F491011

General Info

Members Datasets Scaffolds Average Seq Length
1161 366 2322 249

Family's Representative Sequence

Representative Sequence 3300025960|Ga0207651_10259149|Ga0207651_102591493
Length 310
Sequence MSGHSKWHTIKHKKGAADAKRGKVFTRIIKELTVAARAGGGDPDMNPRLRTIIADAKAQNMPSENIKRAIRRGTGEEPGVSYEEAQYEAYGPGGAAVIMDVLTDNKNRTVGELRHLLTKNGGNLAETNAVAWMFTKRGYIVVPKSKADEETLMSAVLEAGGDDLRDDEDNWEVLSPPEAFQDVLEAVKKLGIEPAAAEISLQIQDALDGFDYSALGLEGKGGRMRIGAHYGPAYRAIDHITGRLNFYGNEVSKAARIEPVTPTGAVFVTEPFAAILALEAPDRFDCRYVGRIQLAKGYGSYPMYRLTRAD

Samples

Sample ID Description Type Environment
1 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
62 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
68 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
69 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
70 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
71 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
72 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
73 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
74 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
75 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
76 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
77 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
78 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
80 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
81 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
82 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
83 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
84 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
85 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
86 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
87 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
88 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
89 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
91 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
92 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
94 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
95 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
97 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
98 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
99 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
100 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
101 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
102 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
103 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
104 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
105 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
106 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
107 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
108 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
109 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
110 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
111 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
112 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
113 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
114 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
115 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
116 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
180 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
184 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
185 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
186 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
187 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
188 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
189 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
190 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
191 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
192 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
193 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
194 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
195 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
196 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
197 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
198 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
199 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
200 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
201 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
202 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
203 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
204 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
205 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
206 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
207 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
208 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
209 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
210 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
211 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
212 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
213 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
214 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
215 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
216 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
217 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
218 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
219 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
220 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
221 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
222 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
223 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
224 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
225 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
226 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
227 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
228 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
229 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
230 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
231 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
232 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
233 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
234 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
235 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
236 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
237 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
238 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
239 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
240 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
241 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
242 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
243 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
244 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
245 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
246 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
247 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
248 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
249 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
250 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
251 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
252 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
253 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
254 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
255 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
256 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
257 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
258 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
259 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
260 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
261 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
262 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
263 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
264 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
265 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
266 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
267 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
268 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
269 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
270 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
271 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
272 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
273 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
274 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
275 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
276 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
277 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
278 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
279 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
280 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
281 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
282 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
283 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
284 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
285 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
286 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
287 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
288 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
289 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
290 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
291 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
292 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
293 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
294 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
295 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
296 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
297 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
298 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
299 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
300 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
301 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
302 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
303 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
304 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
305 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
306 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
307 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
308 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
309 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
310 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
311 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
312 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
313 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
314 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
315 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
316 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
317 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
318 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
319 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
320 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
321 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
322 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
323 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
324 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
325 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
326 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
327 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
328 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
329 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
330 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
331 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
332 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
333 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
334 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
335 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
336 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
337 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
338 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
339 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
340 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
341 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
342 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
343 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
344 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
345 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
346 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
347 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
348 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
349 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
350 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
351 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
352 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
353 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
354 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
355 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
356 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
357 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
358 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
359 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
360 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
361 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
362 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
363 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
364 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
365 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
366 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.91
Metatranscriptomes 0.09
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.82
Nodule 0
Rhizoplane 3.45
Rhizosphere 91.73
Stem 0
Stem Tuber 0
Unclassified 3.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207651_10259149 3300025960 Bacteria 1427
2 JGI24751J29686_10015170 3300002459 Bacteria 1590
3 Ga0065715_10090135 3300005293 Bacteria 7597
4 Ga0065715_10094425 3300005293 Bacteria 4344
5 Ga0065715_10286916 3300005293 Bacteria 1072
6 Ga0065707_10097878 3300005295 Bacteria 3132
7 Ga0065707_10146127 3300005295 Unclassified 1712
8 Ga0065707_10149389 3300005295 Bacteria 1675
9 Ga0070676_10004636 3300005328 Bacteria 7258
10 Ga0070676_10221450 3300005328 Unclassified 1250
11 Ga0070683_100000767 3300005329 Bacteria 23601
12 Ga0070683_100024989 3300005329 Bacteria 5358
13 Ga0070683_100367655 3300005329 Bacteria 1370
14 Ga0070670_100014101 3300005331 Bacteria 6857
15 Ga0070670_100090286 3300005331 Bacteria 2633
16 Ga0070670_100102379 3300005331 Bacteria 2466
17 Ga0070670_100479180 3300005331 Bacteria 1105
18 Ga0070680_100088981 3300005336 Bacteria 2555
19 Ga0068868_100465356 3300005338 Unclassified 1102
20 Ga0068868_100516755 3300005338 Bacteria 1048
21 Ga0070660_100057416 3300005339 Bacteria 3015
22 Ga0070689_100124881 3300005340 Bacteria 2058
23 Ga0070689_100152852 3300005340 Bacteria 1862
24 Ga0070691_10005391 3300005341 Bacteria 5817
25 Ga0070661_100023235 3300005344 Bacteria 4443
26 Ga0070668_100061615 3300005347 Bacteria 2906
27 Ga0070668_100321122 3300005347 Bacteria 1304
28 Ga0070668_100327105 3300005347 Bacteria 1292
29 Ga0070668_100747071 3300005347 Bacteria 866
30 Ga0070669_100000166 3300005353 Bacteria 58014
31 Ga0070669_100016560 3300005353 Bacteria 5261
32 Ga0070669_100085857 3300005353 Bacteria 2350
33 Ga0070669_100241226 3300005353 Bacteria 1436
34 Ga0070669_100422794 3300005353 Bacteria 1094
35 Ga0070675_100000147 3300005354 Bacteria 42295
36 Ga0070675_100049232 3300005354 Bacteria 3458
37 Ga0070675_100072522 3300005354 Bacteria 2859
38 Ga0070675_100083865 3300005354 Bacteria 2661
39 Ga0070675_100096424 3300005354 Bacteria 2484
40 Ga0070675_100163925 3300005354 Bacteria 1913
41 Ga0070675_100540740 3300005354 Bacteria 1053
42 Ga0070675_100572604 3300005354 Bacteria 1023
43 Ga0070671_100001353 3300005355 Bacteria 18364
44 Ga0070671_100050468 3300005355 Bacteria 3460
45 Ga0070671_100181717 3300005355 Bacteria 1781
46 Ga0070674_100004110 3300005356 Bacteria 8268
47 Ga0070674_100013181 3300005356 Bacteria 5102
48 Ga0070674_100016261 3300005356 Bacteria 4662
49 Ga0070674_100029214 3300005356 Bacteria 3628
50 Ga0070674_100113907 3300005356 Bacteria 1991
51 Ga0070673_100013878 3300005364 Bacteria 5593
52 Ga0070673_100027661 3300005364 Bacteria 4206
53 Ga0070673_100062312 3300005364 Bacteria 2962
54 Ga0070688_100045154 3300005365 Bacteria 2721
55 Ga0070659_100031648 3300005366 Bacteria 4099
56 Ga0070659_100040238 3300005366 Bacteria 3652
57 Ga0070659_100106909 3300005366 Unclassified 2256
58 Ga0070659_100141256 3300005366 Bacteria 1961
59 Ga0070667_100107021 3300005367 Unclassified 2421
60 Ga0070667_100111495 3300005367 Bacteria 2373
61 Ga0070703_10053235 3300005406 Bacteria 1301
62 Ga0070709_10005969 3300005434 Bacteria 6615
63 Ga0070714_100005580 3300005435 Bacteria 9611
64 Ga0070713_100068087 3300005436 Bacteria 2999
65 Ga0070701_10064160 3300005438 Bacteria 1945
66 Ga0070711_100491912 3300005439 Bacteria 1010
67 Ga0070705_100002798 3300005440 Bacteria 8692
68 Ga0070700_100078075 3300005441 Bacteria 2131
69 Ga0070694_100026204 3300005444 Bacteria 3777
70 Ga0070694_100032239 3300005444 Bacteria 3441
71 Ga0070663_100025444 3300005455 Bacteria 3996
72 Ga0070678_100068555 3300005456 Bacteria 2645
73 Ga0070678_100274183 3300005456 Bacteria 1424
74 Ga0070678_100335366 3300005456 Bacteria 1295
75 Ga0070678_100506692 3300005456 Bacteria 1066
76 Ga0070662_100058242 3300005457 Bacteria 2811
77 Ga0070662_100243553 3300005457 Bacteria 1443
78 Ga0070681_10000926 3300005458 Bacteria 24766
79 Ga0070681_10083309 3300005458 Bacteria 3152
80 Ga0068867_100012153 3300005459 Bacteria 6083
81 Ga0068867_100122834 3300005459 Bacteria 2009
82 Ga0068867_100263557 3300005459 Bacteria 1406
83 Ga0068867_100421764 3300005459 Unclassified 1130
84 Ga0070685_10251569 3300005466 Bacteria 1171
85 Ga0070706_100418787 3300005467 Bacteria 1247
86 Ga0070698_100036699 3300005471 Bacteria 5060
87 Ga0070699_100001909 3300005518 Bacteria 18820
88 Ga0070699_100026285 3300005518 Bacteria 5021
89 Ga0070699_100106339 3300005518 Bacteria 2461
90 Ga0070699_100127402 3300005518 Bacteria 2242
91 Ga0070699_100429257 3300005518 Bacteria 1197
92 Ga0070679_100004319 3300005530 Bacteria 13121
93 Ga0070679_100011918 3300005530 Bacteria 8298
94 Ga0070679_100078509 3300005530 Bacteria 3290
95 Ga0070684_100004962 3300005535 Bacteria 10158
96 Ga0070697_100009170 3300005536 Bacteria 7730
97 Ga0070697_100309382 3300005536 Bacteria 1359
98 Ga0070672_100104734 3300005543 Bacteria 2299
99 Ga0070672_100209057 3300005543 Bacteria 1634
100 Ga0070672_100572968 3300005543 Bacteria 982
101 Ga0070686_100101555 3300005544 Bacteria 1944
102 Ga0070695_100375470 3300005545 Bacteria 1071
103 Ga0070696_100049557 3300005546 Bacteria 2918
104 Ga0070696_100121755 3300005546 Bacteria 1889
105 Ga0070696_100168876 3300005546 Bacteria 1616
106 Ga0070696_100172230 3300005546 Bacteria 1601
107 Ga0070696_100177722 3300005546 Bacteria 1577
108 Ga0070696_100466866 3300005546 Bacteria 999
109 Ga0070665_100002388 3300005548 Bacteria 20707
110 Ga0070665_100011930 3300005548 Bacteria 8775
111 Ga0070665_100020560 3300005548 Bacteria 6633
112 Ga0070665_100141628 3300005548 Bacteria 2408
113 Ga0070665_100155984 3300005548 Bacteria 2285
114 Ga0070665_100688057 3300005548 Bacteria 1036
115 Ga0070704_100012700 3300005549 Bacteria 5210
116 Ga0070704_100191158 3300005549 Bacteria 1646
117 Ga0070704_100282466 3300005549 Bacteria 1376
118 Ga0070704_100494334 3300005549 Bacteria 1060
119 Ga0068855_100012391 3300005563 Bacteria 10298
120 Ga0068855_100365133 3300005563 Bacteria 1588
121 Ga0068855_100433837 3300005563 Bacteria 1436
122 Ga0068855_100821161 3300005563 Bacteria 987
123 Ga0070664_100016603 3300005564 Bacteria 6039
124 Ga0070664_100620240 3300005564 Bacteria 1004
125 Ga0068857_100031800 3300005577 Bacteria 4663
126 Ga0068857_100035159 3300005577 Unclassified 4435
127 Ga0068857_100074183 3300005577 Bacteria 3032
128 Ga0068857_100136604 3300005577 Bacteria 2214
129 Ga0068857_100376270 3300005577 Bacteria 1318
130 Ga0068854_100041769 3300005578 Bacteria 3242
131 Ga0068856_100135664 3300005614 Bacteria 2466
132 Ga0070702_100002550 3300005615 Bacteria 7914
133 Ga0070702_100187064 3300005615 Bacteria 1360
134 Ga0070702_100361742 3300005615 Bacteria 1026
135 Ga0068852_100151934 3300005616 Bacteria 2154
136 Ga0068852_100334653 3300005616 Bacteria 1474
137 Ga0068852_100494163 3300005616 Bacteria 1218
138 Ga0068852_100635458 3300005616 Bacteria 1074
139 Ga0068859_100007450 3300005617 Bacteria 11108
140 Ga0068859_100098774 3300005617 Bacteria 2974
141 Ga0068859_100126142 3300005617 Bacteria 2629
142 Ga0068859_100129679 3300005617 Bacteria 2593
143 Ga0068859_100159471 3300005617 Bacteria 2335
144 Ga0068859_100179144 3300005617 Bacteria 2202
145 Ga0068859_100339899 3300005617 Unclassified 1595
146 Ga0068859_100502168 3300005617 Bacteria 1308
147 Ga0068859_100512147 3300005617 Bacteria 1295
148 Ga0068864_100002331 3300005618 Bacteria 15700
149 Ga0068864_100181810 3300005618 Bacteria 1923
150 Ga0068866_10031971 3300005718 Bacteria 2540
151 Ga0068866_10376127 3300005718 Bacteria 910
152 Ga0068861_100042593 3300005719 Bacteria 3403
153 Ga0068861_100069944 3300005719 Bacteria 2716
154 Ga0068861_100120796 3300005719 Bacteria 2113
155 Ga0068861_100139279 3300005719 Bacteria 1979
156 Ga0068861_100173727 3300005719 Unclassified 1788
157 Ga0068851_10012457 3300005834 Bacteria 4009
158 Ga0068851_10147182 3300005834 Bacteria 1285
159 Ga0068851_10243411 3300005834 Bacteria 1018
160 Ga0068870_10174164 3300005840 Bacteria 1286
161 Ga0068870_10468662 3300005840 Bacteria 833
162 Ga0068863_100002769 3300005841 Bacteria 17372
163 Ga0068858_100004373 3300005842 Bacteria 13863
164 Ga0068858_100059383 3300005842 Bacteria 3535
165 Ga0068858_100082360 3300005842 Bacteria 2991
166 Ga0068858_100090245 3300005842 Bacteria 2851
167 Ga0068858_100201577 3300005842 Bacteria 1882
168 Ga0068858_100258942 3300005842 Bacteria 1653
169 Ga0068860_100015275 3300005843 Bacteria 7498
170 Ga0068860_100120977 3300005843 Bacteria 2507
171 Ga0068860_100165554 3300005843 Bacteria 2134
172 Ga0068860_100179743 3300005843 Bacteria 2045
173 Ga0068862_100006398 3300005844 Bacteria 9794
174 Ga0068862_100038506 3300005844 Bacteria 4055
175 Ga0068862_100041431 3300005844 Bacteria 3918
176 Ga0068862_100187938 3300005844 Bacteria 1857
177 Ga0081455_10015599 3300005937 Bacteria 7373
178 Ga0081539_10000134 3300005985 Bacteria 173625
179 Ga0081539_10004230 3300005985 Bacteria 16158
180 Ga0075365_10166712 3300006038 Bacteria 1537
181 Ga0075368_10006201 3300006042 Bacteria 4165
182 Ga0075368_10008321 3300006042 Bacteria 3688
183 Ga0075368_10015026 3300006042 Bacteria 2866
184 Ga0075368_10030498 3300006042 Bacteria 2088
185 Ga0075368_10043404 3300006042 Bacteria 1772
186 Ga0075368_10049219 3300006042 Bacteria 1671
187 Ga0075363_100269900 3300006048 Bacteria 982
188 Ga0075364_10075354 3300006051 Bacteria 2226
189 Ga0075364_10087250 3300006051 Bacteria 2068
190 Ga0075364_10100966 3300006051 Bacteria 1921
191 Ga0075364_10309092 3300006051 Bacteria 1076
192 Ga0070716_100212783 3300006173 Bacteria 1293
193 Ga0070712_100141451 3300006175 Unclassified 1837
194 Ga0075362_10001628 3300006177 Bacteria 7284
195 Ga0075367_10003716 3300006178 Bacteria 7337
196 Ga0075367_10052953 3300006178 Bacteria 2404
197 Ga0075367_10058732 3300006178 Bacteria 2289
198 Ga0075367_10077466 3300006178 Bacteria 2007
199 Ga0075367_10120471 3300006178 Bacteria 1617
200 Ga0075366_10002531 3300006195 Bacteria 9396
201 Ga0075366_10005295 3300006195 Bacteria 6987
202 Ga0075366_10016996 3300006195 Bacteria 4183
203 Ga0075366_10043181 3300006195 Bacteria 2670
204 Ga0075366_10088494 3300006195 Bacteria 1854
205 Ga0097621_100043964 3300006237 Bacteria 3602
206 Ga0097621_100162623 3300006237 Bacteria 1920
207 Ga0097621_100733546 3300006237 Bacteria 911
208 Ga0075370_10010509 3300006353 Bacteria 4841
209 Ga0075370_10034756 3300006353 Bacteria 2826
210 Ga0075370_10091048 3300006353 Bacteria 1759
211 Ga0068871_100000311 3300006358 Bacteria 33811
212 Ga0068871_100001175 3300006358 Bacteria 17558
213 Ga0068871_100001401 3300006358 Bacteria 16134
214 Ga0068871_100020021 3300006358 Bacteria 5119
215 Ga0068871_100059848 3300006358 Bacteria 3105
216 Ga0068871_100098440 3300006358 Bacteria 2447
217 Ga0068871_100261059 3300006358 Bacteria 1511
218 Ga0068871_100822031 3300006358 Bacteria 857
219 Ga0075428_100000005 3300006844 Bacteria 326130
220 Ga0075428_100000058 3300006844 Bacteria 89652
221 Ga0075428_100000393 3300006844 Bacteria 43253
222 Ga0075428_100003359 3300006844 Bacteria 17508
223 Ga0075428_100003840 3300006844 Bacteria 16498
224 Ga0075428_100122982 3300006844 Bacteria 2824
225 Ga0075428_100141059 3300006844 Bacteria 2620
226 Ga0075428_100205494 3300006844 Bacteria 2128
227 Ga0075428_100250326 3300006844 Bacteria 1910
228 Ga0075428_100375394 3300006844 Bacteria 1524
229 Ga0075428_100433870 3300006844 Bacteria 1408
230 Ga0075430_100000961 3300006846 Bacteria 22714
231 Ga0075430_100002136 3300006846 Bacteria 16365
232 Ga0075430_100183680 3300006846 Bacteria 1739
233 Ga0075430_100202005 3300006846 Bacteria 1650
234 Ga0075430_100308565 3300006846 Bacteria 1308
235 Ga0075431_100000575 3300006847 Bacteria 31085
236 Ga0075431_100010853 3300006847 Bacteria 9164
237 Ga0075431_100011056 3300006847 Bacteria 9084
238 Ga0075431_100051771 3300006847 Bacteria 4233
239 Ga0075431_100074509 3300006847 Bacteria 3502
240 Ga0075431_100095350 3300006847 Bacteria 3071
241 Ga0075431_100121856 3300006847 Bacteria 2691
242 Ga0075431_100209841 3300006847 Bacteria 1990
243 Ga0075431_100333825 3300006847 Bacteria 1527
244 Ga0075431_100596420 3300006847 Bacteria 1089
245 Ga0075433_10008097 3300006852 Bacteria 8371
246 Ga0075433_10048176 3300006852 Bacteria 3706
247 Ga0075433_10073924 3300006852 Bacteria 2999
248 Ga0075433_10075701 3300006852 Bacteria 2962
249 Ga0075433_10232396 3300006852 Bacteria 1637
250 Ga0075434_100000097 3300006871 Bacteria 48724
251 Ga0075434_100006466 3300006871 Bacteria 10738
252 Ga0075434_100011003 3300006871 Bacteria 8510
253 Ga0075434_100238444 3300006871 Bacteria 1839
254 Ga0075434_100241077 3300006871 Bacteria 1828
255 Ga0075434_100348568 3300006871 Bacteria 1502
256 Ga0075434_100352848 3300006871 Unclassified 1492
257 Ga0075434_100584184 3300006871 Bacteria 1136
258 Ga0075429_100014206 3300006880 Bacteria 6902
259 Ga0075429_100016751 3300006880 Bacteria 6347
260 Ga0075429_100025416 3300006880 Bacteria 5140
261 Ga0075429_100247785 3300006880 Bacteria 1560
262 Ga0068865_100087891 3300006881 Bacteria 2247
263 Ga0068865_100109557 3300006881 Bacteria 2035
264 Ga0068865_100463731 3300006881 Bacteria 1050
265 Ga0068865_100531866 3300006881 Bacteria 985
266 Ga0075436_100000341 3300006914 Bacteria 29776
267 Ga0075436_100070336 3300006914 Bacteria 2419
268 Ga0075436_100168789 3300006914 Bacteria 1545
269 Ga0075436_100229181 3300006914 Bacteria 1319
270 Ga0075436_100407399 3300006914 Bacteria 986
271 Ga0075436_100465916 3300006914 Bacteria 921
272 Ga0097620_100007450 3300006931 Bacteria 11108
273 Ga0097620_100098770 3300006931 Bacteria 2974
274 Ga0097620_100126141 3300006931 Bacteria 2629
275 Ga0097620_100129684 3300006931 Bacteria 2593
276 Ga0097620_100159473 3300006931 Bacteria 2335
277 Ga0097620_100179144 3300006931 Bacteria 2202
278 Ga0097620_100339897 3300006931 Unclassified 1595
279 Ga0097620_100502220 3300006931 Bacteria 1308
280 Ga0097620_100512155 3300006931 Bacteria 1295
281 Ga0075435_100000149 3300007076 Bacteria 39747
282 Ga0075435_100000353 3300007076 Bacteria 28240
283 Ga0075435_100003692 3300007076 Bacteria 10429
284 Ga0075435_100006608 3300007076 Bacteria 8210
285 Ga0075435_100022199 3300007076 Bacteria 4893
286 Ga0075435_100066617 3300007076 Bacteria 2930
287 Ga0105240_10029559 3300009093 Bacteria 7136
288 Ga0105240_10089310 3300009093 Bacteria 3769
289 Ga0105240_10229418 3300009093 Bacteria 2159
290 Ga0111539_10000008 3300009094 Bacteria 382609
291 Ga0111539_10000870 3300009094 Bacteria 39436
292 Ga0111539_10001659 3300009094 Bacteria 29730
293 Ga0111539_10015435 3300009094 Bacteria 9501
294 Ga0111539_10049518 3300009094 Bacteria 5009
295 Ga0111539_10110764 3300009094 Bacteria 3222
296 Ga0111539_10133652 3300009094 Bacteria 2905
297 Ga0111539_10150316 3300009094 Bacteria 2726
298 Ga0111539_10351369 3300009094 Bacteria 1716
299 Ga0105245_10017756 3300009098 Bacteria 6210
300 Ga0105247_10004063 3300009101 Bacteria 9407
301 Ga0105247_10009654 3300009101 Bacteria 5853
302 Ga0105247_10074714 3300009101 Bacteria 2126
303 Ga0114129_10000857 3300009147 Bacteria 39461
304 Ga0114129_10001588 3300009147 Bacteria 30837
305 Ga0114129_10002431 3300009147 Bacteria 25841
306 Ga0114129_10002846 3300009147 Bacteria 24191
307 Ga0114129_10003568 3300009147 Bacteria 21908
308 Ga0114129_10007307 3300009147 Bacteria 15733
309 Ga0114129_10007344 3300009147 Bacteria 15689
310 Ga0114129_10011380 3300009147 Bacteria 12673
311 Ga0114129_10012896 3300009147 Bacteria 11893
312 Ga0114129_10020281 3300009147 Bacteria 9460
313 Ga0114129_10031490 3300009147 Bacteria 7497
314 Ga0114129_10082829 3300009147 Bacteria 4457
315 Ga0114129_10139677 3300009147 Bacteria 3322
316 Ga0114129_10164462 3300009147 Bacteria 3029
317 Ga0114129_10478624 3300009147 Bacteria 1629
318 Ga0114129_10706169 3300009147 Bacteria 1295
319 Ga0105243_10148705 3300009148 Bacteria 2007
320 Ga0105243_10375916 3300009148 Bacteria 1312
321 Ga0105243_10531982 3300009148 Bacteria 1120
322 Ga0105241_10034621 3300009174 Bacteria 3795
323 Ga0105242_10106002 3300009176 Bacteria 2388
324 Ga0105242_10145345 3300009176 Bacteria 2062
325 Ga0105242_10426555 3300009176 Bacteria 1244
326 Ga0105242_10929016 3300009176 Bacteria 872
327 Ga0105248_10001544 3300009177 Bacteria 25631
328 Ga0105248_10039996 3300009177 Bacteria 5255
329 Ga0105248_10060919 3300009177 Bacteria 4237
330 Ga0105248_10107738 3300009177 Bacteria 3142
331 Ga0105248_10120391 3300009177 Bacteria 2961
332 Ga0105248_10155987 3300009177 Bacteria 2576
333 Ga0105248_10204531 3300009177 Bacteria 2225
334 Ga0105248_10239997 3300009177 Bacteria 2040
335 Ga0105248_10326019 3300009177 Bacteria 1730
336 Ga0105248_10330723 3300009177 Bacteria 1716
337 Ga0105248_10437913 3300009177 Bacteria 1472
338 Ga0105248_10802358 3300009177 Bacteria 1062
339 Ga0105237_10067887 3300009545 Bacteria 3559
340 Ga0105237_10632057 3300009545 Bacteria 1077
341 Ga0105238_10276115 3300009551 Bacteria 1661
342 Ga0105238_10643174 3300009551 Bacteria 1070
343 Ga0105238_10890894 3300009551 Bacteria 908
344 Ga0105249_10000230 3300009553 Bacteria 63452
345 Ga0105249_10021476 3300009553 Bacteria 5779
346 Ga0105249_10121381 3300009553 Bacteria 2483
347 Ga0105249_10146581 3300009553 Bacteria 2269
348 Ga0105249_10206917 3300009553 Bacteria 1923
349 Ga0105249_10409841 3300009553 Bacteria 1387
350 Ga0105249_10492498 3300009553 Bacteria 1270
351 Ga0105249_10534352 3300009553 Bacteria 1221
352 Ga0105249_10548909 3300009553 Bacteria 1206
353 Ga0157338_1012247 3300012515 Bacteria 894
354 Ga0157369_10220617 3300013105 Bacteria 1985
355 Ga0157374_10022217 3300013296 Bacteria 5658
356 Ga0157374_10116185 3300013296 Bacteria 2578
357 Ga0157374_10206977 3300013296 Bacteria 1923
358 Ga0157374_10951007 3300013296 Bacteria 878
359 Ga0157374_11048210 3300013296 Bacteria 835
360 Ga0157378_10002694 3300013297 Bacteria 15816
361 Ga0157378_10136504 3300013297 Bacteria 2274
362 Ga0157378_10175247 3300013297 Bacteria 2014
363 Ga0163162_10045801 3300013306 Bacteria 4382
364 Ga0163162_10050707 3300013306 Bacteria 4162
365 Ga0163162_10072255 3300013306 Bacteria 3505
366 Ga0163162_10504752 3300013306 Bacteria 1340
367 Ga0163162_10516635 3300013306 Bacteria 1324
368 Ga0157372_10257465 3300013307 Bacteria 2026
369 Ga0157372_10395267 3300013307 Bacteria 1611
370 Ga0157372_10685061 3300013307 Unclassified 1193
371 Ga0157375_10130402 3300013308 Bacteria 2633
372 Ga0157375_10607939 3300013308 Bacteria 1252
373 Ga0163163_10066121 3300014325 Bacteria 3590
374 Ga0163163_10181899 3300014325 Bacteria 2149
375 Ga0163163_10378538 3300014325 Bacteria 1473
376 Ga0157380_10007520 3300014326 Bacteria 7739
377 Ga0157380_10249172 3300014326 Bacteria 1607
378 Ga0157380_10345238 3300014326 Bacteria 1390
379 Ga0157377_10047416 3300014745 Unclassified 2407
380 Ga0157377_10272060 3300014745 Bacteria 1106
381 Ga0157379_10015268 3300014968 Bacteria 6736
382 Ga0157379_10019035 3300014968 Bacteria 6061
383 Ga0157379_10032311 3300014968 Bacteria 4666
384 Ga0157379_10086614 3300014968 Bacteria 2809
385 Ga0157376_10058632 3300014969 Bacteria 3226
386 Ga0157376_10139153 3300014969 Bacteria 2175
387 Ga0157376_10252275 3300014969 Bacteria 1649
388 Ga0157376_10255992 3300014969 Bacteria 1637
389 Ga0157376_10264502 3300014969 Bacteria 1613
390 Ga0157376_10635233 3300014969 Bacteria 1066
391 Ga0163161_10119870 3300017792 Bacteria 1976
392 Ga0207697_10001789 3300025315 Bacteria 11503
393 Ga0207697_10033250 3300025315 Bacteria 2111
394 Ga0207697_10047374 3300025315 Bacteria 1772
395 Ga0207697_10098678 3300025315 Bacteria 1244
396 Ga0207697_10101759 3300025315 Bacteria 1225
397 Ga0207656_10184929 3300025321 Bacteria 1001
398 Ga0207682_10008627 3300025893 Bacteria 4029
399 Ga0207682_10176767 3300025893 Bacteria 973
400 Ga0207642_10066487 3300025899 Bacteria 1698
401 Ga0207642_10121482 3300025899 Bacteria 1348
402 Ga0207710_10006090 3300025900 Bacteria 5166
403 Ga0207688_10012956 3300025901 Bacteria 4533
404 Ga0207688_10223479 3300025901 Bacteria 1135
405 Ga0207680_10041353 3300025903 Bacteria 2689
406 Ga0207680_10388586 3300025903 Bacteria 985
407 Ga0207699_10132996 3300025906 Bacteria 1625
408 Ga0207699_10179255 3300025906 Bacteria 1423
409 Ga0207699_10186182 3300025906 Bacteria 1398
410 Ga0207645_10025836 3300025907 Bacteria 3799
411 Ga0207645_10029309 3300025907 Bacteria 3549
412 Ga0207645_10084457 3300025907 Bacteria 2037
413 Ga0207645_10124044 3300025907 Unclassified 1678
414 Ga0207645_10165916 3300025907 Bacteria 1446
415 Ga0207645_10222407 3300025907 Unclassified 1245
416 Ga0207643_10354669 3300025908 Bacteria 921
417 Ga0207705_10024227 3300025909 Bacteria 4332
418 Ga0207705_10084207 3300025909 Bacteria 2321
419 Ga0207654_10018368 3300025911 Bacteria 3668
420 Ga0207707_10008909 3300025912 Bacteria 8713
421 Ga0207707_10053566 3300025912 Bacteria 3512
422 Ga0207707_10067600 3300025912 Bacteria 3113
423 Ga0207707_10181612 3300025912 Bacteria 1837
424 Ga0207707_10334464 3300025912 Bacteria 1306
425 Ga0207707_10469631 3300025912 Unclassified 1075
426 Ga0207695_10431254 3300025913 Bacteria 1202
427 Ga0207695_10655950 3300025913 Bacteria 930
428 Ga0207671_10423519 3300025914 Bacteria 1059
429 Ga0207663_10142973 3300025916 Bacteria 1669
430 Ga0207663_10365801 3300025916 Bacteria 1095
431 Ga0207662_10150419 3300025918 Bacteria 1480
432 Ga0207657_10000448 3300025919 Bacteria 43812
433 Ga0207657_10228233 3300025919 Bacteria 1490
434 Ga0207649_10005573 3300025920 Bacteria 6809
435 Ga0207652_10015551 3300025921 Bacteria 6190
436 Ga0207652_10418661 3300025921 Bacteria 1208
437 Ga0207646_10122638 3300025922 Bacteria 2335
438 Ga0207681_10005166 3300025923 Bacteria 8015
439 Ga0207681_10035629 3300025923 Bacteria 3280
440 Ga0207681_10045292 3300025923 Bacteria 2953
441 Ga0207681_10055414 3300025923 Bacteria 2700
442 Ga0207681_10070953 3300025923 Bacteria 2428
443 Ga0207681_10118295 3300025923 Bacteria 1939
444 Ga0207681_10186256 3300025923 Bacteria 1585
445 Ga0207694_10270522 3300025924 Bacteria 1394
446 Ga0207694_10318853 3300025924 Bacteria 1282
447 Ga0207694_10627871 3300025924 Bacteria 904
448 Ga0207650_10010475 3300025925 Bacteria 6358
449 Ga0207650_10019816 3300025925 Bacteria 4733
450 Ga0207650_10030655 3300025925 Bacteria 3876
451 Ga0207650_10050169 3300025925 Bacteria 3085
452 Ga0207650_10101322 3300025925 Bacteria 2217
453 Ga0207650_10376426 3300025925 Bacteria 1172
454 Ga0207650_10474982 3300025925 Bacteria 1043
455 Ga0207650_10492388 3300025925 Bacteria 1024
456 Ga0207659_10000075 3300025926 Bacteria 63221
457 Ga0207659_10046961 3300025926 Bacteria 3052
458 Ga0207659_10073247 3300025926 Bacteria 2507
459 Ga0207659_10131379 3300025926 Bacteria 1933
460 Ga0207659_10201429 3300025926 Bacteria 1590
461 Ga0207659_10215185 3300025926 Bacteria 1542
462 Ga0207659_10324321 3300025926 Bacteria 1271
463 Ga0207687_10031240 3300025927 Bacteria 3598
464 Ga0207700_10014085 3300025928 Bacteria 5229
465 Ga0207700_10047062 3300025928 Bacteria 3195
466 Ga0207664_10838521 3300025929 Bacteria 826
467 Ga0207644_10085382 3300025931 Bacteria 2341
468 Ga0207644_10119773 3300025931 Bacteria 2002
469 Ga0207644_10123990 3300025931 Bacteria 1970
470 Ga0207644_10193296 3300025931 Bacteria 1601
471 Ga0207644_10200216 3300025931 Bacteria 1575
472 Ga0207644_10490773 3300025931 Bacteria 1012
473 Ga0207690_10010646 3300025932 Bacteria 5480
474 Ga0207690_10128797 3300025932 Bacteria 1849
475 Ga0207690_10142243 3300025932 Bacteria 1769
476 Ga0207706_10042267 3300025933 Bacteria 4040
477 Ga0207706_10050254 3300025933 Bacteria 3685
478 Ga0207706_10059061 3300025933 Bacteria 3378
479 Ga0207706_10074877 3300025933 Bacteria 2977
480 Ga0207706_10086215 3300025933 Bacteria 2760
481 Ga0207706_10143615 3300025933 Bacteria 2100
482 Ga0207706_10195597 3300025933 Bacteria 1774
483 Ga0207686_10017235 3300025934 Bacteria 4067
484 Ga0207686_10046573 3300025934 Bacteria 2676
485 Ga0207709_10030752 3300025935 Bacteria 3127
486 Ga0207670_10092069 3300025936 Bacteria 2145
487 Ga0207670_10220217 3300025936 Bacteria 1452
488 Ga0207670_10273572 3300025936 Bacteria 1314
489 Ga0207670_10465436 3300025936 Bacteria 1021
490 Ga0207669_10010135 3300025937 Bacteria 4526
491 Ga0207669_10022027 3300025937 Bacteria 3377
492 Ga0207669_10089728 3300025937 Bacteria 1997
493 Ga0207669_10334755 3300025937 Bacteria 1163
494 Ga0207669_10381261 3300025937 Unclassified 1099
495 Ga0207704_10022928 3300025938 Bacteria 3355
496 Ga0207704_10076942 3300025938 Bacteria 2140
497 Ga0207704_10547202 3300025938 Bacteria 940
498 Ga0207704_10700042 3300025938 Bacteria 839
499 Ga0207665_10168135 3300025939 Bacteria 1582
500 Ga0207665_10473583 3300025939 Bacteria 964
501 Ga0207691_10008868 3300025940 Bacteria 9654
502 Ga0207691_10043122 3300025940 Bacteria 4158
503 Ga0207691_10060975 3300025940 Bacteria 3427
504 Ga0207691_10074037 3300025940 Unclassified 3072
505 Ga0207691_10074726 3300025940 Bacteria 3056
506 Ga0207691_10080538 3300025940 Bacteria 2929
507 Ga0207691_10104282 3300025940 Bacteria 2527
508 Ga0207691_10115755 3300025940 Bacteria 2380
509 Ga0207691_10238176 3300025940 Unclassified 1574
510 Ga0207691_10285351 3300025940 Bacteria 1420
511 Ga0207691_10364411 3300025940 Bacteria 1235
512 Ga0207691_10451550 3300025940 Bacteria 1094
513 Ga0207711_10049002 3300025941 Bacteria 3615
514 Ga0207711_10169824 3300025941 Bacteria 1978
515 Ga0207711_10212493 3300025941 Bacteria 1767
516 Ga0207711_10252936 3300025941 Bacteria 1618
517 Ga0207711_10559930 3300025941 Bacteria 1066
518 Ga0207689_10073252 3300025942 Unclassified 2814
519 Ga0207689_10110604 3300025942 Unclassified 2258
520 Ga0207689_10164587 3300025942 Bacteria 1828
521 Ga0207661_10000567 3300025944 Bacteria 23624
522 Ga0207661_10109351 3300025944 Bacteria 2335
523 Ga0207661_10351773 3300025944 Bacteria 1329
524 Ga0207661_10746585 3300025944 Bacteria 901
525 Ga0207679_10768687 3300025945 Bacteria 877
526 Ga0207679_10885148 3300025945 Bacteria 816
527 Ga0207667_10187506 3300025949 Bacteria 2123
528 Ga0207667_10373609 3300025949 Bacteria 1453
529 Ga0207651_10003088 3300025960 Bacteria 8094
530 Ga0207651_10007158 3300025960 Bacteria 5929
531 Ga0207651_10041239 3300025960 Bacteria 3062
532 Ga0207651_10113781 3300025960 Bacteria 2037
533 Ga0207651_10235469 3300025960 Bacteria 1489
534 Ga0207651_10647646 3300025960 Bacteria 927
535 Ga0207712_10037150 3300025961 Unclassified 3322
536 Ga0207712_10088135 3300025961 Bacteria 2278
537 Ga0207712_10179183 3300025961 Bacteria 1663
538 Ga0207712_10183835 3300025961 Bacteria 1644
539 Ga0207712_10238209 3300025961 Bacteria 1464
540 Ga0207712_10480878 3300025961 Bacteria 1059
541 Ga0207668_10027164 3300025972 Bacteria 3727
542 Ga0207668_10059144 3300025972 Bacteria 2683
543 Ga0207668_10260717 3300025972 Bacteria 1412
544 Ga0207668_10584716 3300025972 Bacteria 971
545 Ga0207668_10652318 3300025972 Bacteria 921
546 Ga0207640_10018088 3300025981 Bacteria 4134
547 Ga0207640_10205248 3300025981 Bacteria 1497
548 Ga0207658_10105861 3300025986 Unclassified 2213
549 Ga0207658_10194292 3300025986 Bacteria 1690
550 Ga0207658_10227832 3300025986 Bacteria 1571
551 Ga0207658_10320168 3300025986 Unclassified 1342
552 Ga0207677_10149796 3300026023 Bacteria 1798
553 Ga0207677_10226155 3300026023 Bacteria 1504
554 Ga0207677_10367257 3300026023 Bacteria 1211
555 Ga0207677_10459286 3300026023 Bacteria 1093
556 Ga0207703_10022323 3300026035 Bacteria 4962
557 Ga0207703_10025748 3300026035 Bacteria 4629
558 Ga0207703_10039878 3300026035 Bacteria 3755
559 Ga0207703_10048252 3300026035 Bacteria 3436
560 Ga0207703_10069074 3300026035 Bacteria 2913
561 Ga0207703_10079485 3300026035 Bacteria 2729
562 Ga0207703_10314452 3300026035 Bacteria 1432
563 Ga0207639_10227673 3300026041 Bacteria 1614
564 Ga0207639_10761473 3300026041 Bacteria 901
565 Ga0207678_10043158 3300026067 Bacteria 3903
566 Ga0207678_10150138 3300026067 Bacteria 1989
567 Ga0207678_10255437 3300026067 Bacteria 1501
568 Ga0207678_10568104 3300026067 Bacteria 993
569 Ga0207708_10008877 3300026075 Bacteria 7440
570 Ga0207708_10083007 3300026075 Bacteria 2463
571 Ga0207708_10481808 3300026075 Bacteria 1037
572 Ga0207708_10581270 3300026075 Bacteria 947
573 Ga0207702_10581927 3300026078 Unclassified 1097
574 Ga0207641_10003428 3300026088 Bacteria 14048
575 Ga0207641_10423443 3300026088 Bacteria 1282
576 Ga0207648_10076215 3300026089 Bacteria 2923
577 Ga0207648_10348190 3300026089 Bacteria 1335
578 Ga0207648_10464246 3300026089 Bacteria 1154
579 Ga0207676_10086647 3300026095 Bacteria 2559
580 Ga0207676_10657044 3300026095 Unclassified 1012
581 Ga0207674_10029982 3300026116 Bacteria 5723
582 Ga0207674_10035104 3300026116 Bacteria 5235
583 Ga0207674_10103058 3300026116 Bacteria 2833
584 Ga0207674_10331875 3300026116 Bacteria 1471
585 Ga0207674_10339166 3300026116 Bacteria 1453
586 Ga0207674_10356077 3300026116 Bacteria 1415
587 Ga0207675_100001961 3300026118 Bacteria 20530
588 Ga0207675_100034443 3300026118 Bacteria 4722
589 Ga0207675_100053359 3300026118 Bacteria 3772
590 Ga0207675_100055856 3300026118 Bacteria 3684
591 Ga0207675_100076709 3300026118 Bacteria 3130
592 Ga0207675_100084029 3300026118 Bacteria 2987
593 Ga0207675_100125120 3300026118 Bacteria 2435
594 Ga0207675_100762200 3300026118 Bacteria 979
595 Ga0207675_101052628 3300026118 Bacteria 833
596 Ga0207683_10009776 3300026121 Bacteria 8175
597 Ga0207683_10023171 3300026121 Bacteria 5336
598 Ga0207683_10023218 3300026121 Bacteria 5332
599 Ga0207683_10126635 3300026121 Bacteria 2296
600 Ga0207683_10130214 3300026121 Bacteria 2263
601 Ga0207683_10201478 3300026121 Bacteria 1809
602 Ga0207683_10297817 3300026121 Bacteria 1476
603 Ga0207683_10650726 3300026121 Bacteria 976
604 Ga0207683_10746296 3300026121 Bacteria 908
605 Ga0207698_10151658 3300026142 Bacteria 2013
606 Ga0207698_10504839 3300026142 Bacteria 1178
607 Ga0207698_10506609 3300026142 Bacteria 1176
608 Ga0207698_10813027 3300026142 Bacteria 937
609 Ga0209983_1007398 3300027665 Bacteria 2251
610 Ga0209971_1037486 3300027682 Bacteria 1167
611 Ga0209974_10044943 3300027876 Bacteria 1474
612 Ga0207428_10000285 3300027907 Bacteria 68342
613 Ga0207428_10001407 3300027907 Bacteria 25352
614 Ga0207428_10018231 3300027907 Bacteria 5999
615 Ga0207428_10025243 3300027907 Bacteria 4975
616 Ga0207428_10059452 3300027907 Bacteria 3031
617 Ga0207428_10064360 3300027907 Bacteria 2895
618 Ga0207428_10069091 3300027907 Bacteria 2777
619 Ga0207428_10120655 3300027907 Bacteria 2010
620 Ga0207428_10173511 3300027907 Bacteria 1632
621 Ga0207428_10247580 3300027907 Bacteria 1330
622 Ga0207428_10385513 3300027907 Bacteria 1028
623 Ga0268266_10006901 3300028379 Bacteria 10335
624 Ga0268266_10041832 3300028379 Bacteria 3912
625 Ga0268266_10045819 3300028379 Bacteria 3743
626 Ga0268266_10113898 3300028379 Bacteria 2399
627 Ga0268266_10195239 3300028379 Bacteria 1850
628 Ga0268266_10215536 3300028379 Bacteria 1762
629 Ga0268266_10306004 3300028379 Bacteria 1484
630 Ga0268265_10010217 3300028380 Bacteria 6337
631 Ga0268265_10069855 3300028380 Bacteria 2729
632 Ga0268265_10074816 3300028380 Bacteria 2651
633 Ga0268265_10326541 3300028380 Bacteria 1392
634 Ga0268264_10044786 3300028381 Bacteria 3671
635 Ga0268264_10052704 3300028381 Bacteria 3393
636 Ga0268264_10085886 3300028381 Bacteria 2702
637 Ga0268264_10123523 3300028381 Bacteria 2285
638 Ga0268264_10151292 3300028381 Bacteria 2081
639 Ga0268264_10594460 3300028381 Bacteria 1090
640 Ga0265328_10033986 3300031239 Bacteria 1889
641 Ga0307408_100007220 3300031548 Bacteria 7348
642 Ga0307408_100051756 3300031548 Bacteria 2960
643 Ga0307408_100070001 3300031548 Bacteria 2589
644 Ga0307408_100108344 3300031548 Bacteria 2129
645 Ga0307408_100157043 3300031548 Bacteria 1803
646 Ga0307408_100224027 3300031548 Unclassified 1536
647 Ga0307408_100300294 3300031548 Bacteria 1345
648 Ga0307408_100370135 3300031548 Bacteria 1222
649 Ga0265314_10048897 3300031711 Bacteria 2964
650 Ga0307405_10000638 3300031731 Bacteria 13469
651 Ga0307405_10060249 3300031731 Bacteria 2395
652 Ga0307405_10182484 3300031731 Bacteria 1508
653 Ga0307405_10188354 3300031731 Bacteria 1488
654 Ga0307405_10484962 3300031731 Unclassified 987
655 Ga0307405_10542716 3300031731 Bacteria 939
656 Ga0307413_10163002 3300031824 Bacteria 1568
657 Ga0307413_10525052 3300031824 Bacteria 955
658 Ga0307410_10005295 3300031852 Bacteria 6809
659 Ga0307410_10005377 3300031852 Bacteria 6771
660 Ga0307410_10013809 3300031852 Bacteria 4727
661 Ga0307410_10103370 3300031852 Bacteria 2046
662 Ga0307410_10249638 3300031852 Bacteria 1379
663 Ga0307406_10050379 3300031901 Bacteria 2640
664 Ga0307406_10088306 3300031901 Bacteria 2080
665 Ga0307406_10273985 3300031901 Bacteria 1283
666 Ga0307406_10457589 3300031901 Bacteria 1025
667 Ga0307406_10677116 3300031901 Bacteria 859
668 Ga0307407_10430208 3300031903 Bacteria 953
669 Ga0307407_10487481 3300031903 Bacteria 901
670 Ga0307412_10019250 3300031911 Bacteria 4128
671 Ga0307412_10041236 3300031911 Bacteria 2991
672 Ga0307412_10120582 3300031911 Bacteria 1887
673 Ga0307409_100003656 3300031995 Bacteria 8414
674 Ga0307409_100027858 3300031995 Bacteria 4013
675 Ga0307409_100080729 3300031995 Bacteria 2626
676 Ga0307409_100095181 3300031995 Bacteria 2453
677 Ga0307409_100135409 3300031995 Bacteria 2113
678 Ga0307409_100268120 3300031995 Bacteria 1571
679 Ga0307409_100269896 3300031995 Bacteria 1566
680 Ga0307409_100805854 3300031995 Bacteria 947
681 Ga0307409_100947220 3300031995 Bacteria 877
682 Ga0307409_101103675 3300031995 Bacteria 814
683 Ga0307416_100003391 3300032002 Bacteria 9341
684 Ga0307416_100005385 3300032002 Bacteria 7857
685 Ga0307416_100027297 3300032002 Bacteria 4225
686 Ga0307416_100046391 3300032002 Bacteria 3428
687 Ga0307416_100069563 3300032002 Bacteria 2913
688 Ga0307416_100152269 3300032002 Bacteria 2123
689 Ga0307416_100229856 3300032002 Bacteria 1787
690 Ga0307416_100393702 3300032002 Bacteria 1420
691 Ga0307416_100481589 3300032002 Bacteria 1301
692 Ga0307416_100493573 3300032002 Bacteria 1287
693 Ga0307414_10022618 3300032004 Bacteria 3970
694 Ga0307414_10032519 3300032004 Bacteria 3436
695 Ga0307414_10386875 3300032004 Bacteria 1211
696 Ga0307411_10015778 3300032005 Bacteria 4255
697 Ga0307411_10049207 3300032005 Bacteria 2738
698 Ga0307411_10137405 3300032005 Bacteria 1797
699 Ga0307411_10167183 3300032005 Bacteria 1654
700 Ga0307411_10181406 3300032005 Bacteria 1598
701 Ga0307411_10254152 3300032005 Bacteria 1384
702 Ga0307411_10359268 3300032005 Bacteria 1190
703 Ga0307411_10448320 3300032005 Bacteria 1079
704 Ga0307415_100008737 3300032126 Bacteria 5634
705 Ga0307415_100045149 3300032126 Bacteria 2952
706 Ga0307415_100144515 3300032126 Bacteria 1821
707 Ga0307415_100213929 3300032126 Bacteria 1540
708 Ga0307415_100555032 3300032126 Bacteria 1014
709 Ga0373930_0000510 3300034816 Bacteria 5340
710 Ga0373950_0002125 3300034818 Bacteria 2695
711 Ga0373959_0047853 3300034820 Bacteria 916
712 Ga0373938_0000206 3300034957 Bacteria 8908
713 Ga0373926_0020790 3300035083 Bacteria 2269
714 Ga0373928_0000674 3300035084 Bacteria 6702
715 Ga0373934_0000502 3300035086 Bacteria 13724
716 Ga0373949_0005185 3300035090 Bacteria 2922
717 Ga0373951_0006467 3300035091 Bacteria 2680
718 Ga0373952_0001452 3300035092 Bacteria 4312
719 Ga0373923_0045461 3300035111 Bacteria 1824
720 Ga0373932_0000234 3300035112 Bacteria 16783
721 Ga0373936_0189322 3300035113 Bacteria 905
722 Ga0373939_0010538 3300035114 Bacteria 2314
723 Ga0373939_0010583 3300035114 Bacteria 2310
724 Ga0373941_0000681 3300035115 Bacteria 6910
725 Ga0373945_0012349 3300035116 Bacteria 2836
726 Ga0373945_0112480 3300035116 Unclassified 1075
727 Ga0373945_0117659 3300035116 Bacteria 1054
728 Ga0373953_0136041 3300035117 Bacteria 1049
729 Ga0373956_0002305 3300035119 Bacteria 7847
730 Ga0373957_0006583 3300035120 Bacteria 3669
731 Ga0373957_0076301 3300035120 Bacteria 1318
732 Ga0373960_0004046 3300035121 Bacteria 3347
733 Ga0373943_0027562 3300035170 Bacteria 2670
734 Ga0373943_0033744 3300035170 Bacteria 2440
735 Ga0373946_0003193 3300035171 Bacteria 5812
736 Ga0373946_0158810 3300035171 Bacteria 1060
737 Ga0373955_0001878 3300035172 Bacteria 9053
738 Ga0373955_0041411 3300035172 Bacteria 2469
739 Ga0373942_0001609 3300035207 Bacteria 5780
740 Ga0373961_0002109 3300035241 Bacteria 5278
741 Ga0373962_0001193 3300035242 Bacteria 6081
742 Ga0373962_0013954 3300035242 Bacteria 2042
743 Ga0373924_0010240 3300035410 Bacteria 3451
744 Ga0373931_0061124 3300035691 Bacteria 2030
745 Ga0373927_0161281 3300035695 Bacteria 1469
746 Ga0373927_0273107 3300035695 Bacteria 1112
747 Ga0373933_0122611 3300035724 Bacteria 1629
748 Ga0373933_0165075 3300035724 Bacteria 1407
749 Ga0373947_0006424 3300035725 Bacteria 6830
750 Ga0373947_0010816 3300035725 Bacteria 5237
751 Ga0373947_0077827 3300035725 Bacteria 2046
752 Ga0373937_0000304 3300036401 Bacteria 46720
753 Ga0373937_0115348 3300036401 Bacteria 2501
754 Ga0373937_0162533 3300036401 Bacteria 2094
755 Ga0373937_0258793 3300036401 Bacteria 1641
756 Ga0373937_0271176 3300036401 Bacteria 1602
757 Ga0373937_0747439 3300036401 Bacteria 925
758 Ga0373925_0004724 3300037068 Bacteria 10271
759 Ga0373925_0046004 3300037068 Bacteria 3243
760 Ga0373925_0093957 3300037068 Bacteria 2296
761 Ga0373925_0341161 3300037068 Unclassified 1215
762 Ga0373925_0394029 3300037068 Bacteria 1129
763 Ga0395900_0319278 3300037418 Bacteria 1534
764 Ga0395901_0746397 3300038443 Bacteria 972
765 Ga0439453_0002515 3300041408 Bacteria 2543
766 Ga0451807_1956052 3300041486 Bacteria 1233
767 Ga0451807_2610490 3300041486 Bacteria 1277
768 Ga0439431_0008752 3300041997 Bacteria 2279
769 Ga0439433_0005770 3300041999 Bacteria 2660
770 Ga0439433_0017492 3300041999 Bacteria 1592
771 Ga0439433_0024804 3300041999 Bacteria 1352
772 Ga0439441_015633 3300042001 Bacteria 1345
773 Ga0439442_013980 3300042002 Bacteria 1651
774 Ga0439450_005572 3300042008 Bacteria 2222
775 Ga0439451_051466 3300042009 Bacteria 825
776 Ga0439462_0027702 3300042015 Bacteria 1496
777 Ga0439446_0000727 3300042156 Bacteria 6880
778 Ga0450908_002903 3300042184 Bacteria 3334
779 Ga0450908_025890 3300042184 Bacteria 1024
780 Ga0439434_0060338 3300042435 Bacteria 1185
781 Ga0439435_0004113 3300042436 Bacteria 3105
782 Ga0439435_0010743 3300042436 Bacteria 2181
783 Ga0439435_0013846 3300042436 Bacteria 1983
784 Ga0439435_0015784 3300042436 Bacteria 1884
785 Ga0439435_0089008 3300042436 Bacteria 936
786 Ga0439444_0009297 3300042437 Bacteria 1547
787 Ga0439464_0003390 3300042439 Bacteria 4017
788 Ga0439464_0093526 3300042439 Bacteria 908
789 Ga0439460_0086812 3300042461 Bacteria 989
790 Ga0439460_0097327 3300042461 Bacteria 942
791 Ga0451577_0049163 3300042876 Bacteria 3766
792 Ga0453684_0023641 3300044712 Bacteria 9032
793 Ga0451576_0113292 3300045051 Bacteria 2823
794 Ga0451576_0309445 3300045051 Bacteria 1653
795 Ga0451576_0360049 3300045051 Bacteria 1523
796 Ga0451576_0373756 3300045051 Bacteria 1494
797 Ga0451576_0700516 3300045051 Bacteria 1064
798 Ga0466967_0301003 3300045976 Bacteria 1543
799 Ga0495592_0044739 3300046454 Bacteria 3306
800 Ga0495603_0021187 3300046455 Bacteria 3936
801 Ga0495629_0000298 3300046459 Bacteria 42425
802 Ga0495638_0001740 3300046460 Bacteria 19123
803 Ga0495653_0005508 3300046463 Bacteria 10313
804 Ga0495580_0106332 3300046472 Bacteria 1949
805 Ga0495582_0090918 3300046473 Bacteria 1702
806 Ga0495639_0076733 3300046475 Bacteria 1550
807 Ga0495639_0208364 3300046475 Bacteria 959
808 Ga0495664_0225637 3300046477 Bacteria 1134
809 Ga0495584_0270888 3300046491 Bacteria 863
810 Ga0495594_0013813 3300046499 Bacteria 4221
811 Ga0495594_0018400 3300046499 Bacteria 3700
812 Ga0495594_0036140 3300046499 Bacteria 2693
813 Ga0495608_0006754 3300046511 Bacteria 8135
814 Ga0495628_0026102 3300046516 Bacteria 4769
815 Ga0495630_0082924 3300046517 Bacteria 2420
816 Ga0495630_0303667 3300046517 Unclassified 1220
817 Ga0495666_0166657 3300046526 Bacteria 1020
818 Ga0495652_0146775 3300046529 Bacteria 1848
819 Ga0495640_0331660 3300046533 Bacteria 941
820 Ga0495586_0096554 3300046535 Bacteria 1637
821 Ga0495586_0117043 3300046535 Bacteria 1487
822 Ga0495587_0158842 3300046536 Bacteria 1287
823 Ga0495598_0017053 3300046537 Bacteria 1866
824 Ga0495621_0010977 3300046539 Bacteria 2787
825 Ga0495621_0177978 3300046539 Bacteria 848
826 Ga0495645_0012788 3300046543 Bacteria 5922
827 Ga0495667_0206562 3300046559 Bacteria 1256
828 Ga0495656_0008191 3300046615 Bacteria 3723
829 Ga0495668_0324305 3300046616 Bacteria 845
830 Ga0495634_0054782 3300046642 Bacteria 2668
831 Ga0495634_0253716 3300046642 Bacteria 1075
832 Ga0495635_0135961 3300046663 Bacteria 1675
833 Ga0495635_0249080 3300046663 Bacteria 1198
834 Ga0495635_0317679 3300046663 Bacteria 1043
835 Ga0495659_0042645 3300046664 Bacteria 1625
836 Ga0495588_0007178 3300046674 Bacteria 5054
837 Ga0495599_0047153 3300046678 Bacteria 2701
838 Ga0495599_0215422 3300046678 Bacteria 1176
839 Ga0495599_0230563 3300046678 Bacteria 1131
840 Ga0495647_0031937 3300046681 Bacteria 1960
841 Ga0495647_0034368 3300046681 Bacteria 1898
842 Ga0495658_0000158 3300046683 Bacteria 37553
843 Ga0495658_0016100 3300046683 Bacteria 3847
844 Ga0495658_0083708 3300046683 Bacteria 1877
845 Ga0495658_0301214 3300046683 Bacteria 1014
846 Ga0495658_0366892 3300046683 Bacteria 916
847 Ga0495613_0012260 3300046689 Bacteria 6370
848 Ga0495613_0077793 3300046689 Bacteria 2413
849 Ga0495613_0093113 3300046689 Bacteria 2182
850 Ga0495613_0098736 3300046689 Bacteria 2110
851 Ga0495613_0179418 3300046689 Bacteria 1500
852 Ga0495613_0203579 3300046689 Bacteria 1395
853 Ga0495581_0205210 3300047315 Bacteria 1153
854 Ga0495581_0293937 3300047315 Bacteria 949
855 Ga0495604_0045587 3300047317 Bacteria 3421
856 Ga0495604_0401223 3300047317 Bacteria 903
857 Ga0495604_0434546 3300047317 Bacteria 860
858 Ga0495636_0077728 3300047318 Bacteria 1425
859 Ga0495674_0015359 3300047319 Bacteria 7162
860 Ga0495680_0032633 3300047322 Bacteria 4224
861 Ga0495680_0060393 3300047322 Bacteria 2922
862 Ga0495680_0262936 3300047322 Bacteria 1220
863 Ga0495684_0001031 3300047471 Bacteria 22610
864 Ga0495684_0191666 3300047471 Bacteria 1511
865 Ga0496100_0559581 3300048903 Bacteria 885
866 Ga0496101_0531252 3300048904 Bacteria 930
867 Ga0496101_0644975 3300048904 Bacteria 837
868 Ga0496102_0010134 3300048905 Bacteria 8105
869 Ga0496102_0764100 3300048905 Bacteria 889
870 Ga0496104_0000157 3300048907 Bacteria 61755
871 Ga0496104_0006829 3300048907 Bacteria 10056
872 Ga0496104_0132151 3300048907 Bacteria 2398
873 Ga0496104_0295522 3300048907 Bacteria 1532
874 Ga0496104_0475497 3300048907 Bacteria 1161
875 Ga0496105_0036722 3300048908 Bacteria 4037
876 Ga0496105_0108203 3300048908 Bacteria 2295
877 Ga0496105_0198299 3300048908 Bacteria 1639
878 Ga0496105_0348461 3300048908 Bacteria 1183
879 Ga0496105_0465183 3300048908 Bacteria 997
880 Ga0496106_0015998 3300048909 Bacteria 5548
881 Ga0496106_0028722 3300048909 Bacteria 4143
882 Ga0496106_0054761 3300048909 Bacteria 3014
883 Ga0496106_0144979 3300048909 Bacteria 1870
884 Ga0496106_0317155 3300048909 Bacteria 1251
885 Ga0496106_0428530 3300048909 Bacteria 1063
886 Ga0496107_0459148 3300048910 Bacteria 946
887 Ga0496108_0003499 3300048911 Bacteria 12586
888 Ga0496108_0053846 3300048911 Unclassified 3376
889 Ga0496108_0124256 3300048911 Bacteria 2215
890 Ga0496108_0152588 3300048911 Bacteria 1994
891 Ga0496108_0675127 3300048911 Bacteria 897
892 Ga0496109_0009476 3300048912 Bacteria 8302
893 Ga0496109_0382672 3300048912 Bacteria 1329
894 Ga0496110_0000063 3300048913 Bacteria 53033
895 Ga0496110_0013141 3300048913 Bacteria 6836
896 Ga0496110_0543153 3300048913 Bacteria 1056
897 Ga0496110_0631196 3300048913 Bacteria 970
898 Ga0496111_0004348 3300048914 Bacteria 8942
899 Ga0496112_0000245 3300048915 Bacteria 34580
900 Ga0496112_0024556 3300048915 Bacteria 5774
901 Ga0496112_0045209 3300048915 Bacteria 4316
902 Ga0496114_0000371 3300048917 Bacteria 33092
903 Ga0501031_0210298 3300049568 Bacteria 1268
904 Ga0501032_0290228 3300049569 Bacteria 1058
905 Ga0501033_0384697 3300049570 Bacteria 980
906 Ga0501034_0004421 3300049571 Bacteria 15639
907 Ga0501034_0015307 3300049571 Bacteria 7884
908 Ga0501034_0185030 3300049571 Bacteria 2047
909 Ga0501036_0023391 3300049572 Bacteria 5206
910 Ga0501036_0115763 3300049572 Bacteria 2264
911 Ga0501036_0123787 3300049572 Bacteria 2184
912 Ga0501036_0138618 3300049572 Bacteria 2053
913 Ga0501036_0304211 3300049572 Bacteria 1333
914 Ga0501036_0435418 3300049572 Bacteria 1093
915 Ga0501038_0477751 3300049574 Unclassified 955
916 Ga0501039_0155211 3300049575 Bacteria 1798
917 Ga0501040_0009429 3300049576 Bacteria 6364
918 Ga0501040_0107855 3300049576 Bacteria 1946
919 Ga0501040_0282167 3300049576 Bacteria 1186
920 Ga0501041_0145605 3300049577 Bacteria 1478
921 Ga0501042_0159360 3300049578 Bacteria 1628
922 Ga0501042_0182881 3300049578 Bacteria 1512
923 Ga0501042_0278463 3300049578 Bacteria 1208
924 Ga0501043_0035081 3300049579 Bacteria 3945
925 Ga0501046_0014990 3300049580 Bacteria 6520
926 Ga0501046_0138946 3300049580 Bacteria 1840
927 Ga0501046_0241982 3300049580 Bacteria 1330
928 Ga0501047_0006564 3300049581 Bacteria 10952
929 Ga0501048_0133975 3300049582 Bacteria 1750
930 Ga0501048_0157189 3300049582 Bacteria 1608
931 Ga0501068_0048008 3300049584 Bacteria 2577
932 Ga0501068_0214804 3300049584 Bacteria 1222
933 Ga0501069_0033832 3300049585 Bacteria 2816
934 Ga0501070_0070082 3300049586 Bacteria 2903
935 Ga0501070_0263261 3300049586 Bacteria 1409
936 Ga0501071_0103984 3300049587 Bacteria 2096
937 Ga0501071_0154841 3300049587 Bacteria 1711
938 Ga0501071_0161166 3300049587 Bacteria 1676
939 Ga0501071_0494906 3300049587 Bacteria 938
940 Ga0501071_0512460 3300049587 Bacteria 920
941 Ga0501072_0015475 3300049588 Bacteria 5848
942 Ga0501072_0049533 3300049588 Bacteria 3307
943 Ga0501072_0080291 3300049588 Bacteria 2584
944 Ga0501072_0091854 3300049588 Bacteria 2410
945 Ga0501073_0028966 3300049589 Bacteria 3956
946 Ga0501074_0014603 3300049590 Bacteria 5714
947 Ga0501074_0133875 3300049590 Bacteria 1773
948 Ga0501074_0154697 3300049590 Bacteria 1639
949 Ga0501075_0014357 3300049591 Bacteria 5675
950 Ga0501075_0074796 3300049591 Bacteria 2562
951 Ga0501075_0124772 3300049591 Bacteria 1960
952 Ga0501075_0183749 3300049591 Bacteria 1595
953 Ga0501076_0000633 3300049592 Bacteria 22451
954 Ga0501076_0005874 3300049592 Bacteria 8852
955 Ga0501076_0043485 3300049592 Bacteria 3540
956 Ga0501076_0253971 3300049592 Bacteria 1439
957 Ga0501076_0303167 3300049592 Bacteria 1310
958 Ga0501076_0461498 3300049592 Bacteria 1046
959 Ga0501076_0497259 3300049592 Bacteria 1005
960 Ga0501077_0021021 3300049593 Bacteria 4129
961 Ga0501077_0025618 3300049593 Bacteria 3745
962 Ga0501079_0015604 3300049741 Bacteria 5800
963 Ga0501079_0129700 3300049741 Bacteria 1962
964 Ga0501079_0134846 3300049741 Bacteria 1922
965 Ga0501079_0272763 3300049741 Bacteria 1322
966 Ga0501079_0377104 3300049741 Bacteria 1112
967 Ga0501079_0426611 3300049741 Bacteria 1041
968 Ga0501080_0161216 3300049742 Bacteria 2071
969 Ga0501080_0400591 3300049742 Bacteria 1235
970 Ga0501080_0454806 3300049742 Bacteria 1148
971 Ga0501081_0169883 3300049743 Bacteria 1574
972 Ga0501081_0362411 3300049743 Unclassified 1069
973 Ga0501083_0027632 3300049744 Bacteria 3913
974 Ga0501083_0133586 3300049744 Bacteria 1626
975 Ga0501035_0071193 3300049822 Bacteria 3079
976 Ga0501035_0225517 3300049822 Bacteria 1599
977 Ga0501035_0389576 3300049822 Bacteria 1161
978 Ga0501044_0063277 3300049823 Bacteria 3780
979 Ga0501045_0008164 3300049824 Bacteria 7293
980 Ga0501045_0015928 3300049824 Bacteria 5333
981 Ga0501045_0021060 3300049824 Bacteria 4661
982 Ga0501045_0253853 3300049824 Bacteria 1309
983 Ga0501045_0375843 3300049824 Unclassified 1058
984 Ga0501045_0429706 3300049824 Bacteria 982
985 Ga0501045_0518597 3300049824 Bacteria 885
986 nmdc:mga03n38_122509_c1 3300050490 Bacteria 1280
987 nmdc:mga00v17_146452_c1 3300050491 Bacteria 1516
988 nmdc:mga00v17_152233_c1 3300050491 Bacteria 1486
989 nmdc:mga00v17_3644_c1 3300050491 Bacteria 7962
990 nmdc:mga00v17_485569_c1 3300050491 Bacteria 801
991 nmdc:mga00v17_9961_c1 3300050491 Bacteria 4181
992 nmdc:mga0yw44_213104_c1 3300050492 Bacteria 1278
993 nmdc:mga0yw44_34063_c1 3300050492 Bacteria 2981
994 nmdc:mga0k408_17316_c1 3300050493 Bacteria 4014
995 nmdc:mga0k408_19933_c1 3300050493 Bacteria 3754
996 nmdc:mga0k408_31765_c1 3300050493 Bacteria 3017
997 nmdc:mga0k408_407512_c1 3300050493 Bacteria 809
998 nmdc:mga0k408_42504_c1 3300050493 Bacteria 2618
999 nmdc:mga0k408_5159_c1 3300050493 Bacteria 6924
1000 nmdc:mga06z11_123905_c1 3300050494 Bacteria 1445
1001 nmdc:mga06z11_21219_c1 3300050494 Bacteria 3015
1002 nmdc:mga06z11_32515_c1 3300050494 Bacteria 2545
1003 nmdc:mga06z11_33718_c1 3300050494 Bacteria 2507
1004 nmdc:mga06z11_45763_c1 3300050494 Bacteria 2214
1005 nmdc:mga06z11_71953_c1 3300050494 Bacteria 1832
1006 nmdc:mga04h51_118661_c1 3300050495 Bacteria 983
1007 nmdc:mga07m45_26856_c1 3300050496 Bacteria 3167
1008 nmdc:mga07m45_48197_c1 3300050496 Bacteria 2183
1009 nmdc:mga07m45_49951_c1 3300050496 Bacteria 2356
1010 nmdc:mga05p37_10862_c1 3300050507 Bacteria 10811
1011 nmdc:mga05p37_109001_c1 3300050507 Bacteria 3406
1012 nmdc:mga05p37_109613_c1 3300050507 Bacteria 3396
1013 nmdc:mga05p37_1107_c1 3300050507 Bacteria 28841
1014 nmdc:mga05p37_11748_c1 3300050507 Bacteria 10439
1015 nmdc:mga05p37_12193_c1 3300050507 Bacteria 10263
1016 nmdc:mga05p37_13533_c1 3300050507 Bacteria 9781
1017 nmdc:mga05p37_177158_c1 3300050507 Bacteria 2597
1018 nmdc:mga05p37_18779_c1 3300050507 Bacteria 8355
1019 nmdc:mga05p37_22849_c1 3300050507 Bacteria 7584
1020 nmdc:mga05p37_29_c1 3300050507 Bacteria 114400
1021 nmdc:mga05p37_31095_c1 3300050507 Bacteria 6519
1022 nmdc:mga05p37_369821_c1 3300050507 Unclassified 1683
1023 nmdc:mga05p37_453274_c1 3300050507 Bacteria 1484
1024 nmdc:mga05p37_500386_c1 3300050507 Bacteria 1395
1025 nmdc:mga05p37_5648_c1 3300050507 Bacteria 14708
1026 nmdc:mga05p37_620742_c1 3300050507 Bacteria 1216
1027 nmdc:mga05p37_62653_c1 3300050507 Bacteria 4577
1028 nmdc:mga05p37_789705_c1 3300050507 Bacteria 1040
1029 nmdc:mga05p37_794584_c1 3300050507 Bacteria 1036
1030 nmdc:mga05p37_81819_c1 3300050507 Bacteria 3978
1031 nmdc:mga05p37_862_c1 3300050507 Bacteria 34113
1032 nmdc:mga09592_14921_c1 3300050508 Bacteria 6346
1033 nmdc:mga09592_155598_c1 3300050508 Bacteria 1973
1034 nmdc:mga09592_33010_c1 3300050508 Bacteria 4318
1035 nmdc:mga09592_3601_c1 3300050508 Bacteria 12502
1036 nmdc:mga09592_3762_c1 3300050508 Bacteria 12226
1037 nmdc:mga09592_511705_c1 3300050508 Bacteria 1033
1038 nmdc:mga09592_564611_c1 3300050508 Bacteria 977
1039 nmdc:mga0qj67_197336_c1 3300050509 Bacteria 1635
1040 nmdc:mga0qj67_197363_c1 3300050509 Bacteria 1635
1041 nmdc:mga0qj67_20525_c1 3300050509 Bacteria 5061
1042 nmdc:mga0qj67_21098_c1 3300050509 Bacteria 4995
1043 nmdc:mga0qj67_305951_c1 3300050509 Bacteria 1288
1044 nmdc:mga0qj67_32771_c1 3300050509 Bacteria 4053
1045 nmdc:mga0qj67_7314_c1 3300050509 Bacteria 8161
1046 nmdc:mga06r32_108553_c1 3300050510 Bacteria 2728
1047 nmdc:mga06r32_11212_c1 3300050510 Bacteria 8076
1048 nmdc:mga06r32_222190_c1 3300050510 Bacteria 1877
1049 nmdc:mga06r32_22778_c1 3300050510 Bacteria 5793
1050 nmdc:mga06r32_270908_c1 3300050510 Bacteria 1685
1051 nmdc:mga06r32_323528_c1 3300050510 Bacteria 1527
1052 nmdc:mga06r32_34703_c1 3300050510 Bacteria 4758
1053 nmdc:mga06r32_3980_c1 3300050510 Bacteria 13238
1054 nmdc:mga06r32_45686_c1 3300050510 Bacteria 4176
1055 nmdc:mga06r32_58764_c1 3300050510 Bacteria 3696
1056 nmdc:mga06r32_626307_c1 3300050510 Bacteria 1045
1057 nmdc:mga06r32_70184_c1 3300050510 Bacteria 3387
1058 nmdc:mga06r32_88844_c1 3300050510 Bacteria 3017
1059 nmdc:mga08y16_12654_c1 3300050511 Bacteria 8875
1060 nmdc:mga08y16_16284_c1 3300050511 Bacteria 7817
1061 nmdc:mga08y16_168837_c1 3300050511 Bacteria 2273
1062 nmdc:mga08y16_17_c1 3300050511 Bacteria 382598
1063 nmdc:mga08y16_241173_c1 3300050511 Bacteria 1869
1064 nmdc:mga08y16_24741_c1 3300050511 Bacteria 6337
1065 nmdc:mga08y16_40211_c1 3300050511 Bacteria 4902
1066 nmdc:mga08y16_4308_c1 3300050511 Bacteria 14860
1067 nmdc:mga08y16_510209_c1 3300050511 Bacteria 1221
1068 nmdc:mga08y16_514643_c1 3300050511 Bacteria 1214
1069 nmdc:mga08y16_537185_c1 3300050511 Bacteria 1184
1070 nmdc:mga08y16_56103_c1 3300050511 Bacteria 4117
1071 nmdc:mga08y16_65734_c1 3300050511 Bacteria 3785
1072 nmdc:mga08y16_735_c1 3300050511 Bacteria 31112
1073 nmdc:mga08y16_82239_c1 3300050511 Bacteria 3357
1074 nmdc:mga08y16_84914_c1 3300050511 Bacteria 3299
1075 nmdc:mga08y16_866203_c1 3300050511 Bacteria 892
1076 nmdc:mga08y16_94017_c1 3300050511 Bacteria 3123
1077 nmdc:mga0n895_16030_c1 3300050512 Bacteria 6864
1078 nmdc:mga0n895_203419_c1 3300050512 Bacteria 2011
1079 nmdc:mga0n895_211351_c1 3300050512 Bacteria 1970
1080 nmdc:mga0n895_233424_c1 3300050512 Bacteria 1867
1081 nmdc:mga0n895_234292_c1 3300050512 Bacteria 1863
1082 nmdc:mga0n895_461918_c1 3300050512 Unclassified 1281
1083 nmdc:mga0n895_51007_c1 3300050512 Bacteria 4059
1084 nmdc:mga0n895_511583_c1 3300050512 Bacteria 1209
1085 nmdc:mga0n895_5332_c1 3300050512 Bacteria 10714
1086 nmdc:mga0n895_570264_c1 3300050512 Bacteria 1136
1087 nmdc:mga0n895_726696_c1 3300050512 Bacteria 987
1088 nmdc:mga0n895_751662_c1 3300050512 Bacteria 968
1089 nmdc:mga0n895_75460_c1 3300050512 Bacteria 3352
1090 nmdc:mga0n895_987717_c1 3300050512 Bacteria 824
1091 nmdc:mga0rr50_10927_c1 3300050513 Bacteria 5790
1092 nmdc:mga0rr50_113418_c1 3300050513 Bacteria 2148
1093 nmdc:mga0rr50_141699_c1 3300050513 Bacteria 1935
1094 nmdc:mga0rr50_28_c1 3300050513 Bacteria 108950
1095 nmdc:mga0rr50_3354_c1 3300050513 Bacteria 9199
1096 nmdc:mga0rr50_38805_c1 3300050513 Bacteria 3450
1097 nmdc:mga0rr50_422196_c1 3300050513 Bacteria 1128
1098 nmdc:mga08x19_121_c1 3300050514 Bacteria 69968
1099 nmdc:mga08x19_13456_c1 3300050514 Bacteria 4948
1100 nmdc:mga08x19_15726_c1 3300050514 Bacteria 4604
1101 nmdc:mga08x19_2483_c1 3300050514 Bacteria 11220
1102 nmdc:mga08x19_301301_c1 3300050514 Bacteria 1113
1103 nmdc:mga08x19_366026_c1 3300050514 Bacteria 1008
1104 nmdc:mga08x19_52350_c1 3300050514 Bacteria 2625
1105 nmdc:mga08x19_57682_c1 3300050514 Bacteria 2510
1106 nmdc:mga0a205_101483_c1 3300050515 Bacteria 2776
1107 nmdc:mga0a205_104385_c1 3300050515 Bacteria 2733
1108 nmdc:mga0a205_126002_c1 3300050515 Bacteria 2461
1109 nmdc:mga0a205_138608_c1 3300050515 Bacteria 2333
1110 nmdc:mga0a205_140146_c1 3300050515 Bacteria 2319
1111 nmdc:mga0a205_222886_c1 3300050515 Bacteria 1771
1112 nmdc:mga0a205_256656_c1 3300050515 Bacteria 1627
1113 nmdc:mga0a205_340139_c1 3300050515 Bacteria 1369
1114 nmdc:mga0a205_371825_c1 3300050515 Bacteria 1295
1115 nmdc:mga0a205_445687_c1 3300050515 Unclassified 1155
1116 nmdc:mga0a205_4572_c1 3300050515 Bacteria 12409
1117 nmdc:mga0a205_56762_c1 3300050515 Bacteria 3780
1118 nmdc:mga0a205_575034_c1 3300050515 Bacteria 981
1119 nmdc:mga0a205_66435_c1 3300050515 Bacteria 3485
1120 Ga0495601_0027955 3300053077 Bacteria 3490
1121 Ga0495601_0055347 3300053077 Bacteria 2512
1122 Ga0495601_0191357 3300053077 Bacteria 1337
1123 Ga0495619_0009771 3300053085 Bacteria 6050
1124 Ga0495619_0060487 3300053085 Bacteria 2518
1125 Ga0495619_0082571 3300053085 Bacteria 2166
1126 Ga0495619_0143688 3300053085 Unclassified 1644
1127 Ga0495619_0164499 3300053085 Bacteria 1533
1128 Ga0500555_000060 3300053103 Bacteria 55800
1129 Ga0500556_0028697 3300053104 Bacteria 1869
1130 Ga0500592_028330 3300053116 Bacteria 903
1131 Ga0500628_069254 3300053129 Bacteria 880
1132 Ga0500616_0000336 3300053153 Bacteria 67042
1133 Ga0500599_000325 3300053736 Bacteria 4681
1134 Ga0501084_0007476 3300054114 Bacteria 9007
1135 Ga0501084_0011024 3300054114 Bacteria 7487
1136 Ga0501084_0046698 3300054114 Bacteria 3627
1137 Ga0501084_0079083 3300054114 Bacteria 2756
1138 Ga0501084_0089178 3300054114 Bacteria 2589
1139 Ga0501084_0196797 3300054114 Bacteria 1700
1140 Ga0501084_0481370 3300054114 Bacteria 1049
1141 Ga0590071_001383 3300059421 Bacteria 6429
1142 Ga0590071_008874 3300059421 Bacteria 2363
1143 Ga0590074_000829 3300059423 Bacteria 4776
1144 Ga0590074_001439 3300059423 Bacteria 3833
1145 Ga0590075_000139 3300059424 Bacteria 19073
1146 Ga0590075_001920 3300059424 Bacteria 5035
1147 Ga0590077_000011 3300059426 Bacteria 41505
1148 Ga0590077_005123 3300059426 Bacteria 2680
1149 Ga0590077_007691 3300059426 Bacteria 2203
1150 Ga0587077_032258 3300059493 Bacteria 1005
1151 Ga0501082_0019848 3300060353 Bacteria 5796
1152 Ga0501082_0158654 3300060353 Bacteria 1965
1153 Ga0501082_0161404 3300060353 Bacteria 1948
1154 Ga0501082_0218422 3300060353 Bacteria 1658
1155 Ga0501082_0219154 3300060353 Bacteria 1656
1156 Ga0501082_0389310 3300060353 Bacteria 1216
1157 Ga0501082_0656815 3300060353 Bacteria 918
1158 Ga0530510_0062521 3300061734 Bacteria 2695
1159 Ga0530510_0099668 3300061734 Bacteria 2124
1160 Ga0530510_0230193 3300061734 Bacteria 1378
1161 Ga0530510_0510346 3300061734 Bacteria 912
1162 Ga0207651_10259149
1163 JGI24751J29686_10015170
1164 Ga0065715_10090135
1165 Ga0065715_10094425
1166 Ga0065715_10286916
1167 Ga0065707_10097878
1168 Ga0065707_10146127
1169 Ga0065707_10149389
1170 Ga0070676_10004636
1171 Ga0070676_10221450
1172 Ga0070683_100000767
1173 Ga0070683_100024989
1174 Ga0070683_100367655
1175 Ga0070670_100014101
1176 Ga0070670_100090286
1177 Ga0070670_100102379
1178 Ga0070670_100479180
1179 Ga0070680_100088981
1180 Ga0068868_100465356
1181 Ga0068868_100516755
1182 Ga0070660_100057416
1183 Ga0070689_100124881
1184 Ga0070689_100152852
1185 Ga0070691_10005391
1186 Ga0070661_100023235
1187 Ga0070668_100061615
1188 Ga0070668_100321122
1189 Ga0070668_100327105
1190 Ga0070668_100747071
1191 Ga0070669_100000166
1192 Ga0070669_100016560
1193 Ga0070669_100085857
1194 Ga0070669_100241226
1195 Ga0070669_100422794
1196 Ga0070675_100000147
1197 Ga0070675_100049232
1198 Ga0070675_100072522
1199 Ga0070675_100083865
1200 Ga0070675_100096424
1201 Ga0070675_100163925
1202 Ga0070675_100540740
1203 Ga0070675_100572604
1204 Ga0070671_100001353
1205 Ga0070671_100050468
1206 Ga0070671_100181717
1207 Ga0070674_100004110
1208 Ga0070674_100013181
1209 Ga0070674_100016261
1210 Ga0070674_100029214
1211 Ga0070674_100113907
1212 Ga0070673_100013878
1213 Ga0070673_100027661
1214 Ga0070673_100062312
1215 Ga0070688_100045154
1216 Ga0070659_100031648
1217 Ga0070659_100040238
1218 Ga0070659_100106909
1219 Ga0070659_100141256
1220 Ga0070667_100107021
1221 Ga0070667_100111495
1222 Ga0070703_10053235
1223 Ga0070709_10005969
1224 Ga0070714_100005580
1225 Ga0070713_100068087
1226 Ga0070701_10064160
1227 Ga0070711_100491912
1228 Ga0070705_100002798
1229 Ga0070700_100078075
1230 Ga0070694_100026204
1231 Ga0070694_100032239
1232 Ga0070663_100025444
1233 Ga0070678_100068555
1234 Ga0070678_100274183
1235 Ga0070678_100335366
1236 Ga0070678_100506692
1237 Ga0070662_100058242
1238 Ga0070662_100243553
1239 Ga0070681_10000926
1240 Ga0070681_10083309
1241 Ga0068867_100012153
1242 Ga0068867_100122834
1243 Ga0068867_100263557
1244 Ga0068867_100421764
1245 Ga0070685_10251569
1246 Ga0070706_100418787
1247 Ga0070698_100036699
1248 Ga0070699_100001909
1249 Ga0070699_100026285
1250 Ga0070699_100106339
1251 Ga0070699_100127402
1252 Ga0070699_100429257
1253 Ga0070679_100004319
1254 Ga0070679_100011918
1255 Ga0070679_100078509
1256 Ga0070684_100004962
1257 Ga0070697_100009170
1258 Ga0070697_100309382
1259 Ga0070672_100104734
1260 Ga0070672_100209057
1261 Ga0070672_100572968
1262 Ga0070686_100101555
1263 Ga0070695_100375470
1264 Ga0070696_100049557
1265 Ga0070696_100121755
1266 Ga0070696_100168876
1267 Ga0070696_100172230
1268 Ga0070696_100177722
1269 Ga0070696_100466866
1270 Ga0070665_100002388
1271 Ga0070665_100011930
1272 Ga0070665_100020560
1273 Ga0070665_100141628
1274 Ga0070665_100155984
1275 Ga0070665_100688057
1276 Ga0070704_100012700
1277 Ga0070704_100191158
1278 Ga0070704_100282466
1279 Ga0070704_100494334
1280 Ga0068855_100012391
1281 Ga0068855_100365133
1282 Ga0068855_100433837
1283 Ga0068855_100821161
1284 Ga0070664_100016603
1285 Ga0070664_100620240
1286 Ga0068857_100031800
1287 Ga0068857_100035159
1288 Ga0068857_100074183
1289 Ga0068857_100136604
1290 Ga0068857_100376270
1291 Ga0068854_100041769
1292 Ga0068856_100135664
1293 Ga0070702_100002550
1294 Ga0070702_100187064
1295 Ga0070702_100361742
1296 Ga0068852_100151934
1297 Ga0068852_100334653
1298 Ga0068852_100494163
1299 Ga0068852_100635458
1300 Ga0068859_100007450
1301 Ga0068859_100098774
1302 Ga0068859_100126142
1303 Ga0068859_100129679
1304 Ga0068859_100159471
1305 Ga0068859_100179144
1306 Ga0068859_100339899
1307 Ga0068859_100502168
1308 Ga0068859_100512147
1309 Ga0068864_100002331
1310 Ga0068864_100181810
1311 Ga0068866_10031971
1312 Ga0068866_10376127
1313 Ga0068861_100042593
1314 Ga0068861_100069944
1315 Ga0068861_100120796
1316 Ga0068861_100139279
1317 Ga0068861_100173727
1318 Ga0068851_10012457
1319 Ga0068851_10147182
1320 Ga0068851_10243411
1321 Ga0068870_10174164
1322 Ga0068870_10468662
1323 Ga0068863_100002769
1324 Ga0068858_100004373
1325 Ga0068858_100059383
1326 Ga0068858_100082360
1327 Ga0068858_100090245
1328 Ga0068858_100201577
1329 Ga0068858_100258942
1330 Ga0068860_100015275
1331 Ga0068860_100120977
1332 Ga0068860_100165554
1333 Ga0068860_100179743
1334 Ga0068862_100006398
1335 Ga0068862_100038506
1336 Ga0068862_100041431
1337 Ga0068862_100187938
1338 Ga0081455_10015599
1339 Ga0081539_10000134
1340 Ga0081539_10004230
1341 Ga0075365_10166712
1342 Ga0075368_10006201
1343 Ga0075368_10008321
1344 Ga0075368_10015026
1345 Ga0075368_10030498
1346 Ga0075368_10043404
1347 Ga0075368_10049219
1348 Ga0075363_100269900
1349 Ga0075364_10075354
1350 Ga0075364_10087250
1351 Ga0075364_10100966
1352 Ga0075364_10309092
1353 Ga0070716_100212783
1354 Ga0070712_100141451
1355 Ga0075362_10001628
1356 Ga0075367_10003716
1357 Ga0075367_10052953
1358 Ga0075367_10058732
1359 Ga0075367_10077466
1360 Ga0075367_10120471
1361 Ga0075366_10002531
1362 Ga0075366_10005295
1363 Ga0075366_10016996
1364 Ga0075366_10043181
1365 Ga0075366_10088494
1366 Ga0097621_100043964
1367 Ga0097621_100162623
1368 Ga0097621_100733546
1369 Ga0075370_10010509
1370 Ga0075370_10034756
1371 Ga0075370_10091048
1372 Ga0068871_100000311
1373 Ga0068871_100001175
1374 Ga0068871_100001401
1375 Ga0068871_100020021
1376 Ga0068871_100059848
1377 Ga0068871_100098440
1378 Ga0068871_100261059
1379 Ga0068871_100822031
1380 Ga0075428_100000005
1381 Ga0075428_100000058
1382 Ga0075428_100000393
1383 Ga0075428_100003359
1384 Ga0075428_100003840
1385 Ga0075428_100122982
1386 Ga0075428_100141059
1387 Ga0075428_100205494
1388 Ga0075428_100250326
1389 Ga0075428_100375394
1390 Ga0075428_100433870
1391 Ga0075430_100000961
1392 Ga0075430_100002136
1393 Ga0075430_100183680
1394 Ga0075430_100202005
1395 Ga0075430_100308565
1396 Ga0075431_100000575
1397 Ga0075431_100010853
1398 Ga0075431_100011056
1399 Ga0075431_100051771
1400 Ga0075431_100074509
1401 Ga0075431_100095350
1402 Ga0075431_100121856
1403 Ga0075431_100209841
1404 Ga0075431_100333825
1405 Ga0075431_100596420
1406 Ga0075433_10008097
1407 Ga0075433_10048176
1408 Ga0075433_10073924
1409 Ga0075433_10075701
1410 Ga0075433_10232396
1411 Ga0075434_100000097
1412 Ga0075434_100006466
1413 Ga0075434_100011003
1414 Ga0075434_100238444
1415 Ga0075434_100241077
1416 Ga0075434_100348568
1417 Ga0075434_100352848
1418 Ga0075434_100584184
1419 Ga0075429_100014206
1420 Ga0075429_100016751
1421 Ga0075429_100025416
1422 Ga0075429_100247785
1423 Ga0068865_100087891
1424 Ga0068865_100109557
1425 Ga0068865_100463731
1426 Ga0068865_100531866
1427 Ga0075436_100000341
1428 Ga0075436_100070336
1429 Ga0075436_100168789
1430 Ga0075436_100229181
1431 Ga0075436_100407399
1432 Ga0075436_100465916
1433 Ga0097620_100007450
1434 Ga0097620_100098770
1435 Ga0097620_100126141
1436 Ga0097620_100129684
1437 Ga0097620_100159473
1438 Ga0097620_100179144
1439 Ga0097620_100339897
1440 Ga0097620_100502220
1441 Ga0097620_100512155
1442 Ga0075435_100000149
1443 Ga0075435_100000353
1444 Ga0075435_100003692
1445 Ga0075435_100006608
1446 Ga0075435_100022199
1447 Ga0075435_100066617
1448 Ga0105240_10029559
1449 Ga0105240_10089310
1450 Ga0105240_10229418
1451 Ga0111539_10000008
1452 Ga0111539_10000870
1453 Ga0111539_10001659
1454 Ga0111539_10015435
1455 Ga0111539_10049518
1456 Ga0111539_10110764
1457 Ga0111539_10133652
1458 Ga0111539_10150316
1459 Ga0111539_10351369
1460 Ga0105245_10017756
1461 Ga0105247_10004063
1462 Ga0105247_10009654
1463 Ga0105247_10074714
1464 Ga0114129_10000857
1465 Ga0114129_10001588
1466 Ga0114129_10002431
1467 Ga0114129_10002846
1468 Ga0114129_10003568
1469 Ga0114129_10007307
1470 Ga0114129_10007344
1471 Ga0114129_10011380
1472 Ga0114129_10012896
1473 Ga0114129_10020281
1474 Ga0114129_10031490
1475 Ga0114129_10082829
1476 Ga0114129_10139677
1477 Ga0114129_10164462
1478 Ga0114129_10478624
1479 Ga0114129_10706169
1480 Ga0105243_10148705
1481 Ga0105243_10375916
1482 Ga0105243_10531982
1483 Ga0105241_10034621
1484 Ga0105242_10106002
1485 Ga0105242_10145345
1486 Ga0105242_10426555
1487 Ga0105242_10929016
1488 Ga0105248_10001544
1489 Ga0105248_10039996
1490 Ga0105248_10060919
1491 Ga0105248_10107738
1492 Ga0105248_10120391
1493 Ga0105248_10155987
1494 Ga0105248_10204531
1495 Ga0105248_10239997
1496 Ga0105248_10326019
1497 Ga0105248_10330723
1498 Ga0105248_10437913
1499 Ga0105248_10802358
1500 Ga0105237_10067887
1501 Ga0105237_10632057
1502 Ga0105238_10276115
1503 Ga0105238_10643174
1504 Ga0105238_10890894
1505 Ga0105249_10000230
1506 Ga0105249_10021476
1507 Ga0105249_10121381
1508 Ga0105249_10146581
1509 Ga0105249_10206917
1510 Ga0105249_10409841
1511 Ga0105249_10492498
1512 Ga0105249_10534352
1513 Ga0105249_10548909
1514 Ga0157338_1012247
1515 Ga0157369_10220617
1516 Ga0157374_10022217
1517 Ga0157374_10116185
1518 Ga0157374_10206977
1519 Ga0157374_10951007
1520 Ga0157374_11048210
1521 Ga0157378_10002694
1522 Ga0157378_10136504
1523 Ga0157378_10175247
1524 Ga0163162_10045801
1525 Ga0163162_10050707
1526 Ga0163162_10072255
1527 Ga0163162_10504752
1528 Ga0163162_10516635
1529 Ga0157372_10257465
1530 Ga0157372_10395267
1531 Ga0157372_10685061
1532 Ga0157375_10130402
1533 Ga0157375_10607939
1534 Ga0163163_10066121
1535 Ga0163163_10181899
1536 Ga0163163_10378538
1537 Ga0157380_10007520
1538 Ga0157380_10249172
1539 Ga0157380_10345238
1540 Ga0157377_10047416
1541 Ga0157377_10272060
1542 Ga0157379_10015268
1543 Ga0157379_10019035
1544 Ga0157379_10032311
1545 Ga0157379_10086614
1546 Ga0157376_10058632
1547 Ga0157376_10139153
1548 Ga0157376_10252275
1549 Ga0157376_10255992
1550 Ga0157376_10264502
1551 Ga0157376_10635233
1552 Ga0163161_10119870
1553 Ga0207697_10001789
1554 Ga0207697_10033250
1555 Ga0207697_10047374
1556 Ga0207697_10098678
1557 Ga0207697_10101759
1558 Ga0207656_10184929
1559 Ga0207682_10008627
1560 Ga0207682_10176767
1561 Ga0207642_10066487
1562 Ga0207642_10121482
1563 Ga0207710_10006090
1564 Ga0207688_10012956
1565 Ga0207688_10223479
1566 Ga0207680_10041353
1567 Ga0207680_10388586
1568 Ga0207699_10132996
1569 Ga0207699_10179255
1570 Ga0207699_10186182
1571 Ga0207645_10025836
1572 Ga0207645_10029309
1573 Ga0207645_10084457
1574 Ga0207645_10124044
1575 Ga0207645_10165916
1576 Ga0207645_10222407
1577 Ga0207643_10354669
1578 Ga0207705_10024227
1579 Ga0207705_10084207
1580 Ga0207654_10018368
1581 Ga0207707_10008909
1582 Ga0207707_10053566
1583 Ga0207707_10067600
1584 Ga0207707_10181612
1585 Ga0207707_10334464
1586 Ga0207707_10469631
1587 Ga0207695_10431254
1588 Ga0207695_10655950
1589 Ga0207671_10423519
1590 Ga0207663_10142973
1591 Ga0207663_10365801
1592 Ga0207662_10150419
1593 Ga0207657_10000448
1594 Ga0207657_10228233
1595 Ga0207649_10005573
1596 Ga0207652_10015551
1597 Ga0207652_10418661
1598 Ga0207646_10122638
1599 Ga0207681_10005166
1600 Ga0207681_10035629
1601 Ga0207681_10045292
1602 Ga0207681_10055414
1603 Ga0207681_10070953
1604 Ga0207681_10118295
1605 Ga0207681_10186256
1606 Ga0207694_10270522
1607 Ga0207694_10318853
1608 Ga0207694_10627871
1609 Ga0207650_10010475
1610 Ga0207650_10019816
1611 Ga0207650_10030655
1612 Ga0207650_10050169
1613 Ga0207650_10101322
1614 Ga0207650_10376426
1615 Ga0207650_10474982
1616 Ga0207650_10492388
1617 Ga0207659_10000075
1618 Ga0207659_10046961
1619 Ga0207659_10073247
1620 Ga0207659_10131379
1621 Ga0207659_10201429
1622 Ga0207659_10215185
1623 Ga0207659_10324321
1624 Ga0207687_10031240
1625 Ga0207700_10014085
1626 Ga0207700_10047062
1627 Ga0207664_10838521
1628 Ga0207644_10085382
1629 Ga0207644_10119773
1630 Ga0207644_10123990
1631 Ga0207644_10193296
1632 Ga0207644_10200216
1633 Ga0207644_10490773
1634 Ga0207690_10010646
1635 Ga0207690_10128797
1636 Ga0207690_10142243
1637 Ga0207706_10042267
1638 Ga0207706_10050254
1639 Ga0207706_10059061
1640 Ga0207706_10074877
1641 Ga0207706_10086215
1642 Ga0207706_10143615
1643 Ga0207706_10195597
1644 Ga0207686_10017235
1645 Ga0207686_10046573
1646 Ga0207709_10030752
1647 Ga0207670_10092069
1648 Ga0207670_10220217
1649 Ga0207670_10273572
1650 Ga0207670_10465436
1651 Ga0207669_10010135
1652 Ga0207669_10022027
1653 Ga0207669_10089728
1654 Ga0207669_10334755
1655 Ga0207669_10381261
1656 Ga0207704_10022928
1657 Ga0207704_10076942
1658 Ga0207704_10547202
1659 Ga0207704_10700042
1660 Ga0207665_10168135
1661 Ga0207665_10473583
1662 Ga0207691_10008868
1663 Ga0207691_10043122
1664 Ga0207691_10060975
1665 Ga0207691_10074037
1666 Ga0207691_10074726
1667 Ga0207691_10080538
1668 Ga0207691_10104282
1669 Ga0207691_10115755
1670 Ga0207691_10238176
1671 Ga0207691_10285351
1672 Ga0207691_10364411
1673 Ga0207691_10451550
1674 Ga0207711_10049002
1675 Ga0207711_10169824
1676 Ga0207711_10212493
1677 Ga0207711_10252936
1678 Ga0207711_10559930
1679 Ga0207689_10073252
1680 Ga0207689_10110604
1681 Ga0207689_10164587
1682 Ga0207661_10000567
1683 Ga0207661_10109351
1684 Ga0207661_10351773
1685 Ga0207661_10746585
1686 Ga0207679_10768687
1687 Ga0207679_10885148
1688 Ga0207667_10187506
1689 Ga0207667_10373609
1690 Ga0207651_10003088
1691 Ga0207651_10007158
1692 Ga0207651_10041239
1693 Ga0207651_10113781
1694 Ga0207651_10235469
1695 Ga0207651_10647646
1696 Ga0207712_10037150
1697 Ga0207712_10088135
1698 Ga0207712_10179183
1699 Ga0207712_10183835
1700 Ga0207712_10238209
1701 Ga0207712_10480878
1702 Ga0207668_10027164
1703 Ga0207668_10059144
1704 Ga0207668_10260717
1705 Ga0207668_10584716
1706 Ga0207668_10652318
1707 Ga0207640_10018088
1708 Ga0207640_10205248
1709 Ga0207658_10105861
1710 Ga0207658_10194292
1711 Ga0207658_10227832
1712 Ga0207658_10320168
1713 Ga0207677_10149796
1714 Ga0207677_10226155
1715 Ga0207677_10367257
1716 Ga0207677_10459286
1717 Ga0207703_10022323
1718 Ga0207703_10025748
1719 Ga0207703_10039878
1720 Ga0207703_10048252
1721 Ga0207703_10069074
1722 Ga0207703_10079485
1723 Ga0207703_10314452
1724 Ga0207639_10227673
1725 Ga0207639_10761473
1726 Ga0207678_10043158
1727 Ga0207678_10150138
1728 Ga0207678_10255437
1729 Ga0207678_10568104
1730 Ga0207708_10008877
1731 Ga0207708_10083007
1732 Ga0207708_10481808
1733 Ga0207708_10581270
1734 Ga0207702_10581927
1735 Ga0207641_10003428
1736 Ga0207641_10423443
1737 Ga0207648_10076215
1738 Ga0207648_10348190
1739 Ga0207648_10464246
1740 Ga0207676_10086647
1741 Ga0207676_10657044
1742 Ga0207674_10029982
1743 Ga0207674_10035104
1744 Ga0207674_10103058
1745 Ga0207674_10331875
1746 Ga0207674_10339166
1747 Ga0207674_10356077
1748 Ga0207675_100001961
1749 Ga0207675_100034443
1750 Ga0207675_100053359
1751 Ga0207675_100055856
1752 Ga0207675_100076709
1753 Ga0207675_100084029
1754 Ga0207675_100125120
1755 Ga0207675_100762200
1756 Ga0207675_101052628
1757 Ga0207683_10009776
1758 Ga0207683_10023171
1759 Ga0207683_10023218
1760 Ga0207683_10126635
1761 Ga0207683_10130214
1762 Ga0207683_10201478
1763 Ga0207683_10297817
1764 Ga0207683_10650726
1765 Ga0207683_10746296
1766 Ga0207698_10151658
1767 Ga0207698_10504839
1768 Ga0207698_10506609
1769 Ga0207698_10813027
1770 Ga0209983_1007398
1771 Ga0209971_1037486
1772 Ga0209974_10044943
1773 Ga0207428_10000285
1774 Ga0207428_10001407
1775 Ga0207428_10018231
1776 Ga0207428_10025243
1777 Ga0207428_10059452
1778 Ga0207428_10064360
1779 Ga0207428_10069091
1780 Ga0207428_10120655
1781 Ga0207428_10173511
1782 Ga0207428_10247580
1783 Ga0207428_10385513
1784 Ga0268266_10006901
1785 Ga0268266_10041832
1786 Ga0268266_10045819
1787 Ga0268266_10113898
1788 Ga0268266_10195239
1789 Ga0268266_10215536
1790 Ga0268266_10306004
1791 Ga0268265_10010217
1792 Ga0268265_10069855
1793 Ga0268265_10074816
1794 Ga0268265_10326541
1795 Ga0268264_10044786
1796 Ga0268264_10052704
1797 Ga0268264_10085886
1798 Ga0268264_10123523
1799 Ga0268264_10151292
1800 Ga0268264_10594460
1801 Ga0265328_10033986
1802 Ga0307408_100007220
1803 Ga0307408_100051756
1804 Ga0307408_100070001
1805 Ga0307408_100108344
1806 Ga0307408_100157043
1807 Ga0307408_100224027
1808 Ga0307408_100300294
1809 Ga0307408_100370135
1810 Ga0265314_10048897
1811 Ga0307405_10000638
1812 Ga0307405_10060249
1813 Ga0307405_10182484
1814 Ga0307405_10188354
1815 Ga0307405_10484962
1816 Ga0307405_10542716
1817 Ga0307413_10163002
1818 Ga0307413_10525052
1819 Ga0307410_10005295
1820 Ga0307410_10005377
1821 Ga0307410_10013809
1822 Ga0307410_10103370
1823 Ga0307410_10249638
1824 Ga0307406_10050379
1825 Ga0307406_10088306
1826 Ga0307406_10273985
1827 Ga0307406_10457589
1828 Ga0307406_10677116
1829 Ga0307407_10430208
1830 Ga0307407_10487481
1831 Ga0307412_10019250
1832 Ga0307412_10041236
1833 Ga0307412_10120582
1834 Ga0307409_100003656
1835 Ga0307409_100027858
1836 Ga0307409_100080729
1837 Ga0307409_100095181
1838 Ga0307409_100135409
1839 Ga0307409_100268120
1840 Ga0307409_100269896
1841 Ga0307409_100805854
1842 Ga0307409_100947220
1843 Ga0307409_101103675
1844 Ga0307416_100003391
1845 Ga0307416_100005385
1846 Ga0307416_100027297
1847 Ga0307416_100046391
1848 Ga0307416_100069563
1849 Ga0307416_100152269
1850 Ga0307416_100229856
1851 Ga0307416_100393702
1852 Ga0307416_100481589
1853 Ga0307416_100493573
1854 Ga0307414_10022618
1855 Ga0307414_10032519
1856 Ga0307414_10386875
1857 Ga0307411_10015778
1858 Ga0307411_10049207
1859 Ga0307411_10137405
1860 Ga0307411_10167183
1861 Ga0307411_10181406
1862 Ga0307411_10254152
1863 Ga0307411_10359268
1864 Ga0307411_10448320
1865 Ga0307415_100008737
1866 Ga0307415_100045149
1867 Ga0307415_100144515
1868 Ga0307415_100213929
1869 Ga0307415_100555032
1870 Ga0373930_0000510
1871 Ga0373950_0002125
1872 Ga0373959_0047853
1873 Ga0373938_0000206
1874 Ga0373926_0020790
1875 Ga0373928_0000674
1876 Ga0373934_0000502
1877 Ga0373949_0005185
1878 Ga0373951_0006467
1879 Ga0373952_0001452
1880 Ga0373923_0045461
1881 Ga0373932_0000234
1882 Ga0373936_0189322
1883 Ga0373939_0010538
1884 Ga0373939_0010583
1885 Ga0373941_0000681
1886 Ga0373945_0012349
1887 Ga0373945_0112480
1888 Ga0373945_0117659
1889 Ga0373953_0136041
1890 Ga0373956_0002305
1891 Ga0373957_0006583
1892 Ga0373957_0076301
1893 Ga0373960_0004046
1894 Ga0373943_0027562
1895 Ga0373943_0033744
1896 Ga0373946_0003193
1897 Ga0373946_0158810
1898 Ga0373955_0001878
1899 Ga0373955_0041411
1900 Ga0373942_0001609
1901 Ga0373961_0002109
1902 Ga0373962_0001193
1903 Ga0373962_0013954
1904 Ga0373924_0010240
1905 Ga0373931_0061124
1906 Ga0373927_0161281
1907 Ga0373927_0273107
1908 Ga0373933_0122611
1909 Ga0373933_0165075
1910 Ga0373947_0006424
1911 Ga0373947_0010816
1912 Ga0373947_0077827
1913 Ga0373937_0000304
1914 Ga0373937_0115348
1915 Ga0373937_0162533
1916 Ga0373937_0258793
1917 Ga0373937_0271176
1918 Ga0373937_0747439
1919 Ga0373925_0004724
1920 Ga0373925_0046004
1921 Ga0373925_0093957
1922 Ga0373925_0341161
1923 Ga0373925_0394029
1924 Ga0395900_0319278
1925 Ga0395901_0746397
1926 Ga0439453_0002515
1927 Ga0451807_1956052
1928 Ga0451807_2610490
1929 Ga0439431_0008752
1930 Ga0439433_0005770
1931 Ga0439433_0017492
1932 Ga0439433_0024804
1933 Ga0439441_015633
1934 Ga0439442_013980
1935 Ga0439450_005572
1936 Ga0439451_051466
1937 Ga0439462_0027702
1938 Ga0439446_0000727
1939 Ga0450908_002903
1940 Ga0450908_025890
1941 Ga0439434_0060338
1942 Ga0439435_0004113
1943 Ga0439435_0010743
1944 Ga0439435_0013846
1945 Ga0439435_0015784
1946 Ga0439435_0089008
1947 Ga0439444_0009297
1948 Ga0439464_0003390
1949 Ga0439464_0093526
1950 Ga0439460_0086812
1951 Ga0439460_0097327
1952 Ga0451577_0049163
1953 Ga0453684_0023641
1954 Ga0451576_0113292
1955 Ga0451576_0309445
1956 Ga0451576_0360049
1957 Ga0451576_0373756
1958 Ga0451576_0700516
1959 Ga0466967_0301003
1960 Ga0495592_0044739
1961 Ga0495603_0021187
1962 Ga0495629_0000298
1963 Ga0495638_0001740
1964 Ga0495653_0005508
1965 Ga0495580_0106332
1966 Ga0495582_0090918
1967 Ga0495639_0076733
1968 Ga0495639_0208364
1969 Ga0495664_0225637
1970 Ga0495584_0270888
1971 Ga0495594_0013813
1972 Ga0495594_0018400
1973 Ga0495594_0036140
1974 Ga0495608_0006754
1975 Ga0495628_0026102
1976 Ga0495630_0082924
1977 Ga0495630_0303667
1978 Ga0495666_0166657
1979 Ga0495652_0146775
1980 Ga0495640_0331660
1981 Ga0495586_0096554
1982 Ga0495586_0117043
1983 Ga0495587_0158842
1984 Ga0495598_0017053
1985 Ga0495621_0010977
1986 Ga0495621_0177978
1987 Ga0495645_0012788
1988 Ga0495667_0206562
1989 Ga0495656_0008191
1990 Ga0495668_0324305
1991 Ga0495634_0054782
1992 Ga0495634_0253716
1993 Ga0495635_0135961
1994 Ga0495635_0249080
1995 Ga0495635_0317679
1996 Ga0495659_0042645
1997 Ga0495588_0007178
1998 Ga0495599_0047153
1999 Ga0495599_0215422
2000 Ga0495599_0230563
2001 Ga0495647_0031937
2002 Ga0495647_0034368
2003 Ga0495658_0000158
2004 Ga0495658_0016100
2005 Ga0495658_0083708
2006 Ga0495658_0301214
2007 Ga0495658_0366892
2008 Ga0495613_0012260
2009 Ga0495613_0077793
2010 Ga0495613_0093113
2011 Ga0495613_0098736
2012 Ga0495613_0179418
2013 Ga0495613_0203579
2014 Ga0495581_0205210
2015 Ga0495581_0293937
2016 Ga0495604_0045587
2017 Ga0495604_0401223
2018 Ga0495604_0434546
2019 Ga0495636_0077728
2020 Ga0495674_0015359
2021 Ga0495680_0032633
2022 Ga0495680_0060393
2023 Ga0495680_0262936
2024 Ga0495684_0001031
2025 Ga0495684_0191666
2026 Ga0496100_0559581
2027 Ga0496101_0531252
2028 Ga0496101_0644975
2029 Ga0496102_0010134
2030 Ga0496102_0764100
2031 Ga0496104_0000157
2032 Ga0496104_0006829
2033 Ga0496104_0132151
2034 Ga0496104_0295522
2035 Ga0496104_0475497
2036 Ga0496105_0036722
2037 Ga0496105_0108203
2038 Ga0496105_0198299
2039 Ga0496105_0348461
2040 Ga0496105_0465183
2041 Ga0496106_0015998
2042 Ga0496106_0028722
2043 Ga0496106_0054761
2044 Ga0496106_0144979
2045 Ga0496106_0317155
2046 Ga0496106_0428530
2047 Ga0496107_0459148
2048 Ga0496108_0003499
2049 Ga0496108_0053846
2050 Ga0496108_0124256
2051 Ga0496108_0152588
2052 Ga0496108_0675127
2053 Ga0496109_0009476
2054 Ga0496109_0382672
2055 Ga0496110_0000063
2056 Ga0496110_0013141
2057 Ga0496110_0543153
2058 Ga0496110_0631196
2059 Ga0496111_0004348
2060 Ga0496112_0000245
2061 Ga0496112_0024556
2062 Ga0496112_0045209
2063 Ga0496114_0000371
2064 Ga0501031_0210298
2065 Ga0501032_0290228
2066 Ga0501033_0384697
2067 Ga0501034_0004421
2068 Ga0501034_0015307
2069 Ga0501034_0185030
2070 Ga0501036_0023391
2071 Ga0501036_0115763
2072 Ga0501036_0123787
2073 Ga0501036_0138618
2074 Ga0501036_0304211
2075 Ga0501036_0435418
2076 Ga0501038_0477751
2077 Ga0501039_0155211
2078 Ga0501040_0009429
2079 Ga0501040_0107855
2080 Ga0501040_0282167
2081 Ga0501041_0145605
2082 Ga0501042_0159360
2083 Ga0501042_0182881
2084 Ga0501042_0278463
2085 Ga0501043_0035081
2086 Ga0501046_0014990
2087 Ga0501046_0138946
2088 Ga0501046_0241982
2089 Ga0501047_0006564
2090 Ga0501048_0133975
2091 Ga0501048_0157189
2092 Ga0501068_0048008
2093 Ga0501068_0214804
2094 Ga0501069_0033832
2095 Ga0501070_0070082
2096 Ga0501070_0263261
2097 Ga0501071_0103984
2098 Ga0501071_0154841
2099 Ga0501071_0161166
2100 Ga0501071_0494906
2101 Ga0501071_0512460
2102 Ga0501072_0015475
2103 Ga0501072_0049533
2104 Ga0501072_0080291
2105 Ga0501072_0091854
2106 Ga0501073_0028966
2107 Ga0501074_0014603
2108 Ga0501074_0133875
2109 Ga0501074_0154697
2110 Ga0501075_0014357
2111 Ga0501075_0074796
2112 Ga0501075_0124772
2113 Ga0501075_0183749
2114 Ga0501076_0000633
2115 Ga0501076_0005874
2116 Ga0501076_0043485
2117 Ga0501076_0253971
2118 Ga0501076_0303167
2119 Ga0501076_0461498
2120 Ga0501076_0497259
2121 Ga0501077_0021021
2122 Ga0501077_0025618
2123 Ga0501079_0015604
2124 Ga0501079_0129700
2125 Ga0501079_0134846
2126 Ga0501079_0272763
2127 Ga0501079_0377104
2128 Ga0501079_0426611
2129 Ga0501080_0161216
2130 Ga0501080_0400591
2131 Ga0501080_0454806
2132 Ga0501081_0169883
2133 Ga0501081_0362411
2134 Ga0501083_0027632
2135 Ga0501083_0133586
2136 Ga0501035_0071193
2137 Ga0501035_0225517
2138 Ga0501035_0389576
2139 Ga0501044_0063277
2140 Ga0501045_0008164
2141 Ga0501045_0015928
2142 Ga0501045_0021060
2143 Ga0501045_0253853
2144 Ga0501045_0375843
2145 Ga0501045_0429706
2146 Ga0501045_0518597
2147 nmdc:mga03n38_122509_c1
2148 nmdc:mga00v17_146452_c1
2149 nmdc:mga00v17_152233_c1
2150 nmdc:mga00v17_3644_c1
2151 nmdc:mga00v17_485569_c1
2152 nmdc:mga00v17_9961_c1
2153 nmdc:mga0yw44_213104_c1
2154 nmdc:mga0yw44_34063_c1
2155 nmdc:mga0k408_17316_c1
2156 nmdc:mga0k408_19933_c1
2157 nmdc:mga0k408_31765_c1
2158 nmdc:mga0k408_407512_c1
2159 nmdc:mga0k408_42504_c1
2160 nmdc:mga0k408_5159_c1
2161 nmdc:mga06z11_123905_c1
2162 nmdc:mga06z11_21219_c1
2163 nmdc:mga06z11_32515_c1
2164 nmdc:mga06z11_33718_c1
2165 nmdc:mga06z11_45763_c1
2166 nmdc:mga06z11_71953_c1
2167 nmdc:mga04h51_118661_c1
2168 nmdc:mga07m45_26856_c1
2169 nmdc:mga07m45_48197_c1
2170 nmdc:mga07m45_49951_c1
2171 nmdc:mga05p37_10862_c1
2172 nmdc:mga05p37_109001_c1
2173 nmdc:mga05p37_109613_c1
2174 nmdc:mga05p37_1107_c1
2175 nmdc:mga05p37_11748_c1
2176 nmdc:mga05p37_12193_c1
2177 nmdc:mga05p37_13533_c1
2178 nmdc:mga05p37_177158_c1
2179 nmdc:mga05p37_18779_c1
2180 nmdc:mga05p37_22849_c1
2181 nmdc:mga05p37_29_c1
2182 nmdc:mga05p37_31095_c1
2183 nmdc:mga05p37_369821_c1
2184 nmdc:mga05p37_453274_c1
2185 nmdc:mga05p37_500386_c1
2186 nmdc:mga05p37_5648_c1
2187 nmdc:mga05p37_620742_c1
2188 nmdc:mga05p37_62653_c1
2189 nmdc:mga05p37_789705_c1
2190 nmdc:mga05p37_794584_c1
2191 nmdc:mga05p37_81819_c1
2192 nmdc:mga05p37_862_c1
2193 nmdc:mga09592_14921_c1
2194 nmdc:mga09592_155598_c1
2195 nmdc:mga09592_33010_c1
2196 nmdc:mga09592_3601_c1
2197 nmdc:mga09592_3762_c1
2198 nmdc:mga09592_511705_c1
2199 nmdc:mga09592_564611_c1
2200 nmdc:mga0qj67_197336_c1
2201 nmdc:mga0qj67_197363_c1
2202 nmdc:mga0qj67_20525_c1
2203 nmdc:mga0qj67_21098_c1
2204 nmdc:mga0qj67_305951_c1
2205 nmdc:mga0qj67_32771_c1
2206 nmdc:mga0qj67_7314_c1
2207 nmdc:mga06r32_108553_c1
2208 nmdc:mga06r32_11212_c1
2209 nmdc:mga06r32_222190_c1
2210 nmdc:mga06r32_22778_c1
2211 nmdc:mga06r32_270908_c1
2212 nmdc:mga06r32_323528_c1
2213 nmdc:mga06r32_34703_c1
2214 nmdc:mga06r32_3980_c1
2215 nmdc:mga06r32_45686_c1
2216 nmdc:mga06r32_58764_c1
2217 nmdc:mga06r32_626307_c1
2218 nmdc:mga06r32_70184_c1
2219 nmdc:mga06r32_88844_c1
2220 nmdc:mga08y16_12654_c1
2221 nmdc:mga08y16_16284_c1
2222 nmdc:mga08y16_168837_c1
2223 nmdc:mga08y16_17_c1
2224 nmdc:mga08y16_241173_c1
2225 nmdc:mga08y16_24741_c1
2226 nmdc:mga08y16_40211_c1
2227 nmdc:mga08y16_4308_c1
2228 nmdc:mga08y16_510209_c1
2229 nmdc:mga08y16_514643_c1
2230 nmdc:mga08y16_537185_c1
2231 nmdc:mga08y16_56103_c1
2232 nmdc:mga08y16_65734_c1
2233 nmdc:mga08y16_735_c1
2234 nmdc:mga08y16_82239_c1
2235 nmdc:mga08y16_84914_c1
2236 nmdc:mga08y16_866203_c1
2237 nmdc:mga08y16_94017_c1
2238 nmdc:mga0n895_16030_c1
2239 nmdc:mga0n895_203419_c1
2240 nmdc:mga0n895_211351_c1
2241 nmdc:mga0n895_233424_c1
2242 nmdc:mga0n895_234292_c1
2243 nmdc:mga0n895_461918_c1
2244 nmdc:mga0n895_51007_c1
2245 nmdc:mga0n895_511583_c1
2246 nmdc:mga0n895_5332_c1
2247 nmdc:mga0n895_570264_c1
2248 nmdc:mga0n895_726696_c1
2249 nmdc:mga0n895_751662_c1
2250 nmdc:mga0n895_75460_c1
2251 nmdc:mga0n895_987717_c1
2252 nmdc:mga0rr50_10927_c1
2253 nmdc:mga0rr50_113418_c1
2254 nmdc:mga0rr50_141699_c1
2255 nmdc:mga0rr50_28_c1
2256 nmdc:mga0rr50_3354_c1
2257 nmdc:mga0rr50_38805_c1
2258 nmdc:mga0rr50_422196_c1
2259 nmdc:mga08x19_121_c1
2260 nmdc:mga08x19_13456_c1
2261 nmdc:mga08x19_15726_c1
2262 nmdc:mga08x19_2483_c1
2263 nmdc:mga08x19_301301_c1
2264 nmdc:mga08x19_366026_c1
2265 nmdc:mga08x19_52350_c1
2266 nmdc:mga08x19_57682_c1
2267 nmdc:mga0a205_101483_c1
2268 nmdc:mga0a205_104385_c1
2269 nmdc:mga0a205_126002_c1
2270 nmdc:mga0a205_138608_c1
2271 nmdc:mga0a205_140146_c1
2272 nmdc:mga0a205_222886_c1
2273 nmdc:mga0a205_256656_c1
2274 nmdc:mga0a205_340139_c1
2275 nmdc:mga0a205_371825_c1
2276 nmdc:mga0a205_445687_c1
2277 nmdc:mga0a205_4572_c1
2278 nmdc:mga0a205_56762_c1
2279 nmdc:mga0a205_575034_c1
2280 nmdc:mga0a205_66435_c1
2281 Ga0495601_0027955
2282 Ga0495601_0055347
2283 Ga0495601_0191357
2284 Ga0495619_0009771
2285 Ga0495619_0060487
2286 Ga0495619_0082571
2287 Ga0495619_0143688
2288 Ga0495619_0164499
2289 Ga0500555_000060
2290 Ga0500556_0028697
2291 Ga0500592_028330
2292 Ga0500628_069254
2293 Ga0500616_0000336
2294 Ga0500599_000325
2295 Ga0501084_0007476
2296 Ga0501084_0011024
2297 Ga0501084_0046698
2298 Ga0501084_0079083
2299 Ga0501084_0089178
2300 Ga0501084_0196797
2301 Ga0501084_0481370
2302 Ga0590071_001383
2303 Ga0590071_008874
2304 Ga0590074_000829
2305 Ga0590074_001439
2306 Ga0590075_000139
2307 Ga0590075_001920
2308 Ga0590077_000011
2309 Ga0590077_005123
2310 Ga0590077_007691
2311 Ga0587077_032258
2312 Ga0501082_0019848
2313 Ga0501082_0158654
2314 Ga0501082_0161404
2315 Ga0501082_0218422
2316 Ga0501082_0219154
2317 Ga0501082_0389310
2318 Ga0501082_0656815
2319 Ga0530510_0062521
2320 Ga0530510_0099668
2321 Ga0530510_0230193
2322 Ga0530510_0510346

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF20772

TACO1_YebC_N

TACO1/YebC protein N-terminal domain

5

76

0.98

PF01709

Transcrip_reg

TACO1/YebC second and third domain

82

208

0.95

PF00211

Guanylate_cyc

Adenylate and Guanylate cyclase catalytic domain

187

308

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
1lfp-assembly1.cif.gz_A crystal structure of a conserved hypothetical protein aq1575 from aquifex aeolicus 0.885 16 240
1kon-assembly1.cif.gz_A crystal structure of e.coli yebc 0.8605 4 245
1kon-assembly1.cif.gz_A crystal structure of e.coli yebc 0.847 4 245
1lfp-assembly1.cif.gz_A crystal structure of a conserved hypothetical protein aq1575 from aquifex aeolicus 0.8206 16 240
4f3q-assembly1.cif.gz_A structure of a yebc family protein (cbu_1566) from coxiella burnetii 0.8117 7 242
ID Description Score Start End Superfamily
1lfpA02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;YebC, transcriptional regulation domain 0.9769 83 240 3.30.70.980
1lfpA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Integrase, N-terminal zinc-binding domain 0.9223 18 79 1.10.10.200
1mw7A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Integrase, N-terminal zinc-binding domain 0.9179 24 77 1.10.10.200
1mw7A03 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;YebC, transcriptional regulation domain 0.9031 134 200 3.30.70.980
af_P9WGA5_1_79_1.10.10.200 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Integrase, N-terminal zinc-binding domain 0.8959 1 79 1.10.10.200
ID Description Score Start End GO Terms
AF-X1CK43-F1-model_v4 YebC/PmpR family DNA-binding transcriptional regulator 0.9699 32 136 GO:0003677
GO:0005829
AF-A0A1G0NS23-F1-model_v4 Transcriptional regulator 0.967 4 249 GO:0003677
GO:0005829
AF-A0A3B9L7U6-F1-model_v4 YebC/PmpR family DNA-binding transcriptional regulator 0.9668 61 240 GO:0003677
GO:0005829
AF-K1UEW2-F1-model_v4 Protein containing DUF28 0.9645 83 239 GO:0005829
AF-A0A7W0RF44-F1-model_v4 Probable transcriptional regulatory protein H0U26_07340 0.9637 1 249 GO:0003677
GO:0005829
GO:0006355

Map