_111713151 110
308 3300025933 Ga0207706_10077712 Ga0207706_100777123 110
309 3300025935 Ga0207709_10365619 Ga0207709_103656192 110
310 3300025945 Ga0207679_10476437 Ga0207679_104764372 110
311 3300025945 Ga0207679_10551082 Ga0207679_105510822 110
312 3300025960 Ga0207651_10037997 Ga0207651_100379975 110
313 3300025960 Ga0207651_11561841 Ga0207651_115618412 110
314 3300025972 Ga0207668_10927237 Ga0207668_109272372 110
315 3300025972 Ga0207668_11206177 Ga0207668_112061772 110
316 3300026067 Ga0207678_10868654 Ga0207678_108686542 110
317 3300026095 Ga0207676_10286062 Ga0207676_102860622 110
318 3300026095 Ga0207676_12110871 Ga0207676_121108712 110
319 3300026116 Ga0207674_10042596 Ga0207674_100425965 110
320 3300027665 Ga0209983_1035526 Ga0209983_10355262 110
321 3300027876 Ga0209974_10010219 Ga0209974_100102192 110
322 3300031548 Ga0307408_100251073 Ga0307408_1002510731 110
323 3300031548 Ga0307408_100354961 Ga0307408_1003549612 110
324 3300031548 Ga0307408_100589591 Ga0307408_1005895912 110
325 3300031548 Ga0307408_101227339 Ga0307408_1012273392 110
326 3300031548 Ga0307408_101361553 Ga0307408_1013615532 110
327 3300031731 Ga0307405_10895690 Ga0307405_108956902 110
328 3300031824 Ga0307413_10111870 Ga0307413_101118701 110
329 3300031824 Ga0307413_10135429 Ga0307413_101354292 110
330 3300031824 Ga0307413_10940868 Ga0307413_109408682 110
331 3300031824 Ga0307413_11242670 Ga0307413_112426702 110
332 3300031852 Ga0307410_10011988 Ga0307410_100119882 110
333 3300031852 Ga0307410_10055070 Ga0307410_100550703 110
334 3300031852 Ga0307410_10070507 Ga0307410_100705075 110
335 3300031852 Ga0307410_10830320 Ga0307410_108303202 110
336 3300031852 Ga0307410_10953828 Ga0307410_109538282 110
337 3300031852 Ga0307410_11277395 Ga0307410_112773952 110
338 3300031901 Ga0307406_10048893 Ga0307406_100488933 110
339 3300031901 Ga0307406_10736987 Ga0307406_107369872 110
340 3300031901 Ga0307406_11525935 Ga0307406_115259352 110
341 3300031903 Ga0307407_10715769 Ga0307407_107157692 110
342 3300031911 Ga0307412_10172677 Ga0307412_101726772 110
343 3300031911 Ga0307412_10260860 Ga0307412_102608602 110
344 3300031911 Ga0307412_11263887 Ga0307412_112638872 110
345 3300031995 Ga0307409_100009922 Ga0307409_1000099223 110
346 3300031995 Ga0307409_100720788 Ga0307409_1007207882 110
347 3300032002 Ga0307416_100080701 Ga0307416_1000807013 110
348 3300032002 Ga0307416_100722950 Ga0307416_1007229502 110
349 3300032002 Ga0307416_102743452 Ga0307416_1027434521 110
350 3300032004 Ga0307414_10003583 Ga0307414_100035832 110
351 3300032004 Ga0307414_10182168 Ga0307414_101821682 110
352 3300032004 Ga0307414_10366631 Ga0307414_103666311 110
353 3300032005 Ga0307411_10004272 Ga0307411_100042725 110
354 3300032005 Ga0307411_10315993 Ga0307411_103159932 110
355 3300032005 Ga0307411_10318436 Ga0307411_103184362 110
356 3300032005 Ga0307411_10540808 Ga0307411_105408081 110
357 3300032005 Ga0307411_10714585 Ga0307411_107145852 110
358 3300032005 Ga0307411_11787030 Ga0307411_117870302 110
359 3300032126 Ga0307415_100017753 Ga0307415_1000177532 110
360 3300032126 Ga0307415_101016559 Ga0307415_1010165592 110
361 3300032126 Ga0307415_101685120 Ga0307415_1016851202 110
362 3300032126 Ga0307415_101962472 Ga0307415_1019624722 110
363 3300042122 Ga0450920_001263 Ga0450920_001263_333_671 110
364 3300042144 Ga0450889_042010 Ga0450889_042010_142_480 110
365 3300042146 Ga0450907_046185 Ga0450907_046185_115_453 110
366 3300042531 Ga0450918_009773 Ga0450918_009773_753_1091 110
367 3300044683 Ga0466965_0362881 Ga0466965_0362881_120_464 110
368 3300044712 Ga0453684_1083656 Ga0453684_1083656_142_480 110
369 3300044901 Ga0466960_0774685 Ga0466960_0774685_162_506 110
370 3300046660 Ga0495625_0701583 Ga0495625_0701583_208_546 110
371 3300046684 Ga0495669_0195265 Ga0495669_0195265_612_950 110
372 3300048913 Ga0496110_0362219 Ga0496110_0362219_387_725 110
373 3300048914 Ga0496111_0271132 Ga0496111_0271132_209_547 110
374 3300049519 Ga0501296_069239 Ga0501296_069239_135_470 110
375 3300049576 Ga0501040_0350371 Ga0501040_0350371_164_499 110
376 3300049775 Ga0501279_112314 Ga0501279_112314_153_488 110
377 3300049824 Ga0501045_1343461 Ga0501045_1343461_128_463 110
378 3300050493 nmdc:mga0k408_783224_c1 nmdc:mga0k408_783224_c1_28_369 110
379 3300053139 Ga0500568_0002269 Ga0500568_0002269_5007_5339 110
380 3300053153 Ga0500616_0000265 Ga0500616_0000265_21032_21364 110
381 3300059424 Ga0590075_097613 Ga0590075_097613_219_557 110
382 3300005354 Ga0070675_100681224 Ga0070675_1006812242 111
383 3300005355 Ga0070671_102111229 Ga0070671_1021112291 111
384 3300005364 Ga0070673_100505408 Ga0070673_1005054082 111
385 3300005367 Ga0070667_101576383 Ga0070667_1015763832 111
386 3300005444 Ga0070694_100099652 Ga0070694_1000996522 111
387 3300005456 Ga0070678_100434828 Ga0070678_1004348282 111
388 3300005457 Ga0070662_100158288 Ga0070662_1001582883 111
389 3300005457 Ga0070662_101389651 Ga0070662_1013896511 111
390 3300005458 Ga0070681_10066272 Ga0070681_100662722 111
391 3300005459 Ga0068867_101629007 Ga0068867_1016290071 111
392 3300005467 Ga0070706_100365646 Ga0070706_1003656462 111
393 3300005530 Ga0070679_100841590 Ga0070679_1008415903 111
394 3300005539 Ga0068853_100583188 Ga0068853_1005831882 111
395 3300005543 Ga0070672_100577413 Ga0070672_1005774132 111
396 3300005545 Ga0070695_100008395 Ga0070695_1000083956 111
397 3300005546 Ga0070696_100004732 Ga0070696_1000047322 111
398 3300005546 Ga0070696_100136532 Ga0070696_1001365321 111
399 3300005578 Ga0068854_100244736 Ga0068854_1002447362 111
400 3300005843 Ga0068860_100012363 Ga0068860_1000123637 111
401 3300005844 Ga0068862_102192958 Ga0068862_1021929581 111
402 3300006237 Ga0097621_101137080 Ga0097621_1011370801 111
403 3300009098 Ga0105245_10007967 Ga0105245_100079675 111
404 3300013308 Ga0157375_10861828 Ga0157375_108618282 111
405 3300025903 Ga0207680_10192271 Ga0207680_101922712 111
406 3300025910 Ga0207684_10481385 Ga0207684_104813852 111
407 3300025912 Ga0207707_10992699 Ga0207707_109926992 111
408 3300025927 Ga0207687_10206784 Ga0207687_102067844 111
409 3300025932 Ga0207690_10093101 Ga0207690_100931012 111
410 3300025933 Ga0207706_10588985 Ga0207706_105889852 111
411 3300025940 Ga0207691_10441174 Ga0207691_104411742 111
412 3300025960 Ga0207651_10569057 Ga0207651_105690572 111
413 3300025981 Ga0207640_10205274 Ga0207640_102052743 111
414 3300025981 Ga0207640_10537075 Ga0207640_105370752 111
415 3300025986 Ga0207658_10932284 Ga0207658_109322842 111
416 3300026075 Ga0207708_10318908 Ga0207708_103189082 111
417 3300028379 Ga0268266_11489077 Ga0268266_114890772 111
418 3300028380 Ga0268265_10545331 Ga0268265_105453312 111
419 3300028381 Ga0268264_10068017 Ga0268264_100680172 111
420 3300028666 Ga0265336_10041638 Ga0265336_100416382 111
421 3300031901 Ga0307406_10022492 Ga0307406_100224924 111
422 3300032005 Ga0307411_11811809 Ga0307411_118118091 111
423 3300042120 Ga0450917_000425 Ga0450917_000425_1870_2220 111
424 3300042127 Ga0450890_063167 Ga0450890_063167_197_547 111
425 3300042142 Ga0450905_000906 Ga0450905_000906_2536_2886 111
426 3300042144 Ga0450889_000007 Ga0450889_000007_2328_2678 111
427 3300050508 nmdc:mga09592_79856_c1 nmdc:mga09592_79856_c1_2046_2396 111
428 3300053151 Ga0500604_0000065 Ga0500604_0000065_12124_12459 111
429 3300001979 JGI24740J21852_10090441 JGI24740J21852_100904411 112
430 3300005327 Ga0070658_10050581 Ga0070658_100505813 112
431 3300005327 Ga0070658_10523306 Ga0070658_105233062 112
432 3300005328 Ga0070676_10092344 Ga0070676_100923442 112
433 3300005328 Ga0070676_10327606 Ga0070676_103276063 112
434 3300005331 Ga0070670_100709258 Ga0070670_1007092582 112
435 3300005337 Ga0070682_101824789 Ga0070682_1018247891 112
436 3300005338 Ga0068868_101688206 Ga0068868_1016882062 112
437 3300005339 Ga0070660_100597382 Ga0070660_1005973822 112
438 3300005353 Ga0070669_100519625 Ga0070669_1005196252 112
439 3300005364 Ga0070673_100956909 Ga0070673_1009569092 112
440 3300005455 Ga0070663_100105849 Ga0070663_1001058492 112
441 3300005456 Ga0070678_101318721 Ga0070678_1013187212 112
442 3300005457 Ga0070662_100572995 Ga0070662_1005729953 112
443 3300005457 Ga0070662_100976490 Ga0070662_1009764902 112
444 3300005459 Ga0068867_100017848 Ga0068867_1000178482 112
445 3300005548 Ga0070665_100000024 Ga0070665_100000024349 112
446 3300005548 Ga0070665_100036936 Ga0070665_1000369366 112
447 3300005548 Ga0070665_102250179 Ga0070665_1022501791 112
448 3300005615 Ga0070702_100384527 Ga0070702_1003845272 112
449 3300005616 Ga0068852_100171770 Ga0068852_1001717702 112
450 3300005618 Ga0068864_101941282 Ga0068864_1019412822 112
451 3300005834 Ga0068851_10126269 Ga0068851_101262691 112
452 3300005834 Ga0068851_10175795 Ga0068851_101757952 112
453 3300009148 Ga0105243_10627620 Ga0105243_106276202 112
454 3300009551 Ga0105238_10273805 Ga0105238_102738052 112
455 3300009551 Ga0105238_10428449 Ga0105238_104284492 112
456 3300017792 Ga0163161_10156948 Ga0163161_101569483 112
457 3300017792 Ga0163161_11972941 Ga0163161_119729411 112
458 3300025321 Ga0207656_10010444 Ga0207656_100104443 112
459 3300025321 Ga0207656_10095131 Ga0207656_100951312 112
460 3300025907 Ga0207645_10558278 Ga0207645_105582783 112
461 3300025909 Ga0207705_10055234 Ga0207705_100552343 112
462 3300025920 Ga0207649_10608904 Ga0207649_106089043 112
463 3300025924 Ga0207694_10814919 Ga0207694_108149192 112
464 3300025933 Ga0207706_10325025 Ga0207706_103250252 112
465 3300025934 Ga0207686_10716040 Ga0207686_107160402 112
466 3300025935 Ga0207709_10084719 Ga0207709_100847193 112
467 3300025942 Ga0207689_10136985 Ga0207689_101369852 112
468 3300026041 Ga0207639_10547654 Ga0207639_105476542 112
469 3300026089 Ga0207648_10031541 Ga0207648_100315417 112
470 3300026121 Ga0207683_11723201 Ga0207683_117232011 112
471 3300026121 Ga0207683_12143147 Ga0207683_121431471 112
472 3300026142 Ga0207698_10074821 Ga0207698_100748213 112
473 3300028379 Ga0268266_10000019 Ga0268266_1000001919 112
474 3300028379 Ga0268266_10033304 Ga0268266_100333045 112
475 3300028379 Ga0268266_10192741 Ga0268266_101927413 112
476 3300031824 Ga0307413_10387005 Ga0307413_103870052 112
477 3300031852 Ga0307410_10076575 Ga0307410_100765752 112
478 3300031995 Ga0307409_100009486 Ga0307409_1000094866 112
479 3300032005 Ga0307411_10032674 Ga0307411_100326744 112
480 3300032126 Ga0307415_100046414 Ga0307415_1000464142 112
481 3300037418 Ga0395900_0168793 Ga0395900_0168793_1380_1724 112
482 3300037466 Ga0395898_0201755 Ga0395898_0201755_948_1292 112
483 3300037471 Ga0395905_0299450 Ga0395905_0299450_80_424 112
484 3300038443 Ga0395901_0183107 Ga0395901_0183107_811_1155 112
485 3300044656 Ga0466969_0012882 Ga0466969_0012882_375_719 112
486 3300044684 Ga0466966_0030294 Ga0466966_0030294_1701_2045 112
487 3300044765 Ga0466970_0051937 Ga0466970_0051937_400_744 112
488 3300044901 Ga0466960_0037098 Ga0466960_0037098_1458_1802 112
489 3300045049 Ga0466959_0038942 Ga0466959_0038942_2876_3220 112
490 3300046525 Ga0495663_0208038 Ga0495663_0208038_316_654 112
491 3300048911 Ga0496108_1747949 Ga0496108_1747949_85_429 112
492 3300001989 JGI24739J22299_10008731 JGI24739J22299_100087311 113
493 3300001990 JGI24737J22298_10005413 JGI24737J22298_100054135 113
494 3300002070 JGI24750J21931_1020924 JGI24750J21931_10209242 113
495 3300002126 JGI24035J26624_1017087 JGI24035J26624_10170871 113
496 3300005328 Ga0070676_10003276 Ga0070676_100032762 113
497 3300005330 Ga0070690_101384844 Ga0070690_1013848442 113
498 3300005331 Ga0070670_100004152 Ga0070670_1000041523 113
499 3300005334 Ga0068869_100000074 Ga0068869_10000007430 113
500 3300005335 Ga0070666_10024772 Ga0070666_100247724 113
501 3300005336 Ga0070680_100186834 Ga0070680_1001868342 113
502 3300005338 Ga0068868_100000398 Ga0068868_10000039824 113
503 3300005339 Ga0070660_100003127 Ga0070660_1000031278 113
504 3300005344 Ga0070661_100089555 Ga0070661_1000895552 113
505 3300005347 Ga0070668_100001938 Ga0070668_10000193810 113
506 3300005353 Ga0070669_100000197 Ga0070669_10000019739 113
507 3300005354 Ga0070675_100109100 Ga0070675_1001091002 113
508 3300005355 Ga0070671_100009654 Ga0070671_1000096548 113
509 3300005356 Ga0070674_100066462 Ga0070674_1000664622 113
510 3300005364 Ga0070673_100001014 Ga0070673_10000101412 113
511 3300005365 Ga0070688_100717628 Ga0070688_1007176282 113
512 3300005366 Ga0070659_100000791 Ga0070659_1000007915 113
513 3300005367 Ga0070667_100000876 Ga0070667_10000087620 113
514 3300005438 Ga0070701_10445937 Ga0070701_104459373 113
515 3300005455 Ga0070663_100210412 Ga0070663_1002104122 113
516 3300005457 Ga0070662_100000334 Ga0070662_10000033413 113
517 3300005459 Ga0068867_100000836 Ga0068867_1000008363 113
518 3300005539 Ga0068853_100001079 Ga0068853_1000010798 113
519 3300005543 Ga0070672_100000227 Ga0070672_10000022712 113
520 3300005544 Ga0070686_100185118 Ga0070686_1001851183 113
521 3300005547 Ga0070693_100704636 Ga0070693_1007046361 113
522 3300005547 Ga0070693_101047905 Ga0070693_1010479052 113
523 3300005563 Ga0068855_100001413 Ga0068855_10000141318 113
524 3300005563 Ga0068855_101465847 Ga0068855_1014658471 113
525 3300005564 Ga0070664_100013789 Ga0070664_1000137894 113
526 3300005564 Ga0070664_100247239 Ga0070664_1002472392 113
527 3300005577 Ga0068857_100109876 Ga0068857_1001098762 113
528 3300005577 Ga0068857_100121854 Ga0068857_1001218543 113
529 3300005578 Ga0068854_100000549 Ga0068854_10000054923 113
530 3300005616 Ga0068852_100000835 Ga0068852_1000008353 113
531 3300005617 Ga0068859_100001673 Ga0068859_10000167313 113
532 3300005618 Ga0068864_100000393 Ga0068864_10000039323 113
533 3300005719 Ga0068861_100324309 Ga0068861_1003243092 113
534 3300005834 Ga0068851_10277389 Ga0068851_102773892 113
535 3300005840 Ga0068870_10052512 Ga0068870_100525122 113
536 3300005841 Ga0068863_100002359 Ga0068863_10000235914 113
537 3300005842 Ga0068858_100004688 Ga0068858_10000468813 113
538 3300005843 Ga0068860_100006230 Ga0068860_10000623012 113
539 3300005844 Ga0068862_100286044 Ga0068862_1002860442 113
540 3300006237 Ga0097621_100378668 Ga0097621_1003786683 113
541 3300006353 Ga0075370_10454718 Ga0075370_104547182 113
542 3300006881 Ga0068865_100029527 Ga0068865_1000295273 113
543 3300006931 Ga0097620_100001673 Ga0097620_10000167313 113
544 3300009098 Ga0105245_10000068 Ga0105245_1000006891 113
545 3300009174 Ga0105241_10458408 Ga0105241_104584082 113
546 3300009177 Ga0105248_10001005 Ga0105248_1000100525 113
547 3300009551 Ga0105238_10180931 Ga0105238_101809313 113
548 3300010375 Ga0105239_10043211 Ga0105239_100432115 113
549 3300011119 Ga0105246_10019547 Ga0105246_100195472 113
550 3300013100 Ga0157373_10014420 Ga0157373_100144204 113
551 3300013100 Ga0157373_10359114 Ga0157373_103591142 113
552 3300013102 Ga0157371_10003274 Ga0157371_1000327413 113
553 3300013102 Ga0157371_10542504 Ga0157371_105425042 113
554 3300013297 Ga0157378_10003316 Ga0157378_1000331612 113
555 3300013308 Ga0157375_10068518 Ga0157375_100685183 113
556 3300014325 Ga0163163_10883349 Ga0163163_108833493 113
557 3300025315 Ga0207697_10000007 Ga0207697_1000000743 113
558 3300025321 Ga0207656_10071025 Ga0207656_100710253 113
559 3300025901 Ga0207688_10000333 Ga0207688_1000033325 113
560 3300025903 Ga0207680_10022712 Ga0207680_100227122 113
561 3300025904 Ga0207647_10001004 Ga0207647_1000100426 113
562 3300025907 Ga0207645_10001287 Ga0207645_100012877 113
563 3300025911 Ga0207654_10557693 Ga0207654_105576932 113
564 3300025919 Ga0207657_10011090 Ga0207657_100110908 113
565 3300025919 Ga0207657_10052196 Ga0207657_100521964 113
566 3300025919 Ga0207657_10331912 Ga0207657_103319122 113
567 3300025923 Ga0207681_10000695 Ga0207681_1000069512 113
568 3300025924 Ga0207694_10279039 Ga0207694_102790392 113
569 3300025925 Ga0207650_10142769 Ga0207650_101427693 113
570 3300025926 Ga0207659_10031782 Ga0207659_100317823 113
571 3300025927 Ga0207687_10000584 Ga0207687_1000058430 113
572 3300025931 Ga0207644_10034223 Ga0207644_100342234 113
573 3300025932 Ga0207690_10001169 Ga0207690_100011693 113
574 3300025932 Ga0207690_10084823 Ga0207690_100848234 113
575 3300025933 Ga0207706_10000766 Ga0207706_100007662 113
576 3300025935 Ga0207709_10013384 Ga0207709_100133845 113
577 3300025937 Ga0207669_10088504 Ga0207669_100885042 113
578 3300025938 Ga0207704_10474285 Ga0207704_104742852 113
579 3300025940 Ga0207691_10000493 Ga0207691_100004932 113
580 3300025941 Ga0207711_10000591 Ga0207711_1000059122 113
581 3300025942 Ga0207689_10000131 Ga0207689_100001312 113
582 3300025945 Ga0207679_10089695 Ga0207679_100896953 113
583 3300025945 Ga0207679_10209298 Ga0207679_102092983 113
584 3300025949 Ga0207667_10001522 Ga0207667_1000152219 113
585 3300025960 Ga0207651_10001650 Ga0207651_1000165011 113
586 3300025972 Ga0207668_10018349 Ga0207668_100183494 113
587 3300025981 Ga0207640_10001011 Ga0207640_1000101116 113
588 3300025986 Ga0207658_10089033 Ga0207658_100890333 113
589 3300026023 Ga0207677_10000872 Ga0207677_100008727 113
590 3300026035 Ga0207703_10006948 Ga0207703_100069484 113
591 3300026041 Ga0207639_10002206 Ga0207639_100022064 113
592 3300026041 Ga0207639_10095574 Ga0207639_100955742 113
593 3300026067 Ga0207678_10690401 Ga0207678_106904012 113
594 3300026088 Ga0207641_10003184 Ga0207641_1000318414 113
595 3300026089 Ga0207648_10000752 Ga0207648_1000075225 113
596 3300026095 Ga0207676_10000257 Ga0207676_1000025743 113
597 3300026116 Ga0207674_10127190 Ga0207674_101271902 113
598 3300026118 Ga0207675_100448631 Ga0207675_1004486311 113
599 3300026121 Ga0207683_10527541 Ga0207683_105275412 113
600 3300026142 Ga0207698_10059474 Ga0207698_100594743 113
601 3300026142 Ga0207698_10284000 Ga0207698_102840002 113
602 3300028379 Ga0268266_10374192 Ga0268266_103741922 113
603 3300028381 Ga0268264_10001215 Ga0268264_1000121528 113
604 3300031731 Ga0307405_10276337 Ga0307405_102763372 113
605 3300031901 Ga0307406_10148764 Ga0307406_101487642 113
606 3300031901 Ga0307406_10156176 Ga0307406_101561762 113
607 3300031911 Ga0307412_11812283 Ga0307412_118122831 113
608 3300032002 Ga0307416_100012537 Ga0307416_1000125375 113
609 3300032126 Ga0307415_100024406 Ga0307415_1000244063 113
610 3300032126 Ga0307415_102245018 Ga0307415_1022450182 113
611 3300037418 Ga0395900_0237965 Ga0395900_0237965_14_382 113
612 3300037466 Ga0395898_0724009 Ga0395898_0724009_14_382 113
613 3300037471 Ga0395905_0041515 Ga0395905_0041515_1234_1602 113
614 3300037471 Ga0395905_0426211 Ga0395905_0426211_703_1050 113
615 3300038443 Ga0395901_0907336 Ga0395901_0907336_481_849 113
616 3300044658 Ga0466972_0142274 Ga0466972_0142274_630_974 113
617 3300044765 Ga0466970_0212072 Ga0466970_0212072_371_715 113
618 3300044901 Ga0466960_0548339 Ga0466960_0548339_206_550 113
619 3300045049 Ga0466959_1211223 Ga0466959_1211223_106_450 113
620 3300045976 Ga0466967_0297022 Ga0466967_0297022_941_1288 113
621 3300050496 nmdc:mga07m45_361108_c1 nmdc:mga07m45_361108_c1_276_617 113
622 3300001915 JGI24741J21665_1017066 JGI24741J21665_10170662 114
623 3300001978 JGI24747J21853_1049263 JGI24747J21853_10492631 114
624 3300001979 JGI24740J21852_10123558 JGI24740J21852_101235581 114
625 3300002067 JGI24735J21928_10137195 JGI24735J21928_101371952 114
626 3300005295 Ga0065707_10236857 Ga0065707_102368573 114
627 3300005327 Ga0070658_10015564 Ga0070658_1001556410 114
628 3300005327 Ga0070658_10135214 Ga0070658_101352142 114
629 3300005327 Ga0070658_10203110 Ga0070658_102031102 114
630 3300005327 Ga0070658_10810413 Ga0070658_108104132 114
631 3300005327 Ga0070658_11600143 Ga0070658_116001431 114
632 3300005328 Ga0070676_10001271 Ga0070676_100012717 114
633 3300005328 Ga0070676_10208961 Ga0070676_102089612 114
634 3300005328 Ga0070676_10614157 Ga0070676_106141572 114
635 3300005329 Ga0070683_101189385 Ga0070683_1011893852 114
636 3300005330 Ga0070690_100000870 Ga0070690_1000008705 114
637 3300005330 Ga0070690_100533438 Ga0070690_1005334383 114
638 3300005331 Ga0070670_100022285 Ga0070670_1000222853 114
639 3300005331 Ga0070670_100273741 Ga0070670_1002737412 114
640 3300005333 Ga0070677_10024658 Ga0070677_100246582 114
641 3300005334 Ga0068869_100250814 Ga0068869_1002508143 114
642 3300005334 Ga0068869_100404430 Ga0068869_1004044303 114
643 3300005334 Ga0068869_100807768 Ga0068869_1008077682 114
644 3300005335 Ga0070666_10000421 Ga0070666_1000042123 114
645 3300005335 Ga0070666_10006159 Ga0070666_100061592 114
646 3300005335 Ga0070666_10526311 Ga0070666_105263112 114
647 3300005336 Ga0070680_100198309 Ga0070680_1001983092 114
648 3300005336 Ga0070680_100616626 Ga0070680_1006166263 114
649 3300005337 Ga0070682_101375269 Ga0070682_1013752691 114
650 3300005338 Ga0068868_100000688 Ga0068868_1000006884 114
651 3300005338 Ga0068868_100045136 Ga0068868_1000451364 114
652 3300005338 Ga0068868_100067926 Ga0068868_1000679263 114
653 3300005338 Ga0068868_100240294 Ga0068868_1002402943 114
654 3300005339 Ga0070660_100013461 Ga0070660_1000134615 114
655 3300005339 Ga0070660_100025778 Ga0070660_1000257785 114
656 3300005339 Ga0070660_100061354 Ga0070660_1000613542 114
657 3300005341 Ga0070691_10001768 Ga0070691_100017689 114
658 3300005343 Ga0070687_100067216 Ga0070687_1000672163 114
659 3300005343 Ga0070687_100545354 Ga0070687_1005453542 114
660 3300005344 Ga0070661_100057173 Ga0070661_1000571733 114
661 3300005344 Ga0070661_100077189 Ga0070661_1000771892 114
662 3300005344 Ga0070661_100103285 Ga0070661_1001032852 114
663 3300005344 Ga0070661_100230355 Ga0070661_1002303552 114
664 3300005344 Ga0070661_100257754 Ga0070661_1002577542 114
665 3300005344 Ga0070661_100431688 Ga0070661_1004316882 114
666 3300005344 Ga0070661_100464510 Ga0070661_1004645102 114
667 3300005345 Ga0070692_10067350 Ga0070692_100673502 114
668 3300005345 Ga0070692_11144056 Ga0070692_111440561 114
669 3300005347 Ga0070668_100007633 Ga0070668_1000076335 114
670 3300005347 Ga0070668_100092409 Ga0070668_1000924092 114
671 3300005353 Ga0070669_100014352 Ga0070669_1000143525 114
672 3300005353 Ga0070669_100017462 Ga0070669_1000174624 114
673 3300005353 Ga0070669_100023618 Ga0070669_1000236183 114
674 3300005353 Ga0070669_100957488 Ga0070669_1009574881 114
675 3300005354 Ga0070675_100129324 Ga0070675_1001293243 114
676 3300005354 Ga0070675_100298639 Ga0070675_1002986392 114
677 3300005354 Ga0070675_100684187 Ga0070675_1006841872 114
678 3300005354 Ga0070675_101069189 Ga0070675_1010691892 114
679 3300005355 Ga0070671_100006644 Ga0070671_1000066443 114
680 3300005355 Ga0070671_100023695 Ga0070671_1000236956 114
681 3300005355 Ga0070671_100033979 Ga0070671_1000339792 114
682 3300005355 Ga0070671_100115008 Ga0070671_1001150083 114
683 3300005355 Ga0070671_100981509 Ga0070671_1009815092 114
684 3300005356 Ga0070674_100007352 Ga0070674_1000073527 114
685 3300005356 Ga0070674_100014055 Ga0070674_1000140552 114
686 3300005356 Ga0070674_100016981 Ga0070674_1000169814 114
687 3300005356 Ga0070674_100058974 Ga0070674_1000589742 114
688 3300005356 Ga0070674_100214329 Ga0070674_1002143292 114
689 3300005364 Ga0070673_100007010 Ga0070673_1000070102 114
690 3300005364 Ga0070673_100112325 Ga0070673_1001123252 114
691 3300005364 Ga0070673_100125580 Ga0070673_1001255804 114
692 3300005364 Ga0070673_100186819 Ga0070673_1001868194 114
693 3300005364 Ga0070673_100247483 Ga0070673_1002474833 114
694 3300005364 Ga0070673_100443617 Ga0070673_1004436172 114
695 3300005364 Ga0070673_100660478 Ga0070673_1006604782 114
696 3300005365 Ga0070688_100215133 Ga0070688_1002151332 114
697 3300005365 Ga0070688_100388320 Ga0070688_1003883203 114
698 3300005366 Ga0070659_100124315 Ga0070659_1001243152 114
699 3300005366 Ga0070659_100208157 Ga0070659_1002081572 114
700 3300005366 Ga0070659_100216036 Ga0070659_1002160363 114
701 3300005366 Ga0070659_100389156 Ga0070659_1003891562 114
702 3300005366 Ga0070659_100493150 Ga0070659_1004931502 114
703 3300005367 Ga0070667_100006803 Ga0070667_1000068033 114
704 3300005367 Ga0070667_100011319 Ga0070667_1000113192 114
705 3300005367 Ga0070667_100154521 Ga0070667_1001545212 114
706 3300005367 Ga0070667_100285355 Ga0070667_1002853552 114
707 3300005367 Ga0070667_100842069 Ga0070667_1008420692 114
708 3300005367 Ga0070667_101121381 Ga0070667_1011213812 114
709 3300005435 Ga0070714_100022621 Ga0070714_1000226213 114
710 3300005435 Ga0070714_100211617 Ga0070714_1002116172 114
711 3300005455 Ga0070663_100016402 Ga0070663_1000164022 114
712 3300005455 Ga0070663_100049418 Ga0070663_1000494184 114
713 3300005455 Ga0070663_100319809 Ga0070663_1003198092 114
714 3300005455 Ga0070663_100350193 Ga0070663_1003501932 114
715 3300005455 Ga0070663_100487541 Ga0070663_1004875412 114
716 3300005455 Ga0070663_102015669 Ga0070663_1020156691 114
717 3300005456 Ga0070678_100001009 Ga0070678_1000010095 114
718 3300005456 Ga0070678_100583077 Ga0070678_1005830772 114
719 3300005457 Ga0070662_100059189 Ga0070662_1000591893 114
720 3300005457 Ga0070662_100138399 Ga0070662_1001383992 114
721 3300005457 Ga0070662_100251709 Ga0070662_1002517092 114
722 3300005457 Ga0070662_100253534 Ga0070662_1002535342 114
723 3300005457 Ga0070662_100372112 Ga0070662_1003721122 114
724 3300005458 Ga0070681_10307135 Ga0070681_103071352 114
725 3300005458 Ga0070681_11532008 Ga0070681_115320081 114
726 3300005459 Ga0068867_100006028 Ga0068867_1000060288 114
727 3300005459 Ga0068867_100014225 Ga0068867_1000142253 114
728 3300005459 Ga0068867_100239537 Ga0068867_1002395373 114
729 3300005459 Ga0068867_100604837 Ga0068867_1006048373 114
730 3300005466 Ga0070685_11209175 Ga0070685_112091752 114
731 3300005530 Ga0070679_100246224 Ga0070679_1002462242 114
732 3300005530 Ga0070679_100708473 Ga0070679_1007084732 114
733 3300005530 Ga0070679_101148902 Ga0070679_1011489021 114
734 3300005535 Ga0070684_100008372 Ga0070684_1000083728 114
735 3300005539 Ga0068853_100717222 Ga0068853_1007172222 114
736 3300005539 Ga0068853_100913466 Ga0068853_1009134662 114
737 3300005539 Ga0068853_101051461 Ga0068853_1010514612 114
738 3300005539 Ga0068853_101294249 Ga0068853_1012942492 114
739 3300005543 Ga0070672_100021430 Ga0070672_1000214302 114
740 3300005543 Ga0070672_100043910 Ga0070672_1000439102 114
741 3300005543 Ga0070672_100069784 Ga0070672_1000697843 114
742 3300005544 Ga0070686_100008537 Ga0070686_1000085372 114
743 3300005547 Ga0070693_100137226 Ga0070693_1001372261 114
744 3300005547 Ga0070693_100278856 Ga0070693_1002788562 114
745 3300005547 Ga0070693_100549387 Ga0070693_1005493871 114
746 3300005548 Ga0070665_100315832 Ga0070665_1003158322 114
747 3300005563 Ga0068855_100057746 Ga0068855_1000577462 114
748 3300005563 Ga0068855_100232314 Ga0068855_1002323142 114
749 3300005564 Ga0070664_100008693 Ga0070664_1000086936 114
750 3300005564 Ga0070664_100067425 Ga0070664_1000674253 114
751 3300005564 Ga0070664_100072567 Ga0070664_1000725672 114
752 3300005564 Ga0070664_100183381 Ga0070664_1001833812 114
753 3300005564 Ga0070664_100375238 Ga0070664_1003752382 114
754 3300005564 Ga0070664_100406500 Ga0070664_1004065002 114
755 3300005564 Ga0070664_100964443 Ga0070664_1009644432 114
756 3300005564 Ga0070664_101165735 Ga0070664_1011657352 114
757 3300005577 Ga0068857_100032752 Ga0068857_1000327522 114
758 3300005577 Ga0068857_100895845 Ga0068857_1008958453 114
759 3300005578 Ga0068854_100073079 Ga0068854_1000730793 114
760 3300005578 Ga0068854_100164043 Ga0068854_1001640432 114
761 3300005578 Ga0068854_100226910 Ga0068854_1002269103 114
762 3300005578 Ga0068854_100292253 Ga0068854_1002922532 114
763 3300005578 Ga0068854_100751402 Ga0068854_1007514022 114
764 3300005578 Ga0068854_101091669 Ga0068854_1010916692 114
765 3300005578 Ga0068854_101197082 Ga0068854_1011970822 114
766 3300005614 Ga0068856_100062371 Ga0068856_1000623712 114
767 3300005614 Ga0068856_100631678 Ga0068856_1006316782 114
768 3300005614 Ga0068856_100792348 Ga0068856_1007923482 114
769 3300005616 Ga0068852_100037157 Ga0068852_1000371572 114
770 3300005616 Ga0068852_100040637 Ga0068852_1000406373 114
771 3300005616 Ga0068852_100095821 Ga0068852_1000958212 114
772 3300005616 Ga0068852_100475739 Ga0068852_1004757392 114
773 3300005616 Ga0068852_100485984 Ga0068852_1004859842 114
774 3300005616 Ga0068852_100549196 Ga0068852_1005491963 114
775 3300005616 Ga0068852_100871837 Ga0068852_1008718372 114
776 3300005616 Ga0068852_101093178 Ga0068852_1010931782 114
777 3300005616 Ga0068852_102849484 Ga0068852_1028494842 114
778 3300005617 Ga0068859_100033508 Ga0068859_1000335082 114
779 3300005617 Ga0068859_100070604 Ga0068859_1000706043 114
780 3300005617 Ga0068859_100346360 Ga0068859_1003463603 114
781 3300005617 Ga0068859_100488236 Ga0068859_1004882361 114
782 3300005617 Ga0068859_100565026 Ga0068859_1005650262 114
783 3300005618 Ga0068864_100012617 Ga0068864_1000126174 114
784 3300005618 Ga0068864_100022478 Ga0068864_1000224785 114
785 3300005618 Ga0068864_101211981 Ga0068864_1012119812 114
786 3300005718 Ga0068866_10168224 Ga0068866_101682242 114
787 3300005718 Ga0068866_10339736 Ga0068866_103397361 114
788 3300005718 Ga0068866_10813467 Ga0068866_108134672 114
789 3300005834 Ga0068851_10010021 Ga0068851_100100214 114
790 3300005834 Ga0068851_10151082 Ga0068851_101510822 114
791 3300005834 Ga0068851_10177055 Ga0068851_101770552 114
792 3300005840 Ga0068870_10593555 Ga0068870_105935552 114
793 3300005841 Ga0068863_100007847 Ga0068863_1000078479 114
794 3300005841 Ga0068863_100193346 Ga0068863_1001933463 114
795 3300005841 Ga0068863_101191039 Ga0068863_1011910392 114
796 3300005842 Ga0068858_100169471 Ga0068858_1001694712 114
797 3300005842 Ga0068858_100869630 Ga0068858_1008696301 114
798 3300005843 Ga0068860_100022090 Ga0068860_1000220905 114
799 3300005843 Ga0068860_100062699 Ga0068860_1000626994 114
800 3300005844 Ga0068862_100007505 Ga0068862_1000075058 114
801 3300006175 Ga0070712_100009693 Ga0070712_1000096932 114
802 3300006237 Ga0097621_100208139 Ga0097621_1002081393 114
803 3300006237 Ga0097621_100771013 Ga0097621_1007710132 114
804 3300006358 Ga0068871_100006808 Ga0068871_1000068088 114
805 3300006358 Ga0068871_100052764 Ga0068871_1000527643 114
806 3300006358 Ga0068871_100214847 Ga0068871_1002148472 114
807 3300006358 Ga0068871_102119559 Ga0068871_1021195591 114
808 3300006847 Ga0075431_100200375 Ga0075431_1002003752 114
809 3300006852 Ga0075433_10086504 Ga0075433_100865042 114
810 3300006871 Ga0075434_100609706 Ga0075434_1006097062 114
811 3300006881 Ga0068865_100026937 Ga0068865_1000269372 114
812 3300006881 Ga0068865_100133171 Ga0068865_1001331712 114
813 3300006931 Ga0097620_100033508 Ga0097620_1000335085 114
814 3300006931 Ga0097620_100070609 Ga0097620_1000706093 114
815 3300006931 Ga0097620_100346368 Ga0097620_1003463682 114
816 3300006931 Ga0097620_100488225 Ga0097620_1004882251 114
817 3300006931 Ga0097620_100565067 Ga0097620_1005650672 114
818 3300007076 Ga0075435_100435736 Ga0075435_1004357363 114
819 3300009093 Ga0105240_10050145 Ga0105240_100501452 114
820 3300009093 Ga0105240_11976813 Ga0105240_119768132 114
821 3300009098 Ga0105245_10013523 Ga0105245_100135232 114
822 3300009098 Ga0105245_10387028 Ga0105245_103870282 114
823 3300009148 Ga0105243_10328828 Ga0105243_103288282 114
824 3300009148 Ga0105243_11693071 Ga0105243_116930712 114
825 3300009176 Ga0105242_10009233 Ga0105242_100092334 114
826 3300009177 Ga0105248_10000575 Ga0105248_1000057531 114
827 3300009177 Ga0105248_10061315 Ga0105248_100613155 114
828 3300009177 Ga0105248_10084281 Ga0105248_100842815 114
829 3300009177 Ga0105248_10265775 Ga0105248_102657752 114
830 3300009177 Ga0105248_10879880 Ga0105248_108798802 114
831 3300009177 Ga0105248_11728560 Ga0105248_117285602 114
832 3300009545 Ga0105237_11037408 Ga0105237_110374081 114
833 3300009551 Ga0105238_10332808 Ga0105238_103328082 114
834 3300009551 Ga0105238_10443629 Ga0105238_104436292 114
835 3300009551 Ga0105238_11248345 Ga0105238_112483452 114
836 3300009553 Ga0105249_10233260 Ga0105249_102332602 114
837 3300009553 Ga0105249_10386550 Ga0105249_103865501 114
838 3300009553 Ga0105249_11224829 Ga0105249_112248292 114
839 3300010375 Ga0105239_10153245 Ga0105239_101532453 114
840 3300010375 Ga0105239_12525306 Ga0105239_125253062 114
841 3300011119 Ga0105246_10041891 Ga0105246_100418913 114
842 3300013100 Ga0157373_10053721 Ga0157373_100537214 114
843 3300013102 Ga0157371_10272829 Ga0157371_102728291 114
844 3300013102 Ga0157371_10386470 Ga0157371_103864702 114
845 3300013102 Ga0157371_10650388 Ga0157371_106503882 114
846 3300013104 Ga0157370_10023128 Ga0157370_100231282 114
847 3300013104 Ga0157370_10269721 Ga0157370_102697212 114
848 3300013104 Ga0157370_10524914 Ga0157370_105249143 114
849 3300013104 Ga0157370_11095465 Ga0157370_110954652 114
850 3300013104 Ga0157370_11360750 Ga0157370_113607502 114
851 3300013105 Ga0157369_10064173 Ga0157369_100641732 114
852 3300013105 Ga0157369_10340318 Ga0157369_103403182 114
853 3300013105 Ga0157369_10794069 Ga0157369_107940692 114
854 3300013105 Ga0157369_11786757 Ga0157369_117867572 114
855 3300013296 Ga0157374_10012521 Ga0157374_100125212 114
856 3300013296 Ga0157374_11909050 Ga0157374_119090502 114
857 3300013297 Ga0157378_10553702 Ga0157378_105537022 114
858 3300013297 Ga0157378_10890288 Ga0157378_108902883 114
859 3300013297 Ga0157378_12325666 Ga0157378_123256662 114
860 3300013306 Ga0163162_10044059 Ga0163162_100440595 114
861 3300013306 Ga0163162_10338634 Ga0163162_103386343 114
862 3300013306 Ga0163162_10690187 Ga0163162_106901872 114
863 3300013306 Ga0163162_12049168 Ga0163162_120491682 114
864 3300013307 Ga0157372_10392264 Ga0157372_103922642 114
865 3300013307 Ga0157372_10593603 Ga0157372_105936032 114
866 3300013307 Ga0157372_11083615 Ga0157372_110836151 114
867 3300013308 Ga0157375_10013004 Ga0157375_100130042 114
868 3300013308 Ga0157375_10302745 Ga0157375_103027452 114
869 3300013308 Ga0157375_10944565 Ga0157375_109445652 114
870 3300014325 Ga0163163_10214793 Ga0163163_102147934 114
871 3300014497 Ga0182008_10197854 Ga0182008_101978542 114
872 3300014745 Ga0157377_10072902 Ga0157377_100729022 114
873 3300014968 Ga0157379_10008481 Ga0157379_100084814 114
874 3300014968 Ga0157379_10260604 Ga0157379_102606043 114
875 3300014969 Ga0157376_10018617 Ga0157376_100186174 114
876 3300020076 Ga0206355_1257199 Ga0206355_12571994 114
877 3300020082 Ga0206353_10235959 Ga0206353_102359592 114
878 3300021384 Ga0213876_10028035 Ga0213876_100280353 114
879 3300025315 Ga0207697_10243263 Ga0207697_102432632 114
880 3300025901 Ga0207688_10022732 Ga0207688_100227324 114
881 3300025901 Ga0207688_10560157 Ga0207688_105601572 114
882 3300025903 Ga0207680_10222594 Ga0207680_102225942 114
883 3300025904 Ga0207647_10007553 Ga0207647_100075538 114
884 3300025904 Ga0207647_10029204 Ga0207647_100292044 114
885 3300025906 Ga0207699_10841608 Ga0207699_108416082 114
886 3300025907 Ga0207645_10002663 Ga0207645_1000266310 114
887 3300025907 Ga0207645_10203269 Ga0207645_102032692 114
888 3300025907 Ga0207645_10831998 Ga0207645_108319982 114
889 3300025909 Ga0207705_10000275 Ga0207705_1000027541 114
890 3300025909 Ga0207705_10003381 Ga0207705_100033818 114
891 3300025909 Ga0207705_10018542 Ga0207705_100185423 114
892 3300025909 Ga0207705_10043626 Ga0207705_100436265 114
893 3300025909 Ga0207705_10048640 Ga0207705_100486403 114
894 3300025909 Ga0207705_10961207 Ga0207705_109612071 114
895 3300025912 Ga0207707_10162245 Ga0207707_101622451 114
896 3300025913 Ga0207695_10048872 Ga0207695_100488722 114
897 3300025913 Ga0207695_10199904 Ga0207695_101999043 114
898 3300025914 Ga0207671_10117986 Ga0207671_101179862 114
899 3300025916 Ga0207663_11488114 Ga0207663_114881141 114
900 3300025917 Ga0207660_10065595 Ga0207660_100655952 114
901 3300025917 Ga0207660_10204020 Ga0207660_102040202 114
902 3300025918 Ga0207662_10057527 Ga0207662_100575272 114
903 3300025919 Ga0207657_10008917 Ga0207657_100089178 114
904 3300025919 Ga0207657_10015329 Ga0207657_100153292 114
905 3300025919 Ga0207657_10025873 Ga0207657_100258735 114
906 3300025919 Ga0207657_10389172 Ga0207657_103891722 114
907 3300025920 Ga0207649_10007963 Ga0207649_100079633 114
908 3300025920 Ga0207649_10053942 Ga0207649_100539423 114
909 3300025920 Ga0207649_10072847 Ga0207649_100728472 114
910 3300025920 Ga0207649_10088507 Ga0207649_100885072 114
911 3300025920 Ga0207649_10163539 Ga0207649_101635392 114
912 3300025921 Ga0207652_10042152 Ga0207652_100421524 114
913 3300025923 Ga0207681_10003463 Ga0207681_100034636 114
914 3300025923 Ga0207681_10014053 Ga0207681_100140533 114
915 3300025923 Ga0207681_10548517 Ga0207681_105485173 114
916 3300025923 Ga0207681_10963174 Ga0207681_109631741 114
917 3300025923 Ga0207681_11304789 Ga0207681_113047892 114
918 3300025924 Ga0207694_10122638 Ga0207694_101226382 114
919 3300025924 Ga0207694_10122818 Ga0207694_101228182 114
920 3300025925 Ga0207650_10130877 Ga0207650_101308772 114
921 3300025925 Ga0207650_10226027 Ga0207650_102260272 114
922 3300025925 Ga0207650_10613071 Ga0207650_106130712 114
923 3300025926 Ga0207659_10104599 Ga0207659_101045992 114
924 3300025926 Ga0207659_10147643 Ga0207659_101476432 114
925 3300025927 Ga0207687_10101549 Ga0207687_101015492 114
926 3300025929 Ga0207664_10023960 Ga0207664_100239604 114
927 3300025929 Ga0207664_10079985 Ga0207664_100799852 114
928 3300025931 Ga0207644_10002049 Ga0207644_100020495 114
929 3300025931 Ga0207644_10003050 Ga0207644_100030509 114
930 3300025932 Ga0207690_10041141 Ga0207690_100411412 114
931 3300025932 Ga0207690_10383730 Ga0207690_103837302 114
932 3300025932 Ga0207690_10405079 Ga0207690_104050792 114
933 3300025932 Ga0207690_10875431 Ga0207690_108754311 114
934 3300025932 Ga0207690_10932031 Ga0207690_109320312 114
935 3300025933 Ga0207706_10029575 Ga0207706_100295755 114
936 3300025933 Ga0207706_10140742 Ga0207706_101407422 114
937 3300025933 Ga0207706_10154817 Ga0207706_101548172 114
938 3300025933 Ga0207706_10272008 Ga0207706_102720082 114
939 3300025933 Ga0207706_10690079 Ga0207706_106900792 114
940 3300025933 Ga0207706_10936345 Ga0207706_109363451 114
941 3300025934 Ga0207686_10126169 Ga0207686_101261692 114
942 3300025937 Ga0207669_10028721 Ga0207669_100287212 114
943 3300025937 Ga0207669_10244440 Ga0207669_102444402 114
944 3300025938 Ga0207704_10016566 Ga0207704_100165663 114
945 3300025938 Ga0207704_10048680 Ga0207704_100486802 114
946 3300025940 Ga0207691_10009043 Ga0207691_100090432 114
947 3300025940 Ga0207691_10994872 Ga0207691_109948722 114
948 3300025941 Ga0207711_10007235 Ga0207711_100072358 114
949 3300025941 Ga0207711_10026112 Ga0207711_100261126 114
950 3300025941 Ga0207711_10178933 Ga0207711_101789332 114
951 3300025941 Ga0207711_10212839 Ga0207711_102128392 114
952 3300025942 Ga0207689_10128448 Ga0207689_101284482 114
953 3300025944 Ga0207661_10602521 Ga0207661_106025212 114
954 3300025945 Ga0207679_10001267 Ga0207679_100012673 114
955 3300025945 Ga0207679_10040798 Ga0207679_100407984 114
956 3300025945 Ga0207679_10112771 Ga0207679_101127712 114
957 3300025945 Ga0207679_10343138 Ga0207679_103431382 114
958 3300025945 Ga0207679_10695546 Ga0207679_106955461 114
959 3300025945 Ga0207679_11391043 Ga0207679_113910432 114
960 3300025949 Ga0207667_10521167 Ga0207667_105211672 114
961 3300025949 Ga0207667_10600227 Ga0207667_106002272 114
962 3300025949 Ga0207667_11158791 Ga0207667_111587912 114
963 3300025949 Ga0207667_11710974 Ga0207667_117109742 114
964 3300025960 Ga0207651_10000221 Ga0207651_1000022119 114
965 3300025960 Ga0207651_10144012 Ga0207651_101440122 114
966 3300025960 Ga0207651_10149359 Ga0207651_101493592 114
967 3300025960 Ga0207651_12009019 Ga0207651_120090192 114
968 3300025961 Ga0207712_10321624 Ga0207712_103216242 114
969 3300025972 Ga0207668_10000107 Ga0207668_1000010758 114
970 3300025981 Ga0207640_10382128 Ga0207640_103821283 114
971 3300025981 Ga0207640_10468433 Ga0207640_104684333 114
972 3300025981 Ga0207640_10799066 Ga0207640_107990661 114
973 3300025981 Ga0207640_11283523 Ga0207640_112835232 114
974 3300025986 Ga0207658_10012445 Ga0207658_100124455 114
975 3300025986 Ga0207658_10073001 Ga0207658_100730013 114
976 3300025986 Ga0207658_10826975 Ga0207658_108269752 114
977 3300026023 Ga0207677_10013467 Ga0207677_100134675 114
978 3300026023 Ga0207677_10016751 Ga0207677_100167515 114
979 3300026023 Ga0207677_10531662 Ga0207677_105316621 114
980 3300026035 Ga0207703_10004808 Ga0207703_100048088 114
981 3300026035 Ga0207703_10017252 Ga0207703_100172522 114
982 3300026041 Ga0207639_10069488 Ga0207639_100694882 114
983 3300026041 Ga0207639_10461028 Ga0207639_104610283 114
984 3300026041 Ga0207639_10476888 Ga0207639_104768883 114
985 3300026067 Ga0207678_10030342 Ga0207678_100303423 114
986 3300026067 Ga0207678_10040911 Ga0207678_100409114 114
987 3300026067 Ga0207678_10256755 Ga0207678_102567552 114
988 3300026067 Ga0207678_10352971 Ga0207678_103529711 114
989 3300026067 Ga0207678_10717185 Ga0207678_107171852 114
990 3300026067 Ga0207678_10751699 Ga0207678_107516992 114
991 3300026078 Ga0207702_10005393 Ga0207702_1000539312 114
992 3300026078 Ga0207702_10031577 Ga0207702_100315772 114
993 3300026078 Ga0207702_10062604 Ga0207702_100626041 114
994 3300026078 Ga0207702_10104916 Ga0207702_101049162 114
995 3300026088 Ga0207641_10009658 Ga0207641_100096585 114
996 3300026089 Ga0207648_10007924 Ga0207648_1000792410 114
997 3300026089 Ga0207648_10009606 Ga0207648_100096062 114
998 3300026095 Ga0207676_10073720 Ga0207676_100737202 114
999 3300026095 Ga0207676_10369765 Ga0207676_103697653 114
1000 3300026095 Ga0207676_12072199 Ga0207676_120721992 114
1001 3300026116 Ga0207674_10096231 Ga0207674_100962313 114
1002 3300026116 Ga0207674_10111486 Ga0207674_101114863 114
1003 3300026121 Ga0207683_10001252 Ga0207683_1000125213 114
1004 3300026121 Ga0207683_10036543 Ga0207683_100365435 114
1005 3300026142 Ga0207698_10004354 Ga0207698_100043548 114
1006 3300026142 Ga0207698_10018020 Ga0207698_100180205 114
1007 3300026142 Ga0207698_10205648 Ga0207698_102056484 114
1008 3300026142 Ga0207698_10312790 Ga0207698_103127902 114
1009 3300026142 Ga0207698_11017274 Ga0207698_110172742 114
1010 3300026142 Ga0207698_11114387 Ga0207698_111143873 114
1011 3300028379 Ga0268266_10014442 Ga0268266_100144423 114
1012 3300028380 Ga0268265_10008343 Ga0268265_100083436 114
1013 3300028380 Ga0268265_10105184 Ga0268265_101051843 114
1014 3300028380 Ga0268265_10740076 Ga0268265_107400763 114
1015 3300028381 Ga0268264_10308282 Ga0268264_103082822 114
1016 3300031731 Ga0307405_11081446 Ga0307405_110814462 114
1017 3300031824 Ga0307413_10185751 Ga0307413_101857512 114
1018 3300031824 Ga0307413_10216035 Ga0307413_102160352 114
1019 3300031852 Ga0307410_10070233 Ga0307410_100702332 114
1020 3300031903 Ga0307407_10056343 Ga0307407_100563434 114
1021 3300031911 Ga0307412_10157915 Ga0307412_101579154 114
1022 3300031995 Ga0307409_100112136 Ga0307409_1001121363 114
1023 3300032005 Ga0307411_10129219 Ga0307411_101292192 114
1024 3300032126 Ga0307415_100033049 Ga0307415_1000330493 114
1025 3300032126 Ga0307415_100145041 Ga0307415_1001450412 114
1026 3300036401 Ga0373937_0683389 Ga0373937_0683389_368_754 114
1027 3300037312 Ga0395899_0011637 Ga0395899_0011637_202_549 114
1028 3300037312 Ga0395899_0201002 Ga0395899_0201002_842_1186 114
1029 3300037312 Ga0395899_0249211 Ga0395899_0249211_355_699 114
1030 3300037312 Ga0395899_0302145 Ga0395899_0302145_49_393 114
1031 3300037312 Ga0395899_0729971 Ga0395899_0729971_90_440 114
1032 3300037418 Ga0395900_0000739 Ga0395900_0000739_42732_43076 114
1033 3300037418 Ga0395900_0049980 Ga0395900_0049980_3165_3512 114
1034 3300037418 Ga0395900_0215969 Ga0395900_0215969_138_482 114
1035 3300037418 Ga0395900_0676317 Ga0395900_0676317_184_528 114
1036 3300037418 Ga0395900_0687337 Ga0395900_0687337_550_894 114
1037 3300037466 Ga0395898_0000169 Ga0395898_0000169_86261_86605 114
1038 3300037466 Ga0395898_0034121 Ga0395898_0034121_4525_4872 114
1039 3300037466 Ga0395898_0037720 Ga0395898_0037720_3090_3434 114
1040 3300037466 Ga0395898_0121238 Ga0395898_0121238_662_1006 114
1041 3300037466 Ga0395898_0221983 Ga0395898_0221983_202_552 114
1042 3300037466 Ga0395898_1824323 Ga0395898_1824323_43_390 114
1043 3300037471 Ga0395905_0000109 Ga0395905_0000109_137244_137588 114
1044 3300037471 Ga0395905_0011082 Ga0395905_0011082_6796_7140 114
1045 3300037471 Ga0395905_0011183 Ga0395905_0011183_6328_6675 114
1046 3300037471 Ga0395905_0013554 Ga0395905_0013554_575_919 114
1047 3300037471 Ga0395905_0041597 Ga0395905_0041597_3465_3815 114
1048 3300037471 Ga0395905_0055673 Ga0395905_0055673_3319_3663 114
1049 3300037471 Ga0395905_0081355 Ga0395905_0081355_1342_1686 114
1050 3300037471 Ga0395905_0147233 Ga0395905_0147233_1709_2053 114
1051 3300037471 Ga0395905_0292906 Ga0395905_0292906_262_606 114
1052 3300037471 Ga0395905_0425462 Ga0395905_0425462_796_1140 114
1053 3300037471 Ga0395905_0454829 Ga0395905_0454829_750_1094 114
1054 3300038443 Ga0395901_0002515 Ga0395901_0002515_2565_2909 114
1055 3300038443 Ga0395901_0004885 Ga0395901_0004885_7074_7421 114
1056 3300038443 Ga0395901_0029318 Ga0395901_0029318_5171_5515 114
1057 3300038443 Ga0395901_0074507 Ga0395901_0074507_3000_3344 114
1058 3300038443 Ga0395901_0327858 Ga0395901_0327858_327_671 114
1059 3300038443 Ga0395901_0819009 Ga0395901_0819009_204_548 114
1060 3300038443 Ga0395901_1015341 Ga0395901_1015341_276_626 114
1061 3300038443 Ga0395901_1875628 Ga0395901_1875628_149_493 114
1062 3300039437 Ga0436365_0863121 Ga0436365_0863121_3154_3498 114
1063 3300039450 Ga0436363_0986144 Ga0436363_0986144_187_531 114
1064 3300041503 Ga0451847_0338526 Ga0451847_0338526_96_443 114
1065 3300042005 Ga0439448_0001896 Ga0439448_0001896_4628_4972 114
1066 3300042157 Ga0439458_0000089 Ga0439458_0000089_7142_7486 114
1067 3300044684 Ga0466966_0843333 Ga0466966_0843333_31_378 114
1068 3300044693 Ga0466961_0016584 Ga0466961_0016584_2369_2716 114
1069 3300044693 Ga0466961_0037775 Ga0466961_0037775_175_522 114
1070 3300044694 Ga0466963_0002624 Ga0466963_0002624_9554_9901 114
1071 3300044694 Ga0466963_0064585 Ga0466963_0064585_2017_2364 114
1072 3300044694 Ga0466963_0544144 Ga0466963_0544144_168_515 114
1073 3300044719 Ga0466971_0015532 Ga0466971_0015532_1177_1524 114
1074 3300044719 Ga0466971_0036905 Ga0466971_0036905_926_1273 114
1075 3300044765 Ga0466970_0402079 Ga0466970_0402079_180_527 114
1076 3300044842 Ga0466957_0053072 Ga0466957_0053072_1658_2005 114
1077 3300044842 Ga0466957_0065981 Ga0466957_0065981_1664_2011 114
1078 3300044842 Ga0466957_0439441 Ga0466957_0439441_65_409 114
1079 3300045049 Ga0466959_0105342 Ga0466959_0105342_1345_1692 114
1080 3300045049 Ga0466959_0291974 Ga0466959_0291974_159_506 114
1081 3300045836 Ga0466958_0005699 Ga0466958_0005699_1033_1380 114
1082 3300045976 Ga0466967_0317872 Ga0466967_0317872_1065_1412 114
1083 3300045976 Ga0466967_0787099 Ga0466967_0787099_214_558 114
1084 3300045976 Ga0466967_2337100 Ga0466967_2337100_169_516 114
1085 3300046459 Ga0495629_0755065 Ga0495629_0755065_204_551 114
1086 3300046474 Ga0495605_0252249 Ga0495605_0252249_274_621 114
1087 3300046506 Ga0495583_0340283 Ga0495583_0340283_104_451 114
1088 3300046507 Ga0495606_0452314 Ga0495606_0452314_241_588 114
1089 3300046513 Ga0495616_0140747 Ga0495616_0140747_517_864 114
1090 3300046525 Ga0495663_0166394 Ga0495663_0166394_114_461 114
1091 3300046528 Ga0495642_0043590 Ga0495642_0043590_810_1154 114
1092 3300046530 Ga0495654_0118918 Ga0495654_0118918_657_1004 114
1093 3300046542 Ga0495597_0233696 Ga0495597_0233696_166_513 114
1094 3300046681 Ga0495647_0097774 Ga0495647_0097774_840_1187 114
1095 3300046684 Ga0495669_0000417 Ga0495669_0000417_1831_2178 114
1096 3300046684 Ga0495669_0056214 Ga0495669_0056214_390_737 114
1097 3300046684 Ga0495669_0059048 Ga0495669_0059048_1227_1571 114
1098 3300047445 Ga0495677_0058111 Ga0495677_0058111_143_487 114
1099 3300047445 Ga0495677_0252721 Ga0495677_0252721_179_526 114
1100 3300047470 Ga0495681_0180861 Ga0495681_0180861_362_709 114
1101 3300048906 Ga0496103_0360814 Ga0496103_0360814_243_587 114
1102 3300048908 Ga0496105_0383365 Ga0496105_0383365_190_534 114
1103 3300048910 Ga0496107_0126637 Ga0496107_0126637_162_506 114
1104 3300048911 Ga0496108_0006811 Ga0496108_0006811_535_879 114
1105 3300048912 Ga0496109_0130339 Ga0496109_0130339_1639_1983 114
1106 3300048912 Ga0496109_0333661 Ga0496109_0333661_57_404 114
1107 3300048912 Ga0496109_0432415 Ga0496109_0432415_832_1176 114
1108 3300048913 Ga0496110_0007429 Ga0496110_0007429_3207_3551 114
1109 3300048914 Ga0496111_0003956 Ga0496111_0003956_506_850 114
1110 3300048915 Ga0496112_0014136 Ga0496112_0014136_242_589 114
1111 3300048915 Ga0496112_0188267 Ga0496112_0188267_1284_1628 114
1112 3300048915 Ga0496112_0611459 Ga0496112_0611459_31_375 114
1113 3300048916 Ga0496113_0051627 Ga0496113_0051627_581_925 114
1114 3300049583 Ga0501067_0038834 Ga0501067_0038834_1968_2315 114
1115 3300050510 nmdc:mga06r32_219565_c1 nmdc:mga06r32_219565_c1_1361_1705 114
1116 3300050512 nmdc:mga0n895_1920718_c1 nmdc:mga0n895_1920718_c1_40_384 114
1117 3300050512 nmdc:mga0n895_543475_c1 nmdc:mga0n895_543475_c1_199_543 114
1118 3300050513 nmdc:mga0rr50_338358_c1 nmdc:mga0rr50_338358_c1_222_566 114
1119 3300050515 nmdc:mga0a205_20051_c1 nmdc:mga0a205_20051_c1_1091_1435 114
1120 3300061719 Ga0466962_0012326 Ga0466962_0012326_3283_3630 114
1121 3300061719 Ga0466962_0033509 Ga0466962_0033509_794_1141 114
1122 3300001904 JGI24736J21556_1028504 JGI24736J21556_10285042 115
1123 3300001990 JGI24737J22298_10045001 JGI24737J22298_100450012 115
1124 3300005293 Ga0065715_10236176 Ga0065715_102361763 115
1125 3300005328 Ga0070676_11366081 Ga0070676_113660812 115
1126 3300005339 Ga0070660_100046452 Ga0070660_1000464523 115
1127 3300005344 Ga0070661_100215329 Ga0070661_1002153292 115
1128 3300005345 Ga0070692_10147116 Ga0070692_101471163 115
1129 3300005347 Ga0070668_100838702 Ga0070668_1008387022 115
1130 3300005353 Ga0070669_100437641 Ga0070669_1004376412 115
1131 3300005366 Ga0070659_100003440 Ga0070659_10000344010 115
1132 3300005444 Ga0070694_100013344 Ga0070694_1000133444 115
1133 3300005457 Ga0070662_100059145 Ga0070662_1000591453 115
1134 3300005543 Ga0070672_100077932 Ga0070672_1000779322 115
1135 3300005545 Ga0070695_100554008 Ga0070695_1005540083 115
1136 3300005563 Ga0068855_100137353 Ga0068855_1001373532 115
1137 3300005616 Ga0068852_100117141 Ga0068852_1001171413 115
1138 3300005843 Ga0068860_100010609 Ga0068860_1000106093 115
1139 3300009092 Ga0105250_10399044 Ga0105250_103990441 115
1140 3300009093 Ga0105240_10459400 Ga0105240_104594003 115
1141 3300009098 Ga0105245_10236419 Ga0105245_102364193 115
1142 3300009148 Ga0105243_10190386 Ga0105243_101903864 115
1143 3300009176 Ga0105242_10072377 Ga0105242_100723772 115
1144 3300009545 Ga0105237_10468510 Ga0105237_104685103 115
1145 3300009553 Ga0105249_10094596 Ga0105249_100945963 115
1146 3300010375 Ga0105239_10147654 Ga0105239_101476542 115
1147 3300013100 Ga0157373_10958497 Ga0157373_109584971 115
1148 3300013297 Ga0157378_10624178 Ga0157378_106241782 115
1149 3300013306 Ga0163162_10052258 Ga0163162_100522584 115
1150 3300014968 Ga0157379_11006087 Ga0157379_110060872 115
1151 3300025904 Ga0207647_10027597 Ga0207647_100275972 115
1152 3300025919 Ga0207657_10025917 Ga0207657_100259175 115
1153 3300025927 Ga0207687_10185550 Ga0207687_101855502 115
1154 3300025932 Ga0207690_10003581 Ga0207690_100035816 115
1155 3300025933 Ga0207706_10008705 Ga0207706_100087059 115
1156 3300025934 Ga0207686_10203240 Ga0207686_102032404 115
1157 3300025935 Ga0207709_10316307 Ga0207709_103163073 115
1158 3300025940 Ga0207691_10047753 Ga0207691_100477534 115
1159 3300025949 Ga0207667_10014838 Ga0207667_100148383 115
1160 3300025961 Ga0207712_10000974 Ga0207712_1000097410 115
1161 3300025972 Ga0207668_10017211 Ga0207668_100172112 115
1162 3300026041 Ga0207639_11857627 Ga0207639_118576272 115
1163 3300026142 Ga0207698_10091719 Ga0207698_100917191 115
1164 3300028381 Ga0268264_10000546 Ga0268264_1000054636 115

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02699

YajC

Preprotein translocase subunit

40

117

0.96

Feature Viewer

pLDDT pTM Quality
70.43 0.4 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map