metagRoot

F491013

General Info

Members	Datasets	Scaffolds	Average Seq Length
1161	667	2322	218

Family's Representative Sequence

Representative Sequence	3300044656\|Ga0466969_0003723\|Ga0466969_0003723_2042_2812
Length	256
Sequence	MRIWRRYSGKHDAEPDFHIRSAGGGMNDATDPAADDAALRAAVVHTALEMERLGINQGTSGNVSVRCGEDFLITPSGVPAAALTADSIVRLPLDVEADAPLLSKRGPSSEWRMHRDILRARGEIDAVVHTHSIAATAMAIHGREIPAHHYMVAAAGGNSIRCAPYATFGSQALSDYALEALEDRTACLLAHHGVIAIGRDLERALWLANEVEVLAKQYLLASQLGTPPLLSDDEIAEVVKKFSNYGPRRAHGSGAR

Samples

	Sample ID	Description	Type	Environment
1	3300044656	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R	Metagenome	Rhizosphere
2	3300001989	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5	Metagenome	Rhizosphere
3	3300002067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1	Metagenome	Rhizosphere
4	3300002075	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4	Metagenome	Rhizosphere
5	3300002705	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS	Metagenome	Unclassified
6	3300003187	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB	Metagenome	Endosphere
7	3300003203	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
8	3300003214	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL	Metagenome	Endosphere
9	3300003215	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF	Metagenome	Endosphere
10	3300003320	Sugarcane root Sample H2	Metagenome	Unclassified
11	3300003322	Sugarcane root Sample L2	Metagenome	Unclassified
12	3300003323	Sugarcane root Sample H1	Metagenome	Unclassified
13	3300003354	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS	Metagenome	Endosphere
14	3300003659	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
15	3300003756	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2	Metagenome	Endosphere
16	3300003758	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2	Metagenome	Endosphere
17	3300003759	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2	Metagenome	Endosphere
18	3300003760	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2	Metagenome	Endosphere
19	3300003761	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2	Metagenome	Endosphere
20	3300003762	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2	Metagenome	Endosphere
21	3300003763	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2	Metagenome	Endosphere
22	3300003771	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2	Metagenome	Endosphere
23	3300003794	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2	Metagenome	Endosphere
24	3300004625	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2	Metagenome	Endosphere
25	3300005262	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3)	Metagenome	Endosphere
26	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
27	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
28	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
29	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
30	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
31	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
32	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
33	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
34	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
35	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
36	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
37	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
38	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
39	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
40	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
41	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
42	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
43	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
44	3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Metagenome	Rhizosphere
45	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
46	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
47	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
48	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
49	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
50	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
51	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
52	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
53	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
54	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
55	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
56	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
57	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
58	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
59	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
60	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
61	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
62	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
63	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
64	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
65	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
66	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
67	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
68	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
69	3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
70	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
71	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
72	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
73	3300006042	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3	Metagenome	Endosphere
74	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
75	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
76	3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Metagenome	Rhizosphere
77	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
78	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
79	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
80	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
81	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
82	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
83	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
84	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
85	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
86	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
87	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
88	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
89	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
90	3300006942	Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW	Metagenome	Nodule
91	3300007265	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1	Metagenome	Rhizosphere
92	3300007788	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2	Metagenome	Rhizosphere
93	3300009011	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG	Metagenome	Rhizosphere
94	3300009092	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG	Metagenome	Rhizosphere
95	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
96	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
97	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
98	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
99	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
100	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
101	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
102	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
103	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
104	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
105	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
106	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
107	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
108	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
109	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
110	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
111	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
112	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
113	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
114	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
115	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
116	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
117	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
118	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
119	3300015261	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG	Metagenome	Rhizosphere
120	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
121	3300021320	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3	Metagenome	Nodule
122	3300021321	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1	Metagenome	Nodule
123	3300021324	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4	Metagenome	Nodule
124	3300021327	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2	Metagenome	Nodule
125	3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Metagenome	Unclassified
126	3300021441	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1	Metagenome	Rhizosphere
127	3300022467	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
128	3300025206	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2)	Metagenome	Unclassified
129	3300025225	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
130	3300025226	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
131	3300025228	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
132	3300025229	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
133	3300025230	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
134	3300025231	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
135	3300025242	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
136	3300025254	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
137	3300025256	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2)	Metagenome	Unclassified
138	3300025261	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2)	Metagenome	Endosphere
139	3300025272	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
140	3300025294	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2)	Metagenome	Endosphere
141	3300025295	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3)	Metagenome	Endosphere
142	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
143	3300025299	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3)	Metagenome	Endosphere
144	3300025302	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
145	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
146	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
147	3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2)	Metagenome	Rhizosphere
148	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
149	3300025735	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
150	3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
151	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
152	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
153	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
154	3300025905	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
155	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
156	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
157	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
158	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
159	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
160	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
161	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
162	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
163	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
164	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
165	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
166	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
167	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
168	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
169	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
170	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
171	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
172	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
173	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
174	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
175	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
176	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
177	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
178	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
179	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
180	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
181	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
182	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
183	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
184	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
185	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
186	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
187	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
188	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
189	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
190	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
191	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
192	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
193	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
194	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
195	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
196	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
197	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
198	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
199	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
200	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
201	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
202	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
203	3300027296	Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2)	Metagenome	Nodule
204	3300027357	Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2)	Metagenome	Nodule
205	3300027361	Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2)	Metagenome	Nodule
206	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
207	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
208	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
209	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
210	3300028786	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM	Metagenome	Unclassified
211	3300031249	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG	Metagenome	Rhizosphere
212	3300031250	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG	Metagenome	Rhizosphere
213	3300031251	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG	Metagenome	Rhizosphere
214	3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Metagenome	Unclassified
215	3300031507	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM	Metagenome	Unclassified
216	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
217	3300031595	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG	Metagenome	Rhizosphere
218	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
219	3300031730	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM	Metagenome	Unclassified
220	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
221	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
222	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
223	3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Metagenome	Rhizosphere
224	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
225	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
226	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
227	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
228	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
229	3300033180	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM	Metagenome	Unclassified
230	3300034957	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2	Metagenome	Rhizosphere
231	3300035092	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11	Metagenome	Rhizosphere
232	3300035113	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12	Metagenome	Rhizosphere
233	3300035170	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1	Metagenome	Rhizosphere
234	3300035171	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4	Metagenome	Rhizosphere
235	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
236	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
237	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
238	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
239	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
240	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
241	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
242	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
243	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
244	3300037853	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2	Metagenome	Unclassified
245	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
246	3300038726	Seagrass microbial communities from Seahorse Key, FL, USA - TH0319	Metagenome	Unclassified
247	3300038727	Seagrass microbial communities from Seahorse Key, FL, USA - TV0818	Metagenome	Unclassified
248	3300038735	Seagrass microbial communities from Seahorse Key, FL, USA - SH0319	Metagenome	Unclassified
249	3300039062	Seagrass microbial communities from Seahorse Key, FL, USA - HH0818	Metagenome	Unclassified
250	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
251	3300039438	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2	Metagenome	Rhizosphere
252	3300039447	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2	Metagenome	Rhizosphere
253	3300039453	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2	Metagenome	Rhizosphere
254	3300041443	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG	Metagenome	Rhizoplane
255	3300041453	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG	Metagenome	Rhizoplane
256	3300041491	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG	Metagenome	Unclassified
257	3300041503	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG	Metagenome	Unclassified
258	3300042876	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED	Metagenome	Rhizosphere
259	3300044658	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R	Metagenome	Rhizosphere
260	3300044683	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R	Metagenome	Rhizosphere
261	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
262	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
263	3300044706	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R	Metagenome	Rhizosphere
264	3300044712	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED	Metagenome	Rhizosphere
265	3300044735	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R	Metagenome	Rhizosphere
266	3300044765	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R	Metagenome	Rhizosphere
267	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
268	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
269	3300045836	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R	Metagenome	Rhizosphere
270	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
271	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
272	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
273	3300046457	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere	Metagenome	Rhizosphere
274	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
275	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
276	3300046461	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere	Metagenome	Rhizosphere
277	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
278	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
279	3300046471	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere	Metagenome	Rhizosphere
280	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
281	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
282	3300046474	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere	Metagenome	Rhizosphere
283	3300046475	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere	Metagenome	Rhizosphere
284	3300046476	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere	Metagenome	Rhizosphere
285	3300046477	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere	Metagenome	Rhizosphere
286	3300046491	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere	Metagenome	Rhizosphere
287	3300046492	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere	Metagenome	Rhizosphere
288	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
289	3300046500	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere	Metagenome	Rhizosphere
290	3300046506	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere	Metagenome	Rhizosphere
291	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
292	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
293	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
294	3300046513	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere	Metagenome	Rhizosphere
295	3300046514	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere	Metagenome	Rhizosphere
296	3300046515	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere	Metagenome	Rhizosphere
297	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
298	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
299	3300046519	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere	Metagenome	Rhizosphere
300	3300046522	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere	Metagenome	Rhizosphere
301	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
302	3300046526	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere	Metagenome	Rhizosphere
303	3300046528	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere	Metagenome	Rhizosphere
304	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
305	3300046531	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere	Metagenome	Rhizosphere
306	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
307	3300046535	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere	Metagenome	Rhizosphere
308	3300046537	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere	Metagenome	Rhizosphere
309	3300046538	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere	Metagenome	Rhizosphere
310	3300046542	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere	Metagenome	Rhizosphere
311	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
312	3300046557	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere	Metagenome	Rhizosphere
313	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
314	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
315	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
316	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
317	3300046648	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere	Metagenome	Rhizosphere
318	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
319	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
320	3300046665	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere	Metagenome	Rhizosphere
321	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
322	3300046678	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere	Metagenome	Rhizosphere
323	3300046679	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere	Metagenome	Rhizosphere
324	3300046680	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere	Metagenome	Rhizosphere
325	3300046681	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere	Metagenome	Rhizosphere
326	3300046684	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere	Metagenome	Rhizosphere
327	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
328	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
329	3300046794	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere	Metagenome	Rhizosphere
330	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
331	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
332	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
333	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
334	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
335	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
336	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
337	3300047323	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere	Metagenome	Rhizosphere
338	3300047443	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere	Metagenome	Rhizosphere
339	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
340	3300047445	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere	Metagenome	Rhizosphere
341	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
342	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
343	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
344	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
345	3300048089	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere	Metagenome	Rhizosphere
346	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
347	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
348	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
349	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
350	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
351	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
352	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
353	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
354	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
355	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
356	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
357	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
358	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
359	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
360	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
361	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
362	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
363	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
364	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
365	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
366	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
367	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
368	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
369	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
370	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
371	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
372	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
373	3300049459	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere	Metagenome	Rhizosphere
374	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
375	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
376	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
377	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
378	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
379	3300049577	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02	Metagenome	Rhizosphere
380	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
381	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
382	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
383	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
384	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
385	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
386	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
387	3300049591	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03	Metagenome	Rhizosphere
388	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
389	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
390	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
391	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
392	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
393	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
394	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
395	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
396	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
397	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
398	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
399	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
400	3300050495	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation	Metagenome	Endosphere
401	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
402	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
403	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
404	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
405	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
406	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
407	3300053080	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere	Metagenome	Endosphere
408	3300053084	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere	Metagenome	Rhizosphere
409	3300053086	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere	Metagenome	Endosphere
410	3300053087	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere	Metagenome	Endosphere
411	3300053088	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere	Metagenome	Endosphere
412	3300053091	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere	Metagenome	Endosphere
413	3300053092	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere	Metagenome	Endosphere
414	3300053094	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere	Metagenome	Endosphere
415	3300053095	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere	Metagenome	Endosphere
416	3300053096	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere	Metagenome	Endosphere
417	3300053103	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere	Metagenome	Endosphere
418	3300053105	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere	Metagenome	Endosphere
419	3300053108	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere	Metagenome	Endosphere
420	3300053111	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere	Metagenome	Endosphere
421	3300053119	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere	Metagenome	Endosphere
422	3300053126	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere	Metagenome	Endosphere
423	3300053128	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere	Metagenome	Endosphere
424	3300053130	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere	Metagenome	Endosphere
425	3300053131	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere	Metagenome	Endosphere
426	3300053133	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere	Metagenome	Endosphere
427	3300053134	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere	Metagenome	Endosphere
428	3300053138	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere	Metagenome	Endosphere
429	3300053139	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere	Metagenome	Endosphere
430	3300053142	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere	Metagenome	Endosphere
431	3300053147	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere	Metagenome	Endosphere
432	3300053148	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere	Metagenome	Endosphere
433	3300053150	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere	Metagenome	Endosphere
434	3300053151	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere	Metagenome	Endosphere
435	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
436	3300053155	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere	Metagenome	Endosphere
437	3300053156	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere	Metagenome	Endosphere
438	3300053158	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere	Metagenome	Endosphere
439	3300053161	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere	Metagenome	Endosphere
440	3300053162	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere	Metagenome	Endosphere
441	3300053177	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere	Metagenome	Endosphere
442	3300053178	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere	Metagenome	Endosphere
443	3300053727	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere	Metagenome	Endosphere
444	3300053729	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere	Metagenome	Endosphere
445	3300053730	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere	Metagenome	Endosphere
446	3300053731	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere	Metagenome	Endosphere
447	3300053737	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere	Metagenome	Endosphere
448	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
449	3300055283	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere	Metagenome	Endosphere
450	2501025502	Paraburkholderia unamae MTI-641	Isolate	Rhizosphere
451	2507262055	Bradyrhizobium sp. WSM1417	Isolate	Nodule
452	2508501009	Bradyrhizobium sp. WSM471	Isolate	Nodule
453	2508501042	Bradyrhizobium sp. WSM1253	Isolate	Nodule
454	2508501125	Burkholderia sp. WSM2232	Isolate	Nodule
455	2508501127	Mesorhizobium sp. WSM2561	Isolate	Nodule
456	2508501128	Bradyrhizobium sp. ARR65	Isolate	Nodule
457	2510917013	Paraburkholderia unamae MTI-641	Isolate	Rhizosphere
458	2511231028	Bradyrhizobium sp. YR681	Isolate	Rhizosphere
459	2513237092	Bradyrhizobium sp. WSM1743	Isolate	Nodule
460	2513237094	Bradyrhizobium sp. WSM3983	Isolate	Nodule
461	2513237095	Bradyrhizobium diazoefficiens USDA 122	Isolate	Nodule
462	2513237098	Bradyrhizobium elkanii WSM2783	Isolate	Nodule
463	2513237101	Bradyrhizobium murdochi WSM1741	Isolate	Nodule
464	2513237102	Bradyrhizobium japonicum USDA 135	Isolate	Nodule
465	2513237139	Bradyrhizobium ottawaense USDA 4	Isolate	Nodule
466	2513237161	Bradyrhizobium sp. WSM2793	Isolate	Nodule
467	2515154112	Bradyrhizobium sp. WSM4349	Isolate	Nodule
468	2517093001	Bradyrhizobium japonicum USDA 124	Isolate	Nodule
469	2524023205	Bradyrhizobium sp. Cp5.3	Isolate	Nodule
470	2524023210	Bradyrhizobium sp. Ai1a-2	Isolate	Nodule
471	2528768022	Bradyrhizobium japonicum USDA 123	Isolate	Nodule
472	2597490356	Azospirillum brasilense sp7	Isolate	Unclassified
473	2600255067	Paraburkholderia kururiensis thiooxydans NBRC 107107	Isolate	Unclassified
474	2617270735	Bradyrhizobium shewense ERR11	Isolate	Nodule
475	2617270741	Bradyrhizobium yuanmingense CCBAU 10071	Isolate	Nodule
476	2721755755	Bradyrhizobium icense LMTR 13	Isolate	Nodule
477	2738541296	Paraburkholderia sp. GV073	Isolate	Unclassified
478	2738541298	Paraburkholderia sp. GV068	Isolate	Unclassified
479	2738541306	Paraburkholderia sp. GV052	Isolate	Unclassified
480	2738543002	Paraburkholderia sp. GV072	Isolate	Unclassified
481	2738543008	Paraburkholderia sp. GV060	Isolate	Unclassified
482	2751185846	Paraburkholderia ribeironis STM 7296	Isolate	Unclassified
483	2758568016	[Ochrobactrum] quorumnocens A44	Isolate	Rhizosphere
484	2791355196	Bradyrhizobium sp. Y36	Isolate	Nodule
485	2791355199
486	2802429603	Bradyrhizobium ottawaense L2	Isolate	Nodule
487	2816332527	Bradyrhizobium diazoefficiens Y21	Isolate	Nodule
488	2824600985	Bradyrhizobium sp.HAMBI 2135	Isolate	Unclassified
489	2824609381	Bradyrhizobium sp. HAMBI 2134	Isolate	Unclassified
490	2824617872	Bradyrhizobium sp. HAMBI 2133	Isolate	Unclassified
491	2824626560	Bradyrhizobium sp. HAMBI 2149	Isolate	Unclassified
492	2824635225	Bradyrhizobium sp. HAMBI 2136	Isolate	Unclassified
493	2824644064	Bradyrhizobium sp. HAMBI 2137	Isolate	Unclassified
494	2824653114	Bradyrhizobium sp. HAMBI 2142	Isolate	Unclassified
495	2824661429	Bradyrhizobium sp. HAMBI 2115	Isolate	Unclassified
496	2824671348	Bradyrhizobium sp. HAMBI 2125	Isolate	Unclassified
497	2824679649	Bradyrhizobium sp.HAMBI 2116	Isolate	Unclassified
498	2824687955	Bradyrhizobium sp. HAMBI 2126	Isolate	Unclassified
499	2824696289	Bradyrhizobium sp. HAMBI 2127	Isolate	Unclassified
500	2824704595	Bradyrhizobium sp. HAMBI 2150	Isolate	Unclassified
501	2824714736	Bradyrhizobium sp. HAMBI 2151	Isolate	Unclassified
502	2824723954	Bradyrhizobium sp. HAMBI 2152	Isolate	Unclassified
503	2824732956	Bradyrhizobium sp. HAMBI 2153	Isolate	Unclassified
504	2824746037	Bradyrhizobium sp. HAMBI 2299	Isolate	Unclassified
505	2824753945	Bradyrhizobium sp. HAMBI 2128	Isolate	Unclassified
506	2824763712	Bradyrhizobium sp. HAMBI 2129	Isolate	Unclassified
507	2824773399	Bradyrhizobium sp. HAMBI 2130	Isolate	Unclassified
508	2829745981	Methylorubrum rhodinum DSM 2163	Isolate	Rhizosphere
509	2834578030	Paracoccus thiocyanatus SST	Isolate	Unclassified
510	2837651117	Pseudohoeflea suaedae YC6898	Isolate	Unclassified
511	2838122688	Bradyrhizobium sp. CIR3A	Isolate	Nodule
512	2841941048	Bradyrhizobium sp. SBR1B	Isolate	Nodule
513	2841949485	Bradyrhizobium sp. ERR14	Isolate	Nodule
514	2841957949	Bradyrhizobium sp. CIR1	Isolate	Nodule
515	2841966195	Bradyrhizobium sp. CIR18	Isolate	Nodule
516	2841974524	Bradyrhizobium sp. CIR48	Isolate	Nodule
517	2841983080	Bradyrhizobium sp. IAR9	Isolate	Nodule
518	2842038055	Bradyrhizobium centrosematis SEMIA 424	Isolate	Nodule
519	2842045827	Bradyrhizobium centrosematis SEMIA 431	Isolate	Nodule
520	2844315083	Bradyrhizobium guangzhouense CCBAU 51670	Isolate	Unclassified
521	2846952575	Azospirillum brasilense sp7	Isolate	Unclassified
522	2847939898	Bradyrhizobium ottawaense OO99	Isolate	Unclassified
523	2848858292	Azospirillum brasilense Az39	Isolate	Unclassified
524	2849076700	Bradyrhizobium symbiodeficiens 85S1MB	Isolate	Nodule
525	2854681122	Luteovulum sphaeroides SCJ	Isolate	Unclassified
526	2857509624	Bradyrhizobium sp. R-73088	Isolate	Unclassified
527	2861691609	Methylorubrum thiocyanatum DSM 11490	Isolate	Rhizosphere
528	2869162929	Mesorhizobium sanjuanii BSA136	Isolate	Nodule
529	2874590934	Bradyrhizobium canariense UBMA181	Isolate	Nodule
530	2874604998	Bradyrhizobium sp. LMTR 3	Isolate	Nodule
531	2874620515	Bradyrhizobium nanningense CCBAU 53390	Isolate	Unclassified
532	2874628541	Bradyrhizobium betae Opo-243	Isolate	Unclassified
533	2874645413	Bradyrhizobium canariense UBMA122	Isolate	Nodule
534	2876761206	Bradyrhizobium centrolobii BR 10245	Isolate	Nodule
535	2876771140	Bradyrhizobium canariense UBMA192	Isolate	Nodule
536	2876808645	Bradyrhizobium algeriense RST89	Isolate	Unclassified
537	2876818435	Bradyrhizobium canariense UBMA195	Isolate	Nodule
538	2879074833	Bradyrhizobium canariense UBMA171	Isolate	Nodule
539	2879099564	Bradyrhizobium japonicum UBMA197	Isolate	Nodule
540	2879110137	Bradyrhizobium algeriense RST91	Isolate	Nodule
541	2879127579	Bradyrhizobium canariense UBMA052	Isolate	Nodule
542	2879142872	Bradyrhizobium canariense UBMA061	Isolate	Nodule
543	2881364244	Bradyrhizobium sp. RP6	Isolate	Unclassified
544	2881665667	Bradyrhizobium vignae LMG 28791	Isolate	Unclassified
545	2883087390	Paraburkholderia guartelaensis CNPSo 3008	Isolate	Unclassified
546	2885270888	Paraburkholderia sp. UYCPa14C	Isolate	Unclassified
547	2885383462	Bradyrhizobium sp. Leo170	Isolate	Unclassified
548	2885409591	Bradyrhizobium sp. NAS80.1	Isolate	Unclassified
549	2888378607	Bradyrhizobium sp. LCT2	Isolate	Unclassified
550	2888388044	Bradyrhizobium cosmicum 58S1	Isolate	Unclassified
551	2888419890	Bradyrhizobium sp. 1(2017) 63S1MB	Isolate	Unclassified
552	2889033259	Bradyrhizobium sp. CCBAU 051011	Isolate	Unclassified
553	2903727486	Bradyrhizobium guangzhouense CCBAU 53424	Isolate	Unclassified
554	2903768456	Bradyrhizobium sp. Leo121	Isolate	Unclassified
555	2904483920	Paraburkholderia caledonica 575	Isolate	Unclassified
556	2904666416	Bradyrhizobium nanningense CCBAU 51757	Isolate	Unclassified
557	2904711408	Bradyrhizobium sp. USDA 3456	Isolate	Unclassified
558	2906602504	Bradyrhizobium guangzhouense CCBAU 53426	Isolate	Unclassified
559	2906626472	Bradyrhizobium hipponense aSej3	Isolate	Unclassified
560	2908775508	Bradyrhizobium sp. SUTN9-2	Isolate	Unclassified
561	2919527303	Paraburkholderia strydomiana 3827	Isolate	Unclassified
562	2922361189	Bradyrhizobium australiense WSM 1791	Isolate	Nodule
563	2922368715
564	2922386360	Bradyrhizobium archetypum WSM 1744	Isolate	Nodule
565	2922393267	Bradyrhizobium sp. WBAH10	Isolate	Nodule
566	2929615660	Bradyrhizobium japonicum TXVA	Isolate	Nodule
567	2929624759	Bradyrhizobium japonicum TXEA	Isolate	Nodule
568	2932784394	Bradyrhizobium sp. S3.2.12	Isolate	Nodule
569	2932794094	Bradyrhizobium sp. S3.2.6	Isolate	Nodule
570	2932801729	Bradyrhizobium sp. S3.3.6	Isolate	Nodule
571	2932809354	Bradyrhizobium sp. S3.5.5	Isolate	Nodule
572	2932818245	Bradyrhizobium sp. S3.9.1	Isolate	Nodule
573	2932828146	Bradyrhizobium sp. S3.9.2	Isolate	Nodule
574	2933577622	Bradyrhizobium japonicum SEMIA 417	Isolate	Nodule
575	2935608549	Bradyrhizobium sp. RT6a	Isolate	Nodule
576	2935616580	Bradyrhizobium sp. RT7a	Isolate	Nodule
577	2935638405	Bradyrhizobium sp. JR19.8	Isolate	Nodule
578	2935648319	Bradyrhizobium sp. JR4.3	Isolate	Nodule
579	2935656913	Bradyrhizobium sp. JR5.3	Isolate	Nodule
580	2935665750	Bradyrhizobium sp. JR7.2	Isolate	Nodule
581	2935675223	Bradyrhizobium sp. LA2.1	Isolate	Nodule
582	2935684952	Bradyrhizobium sp. LA3.X	Isolate	Nodule
583	2935694250	Bradyrhizobium sp. LA6.1	Isolate	Nodule
584	2935703347	Bradyrhizobium sp. LA6.10	Isolate	Nodule
585	2935713505	Bradyrhizobium sp. LA6.12	Isolate	Nodule
586	2935722832	Bradyrhizobium sp. LA6.3	Isolate	Nodule
587	2935732158	Bradyrhizobium sp. LA6.4	Isolate	Nodule
588	2935741537	Bradyrhizobium sp. LA6.7	Isolate	Nodule
589	2935750917	Bradyrhizobium sp. LA6.8	Isolate	Nodule
590	2935760218	Bradyrhizobium sp. LA7.1	Isolate	Nodule
591	2935769743	Bradyrhizobium sp. LB12.1	Isolate	Nodule
592	2935777560	Bradyrhizobium sp. LB14.3	Isolate	Nodule
593	2935785616	Bradyrhizobium sp. LB5.2	Isolate	Nodule
594	2935793552	Bradyrhizobium sp. LB8.2	Isolate	Nodule
595	2935801545	Bradyrhizobium sp. RT10b	Isolate	Nodule
596	2935810662	Bradyrhizobium sp. RT3a	Isolate	Nodule
597	2935819856	Bradyrhizobium sp. RT3b	Isolate	Nodule
598	2935827899	Bradyrhizobium sp. RT4a	Isolate	Nodule
599	2935847175	Bradyrhizobium sp. RT5a	Isolate	Nodule
600	2935855204	Bradyrhizobium sp. RT7b	Isolate	Nodule
601	2935864058	Bradyrhizobium sp. RT9a	Isolate	Nodule
602	2935873716	Bradyrhizobium sp. RT9b	Isolate	Nodule
603	2935883170	Bradyrhizobium sp. S3.12.5	Isolate	Nodule
604	2935908558	Bradyrhizobium sp. F1.1.1	Isolate	Nodule
605	2935916978	Bradyrhizobium sp. F1.13.3	Isolate	Nodule
606	2935926038	Bradyrhizobium sp. F1.2.1	Isolate	Nodule
607	2935934488	Bradyrhizobium sp. F1.2.2	Isolate	Nodule
608	2935942939	Bradyrhizobium sp. F1.2.6	Isolate	Nodule
609	2935951376	Bradyrhizobium sp. F1.2.8	Isolate	Nodule
610	2935959822	Bradyrhizobium sp. F1.4.3	Isolate	Nodule
611	2935967501	Bradyrhizobium sp. F1.6.2	Isolate	Nodule
612	2935975950	Bradyrhizobium sp. GM2.2	Isolate	Nodule
613	2935984226	Bradyrhizobium sp. i1.15.2	Isolate	Nodule
614	2935992306	Bradyrhizobium sp. I1.7.5	Isolate	Nodule
615	2936002035	Bradyrhizobium sp. I1.8.5	Isolate	Nodule
616	2936011229	Bradyrhizobium sp. JR1.1	Isolate	Nodule
617	2936019824	Bradyrhizobium sp. JR1.5	Isolate	Nodule
618	2936028420	Bradyrhizobium sp. JR1.7	Isolate	Nodule
619	2936037263	Bradyrhizobium sp. JR18.2	Isolate	Nodule
620	2936046547	Bradyrhizobium sp. JR3.12	Isolate	Nodule
621	2936055302	Bradyrhizobium sp. JR4.1	Isolate	Nodule
622	2940556831	Bradyrhizobium sp. LA8.1	Isolate	Nodule
623	2941531003	Bradyrhizobium sp. LB11.1	Isolate	Nodule
624	2941538514	Bradyrhizobium sp. RT11b	Isolate	Nodule
625	2945934425	Paraburkholderia graminis W1I13	Isolate	Rhizosphere
626	2990703756	Paraburkholderia graminis SLBN-33	Isolate	Rhizosphere
627	3005445848	Rhizobium sp. WYJ-E13	Isolate	Unclassified
628	3005483717	Bradyrhizobium agreste CNPSo 4010	Isolate	Unclassified
629	3005506211	Bradyrhizobium diazoefficiens SZCCT0449	Isolate	Unclassified
630	3005587118	Bradyrhizobium glycinis CNPSo 4016	Isolate	Unclassified
631	3005594810	Bradyrhizobium sp. CCBAU 53340	Isolate	Nodule
632	3005710791	Bradyrhizobium genosp. B BDV5040	Isolate	Unclassified
633	3005718088	Bradyrhizobium sp. CCBAU 53338	Isolate	Nodule
634	641736151	Paraburkholderia graminis C4D1M	Isolate	Rhizoplane
635	8006964411	Bradyrhizobium sp. sBnM-33	Isolate	Nodule
636	8006984368	Bradyrhizobium sp. SRL28	Isolate	Unclassified
637	8006994254	Bradyrhizobium sp. sGM-13	Isolate	Nodule
638	8016522445	Bradyrhizobium sp. LM6.9	Isolate	Nodule
639	8016557553	Bradyrhizobium sp. LM3.4	Isolate	Nodule
640	8016566248	Bradyrhizobium sp. LM3.2	Isolate	Nodule
641	8016575299	Bradyrhizobium sp. LM2.9	Isolate	Nodule
642	8016595262	Bradyrhizobium sp. LM2.3	Isolate	Nodule
643	8016603502	Bradyrhizobium sp. LB7.2	Isolate	Nodule
644	8016613128	Bradyrhizobium sp. LB7.1	Isolate	Nodule
645	8016622563	Bradyrhizobium sp. LB13.1	Isolate	Nodule
646	8016630954	Bradyrhizobium sp. F1.13.1	Isolate	Nodule
647	8017057580	Bradyrhizobium sp. S3.7.6	Isolate	Nodule
648	8019530166	Bradyrhizobium sp. LM4.3	Isolate	Nodule
649	8019538911	Bradyrhizobium sp. LB9.1b	Isolate	Nodule
650	8019547302	Bradyrhizobium sp. LB1.3	Isolate	Nodule
651	8019576017	Bradyrhizobium sp. i1.7.7	Isolate	Nodule
652	8019586578	Bradyrhizobium sp. i1.4.4	Isolate	Nodule
653	8019597564	Bradyrhizobium sp. i1.3.6	Isolate	Nodule
654	8019608314	Bradyrhizobium sp. i1.3.1	Isolate	Nodule
655	8019619141	Bradyrhizobium sp. GM7.3	Isolate	Nodule
656	8019638758	Bradyrhizobium sp. GM5.1	Isolate	Nodule
657	8019648815	Bradyrhizobium sp. GM24.11	Isolate	Nodule
658	8019659431	Bradyrhizobium sp. GM22.5	Isolate	Nodule
659	8019668869	Bradyrhizobium sp. GM2.4	Isolate	Nodule
660	8019678201	Bradyrhizobium sp. GM0.4	Isolate	Nodule
661	8019687851	Bradyrhizobium sp. F1.13.4	Isolate	Nodule
662	8054002106	Azospirillum lipoferum 59b	Isolate	Unclassified
663	8055301274	Paraburkholderia kirstenboschensis LMG 28727	Isolate	Nodule
664	8055742211	Bradyrhizobium japonicum 5038	Isolate	Nodule
665	8056673599	Bradyrhizobium hereditatis WSM 1738	Isolate	Nodule
666	8056681323	Bradyrhizobium cenepequi CNPSo 4026	Isolate	Nodule
667	8056967851	Bradyrhizobium zhengyangense WYCCWR 12678	Isolate	Nodule

Type Distribution

Type	Percentage (%)
Metagenomes	81.19
Metatranscriptomes	0.09
Isolates	18.72

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	13.52
Nodule	12.92
Rhizoplane	6.72
Rhizosphere	54.69
Stem	0
Stem Tuber	0
Unclassified	0.17

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	Ga0466969_0003723	3300044656	Bacteria	8101
2	JGI24739J22299_10002428	3300001989	Bacteria	7192
3	JGI24739J22299_10041526	3300001989	Unclassified	1530
4	JGI24735J21928_10002099	3300002067	Bacteria	7020
5	JGI24738J21930_10009150	3300002075	Bacteria	2239
6	JGI25156J39149_1000413	3300002705	Bacteria	26612
7	JGI25151J46595_10006907	3300003187	Bacteria	5634
8	JGI25406J46586_10033975	3300003203	Bacteria	1877
9	JGI25165J46597_1000695	3300003214	Bacteria	26820
10	JGI25153J46596_10005839	3300003215	Bacteria	6394
11	JGI25153J46596_10008795	3300003215	Bacteria	4777
12	JGI25153J46596_10011061	3300003215	Bacteria	4020
13	rootH2_10193879	3300003320	Bacteria	1774
14	rootL2_10051959	3300003322	Bacteria	7526
15	rootH1_10089171	3300003323	Bacteria	1088
16	JGI25160J50197_1006854	3300003354	Bacteria	4551
17	JGI25404J52841_10022165	3300003659	Bacteria	1373
18	Ga0055533_1000420	3300003756	Bacteria	16425
19	Ga0055532_1000013	3300003758	Bacteria	380677
20	Ga0055525_1002129	3300003759	Bacteria	2286
21	Ga0055527_1000010	3300003760	Bacteria	380677
22	Ga0055535_1000010	3300003761	Bacteria	380677
23	Ga0055542_1000016	3300003762	Bacteria	380677
24	Ga0055529_1000012	3300003763	Bacteria	380677
25	Ga0055526_1024492	3300003771	Bacteria	1971
26	Ga0055531_10003606	3300003794	Bacteria	9789
27	Ga0055543_1004698	3300004625	Bacteria	3652
28	Ga0065165_1005490	3300005262	Bacteria	7095
29	Ga0065165_1006783	3300005262	Bacteria	5853
30	Ga0065165_1007709	3300005262	Bacteria	5213
31	Ga0065165_1009691	3300005262	Bacteria	4272
32	Ga0070658_10076870	3300005327	Bacteria	2738
33	Ga0070658_10739844	3300005327	Bacteria	854
34	Ga0070683_100080598	3300005329	Bacteria	3047
35	Ga0070680_100017995	3300005336	Bacteria	5580
36	Ga0070680_100170725	3300005336	Bacteria	1830
37	Ga0070680_100502060	3300005336	Bacteria	1038
38	Ga0070682_100034392	3300005337	Bacteria	3086
39	Ga0068868_100151031	3300005338	Bacteria	1913
40	Ga0070660_100066785	3300005339	Bacteria	2801
41	Ga0070660_100069171	3300005339	Bacteria	2753
42	Ga0070691_10320299	3300005341	Bacteria	852
43	Ga0070661_100057667	3300005344	Bacteria	2845
44	Ga0070661_100576129	3300005344	Bacteria	908
45	Ga0070668_100107791	3300005347	Bacteria	2214
46	Ga0070668_100285584	3300005347	Bacteria	1379
47	Ga0070668_100532380	3300005347	Bacteria	1020
48	Ga0070675_100767052	3300005354	Bacteria	880
49	Ga0070671_100047356	3300005355	Bacteria	3575
50	Ga0070674_100057349	3300005356	Bacteria	2703
51	Ga0070673_100171208	3300005364	Bacteria	1854
52	Ga0070673_100538811	3300005364	Bacteria	1059
53	Ga0070688_100173601	3300005365	Bacteria	1490
54	Ga0070688_100350481	3300005365	Bacteria	1081
55	Ga0070667_100198295	3300005367	Bacteria	1781
56	Ga0070667_100329259	3300005367	Bacteria	1380
57	Ga0070667_100476217	3300005367	Bacteria	1143
58	Ga0070709_10099267	3300005434	Bacteria	1936
59	Ga0070714_100025078	3300005435	Bacteria	4918
60	Ga0070714_100549136	3300005435	Bacteria	1106
61	Ga0070714_100663331	3300005435	Bacteria	1005
62	Ga0070713_100005011	3300005436	Bacteria	8995
63	Ga0070713_100016727	3300005436	Bacteria	5521
64	Ga0070713_100019403	3300005436	Bacteria	5190
65	Ga0070713_100082366	3300005436	Bacteria	2747
66	Ga0070713_100366444	3300005436	Bacteria	1340
67	Ga0070710_10025921	3300005437	Bacteria	3109
68	Ga0070710_10094611	3300005437	Bacteria	1768
69	Ga0070711_100010825	3300005439	Bacteria	5655
70	Ga0070711_100036102	3300005439	Bacteria	3310
71	Ga0070711_100092334	3300005439	Bacteria	2184
72	Ga0070700_100463855	3300005441	Bacteria	967
73	Ga0070694_100609998	3300005444	Bacteria	880
74	Ga0070663_100081195	3300005455	Bacteria	2383
75	Ga0070663_100144568	3300005455	Bacteria	1818
76	Ga0070663_100250687	3300005455	Bacteria	1401
77	Ga0070663_100357697	3300005455	Bacteria	1184
78	Ga0070678_100042994	3300005456	Bacteria	3216
79	Ga0070678_100184103	3300005456	Bacteria	1712
80	Ga0070678_100634777	3300005456	Bacteria	957
81	Ga0070662_100356319	3300005457	Bacteria	1200
82	Ga0070681_10028930	3300005458	Bacteria	5567
83	Ga0070681_10129996	3300005458	Bacteria	2450
84	Ga0070679_100005105	3300005530	Bacteria	12131
85	Ga0070679_100144553	3300005530	Bacteria	2356
86	Ga0070684_100007439	3300005535	Bacteria	8514
87	Ga0068853_100203171	3300005539	Bacteria	1804
88	Ga0068853_100240102	3300005539	Bacteria	1660
89	Ga0068853_100527596	3300005539	Bacteria	1117
90	Ga0070686_100068516	3300005544	Bacteria	2315
91	Ga0070695_100443113	3300005545	Bacteria	993
92	Ga0070665_100068609	3300005548	Bacteria	3555
93	Ga0070665_100073474	3300005548	Bacteria	3425
94	Ga0070665_100210378	3300005548	Bacteria	1946
95	Ga0070665_100323422	3300005548	Bacteria	1547
96	Ga0070665_100400288	3300005548	Bacteria	1381
97	Ga0070665_100547825	3300005548	Bacteria	1169
98	Ga0070665_101027093	3300005548	Bacteria	836
99	Ga0068855_100074770	3300005563	Bacteria	3934
100	Ga0068855_100157292	3300005563	Bacteria	2582
101	Ga0068855_100428257	3300005563	Bacteria	1446
102	Ga0068855_100679324	3300005563	Bacteria	1104
103	Ga0070664_100279651	3300005564	Bacteria	1505
104	Ga0068857_100110131	3300005577	Bacteria	2475
105	Ga0068856_100000066	3300005614	Bacteria	98376
106	Ga0068856_100083156	3300005614	Bacteria	3178
107	Ga0068856_100316563	3300005614	Bacteria	1578
108	Ga0068856_100815787	3300005614	Bacteria	952
109	Ga0070702_100678575	3300005615	Bacteria	783
110	Ga0068852_100008061	3300005616	Bacteria	7728
111	Ga0068852_100011855	3300005616	Bacteria	6589
112	Ga0068864_100785170	3300005618	Bacteria	935
113	Ga0068864_100868396	3300005618	Bacteria	890
114	Ga0068861_100116600	3300005719	Bacteria	2148
115	Ga0068860_100605224	3300005843	Bacteria	1101
116	Ga0068860_101229272	3300005843	Bacteria	770
117	Ga0068862_100054763	3300005844	Bacteria	3415
118	Ga0068862_100312055	3300005844	Bacteria	1449
119	Ga0068862_100401299	3300005844	Bacteria	1282
120	Ga0081455_10025144	3300005937	Bacteria	5501
121	Ga0081455_10131918	3300005937	Bacteria	1953
122	Ga0081455_10261257	3300005937	Bacteria	1261
123	Ga0081540_1000745	3300005983	Bacteria	29937
124	Ga0081540_1002325	3300005983	Bacteria	15566
125	Ga0081540_1002857	3300005983	Bacteria	13983
126	Ga0081540_1003237	3300005983	Bacteria	12971
127	Ga0081540_1006752	3300005983	Bacteria	8298
128	Ga0081540_1009867	3300005983	Bacteria	6527
129	Ga0081540_1055603	3300005983	Bacteria	1927
130	Ga0081540_1090144	3300005983	Bacteria	1351
131	Ga0081539_10000584	3300005985	Bacteria	74942
132	Ga0070717_10038500	3300006028	Bacteria	3887
133	Ga0070717_10117806	3300006028	Bacteria	2272
134	Ga0070717_10151423	3300006028	Bacteria	2007
135	Ga0075365_10036170	3300006038	Bacteria	3199
136	Ga0075365_10043177	3300006038	Bacteria	2951
137	Ga0075365_10125635	3300006038	Bacteria	1772
138	Ga0075365_10285484	3300006038	Bacteria	1161
139	Ga0075368_10021300	3300006042	Bacteria	2462
140	Ga0075368_10069619	3300006042	Bacteria	1419
141	Ga0075363_100040609	3300006048	Bacteria	2453
142	Ga0075363_100047620	3300006048	Bacteria	2277
143	Ga0075363_100209734	3300006048	Bacteria	1115
144	Ga0075364_10018779	3300006051	Bacteria	4334
145	Ga0075364_10105718	3300006051	Bacteria	1875
146	Ga0070715_10002269	3300006163	Bacteria	5847
147	Ga0070715_10089635	3300006163	Bacteria	1412
148	Ga0070716_100028614	3300006173	Bacteria	3004
149	Ga0070716_100224614	3300006173	Bacteria	1264
150	Ga0070712_100016026	3300006175	Bacteria	4835
151	Ga0070712_100100360	3300006175	Bacteria	2139
152	Ga0070712_100106344	3300006175	Bacteria	2086
153	Ga0070712_100375634	3300006175	Bacteria	1169
154	Ga0075362_10064390	3300006177	Bacteria	1663
155	Ga0075362_10077593	3300006177	Bacteria	1527
156	Ga0075362_10218581	3300006177	Bacteria	931
157	Ga0075367_10169038	3300006178	Bacteria	1361
158	Ga0075367_10182214	3300006178	Bacteria	1310
159	Ga0075369_10056529	3300006186	Bacteria	1706
160	Ga0075369_10064912	3300006186	Bacteria	1599
161	Ga0075366_10055468	3300006195	Bacteria	2354
162	Ga0075366_10099277	3300006195	Bacteria	1747
163	Ga0097621_100698321	3300006237	Bacteria	934
164	Ga0075370_10005433	3300006353	Bacteria	6337
165	Ga0075370_10060041	3300006353	Bacteria	2165
166	Ga0075370_10129271	3300006353	Bacteria	1473
167	Ga0075428_100106685	3300006844	Bacteria	3053
168	Ga0075433_10551930	3300006852	Bacteria	1013
169	Ga0075434_100016550	3300006871	Bacteria	7090
170	Ga0075436_100020769	3300006914	Bacteria	4506
171	Ga0097620_100081959	3300006931	Bacteria	3268
172	Ga0099824_1023531	3300006942	Bacteria	3800
173	Ga0099794_10080876	3300007265	Bacteria	1603
174	Ga0099795_10135518	3300007788	Bacteria	997
175	Ga0105251_10001323	3300009011	Bacteria	21394
176	Ga0105250_10077566	3300009092	Bacteria	1345
177	Ga0105240_10001168	3300009093	Bacteria	46052
178	Ga0105240_10272929	3300009093	Bacteria	1946
179	Ga0105240_10670737	3300009093	Bacteria	1134
180	Ga0105245_10038469	3300009098	Bacteria	4256
181	Ga0105245_10129270	3300009098	Bacteria	2368
182	Ga0105245_10183500	3300009098	Bacteria	2000
183	Ga0105245_11004562	3300009098	Bacteria	879
184	Ga0105247_10061271	3300009101	Bacteria	2333
185	Ga0105243_10064232	3300009148	Bacteria	2945
186	Ga0105243_10199979	3300009148	Bacteria	1752
187	Ga0105243_10781439	3300009148	Bacteria	939
188	Ga0105241_10026859	3300009174	Bacteria	4284
189	Ga0105241_10068127	3300009174	Bacteria	2756
190	Ga0105241_10216988	3300009174	Bacteria	1606
191	Ga0105242_10132265	3300009176	Bacteria	2155
192	Ga0105248_10018519	3300009177	Bacteria	7697
193	Ga0105248_10203206	3300009177	Bacteria	2232
194	Ga0105248_10327964	3300009177	Bacteria	1724
195	Ga0105248_10529903	3300009177	Bacteria	1328
196	Ga0105237_10004255	3300009545	Bacteria	16659
197	Ga0105237_10050990	3300009545	Bacteria	4158
198	Ga0105237_10275276	3300009545	Bacteria	1686
199	Ga0105237_10426623	3300009545	Bacteria	1331
200	Ga0105237_10781999	3300009545	Bacteria	961
201	Ga0105237_10808185	3300009545	Bacteria	944
202	Ga0105237_10810394	3300009545	Bacteria	943
203	Ga0105238_10096211	3300009551	Bacteria	2947
204	Ga0105238_10114567	3300009551	Bacteria	2675
205	Ga0105238_10349801	3300009551	Bacteria	1467
206	Ga0105238_10396237	3300009551	Bacteria	1373
207	Ga0105238_10590458	3300009551	Bacteria	1118
208	Ga0105238_10904470	3300009551	Bacteria	901
209	Ga0105239_10059931	3300010375	Bacteria	4176
210	Ga0105239_10070577	3300010375	Bacteria	3838
211	Ga0105239_10462911	3300010375	Bacteria	1439
212	Ga0105239_10482831	3300010375	Bacteria	1408
213	Ga0105239_10739235	3300010375	Bacteria	1126
214	Ga0105239_10766785	3300010375	Bacteria	1104
215	Ga0105239_11366618	3300010375	Bacteria	817
216	Ga0105246_10159090	3300011119	Bacteria	1719
217	Ga0105246_10219925	3300011119	Bacteria	1488
218	Ga0105246_10221854	3300011119	Bacteria	1482
219	Ga0105246_10552948	3300011119	Bacteria	987
220	Ga0105246_10606450	3300011119	Bacteria	947
221	Ga0157370_10492151	3300013104	Bacteria	1126
222	Ga0157369_10017444	3300013105	Bacteria	8067
223	Ga0157369_10120158	3300013105	Bacteria	2788
224	Ga0157369_10183146	3300013105	Bacteria	2203
225	Ga0157369_10676771	3300013105	Bacteria	1063
226	Ga0157374_10003974	3300013296	Bacteria	12427
227	Ga0157374_10072526	3300013296	Bacteria	3249
228	Ga0157374_10347154	3300013296	Bacteria	1474
229	Ga0157378_10004175	3300013297	Bacteria	12756
230	Ga0163162_10240251	3300013306	Bacteria	1942
231	Ga0163162_10527057	3300013306	Bacteria	1310
232	Ga0163162_10562780	3300013306	Bacteria	1267
233	Ga0163162_10910490	3300013306	Bacteria	992
234	Ga0157372_10141195	3300013307	Bacteria	2775
235	Ga0157372_10683836	3300013307	Bacteria	1194
236	Ga0157375_10419400	3300013308	Bacteria	1504
237	Ga0157375_10686061	3300013308	Bacteria	1178
238	Ga0157375_10691111	3300013308	Bacteria	1174
239	Ga0157375_10721167	3300013308	Bacteria	1150
240	Ga0163163_10103309	3300014325	Bacteria	2874
241	Ga0163163_10109246	3300014325	Bacteria	2793
242	Ga0163163_10982975	3300014325	Bacteria	907
243	Ga0163163_11082294	3300014325	Bacteria	865
244	Ga0157380_10215349	3300014326	Bacteria	1715
245	Ga0157380_10534602	3300014326	Bacteria	1146
246	Ga0182008_10156895	3300014497	Bacteria	1143
247	Ga0157377_10318008	3300014745	Bacteria	1033
248	Ga0157379_10135335	3300014968	Bacteria	2220
249	Ga0157379_10296344	3300014968	Bacteria	1474
250	Ga0157376_10513197	3300014969	Bacteria	1180
251	Ga0157376_10718496	3300014969	Bacteria	1006
252	Ga0157376_11418559	3300014969	Bacteria	726
253	Ga0157376_11484887	3300014969	Bacteria	711
254	Ga0182006_1146240	3300015261	Bacteria	804
255	Ga0163161_10319761	3300017792	Bacteria	1227
256	Ga0163161_10545697	3300017792	Bacteria	949
257	Ga0163161_10688203	3300017792	Bacteria	850
258	Ga0163161_10833276	3300017792	Bacteria	777
259	Ga0214544_1000013	3300021320	Bacteria	228947
260	Ga0214542_1000013	3300021321	Bacteria	234019
261	Ga0214545_1000012	3300021324	Bacteria	187898
262	Ga0214543_1000065	3300021327	Bacteria	126516
263	Ga0213876_10105618	3300021384	Bacteria	1494
264	Ga0213871_10065200	3300021441	Bacteria	1020
265	Ga0224712_10072757	3300022467	Bacteria	1400
266	Ga0209435_116975	3300025206	Bacteria	743
267	Ga0209566_104145	3300025225	Bacteria	2039
268	Ga0209674_100011	3300025226	Bacteria	997175
269	Ga0209672_100002	3300025228	Bacteria	1733325
270	Ga0209147_100003	3300025229	Bacteria	1733325
271	Ga0209563_100965	3300025230	Bacteria	8423
272	Ga0207427_101839	3300025231	Bacteria	6750
273	Ga0209258_100042	3300025242	Bacteria	380729
274	Ga0209148_1000006	3300025254	Bacteria	1733325
275	Ga0209148_1000319	3300025254	Bacteria	67129
276	Ga0209759_1000051	3300025256	Bacteria	214016
277	Ga0209759_1031348	3300025256	Bacteria	1036
278	Ga0209233_1000033	3300025261	Bacteria	596094
279	Ga0209233_1006521	3300025261	Bacteria	3756
280	Ga0209455_1000003	3300025272	Bacteria	1471893
281	Ga0209455_1002843	3300025272	Bacteria	6426
282	Ga0209025_1000044	3300025294	Bacteria	349480
283	Ga0209564_1001778	3300025295	Bacteria	19990
284	Ga0209564_1006554	3300025295	Bacteria	6253
285	Ga0209564_1012977	3300025295	Bacteria	3580
286	Ga0209758_1000026	3300025297	Bacteria	582706
287	Ga0209758_1000087	3300025297	Bacteria	254384
288	Ga0209758_1000423	3300025297	Bacteria	71797
289	Ga0209758_1006245	3300025297	Bacteria	8679
290	Ga0209758_1006322	3300025297	Bacteria	8588
291	Ga0209758_1012369	3300025297	Bacteria	4786
292	Ga0209256_1008813	3300025299	Bacteria	4576
293	Ga0209256_1029968	3300025299	Bacteria	1507
294	Ga0207426_1000289	3300025302	Bacteria	99963
295	Ga0207426_1000312	3300025302	Bacteria	95006
296	Ga0207426_1002069	3300025302	Bacteria	13937
297	Ga0207426_1006079	3300025302	Bacteria	5326
298	Ga0207426_1025688	3300025302	Bacteria	1980
299	Ga0209051_1044077	3300025303	Bacteria	1558
300	Ga0209257_1002080	3300025304	Bacteria	21092
301	Ga0209257_1012695	3300025304	Bacteria	3854
302	Ga0207697_10094338	3300025315	Bacteria	1270
303	Ga0207656_10059094	3300025321	Bacteria	1677
304	Ga0207713_1005553	3300025735	Bacteria	7858
305	Ga0207692_10020400	3300025898	Bacteria	3014
306	Ga0207692_10030771	3300025898	Bacteria	2563
307	Ga0207710_10067565	3300025900	Bacteria	1633
308	Ga0207688_10061211	3300025901	Bacteria	2122
309	Ga0207647_10033116	3300025904	Bacteria	3312
310	Ga0207647_10073662	3300025904	Bacteria	2057
311	Ga0207647_10132493	3300025904	Bacteria	1464
312	Ga0207685_10001531	3300025905	Bacteria	4895
313	Ga0207699_10026505	3300025906	Bacteria	3196
314	Ga0207699_10097894	3300025906	Bacteria	1855
315	Ga0207699_10109034	3300025906	Bacteria	1771
316	Ga0207643_10062266	3300025908	Bacteria	2132
317	Ga0207705_10066127	3300025909	Bacteria	2614
318	Ga0207654_10022464	3300025911	Bacteria	3366
319	Ga0207654_10130542	3300025911	Bacteria	1590
320	Ga0207654_10185275	3300025911	Bacteria	1360
321	Ga0207654_10297775	3300025911	Bacteria	1096
322	Ga0207707_10000482	3300025912	Bacteria	41345
323	Ga0207707_10058173	3300025912	Bacteria	3364
324	Ga0207707_10146226	3300025912	Bacteria	2066
325	Ga0207695_10000240	3300025913	Bacteria	143196
326	Ga0207671_10006544	3300025914	Bacteria	10354
327	Ga0207671_10100694	3300025914	Bacteria	2188
328	Ga0207671_10128578	3300025914	Bacteria	1943
329	Ga0207671_10282938	3300025914	Bacteria	1308
330	Ga0207693_10004050	3300025915	Bacteria	12453
331	Ga0207693_10055021	3300025915	Bacteria	3122
332	Ga0207663_10006268	3300025916	Bacteria	6070
333	Ga0207663_10009026	3300025916	Bacteria	5250
334	Ga0207663_10211872	3300025916	Bacteria	1405
335	Ga0207660_10028710	3300025917	Bacteria	3807
336	Ga0207662_10201706	3300025918	Bacteria	1288
337	Ga0207657_10079418	3300025919	Bacteria	2760
338	Ga0207657_10110260	3300025919	Bacteria	2273
339	Ga0207649_10008832	3300025920	Bacteria	5502
340	Ga0207649_10089182	3300025920	Bacteria	2016
341	Ga0207652_10006164	3300025921	Bacteria	9693
342	Ga0207652_10119766	3300025921	Bacteria	2341
343	Ga0207681_10594713	3300025923	Bacteria	914
344	Ga0207694_10082673	3300025924	Bacteria	2524
345	Ga0207694_10177299	3300025924	Bacteria	1727
346	Ga0207694_10362371	3300025924	Bacteria	1202
347	Ga0207694_10803857	3300025924	Bacteria	794
348	Ga0207650_10347218	3300025925	Bacteria	1220
349	Ga0207687_10261764	3300025927	Bacteria	1379
350	Ga0207700_10008958	3300025928	Bacteria	6230
351	Ga0207700_10387991	3300025928	Bacteria	1222
352	Ga0207664_10030824	3300025929	Bacteria	4099
353	Ga0207664_10099623	3300025929	Bacteria	2399
354	Ga0207664_10286616	3300025929	Bacteria	1446
355	Ga0207644_10172036	3300025931	Bacteria	1692
356	Ga0207690_10651843	3300025932	Bacteria	863
357	Ga0207706_10026705	3300025933	Bacteria	5169
358	Ga0207706_10353299	3300025933	Bacteria	1278
359	Ga0207706_10523991	3300025933	Bacteria	1022
360	Ga0207686_10904210	3300025934	Bacteria	712
361	Ga0207670_10592385	3300025936	Bacteria	910
362	Ga0207669_10548787	3300025937	Bacteria	932
363	Ga0207665_10000243	3300025939	Bacteria	37399
364	Ga0207691_10276063	3300025940	Bacteria	1447
365	Ga0207691_10715266	3300025940	Bacteria	844
366	Ga0207711_10140991	3300025941	Bacteria	2169
367	Ga0207711_11116726	3300025941	Bacteria	729
368	Ga0207689_10010335	3300025942	Bacteria	8040
369	Ga0207689_10093341	3300025942	Bacteria	2472
370	Ga0207689_10127783	3300025942	Bacteria	2090
371	Ga0207689_10584166	3300025942	Bacteria	939
372	Ga0207661_10027534	3300025944	Bacteria	4342
373	Ga0207679_10241842	3300025945	Bacteria	1530
374	Ga0207679_10263500	3300025945	Bacteria	1471
375	Ga0207679_10346777	3300025945	Bacteria	1293
376	Ga0207679_10554227	3300025945	Bacteria	1032
377	Ga0207667_10082459	3300025949	Bacteria	3331
378	Ga0207667_10193142	3300025949	Bacteria	2089
379	Ga0207667_10592488	3300025949	Bacteria	1118
380	Ga0207667_10695532	3300025949	Bacteria	1019
381	Ga0207712_10288899	3300025961	Bacteria	1341
382	Ga0207668_10125756	3300025972	Bacteria	1949
383	Ga0207668_10196701	3300025972	Bacteria	1602
384	Ga0207668_10311809	3300025972	Bacteria	1302
385	Ga0207668_10611139	3300025972	Bacteria	950
386	Ga0207640_10622256	3300025981	Bacteria	916
387	Ga0207640_10768035	3300025981	Bacteria	832
388	Ga0207640_10926213	3300025981	Bacteria	763
389	Ga0207658_10253723	3300025986	Bacteria	1496
390	Ga0207639_10070198	3300026041	Bacteria	2736
391	Ga0207678_10043409	3300026067	Bacteria	3891
392	Ga0207678_10064120	3300026067	Bacteria	3157
393	Ga0207678_10077584	3300026067	Bacteria	2845
394	Ga0207678_10078534	3300026067	Bacteria	2827
395	Ga0207678_10089234	3300026067	Bacteria	2635
396	Ga0207708_10198036	3300026075	Bacteria	1602
397	Ga0207702_10000044	3300026078	Bacteria	149419
398	Ga0207702_10103875	3300026078	Bacteria	2514
399	Ga0207702_10305317	3300026078	Bacteria	1511
400	Ga0207702_10522637	3300026078	Bacteria	1159
401	Ga0207702_11248639	3300026078	Bacteria	737
402	Ga0207641_10799871	3300026088	Bacteria	933
403	Ga0207648_10166023	3300026089	Bacteria	1951
404	Ga0207648_10479467	3300026089	Bacteria	1136
405	Ga0207676_10125224	3300026095	Bacteria	2175
406	Ga0207676_10462894	3300026095	Bacteria	1198
407	Ga0207674_10051170	3300026116	Bacteria	4216
408	Ga0207674_10145625	3300026116	Bacteria	2327
409	Ga0207674_10256513	3300026116	Bacteria	1695
410	Ga0207675_100069573	3300026118	Bacteria	3290
411	Ga0207675_100401401	3300026118	Bacteria	1351
412	Ga0207683_10128920	3300026121	Bacteria	2274
413	Ga0207683_10449094	3300026121	Bacteria	1188
414	Ga0207683_10469534	3300026121	Bacteria	1161
415	Ga0207683_10649212	3300026121	Bacteria	977
416	Ga0207698_10015275	3300026142	Bacteria	5138
417	Ga0207698_10066119	3300026142	Bacteria	2844
418	Ga0207698_10259828	3300026142	Bacteria	1595
419	Ga0207698_10321850	3300026142	Bacteria	1448
420	Ga0209389_1000060	3300027296	Bacteria	106050
421	Ga0209589_1000062	3300027357	Bacteria	106048
422	Ga0209489_101714	3300027361	Bacteria	45077
423	Ga0207428_10297160	3300027907	Bacteria	1195
424	Ga0268266_10160886	3300028379	Bacteria	2031
425	Ga0268266_10367514	3300028379	Bacteria	1354
426	Ga0268266_10742184	3300028379	Bacteria	947
427	Ga0268266_10744814	3300028379	Bacteria	945
428	Ga0268266_10814588	3300028379	Bacteria	902
429	Ga0268265_10261884	3300028380	Bacteria	1538
430	Ga0268264_10000030	3300028381	Bacteria	418542
431	Ga0268264_10117999	3300028381	Bacteria	2334
432	Ga0307517_10000154	3300028786	Bacteria	109811
433	Ga0265339_10163285	3300031249	Bacteria	1119
434	Ga0265331_10014220	3300031250	Bacteria	4248
435	Ga0265327_10003859	3300031251	Bacteria	13822
436	Ga0307513_10459691	3300031456	Bacteria	996
437	Ga0307509_10459064	3300031507	Bacteria	966
438	Ga0307408_100392343	3300031548	Bacteria	1190
439	Ga0307408_100735636	3300031548	Bacteria	890
440	Ga0265313_10151124	3300031595	Bacteria	992
441	Ga0265314_10013948	3300031711	Bacteria	6463
442	Ga0265314_10015249	3300031711	Bacteria	6103
443	Ga0265314_10054533	3300031711	Bacteria	2767
444	Ga0307516_10284243	3300031730	Bacteria	1335
445	Ga0307405_10126311	3300031731	Bacteria	1759
446	Ga0307413_10207427	3300031824	Bacteria	1420
447	Ga0307413_10685679	3300031824	Bacteria	849
448	Ga0307410_10123614	3300031852	Bacteria	1891
449	Ga0307407_10588196	3300031903	Bacteria	827
450	Ga0307412_10000053	3300031911	Bacteria	148594
451	Ga0307409_100721543	3300031995	Bacteria	998
452	Ga0307409_100745733	3300031995	Bacteria	982
453	Ga0307409_100941583	3300031995	Bacteria	879
454	Ga0307416_100037773	3300032002	Bacteria	3720
455	Ga0307416_100425525	3300032002	Bacteria	1373
456	Ga0307416_100728564	3300032002	Bacteria	1083
457	Ga0307416_101519814	3300032002	Bacteria	775
458	Ga0307411_10026985	3300032005	Bacteria	3467
459	Ga0307415_100397504	3300032126	Bacteria	1175
460	Ga0307510_10011715	3300033180	Bacteria	10409
461	Ga0373938_0013708	3300034957	Bacteria	1543
462	Ga0373952_0007466	3300035092	Bacteria	2049
463	Ga0373936_0218462	3300035113	Bacteria	845
464	Ga0373936_0243557	3300035113	Bacteria	802
465	Ga0373943_0186701	3300035170	Bacteria	1142
466	Ga0373946_0023622	3300035171	Bacteria	2404
467	Ga0373946_0071472	3300035171	Bacteria	1500
468	Ga0373931_0000802	3300035691	Bacteria	13151
469	Ga0373927_0031848	3300035695	Bacteria	3435
470	Ga0373927_0066120	3300035695	Bacteria	2338
471	Ga0373933_0477024	3300035724	Bacteria	817
472	Ga0373947_0013012	3300035725	Bacteria	4771
473	Ga0373937_0032430	3300036401	Bacteria	4738
474	Ga0373937_0675393	3300036401	Bacteria	979
475	Ga0373925_0250493	3300037068	Bacteria	1420
476	Ga0395900_0112895	3300037418	Bacteria	2790
477	Ga0395900_0209469	3300037418	Bacteria	1969
478	Ga0395898_0067438	3300037466	Bacteria	3464
479	Ga0395898_0191090	3300037466	Bacteria	1956
480	Ga0395898_1037950	3300037466	Bacteria	755
481	Ga0395905_0026305	3300037471	Bacteria	5487
482	Ga0395905_0062251	3300037471	Bacteria	3490
483	Ga0395905_0413598	3300037471	Bacteria	1244
484	Ga0436364_0063134	3300037853	Bacteria	1797
485	Ga0436364_1041080	3300037853	Bacteria	9003
486	Ga0395901_0146697	3300038443	Bacteria	2480
487	Ga0395901_0560329	3300038443	Bacteria	1157
488	Ga0400490_21206	3300038726	Bacteria	65749
489	Ga0400491_11624	3300038727	Bacteria	1046
490	Ga0400485_11540	3300038735	Bacteria	9559
491	Ga0400483_027012	3300039062	Bacteria	48133
492	Ga0400483_245193	3300039062	Bacteria	1542
493	Ga0400483_291151	3300039062	Bacteria	24438
494	Ga0436365_1603903	3300039437	Bacteria	7399
495	Ga0436365_1612931	3300039437	Bacteria	772
496	Ga0436360_0711480	3300039438	Bacteria	2560
497	Ga0436360_1015624	3300039438	Bacteria	933
498	Ga0436361_0223647	3300039447	Bacteria	2365
499	Ga0436361_0829653	3300039447	Bacteria	974
500	Ga0436362_1255550	3300039453	Bacteria	1362
501	Ga0451789_0631980	3300041443	Bacteria	1021
502	Ga0451797_1074114	3300041453	Bacteria	1259
503	Ga0451833_0639124	3300041491	Bacteria	907
504	Ga0451847_0439122	3300041503	Bacteria	858
505	Ga0451577_0004487	3300042876	Bacteria	14722
506	Ga0451577_0004566	3300042876	Bacteria	14567
507	Ga0451577_0027000	3300042876	Bacteria	5197
508	Ga0466969_0098366	3300044656	Bacteria	1379
509	Ga0466972_0015190	3300044658	Bacteria	3849
510	Ga0466965_0040207	3300044683	Bacteria	2301
511	Ga0466965_0120290	3300044683	Bacteria	1356
512	Ga0466965_0207539	3300044683	Bacteria	1041
513	Ga0466966_0009260	3300044684	Bacteria	6518
514	Ga0466966_0057203	3300044684	Bacteria	2465
515	Ga0466966_0062856	3300044684	Bacteria	2340
516	Ga0466961_0000016	3300044693	Bacteria	111421
517	Ga0466961_0005273	3300044693	Bacteria	8135
518	Ga0466961_0358365	3300044693	Bacteria	887
519	Ga0466964_0051373	3300044706	Bacteria	1693
520	Ga0453684_0543688	3300044712	Bacteria	1280
521	Ga0466968_0046993	3300044735	Bacteria	1835
522	Ga0466968_0124406	3300044735	Bacteria	1169
523	Ga0466970_0007667	3300044765	Bacteria	5413
524	Ga0466970_0277206	3300044765	Bacteria	943
525	Ga0466970_0364920	3300044765	Bacteria	821
526	Ga0466959_0000469	3300045049	Bacteria	23529
527	Ga0466959_0001181	3300045049	Bacteria	15747
528	Ga0466959_0062332	3300045049	Bacteria	2710
529	Ga0466959_0097943	3300045049	Bacteria	2101
530	Ga0451576_0000571	3300045051	Bacteria	78657
531	Ga0466958_0182429	3300045836	Bacteria	1332
532	Ga0466967_0023131	3300045976	Bacteria	5088
533	Ga0466967_0168313	3300045976	Bacteria	2060
534	Ga0495592_0026558	3300046454	Bacteria	4389
535	Ga0495592_0148173	3300046454	Bacteria	1625
536	Ga0495603_0010879	3300046455	Bacteria	5521
537	Ga0495603_0012072	3300046455	Bacteria	5231
538	Ga0495590_0053102	3300046457	Bacteria	1415
539	Ga0495629_0001346	3300046459	Bacteria	19359
540	Ga0495629_0005377	3300046459	Bacteria	9556
541	Ga0495638_0005507	3300046460	Bacteria	9411
542	Ga0495641_0035979	3300046461	Bacteria	2330
543	Ga0495641_0045014	3300046461	Bacteria	2033
544	Ga0495641_0080626	3300046461	Bacteria	1458
545	Ga0495651_0117099	3300046462	Bacteria	1962
546	Ga0495653_0035739	3300046463	Bacteria	3918
547	Ga0495653_0079135	3300046463	Bacteria	2435
548	Ga0495653_0418539	3300046463	Bacteria	848
549	Ga0495650_0009610	3300046471	Bacteria	5484
550	Ga0495650_0050556	3300046471	Bacteria	1718
551	Ga0495580_0042165	3300046472	Bacteria	3252
552	Ga0495580_0179649	3300046472	Bacteria	1461
553	Ga0495582_0002141	3300046473	Bacteria	11038
554	Ga0495605_0021863	3300046474	Bacteria	3383
555	Ga0495605_0173281	3300046474	Bacteria	952
556	Ga0495639_0001260	3300046475	Bacteria	11412
557	Ga0495639_0036571	3300046475	Bacteria	2200
558	Ga0495662_0004116	3300046476	Bacteria	7327
559	Ga0495664_0002054	3300046477	Bacteria	10773
560	Ga0495664_0003082	3300046477	Bacteria	9034
561	Ga0495664_0025540	3300046477	Bacteria	3439
562	Ga0495584_0249253	3300046491	Bacteria	903
563	Ga0495585_0083364	3300046492	Bacteria	1730
564	Ga0495594_0018538	3300046499	Bacteria	3688
565	Ga0495594_0167262	3300046499	Bacteria	1251
566	Ga0495594_0256921	3300046499	Bacteria	995
567	Ga0495596_0010217	3300046500	Bacteria	4095
568	Ga0495596_0081280	3300046500	Bacteria	1258
569	Ga0495596_0125254	3300046500	Bacteria	997
570	Ga0495583_0138610	3300046506	Bacteria	1014
571	Ga0495606_0017605	3300046507	Bacteria	5394
572	Ga0495606_0018755	3300046507	Bacteria	5175
573	Ga0495606_0019779	3300046507	Bacteria	4990
574	Ga0495606_0088885	3300046507	Bacteria	1904
575	Ga0495606_0109184	3300046507	Bacteria	1671
576	Ga0495606_0121991	3300046507	Bacteria	1559
577	Ga0495608_0050079	3300046511	Bacteria	2771
578	Ga0495608_0068938	3300046511	Bacteria	2312
579	Ga0495608_0296806	3300046511	Bacteria	1001
580	Ga0495610_0000596	3300046512	Bacteria	35779
581	Ga0495616_0103288	3300046513	Bacteria	1334
582	Ga0495618_0049365	3300046514	Bacteria	2657
583	Ga0495620_0017082	3300046515	Bacteria	3626
584	Ga0495620_0037965	3300046515	Bacteria	2141
585	Ga0495620_0070925	3300046515	Bacteria	1426
586	Ga0495628_0032970	3300046516	Bacteria	4177
587	Ga0495628_0054028	3300046516	Bacteria	3167
588	Ga0495630_0024007	3300046517	Bacteria	4508
589	Ga0495630_0050046	3300046517	Bacteria	3126
590	Ga0495630_0068908	3300046517	Bacteria	2661
591	Ga0495632_0073988	3300046519	Bacteria	1633
592	Ga0495632_0295969	3300046519	Bacteria	718
593	Ga0495643_0008106	3300046522	Bacteria	6693
594	Ga0495648_0092549	3300046524	Bacteria	1688
595	Ga0495666_0004293	3300046526	Bacteria	7192
596	Ga0495666_0037213	3300046526	Bacteria	2368
597	Ga0495666_0085603	3300046526	Bacteria	1489
598	Ga0495642_0003951	3300046528	Bacteria	5801
599	Ga0495652_0005430	3300046529	Bacteria	12010
600	Ga0495652_0009198	3300046529	Bacteria	8984
601	Ga0495652_0019258	3300046529	Bacteria	6079
602	Ga0495665_0000209	3300046531	Bacteria	29916
603	Ga0495665_0001580	3300046531	Bacteria	12182
604	Ga0495665_0012709	3300046531	Bacteria	4555
605	Ga0495665_0213680	3300046531	Bacteria	998
606	Ga0495640_0020780	3300046533	Bacteria	4827
607	Ga0495640_0148818	3300046533	Bacteria	1505
608	Ga0495586_0055961	3300046535	Bacteria	2138
609	Ga0495598_0022826	3300046537	Bacteria	1678
610	Ga0495598_0071323	3300046537	Bacteria	1095
611	Ga0495609_0053130	3300046538	Bacteria	1802
612	Ga0495609_0139464	3300046538	Bacteria	1035
613	Ga0495597_0007581	3300046542	Bacteria	5498
614	Ga0495597_0030323	3300046542	Bacteria	2465
615	Ga0495597_0189775	3300046542	Bacteria	827
616	Ga0495645_0004890	3300046543	Bacteria	9164
617	Ga0495645_0036901	3300046543	Bacteria	3562
618	Ga0495645_0069988	3300046543	Bacteria	2532
619	Ga0495622_0230563	3300046557	Bacteria	818
620	Ga0495667_0017415	3300046559	Bacteria	4852
621	Ga0495667_0024866	3300046559	Bacteria	4034
622	Ga0495667_0418944	3300046559	Bacteria	843
623	Ga0495656_0167012	3300046615	Bacteria	1073
624	Ga0495668_0042027	3300046616	Bacteria	2545
625	Ga0495668_0050681	3300046616	Bacteria	2300
626	Ga0495634_0007269	3300046642	Bacteria	8346
627	Ga0495634_0056170	3300046642	Bacteria	2631
628	Ga0495634_0080739	3300046642	Bacteria	2128
629	Ga0495611_0290096	3300046648	Bacteria	755
630	Ga0495625_0393177	3300046660	Bacteria	868
631	Ga0495635_0002096	3300046663	Bacteria	13545
632	Ga0495635_0168795	3300046663	Bacteria	1488
633	Ga0495635_0194397	3300046663	Bacteria	1377
634	Ga0495635_0449086	3300046663	Bacteria	852
635	Ga0495661_0226844	3300046665	Bacteria	965
636	Ga0495657_0000725	3300046675	Bacteria	29627
637	Ga0495657_0014432	3300046675	Bacteria	5800
638	Ga0495657_0209419	3300046675	Bacteria	1185
639	Ga0495599_0004941	3300046678	Bacteria	7927
640	Ga0495599_0089515	3300046678	Bacteria	1921
641	Ga0495623_0006579	3300046679	Bacteria	7562
642	Ga0495623_0016698	3300046679	Bacteria	4742
643	Ga0495623_0219299	3300046679	Bacteria	1085
644	Ga0495646_0000609	3300046680	Bacteria	19488
645	Ga0495646_0026240	3300046680	Bacteria	3659
646	Ga0495646_0153675	3300046680	Bacteria	1278
647	Ga0495646_0188703	3300046680	Bacteria	1128
648	Ga0495646_0290845	3300046680	Bacteria	866
649	Ga0495647_0041296	3300046681	Bacteria	1756
650	Ga0495669_0159524	3300046684	Bacteria	1070
651	Ga0495613_0036068	3300046689	Bacteria	3667
652	Ga0495624_0001367	3300046690	Bacteria	19018
653	Ga0495624_0043848	3300046690	Bacteria	2852
654	Ga0495624_0070116	3300046690	Bacteria	2182
655	Ga0495624_0197931	3300046690	Bacteria	1221
656	Ga0495589_0085471	3300046794	Bacteria	1533
657	Ga0495600_0002199	3300046809	Bacteria	11091
658	Ga0495600_0010397	3300046809	Bacteria	5778
659	Ga0495600_0066146	3300046809	Bacteria	2363
660	Ga0495581_0002935	3300047315	Bacteria	9754
661	Ga0495581_0004952	3300047315	Bacteria	7707
662	Ga0495604_0000420	3300047317	Bacteria	38211
663	Ga0495604_0010762	3300047317	Bacteria	7263
664	Ga0495604_0107551	3300047317	Bacteria	2038
665	Ga0495604_0472994	3300047317	Bacteria	816
666	Ga0495604_0478154	3300047317	Bacteria	811
667	Ga0495604_0532716	3300047317	Bacteria	759
668	Ga0495604_0558048	3300047317	Bacteria	738
669	Ga0495674_0002922	3300047319	Bacteria	16628
670	Ga0495674_0007124	3300047319	Bacteria	10700
671	Ga0495672_0176363	3300047320	Bacteria	1086
672	Ga0495676_0030538	3300047321	Bacteria	4570
673	Ga0495676_0207412	3300047321	Bacteria	1358
674	Ga0495676_0237532	3300047321	Bacteria	1249
675	Ga0495680_0002126	3300047322	Bacteria	20566
676	Ga0495680_0005524	3300047322	Bacteria	11871
677	Ga0495683_0002359	3300047323	Bacteria	11460
678	Ga0495683_0031138	3300047323	Bacteria	2718
679	Ga0495683_0052460	3300047323	Bacteria	2036
680	Ga0495683_0079916	3300047323	Bacteria	1596
681	Ga0495683_0090170	3300047323	Bacteria	1486
682	Ga0495687_000005	3300047443	Bacteria	610401
683	Ga0495687_009562	3300047443	Bacteria	5406
684	Ga0495675_0014725	3300047444	Bacteria	4943
685	Ga0495675_0018670	3300047444	Bacteria	4404
686	Ga0495675_0035058	3300047444	Bacteria	3205
687	Ga0495675_0050944	3300047444	Bacteria	2631
688	Ga0495677_0025426	3300047445	Bacteria	2148
689	Ga0495684_0040851	3300047471	Bacteria	3555
690	Ga0495684_0176624	3300047471	Bacteria	1585
691	Ga0495686_0000099	3300047472	Bacteria	180546
692	Ga0495686_0187396	3300047472	Bacteria	1195
693	Ga0495686_0220010	3300047472	Bacteria	1081
694	Ga0495686_0256407	3300047472	Bacteria	981
695	Ga0495593_0001260	3300047673	Bacteria	14857
696	Ga0495593_0043975	3300047673	Bacteria	2391
697	Ga0495593_0154344	3300047673	Bacteria	1160
698	Ga0495602_0000430	3300048088	Bacteria	39410
699	Ga0495602_0065883	3300048088	Bacteria	3123
700	Ga0495602_0071267	3300048088	Bacteria	2968
701	Ga0495614_0019776	3300048089	Bacteria	2913
702	Ga0496100_0019679	3300048903	Bacteria	4032
703	Ga0496101_0008658	3300048904	Bacteria	6652
704	Ga0496101_0086816	3300048904	Bacteria	2321
705	Ga0496101_0454505	3300048904	Bacteria	1011
706	Ga0496101_0508231	3300048904	Bacteria	952
707	Ga0496102_0021798	3300048905	Bacteria	5669
708	Ga0496102_0038630	3300048905	Bacteria	4309
709	Ga0496102_0141405	3300048905	Bacteria	2257
710	Ga0496102_0231532	3300048905	Bacteria	1742
711	Ga0496102_0301809	3300048905	Bacteria	1509
712	Ga0496102_0727969	3300048905	Bacteria	915
713	Ga0496102_0852593	3300048905	Bacteria	833
714	Ga0496103_0012189	3300048906	Bacteria	5106
715	Ga0496103_0012840	3300048906	Bacteria	4968
716	Ga0496103_0107018	3300048906	Bacteria	1774
717	Ga0496104_0052951	3300048907	Bacteria	3834
718	Ga0496104_0053250	3300048907	Bacteria	3823
719	Ga0496104_0092903	3300048907	Bacteria	2885
720	Ga0496104_0557643	3300048907	Bacteria	1056
721	Ga0496104_0648895	3300048907	Bacteria	964
722	Ga0496104_0840776	3300048907	Bacteria	823
723	Ga0496105_0153053	3300048908	Bacteria	1895
724	Ga0496105_0241929	3300048908	Bacteria	1464
725	Ga0496105_0281701	3300048908	Bacteria	1340
726	Ga0496106_0000044	3300048909	Bacteria	104333
727	Ga0496106_0026977	3300048909	Bacteria	4277
728	Ga0496106_0042487	3300048909	Bacteria	3409
729	Ga0496106_0046187	3300048909	Bacteria	3273
730	Ga0496106_0187174	3300048909	Bacteria	1645
731	Ga0496106_0437594	3300048909	Bacteria	1051
732	Ga0496106_0478359	3300048909	Bacteria	1001
733	Ga0496106_0589691	3300048909	Bacteria	891
734	Ga0496106_0692727	3300048909	Bacteria	812
735	Ga0496107_0031616	3300048910	Bacteria	3779
736	Ga0496107_0283347	3300048910	Bacteria	1233
737	Ga0496107_0401962	3300048910	Bacteria	1019
738	Ga0496107_0579205	3300048910	Bacteria	830
739	Ga0496108_0016960	3300048911	Bacteria	5952
740	Ga0496108_0103141	3300048911	Bacteria	2434
741	Ga0496108_0591062	3300048911	Bacteria	967
742	Ga0496109_0021088	3300048912	Bacteria	5761
743	Ga0496109_0076181	3300048912	Bacteria	3085
744	Ga0496109_0104558	3300048912	Bacteria	2629
745	Ga0496109_0398205	3300048912	Bacteria	1301
746	Ga0496110_0031565	3300048913	Bacteria	4571
747	Ga0496110_0035302	3300048913	Bacteria	4337
748	Ga0496110_0065792	3300048913	Bacteria	3205
749	Ga0496110_0077889	3300048913	Bacteria	2950
750	Ga0496110_0154157	3300048913	Bacteria	2081
751	Ga0496110_0312164	3300048913	Bacteria	1432
752	Ga0496111_0044352	3300048914	Bacteria	3197
753	Ga0496111_0108244	3300048914	Bacteria	2047
754	Ga0496111_0164141	3300048914	Bacteria	1650
755	Ga0496112_0008879	3300048915	Bacteria	9020
756	Ga0496112_0016878	3300048915	Bacteria	6850
757	Ga0496112_0053167	3300048915	Bacteria	3977
758	Ga0496112_0082170	3300048915	Bacteria	3186
759	Ga0496112_0094222	3300048915	Bacteria	2965
760	Ga0496112_0145168	3300048915	Bacteria	2341
761	Ga0496112_0159446	3300048915	Bacteria	2222
762	Ga0496112_0760974	3300048915	Bacteria	894
763	Ga0496113_0006503	3300048916	Bacteria	7416
764	Ga0496113_0016873	3300048916	Bacteria	5054
765	Ga0496113_0199078	3300048916	Bacteria	1592
766	Ga0496113_0206095	3300048916	Bacteria	1564
767	Ga0496114_0024002	3300048917	Bacteria	4976
768	Ga0496114_0374794	3300048917	Bacteria	1260
769	Ga0496114_0568738	3300048917	Bacteria	1001
770	Ga0496115_0040396	3300048918	Bacteria	3709
771	Ga0496115_0114762	3300048918	Bacteria	2214
772	Ga0496115_0164941	3300048918	Bacteria	1832
773	Ga0496115_0276194	3300048918	Bacteria	1380
774	Ga0496115_0284956	3300048918	Bacteria	1356
775	Ga0496115_0451316	3300048918	Bacteria	1038
776	Ga0496115_0466192	3300048918	Bacteria	1019
777	Ga0496116_0012016	3300048919	Bacteria	7106
778	Ga0496116_0084548	3300048919	Bacteria	1954
779	Ga0496117_0006550	3300048920	Bacteria	11723
780	Ga0496117_0007383	3300048920	Bacteria	10758
781	Ga0496117_0032310	3300048920	Bacteria	3978
782	Ga0496118_0004083	3300048921	Bacteria	17705
783	Ga0496118_0008433	3300048921	Bacteria	10656
784	Ga0496118_0016265	3300048921	Bacteria	6833
785	Ga0496118_0027678	3300048921	Bacteria	4790
786	Ga0496118_0029177	3300048921	Bacteria	4632
787	Ga0496118_0101341	3300048921	Bacteria	1945
788	Ga0496119_0283054	3300048922	Bacteria	824
789	Ga0496120_0117845	3300048923	Bacteria	1377
790	Ga0496121_0000409	3300048924	Bacteria	85313
791	Ga0496121_0002124	3300048924	Bacteria	31150
792	Ga0496121_0022718	3300048924	Bacteria	6070
793	Ga0496121_0041564	3300048924	Bacteria	4016
794	Ga0496121_0126440	3300048924	Bacteria	1920
795	Ga0496121_0310796	3300048924	Bacteria	1065
796	Ga0496122_0026812	3300048925	Bacteria	4951
797	Ga0496123_0009267	3300048926	Bacteria	8890
798	Ga0496124_0002033	3300048927	Bacteria	27478
799	Ga0496124_0019124	3300048927	Bacteria	6391
800	Ga0496124_0025817	3300048927	Bacteria	5311
801	Ga0496124_0027336	3300048927	Bacteria	5122
802	Ga0496124_0054727	3300048927	Bacteria	3376
803	Ga0496124_0072066	3300048927	Bacteria	2862
804	Ga0496124_0184430	3300048927	Bacteria	1603
805	Ga0496125_0041358	3300048928	Bacteria	3941
806	Ga0496125_0069832	3300048928	Bacteria	2753
807	Ga0496125_0125852	3300048928	Bacteria	1816
808	Ga0496125_0180241	3300048928	Bacteria	1409
809	Ga0496125_0206446	3300048928	Bacteria	1280
810	Ga0496125_0252190	3300048928	Bacteria	1112
811	Ga0496125_0356057	3300048928	Bacteria	872
812	Ga0496126_0000064	3300048929	Bacteria	255729
813	Ga0496126_0000176	3300048929	Bacteria	145407
814	Ga0496126_0000657	3300048929	Bacteria	64181
815	Ga0496126_0003839	3300048929	Bacteria	18597
816	Ga0496126_0009046	3300048929	Bacteria	10651
817	Ga0496126_0036458	3300048929	Bacteria	4598
818	Ga0496126_0037981	3300048929	Bacteria	4483
819	Ga0496126_0089112	3300048929	Bacteria	2716
820	Ga0496126_0106018	3300048929	Bacteria	2453
821	Ga0496126_0117421	3300048929	Bacteria	2311
822	Ga0496126_0143391	3300048929	Bacteria	2054
823	Ga0496126_0162181	3300048929	Bacteria	1909
824	Ga0496126_0547195	3300048929	Bacteria	919
825	Ga0495678_136640	3300049459	Bacteria	807
826	Ga0501031_0216491	3300049568	Bacteria	1248
827	Ga0501034_0339470	3300049571	Bacteria	1432
828	Ga0501036_0163941	3300049572	Bacteria	1874
829	Ga0501036_0182081	3300049572	Bacteria	1769
830	Ga0501038_0472417	3300049574	Bacteria	962
831	Ga0501039_0047909	3300049575	Bacteria	3304
832	Ga0501041_0055408	3300049577	Bacteria	2420
833	Ga0501042_0281398	3300049578	Bacteria	1201
834	Ga0501047_0011995	3300049581	Bacteria	8200
835	Ga0501047_0521250	3300049581	Bacteria	1014
836	Ga0501069_0157670	3300049585	Bacteria	1306
837	Ga0501070_0000467	3300049586	Bacteria	36791
838	Ga0501070_0016712	3300049586	Bacteria	6162
839	Ga0501070_0054961	3300049586	Bacteria	3301
840	Ga0501072_0375561	3300049588	Bacteria	1128
841	Ga0501073_0026596	3300049589	Bacteria	4144
842	Ga0501073_0210607	3300049589	Bacteria	1343
843	Ga0501074_0036857	3300049590	Bacteria	3543
844	Ga0501075_0429298	3300049591	Bacteria	1008
845	Ga0501075_0514484	3300049591	Bacteria	913
846	Ga0501079_0231813	3300049741	Bacteria	1442
847	Ga0501080_0001900	3300049742	Bacteria	17991
848	Ga0501080_0018939	3300049742	Bacteria	6376
849	Ga0501081_0320655	3300049743	Bacteria	1139
850	Ga0501081_0660442	3300049743	Bacteria	784
851	Ga0501035_0000461	3300049822	Bacteria	45620
852	Ga0501035_0110612	3300049822	Bacteria	2408
853	Ga0501044_0070254	3300049823	Bacteria	3562
854	Ga0501045_0024382	3300049824	Bacteria	4343
855	nmdc:mga03683_146615_c1	3300050489	Bacteria	1063
856	nmdc:mga03683_99472_c1	3300050489	Bacteria	1277
857	nmdc:mga03n38_101376_c1	3300050490	Bacteria	1389
858	nmdc:mga03n38_99034_c1	3300050490	Bacteria	1403
859	nmdc:mga00v17_172991_c1	3300050491	Bacteria	1393
860	nmdc:mga00v17_238739_c1	3300050491	Bacteria	1178
861	nmdc:mga00v17_268293_c1	3300050491	Bacteria	1108
862	nmdc:mga0yw44_114878_c1	3300050492	Bacteria	1728
863	nmdc:mga0yw44_117249_c1	3300050492	Bacteria	1712
864	nmdc:mga0yw44_29914_c1	3300050492	Bacteria	3150
865	nmdc:mga0yw44_32732_c1	3300050492	Bacteria	1668
866	nmdc:mga0yw44_426508_c1	3300050492	Bacteria	898
867	nmdc:mga0yw44_71877_c1	3300050492	Bacteria	2149
868	nmdc:mga0k408_135121_c1	3300050493	Bacteria	1465
869	nmdc:mga0k408_25685_c1	3300050493	Bacteria	3337
870	nmdc:mga0k408_5535_c1	3300050493	Bacteria	5781
871	nmdc:mga06z11_153628_c1	3300050494	Bacteria	1310
872	nmdc:mga06z11_66673_c1	3300050494	Bacteria	1893
873	nmdc:mga06z11_81591_c1	3300050494	Bacteria	1736
874	nmdc:mga04h51_21123_c1	3300050495	Bacteria	1955
875	nmdc:mga07m45_154268_c1	3300050496	Bacteria	1332
876	nmdc:mga07m45_42073_c1	3300050496	Bacteria	2560
877	nmdc:mga05p37_185808_c1	3300050507	Bacteria	2527
878	nmdc:mga08y16_479086_c1	3300050511	Bacteria	1266
879	nmdc:mga08y16_800924_c1	3300050511	Bacteria	935
880	nmdc:mga0n895_25507_c1	3300050512	Bacteria	5586
881	nmdc:mga08x19_160659_c1	3300050514	Bacteria	1526
882	nmdc:mga0sz30_56003_c1	3300050516	Bacteria	1679
883	Ga0500635_0009867	3300053080	Bacteria	2664
884	Ga0500635_0094195	3300053080	Bacteria	1094
885	Ga0495595_0102528	3300053084	Bacteria	1382
886	Ga0500578_0099795	3300053086	Bacteria	1838
887	Ga0500643_001963	3300053087	Bacteria	11143
888	Ga0500643_066958	3300053087	Bacteria	1000
889	Ga0500644_0050353	3300053088	Bacteria	1426
890	Ga0500647_0042230	3300053091	Bacteria	2189
891	Ga0500583_0005780	3300053092	Bacteria	4184
892	Ga0500566_0000446	3300053094	Bacteria	23002
893	Ga0500566_0079335	3300053094	Bacteria	1830
894	Ga0500640_084122	3300053095	Bacteria	1344
895	Ga0500641_0003174	3300053096	Bacteria	5816
896	Ga0500641_0008924	3300053096	Bacteria	3593
897	Ga0500641_0015984	3300053096	Bacteria	2791
898	Ga0500641_0040404	3300053096	Bacteria	1884
899	Ga0500555_001249	3300053103	Bacteria	8170
900	Ga0500557_000014	3300053105	Bacteria	107928
901	Ga0500562_004270	3300053108	Bacteria	3616
902	Ga0500562_034346	3300053108	Bacteria	1341
903	Ga0500572_011372	3300053111	Bacteria	2152
904	Ga0500572_085926	3300053111	Bacteria	991
905	Ga0500595_005974	3300053119	Bacteria	5240
906	Ga0500595_038943	3300053119	Bacteria	1541
907	Ga0500621_038368	3300053126	Bacteria	1928
908	Ga0500626_148067	3300053128	Bacteria	978
909	Ga0500642_0000070	3300053130	Bacteria	55760
910	Ga0500652_028437	3300053131	Bacteria	2172
911	Ga0500655_012083	3300053133	Bacteria	1568
912	Ga0500658_0099855	3300053134	Bacteria	1265
913	Ga0500564_199940	3300053138	Bacteria	821
914	Ga0500568_0005033	3300053139	Bacteria	6923
915	Ga0500568_0088724	3300053139	Bacteria	1168
916	Ga0500577_0028493	3300053142	Bacteria	1925
917	Ga0500577_0045424	3300053142	Bacteria	1623
918	Ga0500589_028841	3300053147	Bacteria	2579
919	Ga0500589_100341	3300053147	Bacteria	1258
920	Ga0500590_126002	3300053148	Bacteria	1192
921	Ga0500603_000992	3300053150	Bacteria	6691
922	Ga0500604_0009173	3300053151	Bacteria	2634
923	Ga0500604_0177858	3300053151	Bacteria	729
924	Ga0500616_0102470	3300053153	Bacteria	1396
925	Ga0500620_011905	3300053155	Bacteria	2349
926	Ga0500622_0011385	3300053156	Bacteria	4846
927	Ga0500627_0010349	3300053158	Bacteria	3398
928	Ga0500634_0131083	3300053161	Bacteria	1203
929	Ga0500638_000630	3300053162	Bacteria	9119
930	Ga0500638_080483	3300053162	Bacteria	1547
931	Ga0500636_0000147	3300053177	Bacteria	36797
932	Ga0500637_0000746	3300053178	Bacteria	13012
933	Ga0500637_0009134	3300053178	Bacteria	5032
934	Ga0500637_0030650	3300053178	Bacteria	2995
935	Ga0500611_026226	3300053727	Bacteria	1163
936	Ga0500625_006079	3300053729	Bacteria	5114
937	Ga0500645_008266	3300053730	Bacteria	3563
938	Ga0500645_022687	3300053730	Bacteria	1929
939	Ga0500609_013784	3300053731	Bacteria	1094
940	Ga0500601_000655	3300053737	Bacteria	4745
941	Ga0501084_0311676	3300054114	Unclassified	1329
942	Ga0500661_000566	3300055283	Bacteria	6879
943	2501080422	2501025502	Bacteria	9641094
944	2507510691	2507262055	Bacteria	8048963
945	2508544494	2508501009	Bacteria	7784016
946	2508697361	2508501042	Bacteria	8719808
947	2509127845	2508501125	Bacteria	7208311
948	2509139424	2508501127	Bacteria	7037543
949	2509148295	2508501128	Bacteria	8613869
950	2511088255	2510917013	Bacteria	9951648
951	2511398656	2511231028	Bacteria	8046582
952	2513625987	2513237092	Bacteria	8341956
953	2513643132	2513237094	Bacteria	8789602
954	2513650659	2513237095	Bacteria	8976980
955	2513674757	2513237098	Bacteria	9902361
956	2513693589	2513237101	Bacteria	7952346
957	2513704583	2513237102	Bacteria	7703324
958	2513877842	2513237139	Bacteria	8737671
959	2514016215	2513237161	Bacteria	8871253
960	2515627944	2515154112	Bacteria	8294334
961	2517108749	2517093001	Bacteria	9002274
962	2524437081	2524023205	Bacteria	8918781
963	2524469047	2524023210	Bacteria	9029266
964	2528857512	2528768022	Bacteria	10457665
965	2599103585	2597490356	Bacteria	7030811
966	2600812841	2600255067	Bacteria	6795583
967	2617353807	2617270735	Bacteria	9163226
968	2617378788	2617270741	Bacteria	8201522
969	2723847471	2721755755	Bacteria	8322773
970	2738822747	2738541296	Bacteria	7285013
971	2738834954	2738541298	Bacteria	7286732
972	2738876433	2738541306	Bacteria	7284992
973	2739188377	2738543002	Bacteria	7284546
974	2739223030	2738543008	Bacteria	7282815
975	2753569155	2751185846	Bacteria	7242164
976	2758638443	2758568016	Bacteria	5645291
977	2793063441	2791355196	Bacteria	7323613
978	2793081501
979	2805917029	2802429603	Bacteria	8777136
980	2818242572	2816332527	Bacteria	8933356
981	2824601937	2824600985	Bacteria	8488197
982	2824615828	2824609381	Bacteria	8672835
983	2824620875	2824617872	Bacteria	8814715
984	2824628263	2824626560	Bacteria	8813858
985	2824636188	2824635225	Bacteria	8785348
986	2824652612	2824644064	Bacteria	8743947
987	2824653168	2824653114	Bacteria	8493680
988	2824662522	2824661429	Bacteria	9877870
989	2824673459	2824671348	Bacteria	8369588
990	2824681196	2824679649	Bacteria	8248951
991	2824689499	2824687955	Bacteria	8360029
992	2824697370	2824696289	Bacteria	8335049
993	2824709638	2824704595	Bacteria	9667483
994	2824719171	2824714736	Bacteria	8717648
995	2824729620	2824723954	Bacteria	8758240
996	2824739065	2824732956	Bacteria	7810675
997	2824747762	2824746037	Bacteria	7911610
998	2824756289	2824753945	Bacteria	9787441
999	2824763973	2824763712	Bacteria	9792355
1000	2824776055	2824773399	Bacteria	8360218
1001	2829746206	2829745981	Bacteria	5406054
1002	2834581555	2834578030	Bacteria	3530182
1003	2837654118	2837651117	Bacteria	3772164
1004	2838125304	2838122688	Bacteria	8803140
1005	2841948557	2841941048	Bacteria	8688029
1006	2841951455	2841949485	Bacteria	8680857
1007	2841960553	2841957949	Bacteria	8652217
1008	2841968529	2841966195	Bacteria	8673214
1009	2841976270	2841974524	Bacteria	8931498
1010	2841987634	2841983080	Bacteria	8395090
1011	2842043187	2842038055	Bacteria	8002051
1012	2842051228	2842045827	Bacteria	8006841
1013	2844317223	2844315083	Bacteria	8138177
1014	2846953473	2846952575	Bacteria	6587527
1015	2847944597	2847939898	Bacteria	8606328
1016	2848860370	2848858292	Bacteria	7391279
1017	2849081167	2849076700	Bacteria	7039503
1018	2854682921	2854681122	Bacteria	4548679
1019	2854684096	2854681122	Bacteria	4548679
1020	2857516050	2857509624	Bacteria	7472071
1021	2861692838	2861691609	Bacteria	5628931
1022	2869164900	2869162929	Bacteria	6399702
1023	2874592352	2874590934	Bacteria	8299676
1024	2874611451	2874604998	Bacteria	7834745
1025	2874625293	2874620515	Bacteria	8290088
1026	2874634636	2874628541	Bacteria	8630250
1027	2874650041	2874645413	Bacteria	8214782
1028	2876763264	2876761206	Bacteria	10111113
1029	2876775430	2876771140	Bacteria	8287509
1030	2876817091	2876808645	Bacteria	8824342
1031	2876826217	2876818435	Bacteria	8274608
1032	2879079482	2879074833	Bacteria	8279565
1033	2879109668	2879099564	Bacteria	10442239
1034	2879117525	2879110137	Bacteria	8907982
1035	2879132271	2879127579	Bacteria	8294491
1036	2879146920	2879142872	Bacteria	8267021
1037	2881365086	2881364244	Bacteria	7710352
1038	2881668469	2881665667	Bacteria	8175609
1039	2883092194	2883087390	Bacteria	9532701
1040	2885276446	2885270888	Bacteria	9831543
1041	2885383993	2885383462	Bacteria	9473874
1042	2885417584	2885409591	Bacteria	9235467
1043	2888381911	2888378607	Bacteria	9652610
1044	2888388731	2888388044	Bacteria	7304136
1045	2888422542	2888419890	Bacteria	7857137
1046	2889042190	2889033259	Bacteria	9099371
1047	2903735207	2903727486	Bacteria	8281579
1048	2903769262	2903768456	Bacteria	9749579
1049	2904486041	2904483920	Bacteria	7545285
1050	2904668847	2904666416	Bacteria	8226587
1051	2904720443	2904711408	Bacteria	9771557
1052	2906607614	2906602504	Bacteria	8295279
1053	2906630485	2906626472	Bacteria	8826946
1054	2908778166	2908775508	Bacteria	8092255
1055	2919527386	2919527303	Bacteria	7718827
1056	2922362938	2922361189	Bacteria	7436256
1057	2922371859
1058	2922390579	2922386360	Bacteria	7017218
1059	2922399419	2922393267	Bacteria	8285685
1060	2929616791	2929615660	Bacteria	9193770
1061	2929625534	2929624759	Bacteria	9339455
1062	2932791186	2932784394	Bacteria	9704911
1063	2932799234	2932794094	Bacteria	7915132
1064	2932803771	2932801729	Bacteria	7987968
1065	2932811631	2932809354	Bacteria	9135765
1066	2932826452	2932818245	Bacteria	9955613
1067	2932834201	2932828146	Bacteria	9745859
1068	2933577927	2933577622	Bacteria	9116884
1069	2935616129	2935608549	Bacteria	8203142
1070	2935623976	2935616580	Bacteria	9032984
1071	2935647022	2935638405	Bacteria	10015038
1072	2935656388	2935648319	Bacteria	8801166
1073	2935665208	2935656913	Bacteria	8965014
1074	2935674287	2935665750	Bacteria	9571747
1075	2935682404	2935675223	Bacteria	9928132
1076	2935691618	2935684952	Bacteria	9590419
1077	2935699492	2935694250	Bacteria	9291695
1078	2935707720	2935703347	Bacteria	10242284
1079	2935719452	2935713505	Bacteria	9608509
1080	2935728948	2935722832	Bacteria	9608746
1081	2935737811	2935732158	Bacteria	9706831
1082	2935747187	2935741537	Bacteria	9707219
1083	2935758013	2935750917	Bacteria	9590372
1084	2935766651	2935760218	Bacteria	9817913
1085	2935770638	2935769743	Bacteria	7878163
1086	2935782871	2935777560	Bacteria	8077691
1087	2935787077	2935785616	Bacteria	7962367
1088	2935795125	2935793552	Bacteria	8012592
1089	2935809469	2935801545	Bacteria	9301974
1090	2935817772	2935810662	Bacteria	9401221
1091	2935820025	2935819856	Bacteria	8261050
1092	2935836289	2935827899	Bacteria	10038562
1093	2935849965	2935847175	Bacteria	8228321
1094	2935862174	2935855204	Bacteria	9035059
1095	2935870899	2935864058	Bacteria	9784707
1096	2935881292	2935873716	Bacteria	9632195
1097	2935884351	2935883170	Bacteria	7964738
1098	2935915118	2935908558	Bacteria	8568796
1099	2935923795	2935916978	Bacteria	9113783
1100	2935932615	2935926038	Bacteria	8601059
1101	2935941301	2935934488	Bacteria	8602579
1102	2935949285	2935942939	Bacteria	8599779
1103	2935957980	2935951376	Bacteria	8602333
1104	2935963732	2935959822	Bacteria	7869783
1105	2935974378	2935967501	Bacteria	8603075
1106	2935979566	2935975950	Bacteria	8347125
1107	2935991877	2935984226	Bacteria	8302647
1108	2935999116	2935992306	Bacteria	9802711
1109	2936005536	2936002035	Bacteria	9362176
1110	2936019237	2936011229	Bacteria	8801034
1111	2936027861	2936019824	Bacteria	8804134
1112	2936036644	2936028420	Bacteria	8965941
1113	2936042065	2936037263	Bacteria	9446081
1114	2936054673	2936046547	Bacteria	8903709
1115	2936060985	2936055302	Bacteria	8785755
1116	2940564076	2940556831	Bacteria	9590747
1117	2941535064	2941531003	Bacteria	7653939
1118	2941545527	2941538514	Bacteria	9402094
1119	2945939951	2945934425	Bacteria	7444609
1120	2990707075	2990703756	Bacteria	7715990
1121	3005452631	3005445848	Bacteria	6906074
1122	3005488630	3005483717	Bacteria	7877331
1123	3005512588	3005506211	Bacteria	6943378
1124	3005594756	3005587118	Bacteria	7794411
1125	3005596922	3005594810	Bacteria	8716512
1126	3005712955	3005710791	Bacteria	7622528
1127	3005720331	3005718088	Bacteria	8283608
1128	642424030	641736151	Bacteria	7477263
1129	8006970203	8006964411	Bacteria	8966052
1130	8006985482	8006984368	Bacteria	9651211
1131	8006994473	8006994254	Bacteria	8309700
1132	8016523369	8016522445	Bacteria	8156687
1133	8016560491	8016557553	Bacteria	8154380
1134	8016566526	8016566248	Bacteria	8158151
1135	8016579273	8016575299	Bacteria	8154085
1136	8016598392	8016595262	Bacteria	8149947
1137	8016604496	8016603502	Bacteria	8731218
1138	8016621082	8016613128	Bacteria	8794220
1139	8016628929	8016622563	Bacteria	7999408
1140	8016633504	8016630954	Bacteria	9217207
1141	8017060683	8017057580	Bacteria	10023680
1142	8019536567	8019530166	Bacteria	8155624
1143	8019542893	8019538911	Bacteria	7872763
1144	8019547852	8019547302	Bacteria	7996444
1145	8019580195	8019576017	Bacteria	10049540
1146	8019587917	8019586578	Bacteria	10212056
1147	8019603414	8019597564	Bacteria	10041141
1148	8019615116	8019608314	Bacteria	10042931
1149	8019625667	8019619141	Bacteria	9218857
1150	8019643003	8019638758	Bacteria	9062356
1151	8019655892	8019648815	Bacteria	10014479
1152	8019664422	8019659431	Bacteria	8577854
1153	8019674015	8019668869	Bacteria	8791617
1154	8019682109	8019678201	Bacteria	8863603
1155	8019693483	8019687851	Bacteria	8712826
1156	8054006083	8054002106	Bacteria	7987183
1157	8055305781	8055301274	Bacteria	8587385
1158	8055748436	8055742211	Bacteria	9226248
1159	8056681205	8056673599	Bacteria	7871253
1160	8056684337	8056681323	Bacteria	8472857
1161	8056976233	8056967851	Bacteria	9038162
1162	Ga0466969_0003723
1163	JGI24739J22299_10002428
1164	JGI24739J22299_10041526
1165	JGI24735J21928_10002099
1166	JGI24738J21930_10009150
1167	JGI25156J39149_1000413
1168	JGI25151J46595_10006907
1169	JGI25406J46586_10033975
1170	JGI25165J46597_1000695
1171	JGI25153J46596_10005839
1172	JGI25153J46596_10008795
1173	JGI25153J46596_10011061
1174	rootH2_10193879
1175	rootL2_10051959
1176	rootH1_10089171
1177	JGI25160J50197_1006854
1178	JGI25404J52841_10022165
1179	Ga0055533_1000420
1180	Ga0055532_1000013
1181	Ga0055525_1002129
1182	Ga0055527_1000010
1183	Ga0055535_1000010
1184	Ga0055542_1000016
1185	Ga0055529_1000012
1186	Ga0055526_1024492
1187	Ga0055531_10003606
1188	Ga0055543_1004698
1189	Ga0065165_1005490
1190	Ga0065165_1006783
1191	Ga0065165_1007709
1192	Ga0065165_1009691
1193	Ga0070658_10076870
1194	Ga0070658_10739844
1195	Ga0070683_100080598
1196	Ga0070680_100017995
1197	Ga0070680_100170725
1198	Ga0070680_100502060
1199	Ga0070682_100034392
1200	Ga0068868_100151031
1201	Ga0070660_100066785
1202	Ga0070660_100069171
1203	Ga0070691_10320299
1204	Ga0070661_100057667
1205	Ga0070661_100576129
1206	Ga0070668_100107791
1207	Ga0070668_100285584
1208	Ga0070668_100532380
1209	Ga0070675_100767052
1210	Ga0070671_100047356
1211	Ga0070674_100057349
1212	Ga0070673_100171208
1213	Ga0070673_100538811
1214	Ga0070688_100173601
1215	Ga0070688_100350481
1216	Ga0070667_100198295
1217	Ga0070667_100329259
1218	Ga0070667_100476217
1219	Ga0070709_10099267
1220	Ga0070714_100025078
1221	Ga0070714_100549136
1222	Ga0070714_100663331
1223	Ga0070713_100005011
1224	Ga0070713_100016727
1225	Ga0070713_100019403
1226	Ga0070713_100082366
1227	Ga0070713_100366444
1228	Ga0070710_10025921
1229	Ga0070710_10094611
1230	Ga0070711_100010825
1231	Ga0070711_100036102
1232	Ga0070711_100092334
1233	Ga0070700_100463855
1234	Ga0070694_100609998
1235	Ga0070663_100081195
1236	Ga0070663_100144568
1237	Ga0070663_100250687
1238	Ga0070663_100357697
1239	Ga0070678_100042994
1240	Ga0070678_100184103
1241	Ga0070678_100634777
1242	Ga0070662_100356319
1243	Ga0070681_10028930
1244	Ga0070681_10129996
1245	Ga0070679_100005105
1246	Ga0070679_100144553
1247	Ga0070684_100007439
1248	Ga0068853_100203171
1249	Ga0068853_100240102
1250	Ga0068853_100527596
1251	Ga0070686_100068516
1252	Ga0070695_100443113
1253	Ga0070665_100068609
1254	Ga0070665_100073474
1255	Ga0070665_100210378
1256	Ga0070665_100323422
1257	Ga0070665_100400288
1258	Ga0070665_100547825
1259	Ga0070665_101027093
1260	Ga0068855_100074770
1261	Ga0068855_100157292
1262	Ga0068855_100428257
1263	Ga0068855_100679324
1264	Ga0070664_100279651
1265	Ga0068857_100110131
1266	Ga0068856_100000066
1267	Ga0068856_100083156
1268	Ga0068856_100316563
1269	Ga0068856_100815787
1270	Ga0070702_100678575
1271	Ga0068852_100008061
1272	Ga0068852_100011855
1273	Ga0068864_100785170
1274	Ga0068864_100868396
1275	Ga0068861_100116600
1276	Ga0068860_100605224
1277	Ga0068860_101229272
1278	Ga0068862_100054763
1279	Ga0068862_100312055
1280	Ga0068862_100401299
1281	Ga0081455_10025144
1282	Ga0081455_10131918
1283	Ga0081455_10261257
1284	Ga0081540_1000745
1285	Ga0081540_1002325
1286	Ga0081540_1002857
1287	Ga0081540_1003237
1288	Ga0081540_1006752
1289	Ga0081540_1009867
1290	Ga0081540_1055603
1291	Ga0081540_1090144
1292	Ga0081539_10000584
1293	Ga0070717_10038500
1294	Ga0070717_10117806
1295	Ga0070717_10151423
1296	Ga0075365_10036170
1297	Ga0075365_10043177
1298	Ga0075365_10125635
1299	Ga0075365_10285484
1300	Ga0075368_10021300
1301	Ga0075368_10069619
1302	Ga0075363_100040609
1303	Ga0075363_100047620
1304	Ga0075363_100209734
1305	Ga0075364_10018779
1306	Ga0075364_10105718
1307	Ga0070715_10002269
1308	Ga0070715_10089635
1309	Ga0070716_100028614
1310	Ga0070716_100224614
1311	Ga0070712_100016026
1312	Ga0070712_100100360
1313	Ga0070712_100106344
1314	Ga0070712_100375634
1315	Ga0075362_10064390
1316	Ga0075362_10077593
1317	Ga0075362_10218581
1318	Ga0075367_10169038
1319	Ga0075367_10182214
1320	Ga0075369_10056529
1321	Ga0075369_10064912
1322	Ga0075366_10055468
1323	Ga0075366_10099277
1324	Ga0097621_100698321
1325	Ga0075370_10005433
1326	Ga0075370_10060041
1327	Ga0075370_10129271
1328	Ga0075428_100106685
1329	Ga0075433_10551930
1330	Ga0075434_100016550
1331	Ga0075436_100020769
1332	Ga0097620_100081959
1333	Ga0099824_1023531
1334	Ga0099794_10080876
1335	Ga0099795_10135518
1336	Ga0105251_10001323
1337	Ga0105250_10077566
1338	Ga0105240_10001168
1339	Ga0105240_10272929
1340	Ga0105240_10670737
1341	Ga0105245_10038469
1342	Ga0105245_10129270
1343	Ga0105245_10183500
1344	Ga0105245_11004562
1345	Ga0105247_10061271
1346	Ga0105243_10064232
1347	Ga0105243_10199979
1348	Ga0105243_10781439
1349	Ga0105241_10026859
1350	Ga0105241_10068127
1351	Ga0105241_10216988
1352	Ga0105242_10132265
1353	Ga0105248_10018519
1354	Ga0105248_10203206
1355	Ga0105248_10327964
1356	Ga0105248_10529903
1357	Ga0105237_10004255
1358	Ga0105237_10050990
1359	Ga0105237_10275276
1360	Ga0105237_10426623
1361	Ga0105237_10781999
1362	Ga0105237_10808185
1363	Ga0105237_10810394
1364	Ga0105238_10096211
1365	Ga0105238_10114567
1366	Ga0105238_10349801
1367	Ga0105238_10396237
1368	Ga0105238_10590458
1369	Ga0105238_10904470
1370	Ga0105239_10059931
1371	Ga0105239_10070577
1372	Ga0105239_10462911
1373	Ga0105239_10482831
1374	Ga0105239_10739235
1375	Ga0105239_10766785
1376	Ga0105239_11366618
1377	Ga0105246_10159090
1378	Ga0105246_10219925
1379	Ga0105246_10221854
1380	Ga0105246_10552948
1381	Ga0105246_10606450
1382	Ga0157370_10492151
1383	Ga0157369_10017444
1384	Ga0157369_10120158
1385	Ga0157369_10183146
1386	Ga0157369_10676771
1387	Ga0157374_10003974
1388	Ga0157374_10072526
1389	Ga0157374_10347154
1390	Ga0157378_10004175
1391	Ga0163162_10240251
1392	Ga0163162_10527057
1393	Ga0163162_10562780
1394	Ga0163162_10910490
1395	Ga0157372_10141195
1396	Ga0157372_10683836
1397	Ga0157375_10419400
1398	Ga0157375_10686061
1399	Ga0157375_10691111
1400	Ga0157375_10721167
1401	Ga0163163_10103309
1402	Ga0163163_10109246
1403	Ga0163163_10982975
1404	Ga0163163_11082294
1405	Ga0157380_10215349
1406	Ga0157380_10534602
1407	Ga0182008_10156895
1408	Ga0157377_10318008
1409	Ga0157379_10135335
1410	Ga0157379_10296344
1411	Ga0157376_10513197
1412	Ga0157376_10718496
1413	Ga0157376_11418559
1414	Ga0157376_11484887
1415	Ga0182006_1146240
1416	Ga0163161_10319761
1417	Ga0163161_10545697
1418	Ga0163161_10688203
1419	Ga0163161_10833276
1420	Ga0214544_1000013
1421	Ga0214542_1000013
1422	Ga0214545_1000012
1423	Ga0214543_1000065
1424	Ga0213876_10105618
1425	Ga0213871_10065200
1426	Ga0224712_10072757
1427	Ga0209435_116975
1428	Ga0209566_104145
1429	Ga0209674_100011
1430	Ga0209672_100002
1431	Ga0209147_100003
1432	Ga0209563_100965
1433	Ga0207427_101839
1434	Ga0209258_100042
1435	Ga0209148_1000006
1436	Ga0209148_1000319
1437	Ga0209759_1000051
1438	Ga0209759_1031348
1439	Ga0209233_1000033
1440	Ga0209233_1006521
1441	Ga0209455_1000003
1442	Ga0209455_1002843
1443	Ga0209025_1000044
1444	Ga0209564_1001778
1445	Ga0209564_1006554
1446	Ga0209564_1012977
1447	Ga0209758_1000026
1448	Ga0209758_1000087
1449	Ga0209758_1000423
1450	Ga0209758_1006245
1451	Ga0209758_1006322
1452	Ga0209758_1012369
1453	Ga0209256_1008813
1454	Ga0209256_1029968
1455	Ga0207426_1000289
1456	Ga0207426_1000312
1457	Ga0207426_1002069
1458	Ga0207426_1006079
1459	Ga0207426_1025688
1460	Ga0209051_1044077
1461	Ga0209257_1002080
1462	Ga0209257_1012695
1463	Ga0207697_10094338
1464	Ga0207656_10059094
1465	Ga0207713_1005553
1466	Ga0207692_10020400
1467	Ga0207692_10030771
1468	Ga0207710_10067565
1469	Ga0207688_10061211
1470	Ga0207647_10033116
1471	Ga0207647_10073662
1472	Ga0207647_10132493
1473	Ga0207685_10001531
1474	Ga0207699_10026505
1475	Ga0207699_10097894
1476	Ga0207699_10109034
1477	Ga0207643_10062266
1478	Ga0207705_10066127
1479	Ga0207654_10022464
1480	Ga0207654_10130542
1481	Ga0207654_10185275
1482	Ga0207654_10297775
1483	Ga0207707_10000482
1484	Ga0207707_10058173
1485	Ga0207707_10146226
1486	Ga0207695_10000240
1487	Ga0207671_10006544
1488	Ga0207671_10100694
1489	Ga0207671_10128578
1490	Ga0207671_10282938
1491	Ga0207693_10004050
1492	Ga0207693_10055021
1493	Ga0207663_10006268
1494	Ga0207663_10009026
1495	Ga0207663_10211872
1496	Ga0207660_10028710
1497	Ga0207662_10201706
1498	Ga0207657_10079418
1499	Ga0207657_10110260
1500	Ga0207649_10008832
1501	Ga0207649_10089182
1502	Ga0207652_10006164
1503	Ga0207652_10119766
1504	Ga0207681_10594713
1505	Ga0207694_10082673
1506	Ga0207694_10177299
1507	Ga0207694_10362371
1508	Ga0207694_10803857
1509	Ga0207650_10347218
1510	Ga0207687_10261764
1511	Ga0207700_10008958
1512	Ga0207700_10387991
1513	Ga0207664_10030824
1514	Ga0207664_10099623
1515	Ga0207664_10286616
1516	Ga0207644_10172036
1517	Ga0207690_10651843
1518	Ga0207706_10026705
1519	Ga0207706_10353299
1520	Ga0207706_10523991
1521	Ga0207686_10904210
1522	Ga0207670_10592385
1523	Ga0207669_10548787
1524	Ga0207665_10000243
1525	Ga0207691_10276063
1526	Ga0207691_10715266
1527	Ga0207711_10140991
1528	Ga0207711_11116726
1529	Ga0207689_10010335
1530	Ga0207689_10093341
1531	Ga0207689_10127783
1532	Ga0207689_10584166
1533	Ga0207661_10027534
1534	Ga0207679_10241842
1535	Ga0207679_10263500
1536	Ga0207679_10346777
1537	Ga0207679_10554227
1538	Ga0207667_10082459
1539	Ga0207667_10193142
1540	Ga0207667_10592488
1541	Ga0207667_10695532
1542	Ga0207712_10288899
1543	Ga0207668_10125756
1544	Ga0207668_10196701
1545	Ga0207668_10311809
1546	Ga0207668_10611139
1547	Ga0207640_10622256
1548	Ga0207640_10768035
1549	Ga0207640_10926213
1550	Ga0207658_10253723
1551	Ga0207639_10070198
1552	Ga0207678_10043409
1553	Ga0207678_10064120
1554	Ga0207678_10077584
1555	Ga0207678_10078534
1556	Ga0207678_10089234
1557	Ga0207708_10198036
1558	Ga0207702_10000044
1559	Ga0207702_10103875
1560	Ga0207702_10305317
1561	Ga0207702_10522637
1562	Ga0207702_11248639
1563	Ga0207641_10799871
1564	Ga0207648_10166023
1565	Ga0207648_10479467
1566	Ga0207676_10125224
1567	Ga0207676_10462894
1568	Ga0207674_10051170
1569	Ga0207674_10145625
1570	Ga0207674_10256513
1571	Ga0207675_100069573
1572	Ga0207675_100401401
1573	Ga0207683_10128920
1574	Ga0207683_10449094
1575	Ga0207683_10469534
1576	Ga0207683_10649212
1577	Ga0207698_10015275
1578	Ga0207698_10066119
1579	Ga0207698_10259828
1580	Ga0207698_10321850
1581	Ga0209389_1000060
1582	Ga0209589_1000062
1583	Ga0209489_101714
1584	Ga0207428_10297160
1585	Ga0268266_10160886
1586	Ga0268266_10367514
1587	Ga0268266_10742184
1588	Ga0268266_10744814
1589	Ga0268266_10814588
1590	Ga0268265_10261884
1591	Ga0268264_10000030
1592	Ga0268264_10117999
1593	Ga0307517_10000154
1594	Ga0265339_10163285
1595	Ga0265331_10014220
1596	Ga0265327_10003859
1597	Ga0307513_10459691
1598	Ga0307509_10459064
1599	Ga0307408_100392343
1600	Ga0307408_100735636
1601	Ga0265313_10151124
1602	Ga0265314_10013948
1603	Ga0265314_10015249
1604	Ga0265314_10054533
1605	Ga0307516_10284243
1606	Ga0307405_10126311
1607	Ga0307413_10207427
1608	Ga0307413_10685679
1609	Ga0307410_10123614
1610	Ga0307407_10588196
1611	Ga0307412_10000053
1612	Ga0307409_100721543
1613	Ga0307409_100745733
1614	Ga0307409_100941583
1615	Ga0307416_100037773
1616	Ga0307416_100425525
1617	Ga0307416_100728564
1618	Ga0307416_101519814
1619	Ga0307411_10026985
1620	Ga0307415_100397504
1621	Ga0307510_10011715
1622	Ga0373938_0013708
1623	Ga0373952_0007466
1624	Ga0373936_0218462
1625	Ga0373936_0243557
1626	Ga0373943_0186701
1627	Ga0373946_0023622
1628	Ga0373946_0071472
1629	Ga0373931_0000802
1630	Ga0373927_0031848
1631	Ga0373927_0066120
1632	Ga0373933_0477024
1633	Ga0373947_0013012
1634	Ga0373937_0032430
1635	Ga0373937_0675393
1636	Ga0373925_0250493
1637	Ga0395900_0112895
1638	Ga0395900_0209469
1639	Ga0395898_0067438
1640	Ga0395898_0191090
1641	Ga0395898_1037950
1642	Ga0395905_0026305
1643	Ga0395905_0062251
1644	Ga0395905_0413598
1645	Ga0436364_0063134
1646	Ga0436364_1041080
1647	Ga0395901_0146697
1648	Ga0395901_0560329
1649	Ga0400490_21206
1650	Ga0400491_11624
1651	Ga0400485_11540
1652	Ga0400483_027012
1653	Ga0400483_245193
1654	Ga0400483_291151
1655	Ga0436365_1603903
1656	Ga0436365_1612931
1657	Ga0436360_0711480
1658	Ga0436360_1015624
1659	Ga0436361_0223647
1660	Ga0436361_0829653
1661	Ga0436362_1255550
1662	Ga0451789_0631980
1663	Ga0451797_1074114
1664	Ga0451833_0639124
1665	Ga0451847_0439122
1666	Ga0451577_0004487
1667	Ga0451577_0004566
1668	Ga0451577_0027000
1669	Ga0466969_0098366
1670	Ga0466972_0015190
1671	Ga0466965_0040207
1672	Ga0466965_0120290
1673	Ga0466965_0207539
1674	Ga0466966_0009260
1675	Ga0466966_0057203
1676	Ga0466966_0062856
1677	Ga0466961_0000016
1678	Ga0466961_0005273
1679	Ga0466961_0358365
1680	Ga0466964_0051373
1681	Ga0453684_0543688
1682	Ga0466968_0046993
1683	Ga0466968_0124406
1684	Ga0466970_0007667
1685	Ga0466970_0277206
1686	Ga0466970_0364920
1687	Ga0466959_0000469
1688	Ga0466959_0001181
1689	Ga0466959_0062332
1690	Ga0466959_0097943
1691	Ga0451576_0000571
1692	Ga0466958_0182429
1693	Ga0466967_0023131
1694	Ga0466967_0168313
1695	Ga0495592_0026558
1696	Ga0495592_0148173
1697	Ga0495603_0010879
1698	Ga0495603_0012072
1699	Ga0495590_0053102
1700	Ga0495629_0001346
1701	Ga0495629_0005377
1702	Ga0495638_0005507
1703	Ga0495641_0035979
1704	Ga0495641_0045014
1705	Ga0495641_0080626
1706	Ga0495651_0117099
1707	Ga0495653_0035739
1708	Ga0495653_0079135
1709	Ga0495653_0418539
1710	Ga0495650_0009610
1711	Ga0495650_0050556
1712	Ga0495580_0042165
1713	Ga0495580_0179649
1714	Ga0495582_0002141
1715	Ga0495605_0021863
1716	Ga0495605_0173281
1717	Ga0495639_0001260
1718	Ga0495639_0036571
1719	Ga0495662_0004116
1720	Ga0495664_0002054
1721	Ga0495664_0003082
1722	Ga0495664_0025540
1723	Ga0495584_0249253
1724	Ga0495585_0083364
1725	Ga0495594_0018538
1726	Ga0495594_0167262
1727	Ga0495594_0256921
1728	Ga0495596_0010217
1729	Ga0495596_0081280
1730	Ga0495596_0125254
1731	Ga0495583_0138610
1732	Ga0495606_0017605
1733	Ga0495606_0018755
1734	Ga0495606_0019779
1735	Ga0495606_0088885
1736	Ga0495606_0109184
1737	Ga0495606_0121991
1738	Ga0495608_0050079
1739	Ga0495608_0068938
1740	Ga0495608_0296806
1741	Ga0495610_0000596
1742	Ga0495616_0103288
1743	Ga0495618_0049365
1744	Ga0495620_0017082
1745	Ga0495620_0037965
1746	Ga0495620_0070925
1747	Ga0495628_0032970
1748	Ga0495628_0054028
1749	Ga0495630_0024007
1750	Ga0495630_0050046
1751	Ga0495630_0068908
1752	Ga0495632_0073988
1753	Ga0495632_0295969
1754	Ga0495643_0008106
1755	Ga0495648_0092549
1756	Ga0495666_0004293
1757	Ga0495666_0037213
1758	Ga0495666_0085603
1759	Ga0495642_0003951
1760	Ga0495652_0005430
1761	Ga0495652_0009198
1762	Ga0495652_0019258
1763	Ga0495665_0000209
1764	Ga0495665_0001580
1765	Ga0495665_0012709
1766	Ga0495665_0213680
1767	Ga0495640_0020780
1768	Ga0495640_0148818
1769	Ga0495586_0055961
1770	Ga0495598_0022826
1771	Ga0495598_0071323
1772	Ga0495609_0053130
1773	Ga0495609_0139464
1774	Ga0495597_0007581
1775	Ga0495597_0030323
1776	Ga0495597_0189775
1777	Ga0495645_0004890
1778	Ga0495645_0036901
1779	Ga0495645_0069988
1780	Ga0495622_0230563
1781	Ga0495667_0017415
1782	Ga0495667_0024866
1783	Ga0495667_0418944
1784	Ga0495656_0167012
1785	Ga0495668_0042027
1786	Ga0495668_0050681
1787	Ga0495634_0007269
1788	Ga0495634_0056170
1789	Ga0495634_0080739
1790	Ga0495611_0290096
1791	Ga0495625_0393177
1792	Ga0495635_0002096
1793	Ga0495635_0168795
1794	Ga0495635_0194397
1795	Ga0495635_0449086
1796	Ga0495661_0226844
1797	Ga0495657_0000725
1798	Ga0495657_0014432
1799	Ga0495657_0209419
1800	Ga0495599_0004941
1801	Ga0495599_0089515
1802	Ga0495623_0006579
1803	Ga0495623_0016698
1804	Ga0495623_0219299
1805	Ga0495646_0000609
1806	Ga0495646_0026240
1807	Ga0495646_0153675
1808	Ga0495646_0188703
1809	Ga0495646_0290845
1810	Ga0495647_0041296
1811	Ga0495669_0159524
1812	Ga0495613_0036068
1813	Ga0495624_0001367
1814	Ga0495624_0043848
1815	Ga0495624_0070116
1816	Ga0495624_0197931
1817	Ga0495589_0085471
1818	Ga0495600_0002199
1819	Ga0495600_0010397
1820	Ga0495600_0066146
1821	Ga0495581_0002935
1822	Ga0495581_0004952
1823	Ga0495604_0000420
1824	Ga0495604_0010762
1825	Ga0495604_0107551
1826	Ga0495604_0472994
1827	Ga0495604_0478154
1828	Ga0495604_0532716
1829	Ga0495604_0558048
1830	Ga0495674_0002922
1831	Ga0495674_0007124
1832	Ga0495672_0176363
1833	Ga0495676_0030538
1834	Ga0495676_0207412
1835	Ga0495676_0237532
1836	Ga0495680_0002126
1837	Ga0495680_0005524
1838	Ga0495683_0002359
1839	Ga0495683_0031138
1840	Ga0495683_0052460
1841	Ga0495683_0079916
1842	Ga0495683_0090170
1843	Ga0495687_000005
1844	Ga0495687_009562
1845	Ga0495675_0014725
1846	Ga0495675_0018670
1847	Ga0495675_0035058
1848	Ga0495675_0050944
1849	Ga0495677_0025426
1850	Ga0495684_0040851
1851	Ga0495684_0176624
1852	Ga0495686_0000099
1853	Ga0495686_0187396
1854	Ga0495686_0220010
1855	Ga0495686_0256407
1856	Ga0495593_0001260
1857	Ga0495593_0043975
1858	Ga0495593_0154344
1859	Ga0495602_0000430
1860	Ga0495602_0065883
1861	Ga0495602_0071267
1862	Ga0495614_0019776
1863	Ga0496100_0019679
1864	Ga0496101_0008658
1865	Ga0496101_0086816
1866	Ga0496101_0454505
1867	Ga0496101_0508231
1868	Ga0496102_0021798
1869	Ga0496102_0038630
1870	Ga0496102_0141405
1871	Ga0496102_0231532
1872	Ga0496102_0301809
1873	Ga0496102_0727969
1874	Ga0496102_0852593
1875	Ga0496103_0012189
1876	Ga0496103_0012840
1877	Ga0496103_0107018
1878	Ga0496104_0052951
1879	Ga0496104_0053250
1880	Ga0496104_0092903
1881	Ga0496104_0557643
1882	Ga0496104_0648895
1883	Ga0496104_0840776
1884	Ga0496105_0153053
1885	Ga0496105_0241929
1886	Ga0496105_0281701
1887	Ga0496106_0000044
1888	Ga0496106_0026977
1889	Ga0496106_0042487
1890	Ga0496106_0046187
1891	Ga0496106_0187174
1892	Ga0496106_0437594
1893	Ga0496106_0478359
1894	Ga0496106_0589691
1895	Ga0496106_0692727
1896	Ga0496107_0031616
1897	Ga0496107_0283347
1898	Ga0496107_0401962
1899	Ga0496107_0579205
1900	Ga0496108_0016960
1901	Ga0496108_0103141
1902	Ga0496108_0591062
1903	Ga0496109_0021088
1904	Ga0496109_0076181
1905	Ga0496109_0104558
1906	Ga0496109_0398205
1907	Ga0496110_0031565
1908	Ga0496110_0035302
1909	Ga0496110_0065792
1910	Ga0496110_0077889
1911	Ga0496110_0154157
1912	Ga0496110_0312164
1913	Ga0496111_0044352
1914	Ga0496111_0108244
1915	Ga0496111_0164141
1916	Ga0496112_0008879
1917	Ga0496112_0016878
1918	Ga0496112_0053167
1919	Ga0496112_0082170
1920	Ga0496112_0094222
1921	Ga0496112_0145168
1922	Ga0496112_0159446
1923	Ga0496112_0760974
1924	Ga0496113_0006503
1925	Ga0496113_0016873
1926	Ga0496113_0199078
1927	Ga0496113_0206095
1928	Ga0496114_0024002
1929	Ga0496114_0374794
1930	Ga0496114_0568738
1931	Ga0496115_0040396
1932	Ga0496115_0114762
1933	Ga0496115_0164941
1934	Ga0496115_0276194
1935	Ga0496115_0284956
1936	Ga0496115_0451316
1937	Ga0496115_0466192
1938	Ga0496116_0012016
1939	Ga0496116_0084548
1940	Ga0496117_0006550
1941	Ga0496117_0007383
1942	Ga0496117_0032310
1943	Ga0496118_0004083
1944	Ga0496118_0008433
1945	Ga0496118_0016265
1946	Ga0496118_0027678
1947	Ga0496118_0029177
1948	Ga0496118_0101341
1949	Ga0496119_0283054
1950	Ga0496120_0117845
1951	Ga0496121_0000409
1952	Ga0496121_0002124
1953	Ga0496121_0022718
1954	Ga0496121_0041564
1955	Ga0496121_0126440
1956	Ga0496121_0310796
1957	Ga0496122_0026812
1958	Ga0496123_0009267
1959	Ga0496124_0002033
1960	Ga0496124_0019124
1961	Ga0496124_0025817
1962	Ga0496124_0027336
1963	Ga0496124_0054727
1964	Ga0496124_0072066
1965	Ga0496124_0184430
1966	Ga0496125_0041358
1967	Ga0496125_0069832
1968	Ga0496125_0125852
1969	Ga0496125_0180241
1970	Ga0496125_0206446
1971	Ga0496125_0252190
1972	Ga0496125_0356057
1973	Ga0496126_0000064
1974	Ga0496126_0000176
1975	Ga0496126_0000657
1976	Ga0496126_0003839
1977	Ga0496126_0009046
1978	Ga0496126_0036458
1979	Ga0496126_0037981
1980	Ga0496126_0089112
1981	Ga0496126_0106018
1982	Ga0496126_0117421
1983	Ga0496126_0143391
1984	Ga0496126_0162181
1985	Ga0496126_0547195
1986	Ga0495678_136640
1987	Ga0501031_0216491
1988	Ga0501034_0339470
1989	Ga0501036_0163941
1990	Ga0501036_0182081
1991	Ga0501038_0472417
1992	Ga0501039_0047909
1993	Ga0501041_0055408
1994	Ga0501042_0281398
1995	Ga0501047_0011995
1996	Ga0501047_0521250
1997	Ga0501069_0157670
1998	Ga0501070_0000467
1999	Ga0501070_0016712
2000	Ga0501070_0054961
2001	Ga0501072_0375561
2002	Ga0501073_0026596
2003	Ga0501073_0210607
2004	Ga0501074_0036857
2005	Ga0501075_0429298
2006	Ga0501075_0514484
2007	Ga0501079_0231813
2008	Ga0501080_0001900
2009	Ga0501080_0018939
2010	Ga0501081_0320655
2011	Ga0501081_0660442
2012	Ga0501035_0000461
2013	Ga0501035_0110612
2014	Ga0501044_0070254
2015	Ga0501045_0024382
2016	nmdc:mga03683_146615_c1
2017	nmdc:mga03683_99472_c1
2018	nmdc:mga03n38_101376_c1
2019	nmdc:mga03n38_99034_c1
2020	nmdc:mga00v17_172991_c1
2021	nmdc:mga00v17_238739_c1
2022	nmdc:mga00v17_268293_c1
2023	nmdc:mga0yw44_114878_c1
2024	nmdc:mga0yw44_117249_c1
2025	nmdc:mga0yw44_29914_c1
2026	nmdc:mga0yw44_32732_c1
2027	nmdc:mga0yw44_426508_c1
2028	nmdc:mga0yw44_71877_c1
2029	nmdc:mga0k408_135121_c1
2030	nmdc:mga0k408_25685_c1
2031	nmdc:mga0k408_5535_c1
2032	nmdc:mga06z11_153628_c1
2033	nmdc:mga06z11_66673_c1
2034	nmdc:mga06z11_81591_c1
2035	nmdc:mga04h51_21123_c1
2036	nmdc:mga07m45_154268_c1
2037	nmdc:mga07m45_42073_c1
2038	nmdc:mga05p37_185808_c1
2039	nmdc:mga08y16_479086_c1
2040	nmdc:mga08y16_800924_c1
2041	nmdc:mga0n895_25507_c1
2042	nmdc:mga08x19_160659_c1
2043	nmdc:mga0sz30_56003_c1
2044	Ga0500635_0009867
2045	Ga0500635_0094195
2046	Ga0495595_0102528
2047	Ga0500578_0099795
2048	Ga0500643_001963
2049	Ga0500643_066958
2050	Ga0500644_0050353
2051	Ga0500647_0042230
2052	Ga0500583_0005780
2053	Ga0500566_0000446
2054	Ga0500566_0079335
2055	Ga0500640_084122
2056	Ga0500641_0003174
2057	Ga0500641_0008924
2058	Ga0500641_0015984
2059	Ga0500641_0040404
2060	Ga0500555_001249
2061	Ga0500557_000014
2062	Ga0500562_004270
2063	Ga0500562_034346
2064	Ga0500572_011372
2065	Ga0500572_085926
2066	Ga0500595_005974
2067	Ga0500595_038943
2068	Ga0500621_038368
2069	Ga0500626_148067
2070	Ga0500642_0000070
2071	Ga0500652_028437
2072	Ga0500655_012083
2073	Ga0500658_0099855
2074	Ga0500564_199940
2075	Ga0500568_0005033
2076	Ga0500568_0088724
2077	Ga0500577_0028493
2078	Ga0500577_0045424
2079	Ga0500589_028841
2080	Ga0500589_100341
2081	Ga0500590_126002
2082	Ga0500603_000992
2083	Ga0500604_0009173
2084	Ga0500604_0177858
2085	Ga0500616_0102470
2086	Ga0500620_011905
2087	Ga0500622_0011385
2088	Ga0500627_0010349
2089	Ga0500634_0131083
2090	Ga0500638_000630
2091	Ga0500638_080483
2092	Ga0500636_0000147
2093	Ga0500637_0000746
2094	Ga0500637_0009134
2095	Ga0500637_0030650
2096	Ga0500611_026226
2097	Ga0500625_006079
2098	Ga0500645_008266
2099	Ga0500645_022687
2100	Ga0500609_013784
2101	Ga0500601_000655
2102	Ga0501084_0311676
2103	Ga0500661_000566
2104	2501080422
2105	2507510691
2106	2508544494
2107	2508697361
2108	2509127845
2109	2509139424
2110	2509148295
2111	2511088255
2112	2511398656
2113	2513625987
2114	2513643132
2115	2513650659
2116	2513674757
2117	2513693589
2118	2513704583
2119	2513877842
2120	2514016215
2121	2515627944
2122	2517108749
2123	2524437081
2124	2524469047
2125	2528857512
2126	2599103585
2127	2600812841
2128	2617353807
2129	2617378788
2130	2723847471
2131	2738822747
2132	2738834954
2133	2738876433
2134	2739188377
2135	2739223030
2136	2753569155
2137	2758638443
2138	2793063441
2139	2793081501
2140	2805917029
2141	2818242572
2142	2824601937
2143	2824615828
2144	2824620875
2145	2824628263
2146	2824636188
2147	2824652612
2148	2824653168
2149	2824662522
2150	2824673459
2151	2824681196
2152	2824689499
2153	2824697370
2154	2824709638
2155	2824719171
2156	2824729620
2157	2824739065
2158	2824747762
2159	2824756289
2160	2824763973
2161	2824776055
2162	2829746206
2163	2834581555
2164	2837654118
2165	2838125304
2166	2841948557
2167	2841951455
2168	2841960553
2169	2841968529
2170	2841976270
2171	2841987634
2172	2842043187
2173	2842051228
2174	2844317223
2175	2846953473
2176	2847944597
2177	2848860370
2178	2849081167
2179	2854682921
2180	2854684096
2181	2857516050
2182	2861692838
2183	2869164900
2184	2874592352
2185	2874611451
2186	2874625293
2187	2874634636
2188	2874650041
2189	2876763264
2190	2876775430
2191	2876817091
2192	2876826217
2193	2879079482
2194	2879109668
2195	2879117525
2196	2879132271
2197	2879146920
2198	2881365086
2199	2881668469
2200	2883092194
2201	2885276446
2202	2885383993
2203	2885417584
2204	2888381911
2205	2888388731
2206	2888422542
2207	2889042190
2208	2903735207
2209	2903769262
2210	2904486041
2211	2904668847
2212	2904720443
2213	2906607614
2214	2906630485
2215	2908778166
2216	2919527386
2217	2922362938
2218	2922371859
2219	2922390579
2220	2922399419
2221	2929616791
2222	2929625534
2223	2932791186
2224	2932799234
2225	2932803771
2226	2932811631
2227	2932826452
2228	2932834201
2229	2933577927
2230	2935616129
2231	2935623976
2232	2935647022
2233	2935656388
2234	2935665208
2235	2935674287
2236	2935682404
2237	2935691618
2238	2935699492
2239	2935707720
2240	2935719452
2241	2935728948
2242	2935737811
2243	2935747187
2244	2935758013
2245	2935766651
2246	2935770638
2247	2935782871
2248	2935787077
2249	2935795125
2250	2935809469
2251	2935817772
2252	2935820025
2253	2935836289
2254	2935849965
2255	2935862174
2256	2935870899
2257	2935881292
2258	2935884351
2259	2935915118
2260	2935923795
2261	2935932615
2262	2935941301
2263	2935949285
2264	2935957980
2265	2935963732
2266	2935974378
2267	2935979566
2268	2935991877
2269	2935999116
2270	2936005536
2271	2936019237
2272	2936027861
2273	2936036644
2274	2936042065
2275	2936054673
2276	2936060985
2277	2940564076
2278	2941535064
2279	2941545527
2280	2945939951
2281	2990707075
2282	3005452631
2283	3005488630
2284	3005512588
2285	3005594756
2286	3005596922
2287	3005712955
2288	3005720331
2289	642424030
2290	8006970203
2291	8006985482
2292	8006994473
2293	8016523369
2294	8016560491
2295	8016566526
2296	8016579273
2297	8016598392
2298	8016604496
2299	8016621082
2300	8016628929
2301	8016633504
2302	8017060683
2303	8019536567
2304	8019542893
2305	8019547852
2306	8019580195
2307	8019587917
2308	8019603414
2309	8019615116
2310	8019625667
2311	8019643003
2312	8019655892
2313	8019664422
2314	8019674015
2315	8019682109
2316	8019693483
2317	8054006083
2318	8055305781
2319	8055748436
2320	8056681205
2321	8056684337
2322	8056976233

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00596

Aldolase_II

Class II Aldolase and Adducin N-terminal domain

41

219

0.93 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
1e49-assembly1.cif.gz_P	l-fuculose 1-phosphate aldolase from escherichia coli mutant n29l/s71a	0.9568	6	212
7x78-assembly1.cif.gz_A	l-fuculose 1-phosphate aldolase	0.9532	5	212
1e4b-assembly1.cif.gz_P	l-fuculose 1-phosphate aldolase from escherichia coli mutant n29q	0.9512	6	212
1dzz-assembly1.cif.gz_P	l-fuculose-1-phosphate aldolase from escherichia coli mutant y113f	0.9493	6	214
1e4a-assembly1.cif.gz_P	l-fuculose 1-phosphate aldolase from escherichia coli mutant del(27)	0.9485	6	212

ID	Description	Score	Start	End	Superfamily
2fuaA00	Alpha Beta;3-Layer(aba) Sandwich;L-fuculose-1-phosphate Aldolase;Class II aldolase/adducin N-terminal domain	0.9466	6	216	3.40.225.10
2fuaA00	Alpha Beta;3-Layer(aba) Sandwich;L-fuculose-1-phosphate Aldolase;Class II aldolase/adducin N-terminal domain	0.9333	6	216	3.40.225.10
6btgA00	Alpha Beta;3-Layer(aba) Sandwich;L-fuculose-1-phosphate Aldolase;Class II aldolase/adducin N-terminal domain	0.923	7	212	3.40.225.10
af_P95075_7_208_3.40.225.10	Alpha Beta;3-Layer(aba) Sandwich;L-fuculose-1-phosphate Aldolase;Class II aldolase/adducin N-terminal domain	0.9121	10	209	3.40.225.10
6btgA00	Alpha Beta;3-Layer(aba) Sandwich;L-fuculose-1-phosphate Aldolase;Class II aldolase/adducin N-terminal domain	0.9057	7	212	3.40.225.10

ID	Description	Score	Start	End	GO Terms
AF-A0A3D5V104-F1-model_v4	Class II aldolase	0.9898	99	217	GO:0005829 GO:0016832 GO:0019323
AF-A0A528IZR5-F1-model_v4	Class II aldolase	0.9884	78	215	GO:0005829 GO:0016832 GO:0019323
AF-W8S966-F1-model_v4	Ribulose-5-phosphate 4-epimerase	0.9872	108	217	GO:0005829 GO:0016832 GO:0019323
AF-A0A7H4PIX0-F1-model_v4	L-fuculose phosphate aldolase (EC 4.1.2.17)	0.9787	88	173	GO:0005829 GO:0008738 GO:0019323
AF-A0A4Q8R610-F1-model_v4	Class II aldolase	0.9754	6	216	GO:0005829 GO:0016832 GO:0019323

F491013

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF00596

Aldolase_II

Class II Aldolase and Adducin N-terminal domain

41

219

0.93

Structural Annotation

Top 5 Hits

Map