F490929
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1155 | 465 | 1138 | 225 |
Family's Representative Sequence
| Representative Sequence | 3300048929|Ga0496126_0424088|Ga0496126_0424088_300_995 |
| Length | 231 |
| Sequence | MPAAGPQPDTTTRISRFITVEGGEGGGKSTQLRRLAELLQAQGEVVCLTREPGGAPGAEDIRRLLVEGDPGRWTPESEALLHFAARADHLARVIRPALTAGQWVLCDRFADSTIAYQGYGHGLDMAWLQALRRQIVGPTEPGLTIILDLPIEVGLARAAKRQQPNAAAPQAAEDRYERMDRGFHQRLRDGFLAIAAAEPGRCKVVDADRPVDEIASDLLSVMNRRFALKLF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 2 | 2643221576 | Nocardioides sp. Root614 | Isolate | Unclassified |
| 3 | 2643221590 | Nocardioides sp. Root682 | Isolate | Unclassified |
| 4 | 2643221604 | Nocardioides sp. Root190 | Isolate | Unclassified |
| 5 | 2643221617 | Nocardioides sp. Root79 | Isolate | Unclassified |
| 6 | 2643221620 | Nocardioides sp. Root240 | Isolate | Unclassified |
| 7 | 2738541305 | Nocardioides sp. CF167 | Isolate | Unclassified |
| 8 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 9 | 2811994874 | Nocardioides sp. SLBN-35 | Isolate | Unclassified |
| 10 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 11 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 12 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 13 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 14 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 15 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 16 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 17 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 18 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 19 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 20 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 21 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 22 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 23 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 24 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 25 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 26 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 27 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 28 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 29 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 30 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 31 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 32 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 33 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 35 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 37 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 40 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 42 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 52 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 63 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 64 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 65 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 67 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 68 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 70 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 72 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 77 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 78 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 80 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 81 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 82 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 84 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 85 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 86 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 87 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 88 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 89 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 90 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 91 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 92 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 93 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 94 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 96 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 97 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 98 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 99 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 100 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 101 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 102 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 103 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 104 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 105 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 106 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 107 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 108 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 109 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 110 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 111 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 112 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 113 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 114 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 115 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 116 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 118 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 119 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 120 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 133 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 148 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 152 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 212 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 213 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 217 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 218 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 219 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 220 | 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 221 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 222 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 223 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 224 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 225 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 226 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 227 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 228 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 229 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 230 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 231 | 3300033544 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 | Metagenome | Unclassified |
| 232 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 233 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 234 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 235 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 236 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 237 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 238 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 239 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 240 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 241 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 242 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 243 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 244 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 245 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 246 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 247 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 248 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 249 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 250 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 251 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 252 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 253 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 254 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 255 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 256 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 257 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 258 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 259 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 260 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 261 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 262 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 263 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 264 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 265 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 266 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 267 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 268 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 269 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 270 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 271 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 272 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 273 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 348 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 349 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 350 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 351 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 352 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 353 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 354 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 355 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 356 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 357 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 358 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 359 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 360 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 361 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 362 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 363 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 364 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 365 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 366 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 367 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 368 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 369 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 370 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 371 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 372 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 373 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 374 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 375 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 376 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 377 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 378 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 379 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 380 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 381 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 382 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 383 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 384 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 385 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 386 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 387 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 388 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 389 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 390 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 391 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 392 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 393 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 394 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 395 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 396 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 397 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 398 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 399 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 400 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 401 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 402 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 403 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 404 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 405 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 406 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 407 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 408 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 409 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 410 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 411 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 412 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 413 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 414 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 415 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 416 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 417 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 418 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 419 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 420 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 421 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 427 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 428 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 429 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 430 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 431 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 432 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 433 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 434 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 435 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 436 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 437 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 438 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 439 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 440 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 441 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 442 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 443 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 444 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 445 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 446 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 447 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 448 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 449 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 450 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 451 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 452 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 453 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 454 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 455 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 456 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 457 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 458 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 459 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 460 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 461 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 462 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 463 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 464 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 465 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.27 |
| Metatranscriptomes | 0.26 |
| Isolates | 1.47 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.95 |
| Nodule | 0.17 |
| Rhizoplane | 6.32 |
| Rhizosphere | 78.53 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.03 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24752J21851_1007459 | 3300001976 | Bacteria | 1427 |
| 2 | JGI24737J22298_10012530 | 3300001990 | Bacteria | 2765 |
| 3 | JGI24743J22301_10000134 | 3300001991 | Bacteria | 7428 |
| 4 | JGI24750J21931_1000851 | 3300002070 | Bacteria | 4209 |
| 5 | JGI24745J21846_1001252 | 3300002073 | Bacteria | 2447 |
| 6 | JGI24748J21848_1001597 | 3300002074 | Bacteria | 2522 |
| 7 | JGI24749J21850_1000509 | 3300002076 | Bacteria | 5726 |
| 8 | JGI24744J21845_10002294 | 3300002077 | Bacteria | 3897 |
| 9 | JGI24034J26672_10002367 | 3300002239 | Bacteria | 2584 |
| 10 | JGI24751J29686_10001980 | 3300002459 | Bacteria | 4179 |
| 11 | JGI25153J46596_10006534 | 3300003215 | Bacteria | 5878 |
| 12 | rootH1_10021619 | 3300003316 | Bacteria | 1264 |
| 13 | rootH2_10032559 | 3300003320 | Bacteria | 12792 |
| 14 | rootL2_10291390 | 3300003322 | Bacteria | 1056 |
| 15 | JGI25160J50197_1001950 | 3300003354 | Bacteria | 9853 |
| 16 | Ga0065165_1028635 | 3300005262 | Bacteria | 1796 |
| 17 | Ga0070683_100269295 | 3300005329 | Bacteria | 1620 |
| 18 | Ga0070690_100028892 | 3300005330 | Bacteria | 3437 |
| 19 | Ga0070670_100013394 | 3300005331 | Bacteria | 7024 |
| 20 | Ga0070670_100020400 | 3300005331 | Bacteria | 5697 |
| 21 | Ga0068869_100028205 | 3300005334 | Bacteria | 3921 |
| 22 | Ga0070680_100002406 | 3300005336 | Bacteria | 13858 |
| 23 | Ga0070680_100022351 | 3300005336 | Bacteria | 5037 |
| 24 | Ga0070680_100343800 | 3300005336 | Bacteria | 1268 |
| 25 | Ga0070680_100698473 | 3300005336 | Unclassified | 873 |
| 26 | Ga0070682_100008050 | 3300005337 | Bacteria | 5937 |
| 27 | Ga0068868_100007445 | 3300005338 | Bacteria | 7795 |
| 28 | Ga0070660_100222309 | 3300005339 | Bacteria | 1535 |
| 29 | Ga0070689_100075714 | 3300005340 | Bacteria | 2636 |
| 30 | Ga0070691_10120209 | 3300005341 | Bacteria | 1322 |
| 31 | Ga0070687_100001322 | 3300005343 | Bacteria | 8663 |
| 32 | Ga0070687_100079089 | 3300005343 | Bacteria | 1789 |
| 33 | Ga0070661_100077062 | 3300005344 | Bacteria | 2457 |
| 34 | Ga0070668_100012197 | 3300005347 | Bacteria | 6401 |
| 35 | Ga0070669_100065344 | 3300005353 | Bacteria | 2680 |
| 36 | Ga0070669_100086295 | 3300005353 | Bacteria | 2345 |
| 37 | Ga0070669_100324818 | 3300005353 | Bacteria | 1243 |
| 38 | Ga0070669_100331888 | 3300005353 | Bacteria | 1230 |
| 39 | Ga0070675_100035184 | 3300005354 | Bacteria | 4068 |
| 40 | Ga0070671_100013663 | 3300005355 | Bacteria | 6548 |
| 41 | Ga0070671_100162171 | 3300005355 | Bacteria | 1890 |
| 42 | Ga0070671_100178959 | 3300005355 | Bacteria | 1795 |
| 43 | Ga0070671_100390424 | 3300005355 | Bacteria | 1190 |
| 44 | Ga0070671_100497137 | 3300005355 | Unclassified | 1049 |
| 45 | Ga0070674_100002023 | 3300005356 | Bacteria | 11113 |
| 46 | Ga0070674_100116254 | 3300005356 | Bacteria | 1973 |
| 47 | Ga0070674_100413441 | 3300005356 | Bacteria | 1105 |
| 48 | Ga0070673_100012244 | 3300005364 | Bacteria | 5884 |
| 49 | Ga0070673_100078176 | 3300005364 | Bacteria | 2676 |
| 50 | Ga0070673_100081066 | 3300005364 | Bacteria | 2631 |
| 51 | Ga0070688_100006730 | 3300005365 | Bacteria | 6160 |
| 52 | Ga0070688_100020200 | 3300005365 | Bacteria | 3869 |
| 53 | Ga0070688_100044398 | 3300005365 | Bacteria | 2743 |
| 54 | Ga0070659_100043352 | 3300005366 | Bacteria | 3519 |
| 55 | Ga0070659_100311580 | 3300005366 | Bacteria | 1314 |
| 56 | Ga0070667_100006086 | 3300005367 | Bacteria | 10016 |
| 57 | Ga0070667_100084771 | 3300005367 | Bacteria | 2716 |
| 58 | Ga0070714_100000556 | 3300005435 | Bacteria | 26845 |
| 59 | Ga0070713_101169477 | 3300005436 | Bacteria | 744 |
| 60 | Ga0070710_10002571 | 3300005437 | Bacteria | 8617 |
| 61 | Ga0070710_10018625 | 3300005437 | Bacteria | 3574 |
| 62 | Ga0070701_10000544 | 3300005438 | Bacteria | 12999 |
| 63 | Ga0070711_100017293 | 3300005439 | Bacteria | 4590 |
| 64 | Ga0070711_100179886 | 3300005439 | Bacteria | 1619 |
| 65 | Ga0070711_100477130 | 3300005439 | Bacteria | 1025 |
| 66 | Ga0070700_100014905 | 3300005441 | Bacteria | 4396 |
| 67 | Ga0070663_100099777 | 3300005455 | Bacteria | 2165 |
| 68 | Ga0070663_100522804 | 3300005455 | Bacteria | 988 |
| 69 | Ga0070678_100033394 | 3300005456 | Bacteria | 3572 |
| 70 | Ga0070678_100042057 | 3300005456 | Bacteria | 3245 |
| 71 | Ga0070678_100065144 | 3300005456 | Bacteria | 2704 |
| 72 | Ga0070681_10030828 | 3300005458 | Bacteria | 5382 |
| 73 | Ga0070681_10036642 | 3300005458 | Bacteria | 4924 |
| 74 | Ga0068867_100006600 | 3300005459 | Bacteria | 8201 |
| 75 | Ga0068867_100112569 | 3300005459 | Bacteria | 2093 |
| 76 | Ga0070685_10001171 | 3300005466 | Bacteria | 14029 |
| 77 | Ga0070698_100407018 | 3300005471 | Bacteria | 1294 |
| 78 | Ga0070679_100010449 | 3300005530 | Bacteria | 8806 |
| 79 | Ga0070679_100016290 | 3300005530 | Bacteria | 7163 |
| 80 | Ga0070684_100111632 | 3300005535 | Bacteria | 2452 |
| 81 | Ga0070697_100039437 | 3300005536 | Bacteria | 3819 |
| 82 | Ga0068853_100011139 | 3300005539 | Bacteria | 7295 |
| 83 | Ga0068853_100028508 | 3300005539 | Bacteria | 4697 |
| 84 | Ga0068853_100037050 | 3300005539 | Bacteria | 4149 |
| 85 | Ga0070672_100007959 | 3300005543 | Bacteria | 7240 |
| 86 | Ga0070686_100242105 | 3300005544 | Bacteria | 1314 |
| 87 | Ga0070686_100615599 | 3300005544 | Bacteria | 857 |
| 88 | Ga0070695_100008588 | 3300005545 | Bacteria | 6068 |
| 89 | Ga0070696_100007312 | 3300005546 | Bacteria | 7374 |
| 90 | Ga0070693_100012903 | 3300005547 | Bacteria | 4243 |
| 91 | Ga0070665_100031361 | 3300005548 | Bacteria | 5349 |
| 92 | Ga0070704_100002394 | 3300005549 | Bacteria | 10529 |
| 93 | Ga0070704_100081333 | 3300005549 | Bacteria | 2386 |
| 94 | Ga0070704_100103455 | 3300005549 | Bacteria | 2151 |
| 95 | Ga0070704_100334507 | 3300005549 | Bacteria | 1273 |
| 96 | Ga0068855_100074040 | 3300005563 | Bacteria | 3956 |
| 97 | Ga0068855_100136130 | 3300005563 | Bacteria | 2803 |
| 98 | Ga0068855_100144161 | 3300005563 | Bacteria | 2713 |
| 99 | Ga0070664_100051607 | 3300005564 | Bacteria | 3482 |
| 100 | Ga0068857_100156103 | 3300005577 | Bacteria | 2069 |
| 101 | Ga0068854_100103200 | 3300005578 | Bacteria | 2140 |
| 102 | Ga0068856_100110413 | 3300005614 | Bacteria | 2747 |
| 103 | Ga0068856_100246984 | 3300005614 | Bacteria | 1800 |
| 104 | Ga0070702_100036072 | 3300005615 | Bacteria | 2736 |
| 105 | Ga0070702_100218091 | 3300005615 | Bacteria | 1274 |
| 106 | Ga0070702_100259079 | 3300005615 | Bacteria | 1183 |
| 107 | Ga0070702_100346934 | 3300005615 | Bacteria | 1044 |
| 108 | Ga0068859_100149112 | 3300005617 | Bacteria | 2415 |
| 109 | Ga0068859_100193521 | 3300005617 | Bacteria | 2118 |
| 110 | Ga0068864_100397581 | 3300005618 | Bacteria | 1309 |
| 111 | Ga0068864_100418600 | 3300005618 | Bacteria | 1276 |
| 112 | Ga0068870_10005222 | 3300005840 | Bacteria | 5652 |
| 113 | Ga0068863_100007012 | 3300005841 | Bacteria | 11043 |
| 114 | Ga0068863_100155966 | 3300005841 | Bacteria | 2186 |
| 115 | Ga0068863_100500957 | 3300005841 | Bacteria | 1196 |
| 116 | Ga0068858_100016071 | 3300005842 | Bacteria | 7031 |
| 117 | Ga0068858_100383926 | 3300005842 | Bacteria | 1348 |
| 118 | Ga0068860_100040442 | 3300005843 | Bacteria | 4455 |
| 119 | Ga0068860_100216486 | 3300005843 | Bacteria | 1859 |
| 120 | Ga0068862_100011484 | 3300005844 | Bacteria | 7311 |
| 121 | Ga0068862_100029912 | 3300005844 | Bacteria | 4589 |
| 122 | Ga0068862_100840405 | 3300005844 | Bacteria | 899 |
| 123 | Ga0068862_101167701 | 3300005844 | Bacteria | 767 |
| 124 | Ga0081455_10010899 | 3300005937 | Bacteria | 9174 |
| 125 | Ga0081455_10033604 | 3300005937 | Bacteria | 4607 |
| 126 | Ga0081455_10469817 | 3300005937 | Bacteria | 854 |
| 127 | Ga0081538_10029065 | 3300005981 | Bacteria | 3785 |
| 128 | Ga0081538_10034984 | 3300005981 | Bacteria | 3309 |
| 129 | Ga0081538_10078950 | 3300005981 | Bacteria | 1763 |
| 130 | Ga0081540_1017139 | 3300005983 | Bacteria | 4497 |
| 131 | Ga0081539_10015587 | 3300005985 | Bacteria | 5512 |
| 132 | Ga0070717_10022811 | 3300006028 | Bacteria | 4951 |
| 133 | Ga0070717_10057188 | 3300006028 | Bacteria | 3224 |
| 134 | Ga0070717_10059609 | 3300006028 | Bacteria | 3159 |
| 135 | Ga0070717_10167415 | 3300006028 | Bacteria | 1910 |
| 136 | Ga0070717_10310901 | 3300006028 | Bacteria | 1402 |
| 137 | Ga0075365_10001017 | 3300006038 | Bacteria | 12044 |
| 138 | Ga0075365_10007361 | 3300006038 | Bacteria | 6157 |
| 139 | Ga0075365_10026251 | 3300006038 | Bacteria | 3696 |
| 140 | Ga0075365_10041020 | 3300006038 | Bacteria | 3021 |
| 141 | Ga0075365_10047027 | 3300006038 | Bacteria | 2835 |
| 142 | Ga0075365_10078435 | 3300006038 | Bacteria | 2233 |
| 143 | Ga0075365_10141855 | 3300006038 | Bacteria | 1668 |
| 144 | Ga0075365_10333070 | 3300006038 | Bacteria | 1069 |
| 145 | Ga0075365_10386415 | 3300006038 | Bacteria | 987 |
| 146 | Ga0075368_10065813 | 3300006042 | Bacteria | 1456 |
| 147 | Ga0075368_10194856 | 3300006042 | Bacteria | 856 |
| 148 | Ga0075363_100076097 | 3300006048 | Bacteria | 1829 |
| 149 | Ga0075363_100137181 | 3300006048 | Bacteria | 1375 |
| 150 | Ga0075363_100151318 | 3300006048 | Bacteria | 1310 |
| 151 | Ga0075363_100288731 | 3300006048 | Bacteria | 950 |
| 152 | Ga0075364_10033452 | 3300006051 | Bacteria | 3311 |
| 153 | Ga0075364_10083572 | 3300006051 | Bacteria | 2113 |
| 154 | Ga0070715_10127066 | 3300006163 | Bacteria | 1222 |
| 155 | Ga0070715_10174973 | 3300006163 | Bacteria | 1072 |
| 156 | Ga0070716_100022930 | 3300006173 | Bacteria | 3305 |
| 157 | Ga0070712_100004847 | 3300006175 | Bacteria | 8318 |
| 158 | Ga0070712_100033476 | 3300006175 | Bacteria | 3478 |
| 159 | Ga0070712_100088621 | 3300006175 | Bacteria | 2261 |
| 160 | Ga0075362_10013531 | 3300006177 | Bacteria | 3268 |
| 161 | Ga0075362_10051552 | 3300006177 | Bacteria | 1842 |
| 162 | Ga0075367_10047397 | 3300006178 | Bacteria | 2528 |
| 163 | Ga0075367_10140312 | 3300006178 | Bacteria | 1497 |
| 164 | Ga0075367_10172944 | 3300006178 | Bacteria | 1346 |
| 165 | Ga0075367_10218491 | 3300006178 | Bacteria | 1192 |
| 166 | Ga0075367_10305587 | 3300006178 | Bacteria | 1001 |
| 167 | Ga0075369_10005025 | 3300006186 | Bacteria | 4926 |
| 168 | Ga0075369_10047996 | 3300006186 | Bacteria | 1842 |
| 169 | Ga0075369_10189107 | 3300006186 | Bacteria | 948 |
| 170 | Ga0075366_10008616 | 3300006195 | Bacteria | 5679 |
| 171 | Ga0075366_10013786 | 3300006195 | Bacteria | 4607 |
| 172 | Ga0075366_10036925 | 3300006195 | Bacteria | 2882 |
| 173 | Ga0075366_10193129 | 3300006195 | Bacteria | 1237 |
| 174 | Ga0075366_10404603 | 3300006195 | Bacteria | 840 |
| 175 | Ga0075370_10027696 | 3300006353 | Bacteria | 3147 |
| 176 | Ga0075370_10099290 | 3300006353 | Bacteria | 1684 |
| 177 | Ga0068871_100067335 | 3300006358 | Bacteria | 2937 |
| 178 | Ga0068871_100113778 | 3300006358 | Bacteria | 2279 |
| 179 | Ga0075428_100001218 | 3300006844 | Bacteria | 27549 |
| 180 | Ga0075428_100022676 | 3300006844 | Bacteria | 6949 |
| 181 | Ga0075428_100573027 | 3300006844 | Bacteria | 1206 |
| 182 | Ga0075428_100624086 | 3300006844 | Bacteria | 1150 |
| 183 | Ga0075430_100000152 | 3300006846 | Bacteria | 44881 |
| 184 | Ga0075430_100025527 | 3300006846 | Bacteria | 5027 |
| 185 | Ga0075430_100045037 | 3300006846 | Bacteria | 3729 |
| 186 | Ga0075430_100198426 | 3300006846 | Bacteria | 1667 |
| 187 | Ga0075431_100000613 | 3300006847 | Bacteria | 30137 |
| 188 | Ga0075431_100010947 | 3300006847 | Bacteria | 9128 |
| 189 | Ga0075431_100062491 | 3300006847 | Bacteria | 3843 |
| 190 | Ga0075431_100064062 | 3300006847 | Bacteria | 3795 |
| 191 | Ga0075431_100582744 | 3300006847 | Bacteria | 1104 |
| 192 | Ga0075431_101208336 | 3300006847 | Bacteria | 719 |
| 193 | Ga0075433_10059850 | 3300006852 | Bacteria | 3333 |
| 194 | Ga0075433_10298209 | 3300006852 | Bacteria | 1427 |
| 195 | Ga0075434_100017361 | 3300006871 | Bacteria | 6930 |
| 196 | Ga0075434_100056047 | 3300006871 | Bacteria | 3916 |
| 197 | Ga0075434_100269646 | 3300006871 | Bacteria | 1721 |
| 198 | Ga0075429_100004424 | 3300006880 | Bacteria | 12075 |
| 199 | Ga0075429_100274586 | 3300006880 | Bacteria | 1476 |
| 200 | Ga0075429_100429975 | 3300006880 | Bacteria | 1157 |
| 201 | Ga0068865_100098503 | 3300006881 | Bacteria | 2136 |
| 202 | Ga0068865_100403720 | 3300006881 | Bacteria | 1120 |
| 203 | Ga0075436_100000477 | 3300006914 | Bacteria | 26044 |
| 204 | Ga0075436_100028761 | 3300006914 | Bacteria | 3823 |
| 205 | Ga0075436_100520032 | 3300006914 | Bacteria | 872 |
| 206 | Ga0097620_100149123 | 3300006931 | Bacteria | 2415 |
| 207 | Ga0097620_100193536 | 3300006931 | Bacteria | 2118 |
| 208 | Ga0075435_100076627 | 3300007076 | Bacteria | 2741 |
| 209 | Ga0075435_100079110 | 3300007076 | Bacteria | 2697 |
| 210 | Ga0099794_10089867 | 3300007265 | Bacteria | 1523 |
| 211 | Ga0099795_10001007 | 3300007788 | Bacteria | 5787 |
| 212 | Ga0099795_10025722 | 3300007788 | Bacteria | 1976 |
| 213 | Ga0105251_10054542 | 3300009011 | Bacteria | 1898 |
| 214 | Ga0105240_10026738 | 3300009093 | Bacteria | 7568 |
| 215 | Ga0111539_10000840 | 3300009094 | Bacteria | 39968 |
| 216 | Ga0111539_10044534 | 3300009094 | Bacteria | 5317 |
| 217 | Ga0111539_10083183 | 3300009094 | Bacteria | 3764 |
| 218 | Ga0111539_10089489 | 3300009094 | Bacteria | 3617 |
| 219 | Ga0111539_10106273 | 3300009094 | Bacteria | 3293 |
| 220 | Ga0111539_10168821 | 3300009094 | Bacteria | 2557 |
| 221 | Ga0111539_10241880 | 3300009094 | Bacteria | 2101 |
| 222 | Ga0105245_10028096 | 3300009098 | Bacteria | 4958 |
| 223 | Ga0105245_10201889 | 3300009098 | Bacteria | 1910 |
| 224 | Ga0105247_10110832 | 3300009101 | Bacteria | 1766 |
| 225 | Ga0105247_10228451 | 3300009101 | Bacteria | 1263 |
| 226 | Ga0114129_10000320 | 3300009147 | Bacteria | 56319 |
| 227 | Ga0114129_10002097 | 3300009147 | Bacteria | 27432 |
| 228 | Ga0114129_10051669 | 3300009147 | Bacteria | 5770 |
| 229 | Ga0114129_10061592 | 3300009147 | Bacteria | 5244 |
| 230 | Ga0114129_11430534 | 3300009147 | Bacteria | 852 |
| 231 | Ga0105243_10023744 | 3300009148 | Bacteria | 4674 |
| 232 | Ga0105243_10221733 | 3300009148 | Bacteria | 1672 |
| 233 | Ga0105241_10024393 | 3300009174 | Bacteria | 4490 |
| 234 | Ga0105241_10075452 | 3300009174 | Bacteria | 2627 |
| 235 | Ga0105241_10116553 | 3300009174 | Bacteria | 2145 |
| 236 | Ga0105241_10639123 | 3300009174 | Bacteria | 965 |
| 237 | Ga0105242_10102353 | 3300009176 | Bacteria | 2429 |
| 238 | Ga0105242_10390973 | 3300009176 | Bacteria | 1295 |
| 239 | Ga0105248_10039516 | 3300009177 | Bacteria | 5285 |
| 240 | Ga0105248_10629824 | 3300009177 | Bacteria | 1210 |
| 241 | Ga0105237_10047128 | 3300009545 | Bacteria | 4334 |
| 242 | Ga0105237_10092024 | 3300009545 | Bacteria | 3022 |
| 243 | Ga0105237_10640661 | 3300009545 | Bacteria | 1070 |
| 244 | Ga0105238_10080512 | 3300009551 | Bacteria | 3246 |
| 245 | Ga0105238_10277946 | 3300009551 | Bacteria | 1655 |
| 246 | Ga0105238_10855019 | 3300009551 | Bacteria | 927 |
| 247 | Ga0099796_10006006 | 3300010159 | Bacteria | 3078 |
| 248 | Ga0099796_10043499 | 3300010159 | Bacteria | 1530 |
| 249 | Ga0099796_10048748 | 3300010159 | Bacteria | 1462 |
| 250 | Ga0105239_10007779 | 3300010375 | Bacteria | 12264 |
| 251 | Ga0105239_10307471 | 3300010375 | Bacteria | 1786 |
| 252 | Ga0105246_10076930 | 3300011119 | Bacteria | 2366 |
| 253 | Ga0105246_10103701 | 3300011119 | Bacteria | 2076 |
| 254 | Ga0105246_10241714 | 3300011119 | Bacteria | 1428 |
| 255 | Ga0105246_10557154 | 3300011119 | Bacteria | 983 |
| 256 | Ga0157373_10015435 | 3300013100 | Bacteria | 5584 |
| 257 | Ga0157373_10242012 | 3300013100 | Bacteria | 1275 |
| 258 | Ga0157374_10144995 | 3300013296 | Bacteria | 2306 |
| 259 | Ga0157378_10142728 | 3300013297 | Bacteria | 2225 |
| 260 | Ga0157378_10430782 | 3300013297 | Bacteria | 1305 |
| 261 | Ga0157378_11203288 | 3300013297 | Bacteria | 797 |
| 262 | Ga0163162_10090461 | 3300013306 | Bacteria | 3142 |
| 263 | Ga0163162_10736081 | 3300013306 | Bacteria | 1106 |
| 264 | Ga0157372_10016504 | 3300013307 | Bacteria | 7925 |
| 265 | Ga0157372_11029520 | 3300013307 | Bacteria | 953 |
| 266 | Ga0157375_10369079 | 3300013308 | Bacteria | 1601 |
| 267 | Ga0163163_10039625 | 3300014325 | Bacteria | 4599 |
| 268 | Ga0163163_10623628 | 3300014325 | Bacteria | 1142 |
| 269 | Ga0157380_10084701 | 3300014326 | Bacteria | 2600 |
| 270 | Ga0157380_10137661 | 3300014326 | Bacteria | 2092 |
| 271 | Ga0157377_10005862 | 3300014745 | Bacteria | 5811 |
| 272 | Ga0157379_10056034 | 3300014968 | Bacteria | 3523 |
| 273 | Ga0157379_10144281 | 3300014968 | Bacteria | 2147 |
| 274 | Ga0157376_10111300 | 3300014969 | Bacteria | 2411 |
| 275 | Ga0157376_10571090 | 3300014969 | Bacteria | 1122 |
| 276 | Ga0163161_10009501 | 3300017792 | Bacteria | 6729 |
| 277 | Ga0224572_1001576 | 3300024225 | Bacteria | 3423 |
| 278 | Ga0209148_1000274 | 3300025254 | Bacteria | 81201 |
| 279 | Ga0209148_1001585 | 3300025254 | Bacteria | 10738 |
| 280 | Ga0209758_1000059 | 3300025297 | Bacteria | 328458 |
| 281 | Ga0209758_1001730 | 3300025297 | Bacteria | 24307 |
| 282 | Ga0209758_1001908 | 3300025297 | Bacteria | 22695 |
| 283 | Ga0209758_1036239 | 3300025297 | Bacteria | 1929 |
| 284 | Ga0209758_1046740 | 3300025297 | Bacteria | 1556 |
| 285 | Ga0209050_1002314 | 3300025298 | Bacteria | 16763 |
| 286 | Ga0209256_1068092 | 3300025299 | Bacteria | 809 |
| 287 | Ga0207426_1000143 | 3300025302 | Bacteria | 192948 |
| 288 | Ga0209257_1000114 | 3300025304 | Bacteria | 233013 |
| 289 | Ga0209257_1019160 | 3300025304 | Bacteria | 2592 |
| 290 | Ga0209257_1030530 | 3300025304 | Bacteria | 1739 |
| 291 | Ga0207692_10009902 | 3300025898 | Bacteria | 3996 |
| 292 | Ga0207692_10029373 | 3300025898 | Bacteria | 2612 |
| 293 | Ga0207642_10000663 | 3300025899 | Bacteria | 10572 |
| 294 | Ga0207642_10138146 | 3300025899 | Bacteria | 1281 |
| 295 | Ga0207710_10023256 | 3300025900 | Bacteria | 2663 |
| 296 | Ga0207688_10000130 | 3300025901 | Bacteria | 31681 |
| 297 | Ga0207688_10068808 | 3300025901 | Bacteria | 2006 |
| 298 | Ga0207688_10273334 | 3300025901 | Bacteria | 1028 |
| 299 | Ga0207647_10002385 | 3300025904 | Bacteria | 14262 |
| 300 | Ga0207685_10061678 | 3300025905 | Bacteria | 1487 |
| 301 | Ga0207699_10001003 | 3300025906 | Bacteria | 13374 |
| 302 | Ga0207645_10049854 | 3300025907 | Bacteria | 2674 |
| 303 | Ga0207643_10001981 | 3300025908 | Bacteria | 11312 |
| 304 | Ga0207705_10315453 | 3300025909 | Bacteria | 1201 |
| 305 | Ga0207654_10063597 | 3300025911 | Bacteria | 2166 |
| 306 | Ga0207707_10045123 | 3300025912 | Bacteria | 3841 |
| 307 | Ga0207707_10121547 | 3300025912 | Bacteria | 2283 |
| 308 | Ga0207695_10050992 | 3300025913 | Bacteria | 4348 |
| 309 | Ga0207671_10087282 | 3300025914 | Unclassified | 2346 |
| 310 | Ga0207693_10004368 | 3300025915 | Bacteria | 11957 |
| 311 | Ga0207693_10045948 | 3300025915 | Bacteria | 3431 |
| 312 | Ga0207693_10062706 | 3300025915 | Bacteria | 2913 |
| 313 | Ga0207693_10080870 | 3300025915 | Bacteria | 2543 |
| 314 | Ga0207693_10253175 | 3300025915 | Bacteria | 1382 |
| 315 | Ga0207663_10012503 | 3300025916 | Bacteria | 4591 |
| 316 | Ga0207663_10046371 | 3300025916 | Bacteria | 2677 |
| 317 | Ga0207660_10174649 | 3300025917 | Bacteria | 1665 |
| 318 | Ga0207660_10294967 | 3300025917 | Bacteria | 1290 |
| 319 | Ga0207662_10147737 | 3300025918 | Bacteria | 1493 |
| 320 | Ga0207657_10032651 | 3300025919 | Bacteria | 4701 |
| 321 | Ga0207652_10043743 | 3300025921 | Bacteria | 3813 |
| 322 | Ga0207652_10102515 | 3300025921 | Bacteria | 2529 |
| 323 | Ga0207652_10413202 | 3300025921 | Bacteria | 1217 |
| 324 | Ga0207681_10054305 | 3300025923 | Bacteria | 2723 |
| 325 | Ga0207681_10364887 | 3300025923 | Bacteria | 1159 |
| 326 | Ga0207694_10127645 | 3300025924 | Bacteria | 2036 |
| 327 | Ga0207694_10175041 | 3300025924 | Bacteria | 1739 |
| 328 | Ga0207650_10004418 | 3300025925 | Bacteria | 9604 |
| 329 | Ga0207650_10014049 | 3300025925 | Bacteria | 5559 |
| 330 | Ga0207650_10025768 | 3300025925 | Bacteria | 4190 |
| 331 | Ga0207659_10012143 | 3300025926 | Bacteria | 5464 |
| 332 | Ga0207659_10066708 | 3300025926 | Bacteria | 2612 |
| 333 | Ga0207659_10099922 | 3300025926 | Bacteria | 2185 |
| 334 | Ga0207687_10005289 | 3300025927 | Bacteria | 8555 |
| 335 | Ga0207687_10061597 | 3300025927 | Bacteria | 2650 |
| 336 | Ga0207700_10058615 | 3300025928 | Bacteria | 2909 |
| 337 | Ga0207700_10084407 | 3300025928 | Bacteria | 2489 |
| 338 | Ga0207700_10452787 | 3300025928 | Bacteria | 1131 |
| 339 | Ga0207700_10977642 | 3300025928 | Bacteria | 758 |
| 340 | Ga0207664_10030708 | 3300025929 | Bacteria | 4105 |
| 341 | Ga0207664_10156957 | 3300025929 | Bacteria | 1938 |
| 342 | Ga0207664_10182416 | 3300025929 | Bacteria | 1803 |
| 343 | Ga0207644_10006827 | 3300025931 | Bacteria | 7440 |
| 344 | Ga0207644_10025164 | 3300025931 | Bacteria | 4091 |
| 345 | Ga0207644_10102456 | 3300025931 | Bacteria | 2153 |
| 346 | Ga0207706_10002801 | 3300025933 | Bacteria | 16940 |
| 347 | Ga0207686_10054100 | 3300025934 | Bacteria | 2513 |
| 348 | Ga0207709_10015455 | 3300025935 | Bacteria | 4233 |
| 349 | Ga0207709_10177333 | 3300025935 | Bacteria | 1501 |
| 350 | Ga0207670_10021754 | 3300025936 | Bacteria | 3962 |
| 351 | Ga0207670_10052934 | 3300025936 | Bacteria | 2732 |
| 352 | Ga0207670_10076670 | 3300025936 | Bacteria | 2327 |
| 353 | Ga0207670_10305155 | 3300025936 | Bacteria | 1248 |
| 354 | Ga0207669_10007567 | 3300025937 | Bacteria | 5035 |
| 355 | Ga0207704_10196064 | 3300025938 | Bacteria | 1473 |
| 356 | Ga0207665_10029125 | 3300025939 | Bacteria | 3651 |
| 357 | Ga0207665_10281471 | 3300025939 | Bacteria | 1238 |
| 358 | Ga0207691_10011407 | 3300025940 | Bacteria | 8528 |
| 359 | Ga0207691_10540575 | 3300025940 | Bacteria | 988 |
| 360 | Ga0207711_10016266 | 3300025941 | Bacteria | 6178 |
| 361 | Ga0207711_10090712 | 3300025941 | Bacteria | 2687 |
| 362 | Ga0207689_10000756 | 3300025942 | Bacteria | 31021 |
| 363 | Ga0207679_10024806 | 3300025945 | Bacteria | 4115 |
| 364 | Ga0207667_10354994 | 3300025949 | Bacteria | 1495 |
| 365 | Ga0207667_10358477 | 3300025949 | Bacteria | 1487 |
| 366 | Ga0207651_10003263 | 3300025960 | Bacteria | 7943 |
| 367 | Ga0207651_10007290 | 3300025960 | Bacteria | 5879 |
| 368 | Ga0207651_10072681 | 3300025960 | Bacteria | 2443 |
| 369 | Ga0207651_10799889 | 3300025960 | Bacteria | 836 |
| 370 | Ga0207712_10017551 | 3300025961 | Bacteria | 4650 |
| 371 | Ga0207668_10028885 | 3300025972 | Bacteria | 3630 |
| 372 | Ga0207668_10485434 | 3300025972 | Bacteria | 1060 |
| 373 | Ga0207668_10767144 | 3300025972 | Bacteria | 852 |
| 374 | Ga0207640_10015569 | 3300025981 | Bacteria | 4406 |
| 375 | Ga0207677_10006114 | 3300026023 | Bacteria | 6574 |
| 376 | Ga0207703_10011569 | 3300026035 | Bacteria | 6861 |
| 377 | Ga0207703_10783315 | 3300026035 | Bacteria | 910 |
| 378 | Ga0207639_10012134 | 3300026041 | Bacteria | 5994 |
| 379 | Ga0207639_10143515 | 3300026041 | Bacteria | 1992 |
| 380 | Ga0207678_10038702 | 3300026067 | Bacteria | 4142 |
| 381 | Ga0207678_10042400 | 3300026067 | Bacteria | 3942 |
| 382 | Ga0207678_10121665 | 3300026067 | Bacteria | 2227 |
| 383 | Ga0207708_10004345 | 3300026075 | Bacteria | 10438 |
| 384 | Ga0207702_10543101 | 3300026078 | Bacteria | 1136 |
| 385 | Ga0207641_10058535 | 3300026088 | Bacteria | 3279 |
| 386 | Ga0207641_10162421 | 3300026088 | Bacteria | 2032 |
| 387 | Ga0207641_10991663 | 3300026088 | Bacteria | 836 |
| 388 | Ga0207648_10009209 | 3300026089 | Bacteria | 9483 |
| 389 | Ga0207648_10060490 | 3300026089 | Bacteria | 3303 |
| 390 | Ga0207676_10007771 | 3300026095 | Bacteria | 7625 |
| 391 | Ga0207676_10132024 | 3300026095 | Bacteria | 2125 |
| 392 | Ga0207676_10308045 | 3300026095 | Bacteria | 1449 |
| 393 | Ga0207674_10184805 | 3300026116 | Bacteria | 2035 |
| 394 | Ga0207675_100004438 | 3300026118 | Bacteria | 13564 |
| 395 | Ga0207683_10015749 | 3300026121 | Bacteria | 6434 |
| 396 | Ga0207683_10049872 | 3300026121 | Bacteria | 3665 |
| 397 | Ga0207683_10090523 | 3300026121 | Bacteria | 2725 |
| 398 | Ga0207683_10572721 | 3300026121 | Unclassified | 1044 |
| 399 | Ga0207698_10115378 | 3300026142 | Bacteria | 2261 |
| 400 | Ga0209813_10005872 | 3300027866 | Bacteria | 3006 |
| 401 | Ga0209813_10039324 | 3300027866 | Bacteria | 1433 |
| 402 | Ga0209813_10074582 | 3300027866 | Bacteria | 1110 |
| 403 | Ga0207428_10017604 | 3300027907 | Bacteria | 6127 |
| 404 | Ga0207428_10066313 | 3300027907 | Bacteria | 2845 |
| 405 | Ga0207428_10123330 | 3300027907 | Bacteria | 1985 |
| 406 | Ga0268266_10209882 | 3300028379 | Bacteria | 1785 |
| 407 | Ga0268266_10319538 | 3300028379 | Bacteria | 1453 |
| 408 | Ga0268265_10015994 | 3300028380 | Bacteria | 5148 |
| 409 | Ga0268264_10244109 | 3300028381 | Bacteria | 1665 |
| 410 | Ga0268264_10733889 | 3300028381 | Bacteria | 983 |
| 411 | Ga0307515_10091636 | 3300028794 | Bacteria | 3795 |
| 412 | Ga0265324_10060633 | 3300029957 | Bacteria | 1293 |
| 413 | Ga0307512_10186941 | 3300030522 | Bacteria | 1151 |
| 414 | Ga0265762_1004526 | 3300030760 | Bacteria | 2488 |
| 415 | Ga0265763_1001918 | 3300030763 | Bacteria | 1545 |
| 416 | Ga0265328_10012454 | 3300031239 | Bacteria | 3384 |
| 417 | Ga0265325_10014052 | 3300031241 | Bacteria | 4539 |
| 418 | Ga0265340_10034405 | 3300031247 | Bacteria | 2520 |
| 419 | Ga0265331_10000333 | 3300031250 | Bacteria | 50586 |
| 420 | Ga0265327_10000775 | 3300031251 | Bacteria | 49295 |
| 421 | Ga0265327_10091170 | 3300031251 | Bacteria | 1486 |
| 422 | Ga0265316_10374520 | 3300031344 | Bacteria | 1028 |
| 423 | Ga0307513_10451469 | 3300031456 | Bacteria | 1010 |
| 424 | Ga0307408_100242164 | 3300031548 | Bacteria | 1483 |
| 425 | Ga0265313_10073434 | 3300031595 | Bacteria | 1570 |
| 426 | Ga0307508_10047520 | 3300031616 | Bacteria | 3827 |
| 427 | Ga0316215_1000920 | 3300033544 | Bacteria | 2876 |
| 428 | Ga0373926_0006659 | 3300035083 | Bacteria | 3836 |
| 429 | Ga0373926_0162366 | 3300035083 | Bacteria | 853 |
| 430 | Ga0373929_0010236 | 3300035085 | Bacteria | 1751 |
| 431 | Ga0373940_0007997 | 3300035088 | Bacteria | 2410 |
| 432 | Ga0373944_0001173 | 3300035089 | Bacteria | 6541 |
| 433 | Ga0373923_0002035 | 3300035111 | Bacteria | 6094 |
| 434 | Ga0373936_0001796 | 3300035113 | Bacteria | 7889 |
| 435 | Ga0373936_0047960 | 3300035113 | Bacteria | 1724 |
| 436 | Ga0373936_0165075 | 3300035113 | Bacteria | 966 |
| 437 | Ga0373939_0001290 | 3300035114 | Bacteria | 6094 |
| 438 | Ga0373945_0005121 | 3300035116 | Bacteria | 4184 |
| 439 | Ga0373945_0007492 | 3300035116 | Bacteria | 3538 |
| 440 | Ga0373945_0007797 | 3300035116 | Bacteria | 3473 |
| 441 | Ga0373945_0017489 | 3300035116 | Bacteria | 2428 |
| 442 | Ga0373953_0032305 | 3300035117 | Bacteria | 2041 |
| 443 | Ga0373956_0012955 | 3300035119 | Bacteria | 3464 |
| 444 | Ga0373956_0037590 | 3300035119 | Bacteria | 2140 |
| 445 | Ga0373943_0000381 | 3300035170 | Bacteria | 18615 |
| 446 | Ga0373943_0002159 | 3300035170 | Bacteria | 8946 |
| 447 | Ga0373943_0015098 | 3300035170 | Bacteria | 3506 |
| 448 | Ga0373943_0031493 | 3300035170 | Bacteria | 2516 |
| 449 | Ga0373943_0077253 | 3300035170 | Bacteria | 1700 |
| 450 | Ga0373943_0224374 | 3300035170 | Bacteria | 1047 |
| 451 | Ga0373946_0002070 | 3300035171 | Bacteria | 7041 |
| 452 | Ga0373946_0036439 | 3300035171 | Bacteria | 1995 |
| 453 | Ga0373946_0052451 | 3300035171 | Unclassified | 1711 |
| 454 | Ga0373955_0002179 | 3300035172 | Bacteria | 8483 |
| 455 | Ga0373955_0007537 | 3300035172 | Bacteria | 5007 |
| 456 | Ga0373962_0041982 | 3300035242 | Bacteria | 1292 |
| 457 | Ga0373924_0015268 | 3300035410 | Bacteria | 2917 |
| 458 | Ga0373924_0031708 | 3300035410 | Bacteria | 2127 |
| 459 | Ga0373924_0102603 | 3300035410 | Bacteria | 1231 |
| 460 | Ga0373931_0086002 | 3300035691 | Bacteria | 1744 |
| 461 | Ga0373935_0000006 | 3300035692 | Bacteria | 121726 |
| 462 | Ga0373935_0034107 | 3300035692 | Bacteria | 3171 |
| 463 | Ga0373935_0049660 | 3300035692 | Bacteria | 2660 |
| 464 | Ga0373935_0053179 | 3300035692 | Bacteria | 2576 |
| 465 | Ga0373935_0105630 | 3300035692 | Bacteria | 1862 |
| 466 | Ga0373935_0170453 | 3300035692 | Bacteria | 1489 |
| 467 | Ga0373927_0003706 | 3300035695 | Bacteria | 10864 |
| 468 | Ga0373927_0013209 | 3300035695 | Bacteria | 5492 |
| 469 | Ga0373927_0015339 | 3300035695 | Bacteria | 5061 |
| 470 | Ga0373927_0015712 | 3300035695 | Bacteria | 4998 |
| 471 | Ga0373927_0018500 | 3300035695 | Bacteria | 4578 |
| 472 | Ga0373927_0029730 | 3300035695 | Bacteria | 3563 |
| 473 | Ga0373927_0171463 | 3300035695 | Bacteria | 1422 |
| 474 | Ga0373927_0238671 | 3300035695 | Bacteria | 1194 |
| 475 | Ga0373927_0547269 | 3300035695 | Bacteria | 765 |
| 476 | Ga0373933_0000007 | 3300035724 | Bacteria | 123599 |
| 477 | Ga0373933_0004171 | 3300035724 | Bacteria | 7960 |
| 478 | Ga0373933_0056949 | 3300035724 | Bacteria | 2348 |
| 479 | Ga0373947_0000419 | 3300035725 | Bacteria | 24144 |
| 480 | Ga0373947_0001498 | 3300035725 | Bacteria | 14333 |
| 481 | Ga0373947_0003146 | 3300035725 | Bacteria | 9827 |
| 482 | Ga0373947_0006728 | 3300035725 | Bacteria | 6668 |
| 483 | Ga0373947_0016255 | 3300035725 | Bacteria | 4277 |
| 484 | Ga0373947_0019872 | 3300035725 | Bacteria | 3877 |
| 485 | Ga0373947_0033265 | 3300035725 | Bacteria | 3042 |
| 486 | Ga0373947_0105033 | 3300035725 | Bacteria | 1779 |
| 487 | Ga0373947_0139717 | 3300035725 | Bacteria | 1553 |
| 488 | Ga0373937_0000124 | 3300036401 | Bacteria | 73933 |
| 489 | Ga0373937_0018439 | 3300036401 | Bacteria | 6233 |
| 490 | Ga0373937_0025281 | 3300036401 | Bacteria | 5361 |
| 491 | Ga0373937_0047656 | 3300036401 | Bacteria | 3922 |
| 492 | Ga0372808_000937 | 3300036459 | Bacteria | 2747 |
| 493 | Ga0373925_0000210 | 3300037068 | Bacteria | 63621 |
| 494 | Ga0373925_0004278 | 3300037068 | Bacteria | 10818 |
| 495 | Ga0373925_0006000 | 3300037068 | Bacteria | 8997 |
| 496 | Ga0373925_0006086 | 3300037068 | Bacteria | 8923 |
| 497 | Ga0373925_0026431 | 3300037068 | Bacteria | 4247 |
| 498 | Ga0373925_0032271 | 3300037068 | Bacteria | 3854 |
| 499 | Ga0373925_0083949 | 3300037068 | Bacteria | 2426 |
| 500 | Ga0373925_0284217 | 3300037068 | Bacteria | 1333 |
| 501 | Ga0373925_0594639 | 3300037068 | Bacteria | 911 |
| 502 | Ga0395900_0534211 | 3300037418 | Bacteria | 1119 |
| 503 | Ga0395898_0179458 | 3300037466 | Bacteria | 2024 |
| 504 | Ga0395901_0266328 | 3300038443 | Bacteria | 1783 |
| 505 | Ga0436365_0368397 | 3300039437 | Bacteria | 2822 |
| 506 | Ga0436365_1370429 | 3300039437 | Bacteria | 3332 |
| 507 | Ga0436360_0320708 | 3300039438 | Bacteria | 3652 |
| 508 | Ga0436361_0622258 | 3300039447 | Bacteria | 7351 |
| 509 | Ga0451800_0784539 | 3300041459 | Bacteria | 1043 |
| 510 | Ga0451807_2166610 | 3300041486 | Bacteria | 950 |
| 511 | Ga0451849_0087101 | 3300041505 | Bacteria | 725 |
| 512 | Ga0439448_0084842 | 3300042005 | Bacteria | 1066 |
| 513 | Ga0439456_078854 | 3300042013 | Unclassified | 734 |
| 514 | Ga0453683_0473469 | 3300044673 | Unclassified | 811 |
| 515 | Ga0466965_0102315 | 3300044683 | Bacteria | 1466 |
| 516 | Ga0466963_0017811 | 3300044694 | Bacteria | 4432 |
| 517 | Ga0466964_0163810 | 3300044706 | Bacteria | 1041 |
| 518 | Ga0453684_0000006 | 3300044712 | Bacteria | 1364191 |
| 519 | Ga0453684_0000031 | 3300044712 | Bacteria | 752632 |
| 520 | Ga0453684_0008102 | 3300044712 | Bacteria | 18989 |
| 521 | Ga0453684_0112756 | 3300044712 | Unclassified | 3300 |
| 522 | Ga0453684_0313101 | 3300044712 | Bacteria | 1780 |
| 523 | Ga0453684_1220544 | 3300044712 | Bacteria | 788 |
| 524 | Ga0466970_0243946 | 3300044765 | Bacteria | 1006 |
| 525 | Ga0466967_0024864 | 3300045976 | Bacteria | 4931 |
| 526 | Ga0466967_0069388 | 3300045976 | Bacteria | 3150 |
| 527 | Ga0495617_078930 | 3300046452 | Bacteria | 1079 |
| 528 | Ga0495592_0000020 | 3300046454 | Bacteria | 140576 |
| 529 | Ga0495592_0026318 | 3300046454 | Bacteria | 4411 |
| 530 | Ga0495592_0034109 | 3300046454 | Bacteria | 3837 |
| 531 | Ga0495592_0095454 | 3300046454 | Unclassified | 2127 |
| 532 | Ga0495603_0001017 | 3300046455 | Bacteria | 16170 |
| 533 | Ga0495629_0001626 | 3300046459 | Bacteria | 17663 |
| 534 | Ga0495629_0006124 | 3300046459 | Bacteria | 8936 |
| 535 | Ga0495629_0008249 | 3300046459 | Bacteria | 7659 |
| 536 | Ga0495629_0044612 | 3300046459 | Bacteria | 3111 |
| 537 | Ga0495629_0258401 | 3300046459 | Bacteria | 1197 |
| 538 | Ga0495629_0444729 | 3300046459 | Bacteria | 878 |
| 539 | Ga0495638_0011195 | 3300046460 | Bacteria | 6192 |
| 540 | Ga0495641_0114372 | 3300046461 | Bacteria | 1203 |
| 541 | Ga0495651_0000282 | 3300046462 | Bacteria | 39576 |
| 542 | Ga0495651_0001410 | 3300046462 | Bacteria | 18660 |
| 543 | Ga0495653_0000046 | 3300046463 | Bacteria | 113893 |
| 544 | Ga0495653_0001155 | 3300046463 | Bacteria | 20322 |
| 545 | Ga0495653_0092433 | 3300046463 | Bacteria | 2209 |
| 546 | Ga0495580_0000806 | 3300046472 | Bacteria | 27108 |
| 547 | Ga0495580_0147371 | 3300046472 | Bacteria | 1631 |
| 548 | Ga0495582_0001348 | 3300046473 | Bacteria | 13795 |
| 549 | Ga0495582_0059585 | 3300046473 | Bacteria | 2106 |
| 550 | Ga0495582_0096554 | 3300046473 | Bacteria | 1652 |
| 551 | Ga0495639_0001292 | 3300046475 | Bacteria | 11259 |
| 552 | Ga0495639_0133006 | 3300046475 | Bacteria | 1192 |
| 553 | Ga0495639_0146341 | 3300046475 | Bacteria | 1138 |
| 554 | Ga0495639_0307503 | 3300046475 | Bacteria | 791 |
| 555 | Ga0495662_0001018 | 3300046476 | Bacteria | 13751 |
| 556 | Ga0495662_0130074 | 3300046476 | Bacteria | 1237 |
| 557 | Ga0495662_0139554 | 3300046476 | Bacteria | 1193 |
| 558 | Ga0495664_0000017 | 3300046477 | Bacteria | 172210 |
| 559 | Ga0495664_0000670 | 3300046477 | Bacteria | 17396 |
| 560 | Ga0495664_0064886 | 3300046477 | Bacteria | 2176 |
| 561 | Ga0495584_0008719 | 3300046491 | Bacteria | 5244 |
| 562 | Ga0495584_0032467 | 3300046491 | Bacteria | 2643 |
| 563 | Ga0495584_0187068 | 3300046491 | Bacteria | 1052 |
| 564 | Ga0495594_0000401 | 3300046499 | Bacteria | 21822 |
| 565 | Ga0495607_0103777 | 3300046501 | Bacteria | 1518 |
| 566 | Ga0495607_0104439 | 3300046501 | Bacteria | 1512 |
| 567 | Ga0495607_0233215 | 3300046501 | Bacteria | 894 |
| 568 | Ga0495606_0110584 | 3300046507 | Bacteria | 1658 |
| 569 | Ga0495608_0000250 | 3300046511 | Bacteria | 39000 |
| 570 | Ga0495608_0010843 | 3300046511 | Bacteria | 6352 |
| 571 | Ga0495608_0081432 | 3300046511 | Bacteria | 2103 |
| 572 | Ga0495610_0021653 | 3300046512 | Bacteria | 3529 |
| 573 | Ga0495616_0071391 | 3300046513 | Bacteria | 1679 |
| 574 | Ga0495616_0191170 | 3300046513 | Bacteria | 905 |
| 575 | Ga0495618_0000059 | 3300046514 | Bacteria | 79623 |
| 576 | Ga0495618_0002157 | 3300046514 | Bacteria | 12882 |
| 577 | Ga0495618_0002703 | 3300046514 | Bacteria | 11302 |
| 578 | Ga0495618_0237435 | 3300046514 | Unclassified | 1146 |
| 579 | Ga0495620_0064800 | 3300046515 | Bacteria | 1510 |
| 580 | Ga0495628_0000022 | 3300046516 | Bacteria | 140362 |
| 581 | Ga0495628_0015475 | 3300046516 | Bacteria | 6370 |
| 582 | Ga0495628_0056961 | 3300046516 | Bacteria | 3075 |
| 583 | Ga0495628_0245684 | 3300046516 | Bacteria | 1337 |
| 584 | Ga0495630_0000758 | 3300046517 | Bacteria | 22647 |
| 585 | Ga0495630_0011807 | 3300046517 | Bacteria | 6330 |
| 586 | Ga0495630_0104242 | 3300046517 | Bacteria | 2147 |
| 587 | Ga0495630_0310229 | 3300046517 | Bacteria | 1206 |
| 588 | Ga0495630_0347433 | 3300046517 | Bacteria | 1135 |
| 589 | Ga0495631_0020740 | 3300046518 | Bacteria | 3067 |
| 590 | Ga0495637_0135961 | 3300046520 | Bacteria | 936 |
| 591 | Ga0495643_0215295 | 3300046522 | Bacteria | 914 |
| 592 | Ga0495644_0095070 | 3300046523 | Bacteria | 1126 |
| 593 | Ga0495648_0082144 | 3300046524 | Bacteria | 1830 |
| 594 | Ga0495663_0063692 | 3300046525 | Bacteria | 1163 |
| 595 | Ga0495666_0114782 | 3300046526 | Bacteria | 1264 |
| 596 | Ga0495666_0204169 | 3300046526 | Bacteria | 908 |
| 597 | Ga0495652_0000008 | 3300046529 | Bacteria | 343637 |
| 598 | Ga0495652_0001912 | 3300046529 | Bacteria | 22147 |
| 599 | Ga0495652_0026195 | 3300046529 | Bacteria | 5154 |
| 600 | Ga0495652_0153943 | 3300046529 | Bacteria | 1792 |
| 601 | Ga0495652_0365284 | 3300046529 | Bacteria | 1030 |
| 602 | Ga0495665_0123950 | 3300046531 | Bacteria | 1353 |
| 603 | Ga0495665_0137291 | 3300046531 | Bacteria | 1279 |
| 604 | Ga0495665_0269460 | 3300046531 | Bacteria | 875 |
| 605 | Ga0495640_0000029 | 3300046533 | Bacteria | 79567 |
| 606 | Ga0495640_0008277 | 3300046533 | Bacteria | 8158 |
| 607 | Ga0495640_0012288 | 3300046533 | Bacteria | 6548 |
| 608 | Ga0495640_0033432 | 3300046533 | Bacteria | 3652 |
| 609 | Ga0495640_0092337 | 3300046533 | Bacteria | 1996 |
| 610 | Ga0495586_0010651 | 3300046535 | Bacteria | 4890 |
| 611 | Ga0495587_0000019 | 3300046536 | Bacteria | 161972 |
| 612 | Ga0495587_0006011 | 3300046536 | Bacteria | 7910 |
| 613 | Ga0495598_0010537 | 3300046537 | Bacteria | 2216 |
| 614 | Ga0495645_0000006 | 3300046543 | Bacteria | 382503 |
| 615 | Ga0495645_0008317 | 3300046543 | Bacteria | 7243 |
| 616 | Ga0495645_0175214 | 3300046543 | Bacteria | 1473 |
| 617 | Ga0495645_0204885 | 3300046543 | Bacteria | 1335 |
| 618 | Ga0495622_0046788 | 3300046557 | Bacteria | 2010 |
| 619 | Ga0495622_0118276 | 3300046557 | Bacteria | 1211 |
| 620 | Ga0495633_0061264 | 3300046558 | Bacteria | 1762 |
| 621 | Ga0495667_0000061 | 3300046559 | Bacteria | 94650 |
| 622 | Ga0495667_0000879 | 3300046559 | Bacteria | 19393 |
| 623 | Ga0495656_0001123 | 3300046615 | Bacteria | 8705 |
| 624 | Ga0495656_0034826 | 3300046615 | Bacteria | 2065 |
| 625 | Ga0495668_0053325 | 3300046616 | Bacteria | 2236 |
| 626 | Ga0495634_0001212 | 3300046642 | Bacteria | 23807 |
| 627 | Ga0495634_0001468 | 3300046642 | Bacteria | 20895 |
| 628 | Ga0495634_0007204 | 3300046642 | Bacteria | 8386 |
| 629 | Ga0495634_0007643 | 3300046642 | Bacteria | 8097 |
| 630 | Ga0495634_0189376 | 3300046642 | Bacteria | 1284 |
| 631 | Ga0495634_0297489 | 3300046642 | Bacteria | 976 |
| 632 | Ga0495611_0251504 | 3300046648 | Bacteria | 819 |
| 633 | Ga0495625_0034767 | 3300046660 | Bacteria | 3717 |
| 634 | Ga0495625_0325743 | 3300046660 | Bacteria | 977 |
| 635 | Ga0495625_0346003 | 3300046660 | Unclassified | 941 |
| 636 | Ga0495635_0000023 | 3300046663 | Bacteria | 153429 |
| 637 | Ga0495635_0009308 | 3300046663 | Bacteria | 6862 |
| 638 | Ga0495635_0050714 | 3300046663 | Bacteria | 2860 |
| 639 | Ga0495635_0135616 | 3300046663 | Bacteria | 1678 |
| 640 | Ga0495635_0169013 | 3300046663 | Bacteria | 1487 |
| 641 | Ga0495661_0016354 | 3300046665 | Bacteria | 4920 |
| 642 | Ga0495661_0018986 | 3300046665 | Bacteria | 4511 |
| 643 | Ga0495588_0005816 | 3300046674 | Bacteria | 5516 |
| 644 | Ga0495657_0000099 | 3300046675 | Bacteria | 76617 |
| 645 | Ga0495657_0031948 | 3300046675 | Bacteria | 3677 |
| 646 | Ga0495599_0000039 | 3300046678 | Bacteria | 98345 |
| 647 | Ga0495599_0068733 | 3300046678 | Bacteria | 2211 |
| 648 | Ga0495599_0183154 | 3300046678 | Bacteria | 1290 |
| 649 | Ga0495623_0000253 | 3300046679 | Bacteria | 34266 |
| 650 | Ga0495623_0002814 | 3300046679 | Bacteria | 11476 |
| 651 | Ga0495623_0163132 | 3300046679 | Bacteria | 1308 |
| 652 | Ga0495646_0000017 | 3300046680 | Bacteria | 123549 |
| 653 | Ga0495646_0010331 | 3300046680 | Bacteria | 5936 |
| 654 | Ga0495646_0115426 | 3300046680 | Bacteria | 1525 |
| 655 | Ga0495646_0156346 | 3300046680 | Bacteria | 1265 |
| 656 | Ga0495647_0006744 | 3300046681 | Bacteria | 3822 |
| 657 | Ga0495647_0068679 | 3300046681 | Bacteria | 1414 |
| 658 | Ga0495658_0003498 | 3300046683 | Bacteria | 7772 |
| 659 | Ga0495658_0036061 | 3300046683 | Bacteria | 2726 |
| 660 | Ga0495658_0046803 | 3300046683 | Bacteria | 2433 |
| 661 | Ga0495658_0069182 | 3300046683 | Bacteria | 2046 |
| 662 | Ga0495658_0082845 | 3300046683 | Bacteria | 1885 |
| 663 | Ga0495658_0165063 | 3300046683 | Unclassified | 1368 |
| 664 | Ga0495669_0090032 | 3300046684 | Bacteria | 1416 |
| 665 | Ga0495613_0000508 | 3300046689 | Bacteria | 32835 |
| 666 | Ga0495613_0026976 | 3300046689 | Bacteria | 4276 |
| 667 | Ga0495613_0049670 | 3300046689 | Bacteria | 3095 |
| 668 | Ga0495613_0597593 | 3300046689 | Bacteria | 735 |
| 669 | Ga0495624_0032723 | 3300046690 | Bacteria | 3370 |
| 670 | Ga0495624_0036798 | 3300046690 | Bacteria | 3153 |
| 671 | Ga0495624_0047972 | 3300046690 | Bacteria | 2712 |
| 672 | Ga0495624_0107846 | 3300046690 | Bacteria | 1713 |
| 673 | Ga0495624_0208057 | 3300046690 | Bacteria | 1187 |
| 674 | Ga0495670_0005031 | 3300046691 | Bacteria | 6504 |
| 675 | Ga0495671_0088284 | 3300046692 | Bacteria | 1518 |
| 676 | Ga0495649_0073715 | 3300046694 | Bacteria | 1829 |
| 677 | Ga0495649_0100214 | 3300046694 | Bacteria | 1540 |
| 678 | Ga0495589_0282080 | 3300046794 | Bacteria | 772 |
| 679 | Ga0495600_0000030 | 3300046809 | Bacteria | 89424 |
| 680 | Ga0495581_0015077 | 3300047315 | Bacteria | 4487 |
| 681 | Ga0495581_0071686 | 3300047315 | Bacteria | 2005 |
| 682 | Ga0495581_0078613 | 3300047315 | Bacteria | 1909 |
| 683 | Ga0495581_0163574 | 3300047315 | Bacteria | 1301 |
| 684 | Ga0495604_0000030 | 3300047317 | Bacteria | 138597 |
| 685 | Ga0495604_0000662 | 3300047317 | Bacteria | 29274 |
| 686 | Ga0495604_0515409 | 3300047317 | Bacteria | 774 |
| 687 | Ga0495674_0000009 | 3300047319 | Bacteria | 310479 |
| 688 | Ga0495674_0002163 | 3300047319 | Bacteria | 19301 |
| 689 | Ga0495674_0013531 | 3300047319 | Bacteria | 7669 |
| 690 | Ga0495674_0479164 | 3300047319 | Bacteria | 997 |
| 691 | Ga0495676_0104282 | 3300047321 | Bacteria | 2093 |
| 692 | Ga0495676_0116718 | 3300047321 | Bacteria | 1948 |
| 693 | Ga0495676_0120623 | 3300047321 | Bacteria | 1908 |
| 694 | Ga0495676_0192362 | 3300047321 | Bacteria | 1422 |
| 695 | Ga0495676_0200553 | 3300047321 | Bacteria | 1387 |
| 696 | Ga0495676_0241159 | 3300047321 | Unclassified | 1237 |
| 697 | Ga0495680_0000359 | 3300047322 | Bacteria | 51000 |
| 698 | Ga0495680_0001209 | 3300047322 | Bacteria | 28308 |
| 699 | Ga0495680_0040382 | 3300047322 | Bacteria | 3719 |
| 700 | Ga0495680_0238091 | 3300047322 | Unclassified | 1294 |
| 701 | Ga0495680_0339882 | 3300047322 | Bacteria | 1047 |
| 702 | Ga0495675_0000056 | 3300047444 | Bacteria | 77625 |
| 703 | Ga0495675_0008977 | 3300047444 | Bacteria | 6217 |
| 704 | Ga0495684_0000056 | 3300047471 | Bacteria | 79718 |
| 705 | Ga0495684_0001278 | 3300047471 | Bacteria | 20227 |
| 706 | Ga0495684_0074981 | 3300047471 | Bacteria | 2570 |
| 707 | Ga0495686_0214595 | 3300047472 | Bacteria | 1098 |
| 708 | Ga0495686_0262390 | 3300047472 | Bacteria | 966 |
| 709 | Ga0495593_0003363 | 3300047673 | Bacteria | 9582 |
| 710 | Ga0495593_0003599 | 3300047673 | Bacteria | 9257 |
| 711 | Ga0495593_0127986 | 3300047673 | Bacteria | 1290 |
| 712 | Ga0495602_0000006 | 3300048088 | Bacteria | 322593 |
| 713 | Ga0495602_0000539 | 3300048088 | Bacteria | 35239 |
| 714 | Ga0495602_0244967 | 3300048088 | Bacteria | 1339 |
| 715 | Ga0495602_0549334 | 3300048088 | Bacteria | 801 |
| 716 | Ga0495614_0137271 | 3300048089 | Bacteria | 1085 |
| 717 | Ga0495614_0299412 | 3300048089 | Bacteria | 743 |
| 718 | Ga0496100_0000926 | 3300048903 | Bacteria | 14006 |
| 719 | Ga0496100_0007931 | 3300048903 | Bacteria | 5899 |
| 720 | Ga0496100_0010730 | 3300048903 | Bacteria | 5194 |
| 721 | Ga0496100_0116252 | 3300048903 | Bacteria | 1866 |
| 722 | Ga0496100_0209142 | 3300048903 | Bacteria | 1426 |
| 723 | Ga0496101_0004497 | 3300048904 | Bacteria | 8790 |
| 724 | Ga0496101_0020299 | 3300048904 | Bacteria | 4545 |
| 725 | Ga0496101_0032008 | 3300048904 | Bacteria | 3700 |
| 726 | Ga0496102_0002933 | 3300048905 | Bacteria | 14466 |
| 727 | Ga0496102_0005716 | 3300048905 | Bacteria | 10564 |
| 728 | Ga0496104_0008179 | 3300048907 | Bacteria | 9288 |
| 729 | Ga0496104_0010922 | 3300048907 | Bacteria | 8124 |
| 730 | Ga0496104_0039756 | 3300048907 | Bacteria | 4404 |
| 731 | Ga0496104_0077661 | 3300048907 | Bacteria | 3163 |
| 732 | Ga0496104_0222826 | 3300048907 | Bacteria | 1798 |
| 733 | Ga0496105_0005555 | 3300048908 | Bacteria | 9575 |
| 734 | Ga0496105_0020686 | 3300048908 | Bacteria | 5319 |
| 735 | Ga0496105_0029456 | 3300048908 | Bacteria | 4493 |
| 736 | Ga0496105_0031349 | 3300048908 | Bacteria | 4358 |
| 737 | Ga0496105_0267976 | 3300048908 | Bacteria | 1380 |
| 738 | Ga0496105_0322327 | 3300048908 | Bacteria | 1238 |
| 739 | Ga0496106_0004750 | 3300048909 | Bacteria | 10048 |
| 740 | Ga0496106_0015351 | 3300048909 | Bacteria | 5668 |
| 741 | Ga0496106_0016428 | 3300048909 | Bacteria | 5476 |
| 742 | Ga0496106_0117374 | 3300048909 | Bacteria | 2077 |
| 743 | Ga0496106_0174483 | 3300048909 | Bacteria | 1705 |
| 744 | Ga0496107_0007435 | 3300048910 | Bacteria | 7552 |
| 745 | Ga0496107_0010058 | 3300048910 | Bacteria | 6562 |
| 746 | Ga0496107_0091732 | 3300048910 | Bacteria | 2220 |
| 747 | Ga0496108_0001187 | 3300048911 | Bacteria | 20358 |
| 748 | Ga0496108_0022989 | 3300048911 | Bacteria | 5129 |
| 749 | Ga0496108_0037474 | 3300048911 | Bacteria | 4038 |
| 750 | Ga0496108_0057975 | 3300048911 | Bacteria | 3253 |
| 751 | Ga0496108_0481587 | 3300048911 | Bacteria | 1084 |
| 752 | Ga0496109_0003628 | 3300048912 | Bacteria | 12895 |
| 753 | Ga0496109_0005207 | 3300048912 | Bacteria | 10863 |
| 754 | Ga0496109_0005449 | 3300048912 | Bacteria | 10641 |
| 755 | Ga0496109_0014804 | 3300048912 | Bacteria | 6787 |
| 756 | Ga0496109_0233656 | 3300048912 | Bacteria | 1730 |
| 757 | Ga0496109_0644463 | 3300048912 | Bacteria | 996 |
| 758 | Ga0496110_0001389 | 3300048913 | Bacteria | 17461 |
| 759 | Ga0496110_0002156 | 3300048913 | Bacteria | 14686 |
| 760 | Ga0496110_0008745 | 3300048913 | Bacteria | 8155 |
| 761 | Ga0496110_0012668 | 3300048913 | Bacteria | 6939 |
| 762 | Ga0496110_0184014 | 3300048913 | Bacteria | 1897 |
| 763 | Ga0496110_0238597 | 3300048913 | Bacteria | 1654 |
| 764 | Ga0496111_0001694 | 3300048914 | Bacteria | 12851 |
| 765 | Ga0496111_0018942 | 3300048914 | Bacteria | 4772 |
| 766 | Ga0496111_0023129 | 3300048914 | Bacteria | 4360 |
| 767 | Ga0496111_0034140 | 3300048914 | Bacteria | 3631 |
| 768 | Ga0496112_0001346 | 3300048915 | Bacteria | 18695 |
| 769 | Ga0496112_0001940 | 3300048915 | Bacteria | 16337 |
| 770 | Ga0496112_0020476 | 3300048915 | Bacteria | 6272 |
| 771 | Ga0496112_0057488 | 3300048915 | Bacteria | 3829 |
| 772 | Ga0496112_0306561 | 3300048915 | Bacteria | 1533 |
| 773 | Ga0496113_0001229 | 3300048916 | Bacteria | 14079 |
| 774 | Ga0496113_0003069 | 3300048916 | Bacteria | 9911 |
| 775 | Ga0496113_0009756 | 3300048916 | Bacteria | 6311 |
| 776 | Ga0496113_0046514 | 3300048916 | Bacteria | 3221 |
| 777 | Ga0496113_0421480 | 3300048916 | Bacteria | 1072 |
| 778 | Ga0496113_0710337 | 3300048916 | Bacteria | 802 |
| 779 | Ga0496114_0017584 | 3300048917 | Bacteria | 5774 |
| 780 | Ga0496114_0067775 | 3300048917 | Bacteria | 2994 |
| 781 | Ga0496114_0093566 | 3300048917 | Bacteria | 2555 |
| 782 | Ga0496114_0393844 | 3300048917 | Bacteria | 1227 |
| 783 | Ga0496115_0003119 | 3300048918 | Bacteria | 11913 |
| 784 | Ga0496115_0010171 | 3300048918 | Bacteria | 7020 |
| 785 | Ga0496115_0030851 | 3300048918 | Bacteria | 4220 |
| 786 | Ga0496115_0037797 | 3300048918 | Bacteria | 3827 |
| 787 | Ga0496115_0061881 | 3300048918 | Bacteria | 3019 |
| 788 | Ga0496116_0001851 | 3300048919 | Bacteria | 22897 |
| 789 | Ga0496117_0121378 | 3300048920 | Bacteria | 1604 |
| 790 | Ga0496120_0300990 | 3300048923 | Bacteria | 734 |
| 791 | Ga0496121_0013940 | 3300048924 | Bacteria | 8589 |
| 792 | Ga0496122_0054736 | 3300048925 | Bacteria | 2993 |
| 793 | Ga0496123_0226992 | 3300048926 | Bacteria | 937 |
| 794 | Ga0496125_0029721 | 3300048928 | Bacteria | 4904 |
| 795 | Ga0496125_0090833 | 3300048928 | Bacteria | 2290 |
| 796 | Ga0496126_0424088 | 3300048929 | Bacteria | 1075 |
| 797 | Ga0501031_0045287 | 3300049568 | Bacteria | 2870 |
| 798 | Ga0501031_0048768 | 3300049568 | Bacteria | 2760 |
| 799 | Ga0501031_0092149 | 3300049568 | Bacteria | 1977 |
| 800 | Ga0501032_0013003 | 3300049569 | Bacteria | 5928 |
| 801 | Ga0501032_0022105 | 3300049569 | Bacteria | 4414 |
| 802 | Ga0501032_0048876 | 3300049569 | Bacteria | 2855 |
| 803 | Ga0501032_0055122 | 3300049569 | Bacteria | 2675 |
| 804 | Ga0501032_0093051 | 3300049569 | Bacteria | 1999 |
| 805 | Ga0501033_0017990 | 3300049570 | Bacteria | 5336 |
| 806 | Ga0501033_0033329 | 3300049570 | Bacteria | 3867 |
| 807 | Ga0501033_0127122 | 3300049570 | Bacteria | 1848 |
| 808 | Ga0501034_0002201 | 3300049571 | Bacteria | 24114 |
| 809 | Ga0501034_0023489 | 3300049571 | Bacteria | 6283 |
| 810 | Ga0501034_0031875 | 3300049571 | Bacteria | 5355 |
| 811 | Ga0501034_0050893 | 3300049571 | Bacteria | 4177 |
| 812 | Ga0501034_0056596 | 3300049571 | Bacteria | 3945 |
| 813 | Ga0501034_0081474 | 3300049571 | Bacteria | 3239 |
| 814 | Ga0501034_0093059 | 3300049571 | Bacteria | 3011 |
| 815 | Ga0501034_0127324 | 3300049571 | Bacteria | 2531 |
| 816 | Ga0501034_0158572 | 3300049571 | Bacteria | 2235 |
| 817 | Ga0501034_0269075 | 3300049571 | Bacteria | 1645 |
| 818 | Ga0501034_0283883 | 3300049571 | Bacteria | 1595 |
| 819 | Ga0501034_0345771 | 3300049571 | Bacteria | 1416 |
| 820 | Ga0501034_0708855 | 3300049571 | Bacteria | 904 |
| 821 | Ga0501036_0007818 | 3300049572 | Bacteria | 8746 |
| 822 | Ga0501036_0016265 | 3300049572 | Bacteria | 6213 |
| 823 | Ga0501036_0058284 | 3300049572 | Bacteria | 3271 |
| 824 | Ga0501036_0062481 | 3300049572 | Bacteria | 3154 |
| 825 | Ga0501036_0069973 | 3300049572 | Bacteria | 2967 |
| 826 | Ga0501036_0124437 | 3300049572 | Bacteria | 2177 |
| 827 | Ga0501036_0136118 | 3300049572 | Bacteria | 2073 |
| 828 | Ga0501037_0005054 | 3300049573 | Bacteria | 9600 |
| 829 | Ga0501037_0009480 | 3300049573 | Bacteria | 7146 |
| 830 | Ga0501037_0126480 | 3300049573 | Bacteria | 1834 |
| 831 | Ga0501037_0417485 | 3300049573 | Bacteria | 919 |
| 832 | Ga0501038_0018363 | 3300049574 | Bacteria | 6313 |
| 833 | Ga0501038_0037433 | 3300049574 | Bacteria | 4253 |
| 834 | Ga0501038_0047640 | 3300049574 | Bacteria | 3712 |
| 835 | Ga0501038_0137111 | 3300049574 | Bacteria | 2004 |
| 836 | Ga0501038_0173305 | 3300049574 | Bacteria | 1745 |
| 837 | Ga0501038_0224760 | 3300049574 | Bacteria | 1496 |
| 838 | Ga0501038_0310331 | 3300049574 | Bacteria | 1236 |
| 839 | Ga0501038_0342794 | 3300049574 | Bacteria | 1165 |
| 840 | Ga0501039_0088736 | 3300049575 | Bacteria | 2408 |
| 841 | Ga0501039_0126551 | 3300049575 | Bacteria | 2004 |
| 842 | Ga0501039_0180494 | 3300049575 | Bacteria | 1660 |
| 843 | Ga0501039_0195945 | 3300049575 | Bacteria | 1588 |
| 844 | Ga0501039_0356505 | 3300049575 | Bacteria | 1149 |
| 845 | Ga0501040_0066629 | 3300049576 | Bacteria | 2481 |
| 846 | Ga0501040_0093026 | 3300049576 | Bacteria | 2097 |
| 847 | Ga0501040_0451038 | 3300049576 | Bacteria | 926 |
| 848 | Ga0501041_0054388 | 3300049577 | Bacteria | 2442 |
| 849 | Ga0501042_0039496 | 3300049578 | Bacteria | 3354 |
| 850 | Ga0501042_0199294 | 3300049578 | Bacteria | 1444 |
| 851 | Ga0501043_0001843 | 3300049579 | Bacteria | 18180 |
| 852 | Ga0501043_0028972 | 3300049579 | Bacteria | 4347 |
| 853 | Ga0501043_0049051 | 3300049579 | Bacteria | 3319 |
| 854 | Ga0501043_0052764 | 3300049579 | Bacteria | 3193 |
| 855 | Ga0501043_0145326 | 3300049579 | Bacteria | 1857 |
| 856 | Ga0501043_0149423 | 3300049579 | Bacteria | 1828 |
| 857 | Ga0501043_0230029 | 3300049579 | Bacteria | 1432 |
| 858 | Ga0501043_0346698 | 3300049579 | Bacteria | 1129 |
| 859 | Ga0501043_0539355 | 3300049579 | Bacteria | 868 |
| 860 | Ga0501043_0832478 | 3300049579 | Unclassified | 666 |
| 861 | Ga0501046_0029021 | 3300049580 | Bacteria | 4502 |
| 862 | Ga0501046_0042972 | 3300049580 | Bacteria | 3600 |
| 863 | Ga0501046_0046372 | 3300049580 | Bacteria | 3449 |
| 864 | Ga0501046_0213269 | 3300049580 | Bacteria | 1432 |
| 865 | Ga0501046_0267391 | 3300049580 | Bacteria | 1255 |
| 866 | Ga0501047_0000010 | 3300049581 | Bacteria | 429357 |
| 867 | Ga0501047_0001775 | 3300049581 | Bacteria | 20844 |
| 868 | Ga0501047_0014495 | 3300049581 | Bacteria | 7497 |
| 869 | Ga0501047_0095778 | 3300049581 | Bacteria | 2847 |
| 870 | Ga0501047_0127392 | 3300049581 | Bacteria | 2426 |
| 871 | Ga0501047_0289149 | 3300049581 | Bacteria | 1483 |
| 872 | Ga0501047_0327509 | 3300049581 | Bacteria | 1371 |
| 873 | Ga0501048_0004920 | 3300049582 | Bacteria | 10191 |
| 874 | Ga0501048_0016921 | 3300049582 | Bacteria | 5375 |
| 875 | Ga0501048_0111287 | 3300049582 | Bacteria | 1933 |
| 876 | Ga0501048_0578936 | 3300049582 | Unclassified | 806 |
| 877 | Ga0501067_0089828 | 3300049583 | Bacteria | 1705 |
| 878 | Ga0501067_0165649 | 3300049583 | Bacteria | 1231 |
| 879 | Ga0501067_0325256 | 3300049583 | Bacteria | 856 |
| 880 | Ga0501068_0005782 | 3300049584 | Bacteria | 6783 |
| 881 | Ga0501068_0103009 | 3300049584 | Bacteria | 1770 |
| 882 | Ga0501068_0111004 | 3300049584 | Bacteria | 1705 |
| 883 | Ga0501068_0154246 | 3300049584 | Bacteria | 1445 |
| 884 | Ga0501068_0191423 | 3300049584 | Bacteria | 1295 |
| 885 | Ga0501068_0325772 | 3300049584 | Bacteria | 985 |
| 886 | Ga0501068_0327630 | 3300049584 | Unclassified | 982 |
| 887 | Ga0501069_0035200 | 3300049585 | Bacteria | 2758 |
| 888 | Ga0501069_0051069 | 3300049585 | Bacteria | 2301 |
| 889 | Ga0501069_0102789 | 3300049585 | Bacteria | 1623 |
| 890 | Ga0501069_0108775 | 3300049585 | Bacteria | 1577 |
| 891 | Ga0501069_0124177 | 3300049585 | Bacteria | 1475 |
| 892 | Ga0501069_0246239 | 3300049585 | Unclassified | 1042 |
| 893 | Ga0501070_0044484 | 3300049586 | Bacteria | 3694 |
| 894 | Ga0501070_0056695 | 3300049586 | Bacteria | 3247 |
| 895 | Ga0501070_0102058 | 3300049586 | Bacteria | 2372 |
| 896 | Ga0501070_0123635 | 3300049586 | Bacteria | 2138 |
| 897 | Ga0501070_0132694 | 3300049586 | Bacteria | 2057 |
| 898 | Ga0501070_0154409 | 3300049586 | Bacteria | 1893 |
| 899 | Ga0501070_0191252 | 3300049586 | Bacteria | 1682 |
| 900 | Ga0501070_0202789 | 3300049586 | Bacteria | 1628 |
| 901 | Ga0501070_0242180 | 3300049586 | Bacteria | 1476 |
| 902 | Ga0501070_0245748 | 3300049586 | Bacteria | 1464 |
| 903 | Ga0501070_0256771 | 3300049586 | Bacteria | 1429 |
| 904 | Ga0501071_0083235 | 3300049587 | Bacteria | 2344 |
| 905 | Ga0501071_0155413 | 3300049587 | Bacteria | 1708 |
| 906 | Ga0501072_0033081 | 3300049588 | Bacteria | 4051 |
| 907 | Ga0501072_0062220 | 3300049588 | Bacteria | 2944 |
| 908 | Ga0501072_0086538 | 3300049588 | Bacteria | 2487 |
| 909 | Ga0501072_0258493 | 3300049588 | Bacteria | 1386 |
| 910 | Ga0501072_0327898 | 3300049588 | Bacteria | 1216 |
| 911 | Ga0501072_0461682 | 3300049588 | Bacteria | 1005 |
| 912 | Ga0501073_0004541 | 3300049589 | Bacteria | 10438 |
| 913 | Ga0501073_0016110 | 3300049589 | Bacteria | 5419 |
| 914 | Ga0501073_0033338 | 3300049589 | Bacteria | 3667 |
| 915 | Ga0501073_0072315 | 3300049589 | Bacteria | 2402 |
| 916 | Ga0501073_0124554 | 3300049589 | Bacteria | 1786 |
| 917 | Ga0501073_0183423 | 3300049589 | Bacteria | 1448 |
| 918 | Ga0501073_0334461 | 3300049589 | Unclassified | 1045 |
| 919 | Ga0501073_0377293 | 3300049589 | Bacteria | 979 |
| 920 | Ga0501073_0382846 | 3300049589 | Unclassified | 972 |
| 921 | Ga0501074_0009189 | 3300049590 | Bacteria | 7181 |
| 922 | Ga0501074_0010349 | 3300049590 | Bacteria | 6768 |
| 923 | Ga0501074_0046562 | 3300049590 | Bacteria | 3136 |
| 924 | Ga0501074_0180689 | 3300049590 | Unclassified | 1505 |
| 925 | Ga0501074_0192647 | 3300049590 | Bacteria | 1453 |
| 926 | Ga0501075_0010200 | 3300049591 | Bacteria | 6596 |
| 927 | Ga0501075_0040287 | 3300049591 | Bacteria | 3498 |
| 928 | Ga0501075_0600613 | 3300049591 | Bacteria | 839 |
| 929 | Ga0501076_0009793 | 3300049592 | Bacteria | 7079 |
| 930 | Ga0501076_0078679 | 3300049592 | Bacteria | 2646 |
| 931 | Ga0501076_0247431 | 3300049592 | Bacteria | 1459 |
| 932 | Ga0501076_0337393 | 3300049592 | Bacteria | 1237 |
| 933 | Ga0501076_0400388 | 3300049592 | Bacteria | 1129 |
| 934 | Ga0501077_0118183 | 3300049593 | Bacteria | 1680 |
| 935 | Ga0501079_0020198 | 3300049741 | Bacteria | 5091 |
| 936 | Ga0501079_0042950 | 3300049741 | Bacteria | 3490 |
| 937 | Ga0501079_0066627 | 3300049741 | Bacteria | 2779 |
| 938 | Ga0501079_0291895 | 3300049741 | Bacteria | 1275 |
| 939 | Ga0501079_0312730 | 3300049741 | Bacteria | 1229 |
| 940 | Ga0501080_0000314 | 3300049742 | Bacteria | 37074 |
| 941 | Ga0501080_0006102 | 3300049742 | Bacteria | 10802 |
| 942 | Ga0501080_0008717 | 3300049742 | Bacteria | 9209 |
| 943 | Ga0501080_0009753 | 3300049742 | Bacteria | 8771 |
| 944 | Ga0501080_0011995 | 3300049742 | Bacteria | 7937 |
| 945 | Ga0501080_0022269 | 3300049742 | Bacteria | 5871 |
| 946 | Ga0501080_0023180 | 3300049742 | Bacteria | 5756 |
| 947 | Ga0501080_0035262 | 3300049742 | Bacteria | 4670 |
| 948 | Ga0501080_0045183 | 3300049742 | Bacteria | 4100 |
| 949 | Ga0501080_0081340 | 3300049742 | Bacteria | 3010 |
| 950 | Ga0501080_0177989 | 3300049742 | Bacteria | 1958 |
| 951 | Ga0501080_0236493 | 3300049742 | Bacteria | 1669 |
| 952 | Ga0501080_0254933 | 3300049742 | Bacteria | 1599 |
| 953 | Ga0501080_0504689 | 3300049742 | Bacteria | 1081 |
| 954 | Ga0501080_0540662 | 3300049742 | Bacteria | 1038 |
| 955 | Ga0501081_0018902 | 3300049743 | Bacteria | 4580 |
| 956 | Ga0501081_0027216 | 3300049743 | Bacteria | 3858 |
| 957 | Ga0501081_0148981 | 3300049743 | Bacteria | 1680 |
| 958 | Ga0501081_0533896 | 3300049743 | Bacteria | 876 |
| 959 | Ga0501083_0005058 | 3300049744 | Bacteria | 9342 |
| 960 | Ga0501083_0030007 | 3300049744 | Bacteria | 3737 |
| 961 | Ga0501083_0144139 | 3300049744 | Bacteria | 1559 |
| 962 | Ga0501083_0181223 | 3300049744 | Bacteria | 1375 |
| 963 | Ga0501083_0418990 | 3300049744 | Bacteria | 871 |
| 964 | Ga0501035_0004729 | 3300049822 | Bacteria | 12925 |
| 965 | Ga0501035_0011561 | 3300049822 | Bacteria | 8181 |
| 966 | Ga0501035_0030708 | 3300049822 | Bacteria | 4898 |
| 967 | Ga0501035_0036440 | 3300049822 | Bacteria | 4458 |
| 968 | Ga0501035_0330562 | 3300049822 | Unclassified | 1279 |
| 969 | Ga0501035_0620731 | 3300049822 | Bacteria | 879 |
| 970 | Ga0501044_0000116 | 3300049823 | Bacteria | 96626 |
| 971 | Ga0501044_0002291 | 3300049823 | Bacteria | 21805 |
| 972 | Ga0501044_0003610 | 3300049823 | Bacteria | 17403 |
| 973 | Ga0501044_0078352 | 3300049823 | Bacteria | 3349 |
| 974 | Ga0501044_0093602 | 3300049823 | Bacteria | 3030 |
| 975 | Ga0501044_0125313 | 3300049823 | Bacteria | 2566 |
| 976 | Ga0501044_0262961 | 3300049823 | Bacteria | 1663 |
| 977 | Ga0501044_0404528 | 3300049823 | Bacteria | 1277 |
| 978 | Ga0501045_0038834 | 3300049824 | Bacteria | 3463 |
| 979 | Ga0501045_0361097 | 3300049824 | Bacteria | 1081 |
| 980 | Ga0501045_0520249 | 3300049824 | Bacteria | 883 |
| 981 | nmdc:mga03683_1213_c2 | 3300050489 | Bacteria | 5469 |
| 982 | nmdc:mga03683_44154_c1 | 3300050489 | Bacteria | 1841 |
| 983 | nmdc:mga03n38_331637_c1 | 3300050490 | Bacteria | 824 |
| 984 | nmdc:mga03n38_59258_c1 | 3300050490 | Bacteria | 1737 |
| 985 | nmdc:mga03n38_9563_c1 | 3300050490 | Bacteria | 3533 |
| 986 | nmdc:mga00v17_149620_c1 | 3300050491 | Bacteria | 1500 |
| 987 | nmdc:mga00v17_24709_c1 | 3300050491 | Bacteria | 2178 |
| 988 | nmdc:mga00v17_28997_c1 | 3300050491 | Bacteria | 3245 |
| 989 | nmdc:mga00v17_4955_c1 | 3300050491 | Bacteria | 6983 |
| 990 | nmdc:mga00v17_79322_c1 | 3300050491 | Bacteria | 2047 |
| 991 | nmdc:mga0yw44_11062_c1 | 3300050492 | Bacteria | 4638 |
| 992 | nmdc:mga0yw44_116513_c1 | 3300050492 | Bacteria | 1717 |
| 993 | nmdc:mga0yw44_4079_c1 | 3300050492 | Bacteria | 6620 |
| 994 | nmdc:mga0yw44_54507_c1 | 3300050492 | Bacteria | 2430 |
| 995 | nmdc:mga0yw44_580_c1 | 3300050492 | Bacteria | 13256 |
| 996 | nmdc:mga0yw44_63973_c1 | 3300050492 | Bacteria | 2263 |
| 997 | nmdc:mga0yw44_69664_c1 | 3300050492 | Bacteria | 2179 |
| 998 | nmdc:mga0yw44_98989_c1 | 3300050492 | Bacteria | 1855 |
| 999 | nmdc:mga0k408_142046_c1 | 3300050493 | Bacteria | 1428 |
| 1000 | nmdc:mga0k408_47462_c1 | 3300050493 | Bacteria | 2482 |
| 1001 | nmdc:mga06z11_15735_c2 | 3300050494 | Bacteria | 2987 |
| 1002 | nmdc:mga06z11_169845_c1 | 3300050494 | Bacteria | 1251 |
| 1003 | nmdc:mga06z11_33677_c1 | 3300050494 | Bacteria | 2508 |
| 1004 | nmdc:mga06z11_44729_c1 | 3300050494 | Bacteria | 2234 |
| 1005 | nmdc:mga04h51_121630_c1 | 3300050495 | Bacteria | 973 |
| 1006 | nmdc:mga04h51_148960_c1 | 3300050495 | Bacteria | 893 |
| 1007 | nmdc:mga04h51_19183_c1 | 3300050495 | Bacteria | 1474 |
| 1008 | nmdc:mga04h51_6680_c1 | 3300050495 | Bacteria | 3005 |
| 1009 | nmdc:mga07m45_12481_c1 | 3300050496 | Bacteria | 4491 |
| 1010 | nmdc:mga07m45_46338_c1 | 3300050496 | Bacteria | 2442 |
| 1011 | nmdc:mga05p37_11744_c1 | 3300050507 | Bacteria | 10440 |
| 1012 | nmdc:mga05p37_374_c1 | 3300050507 | Bacteria | 48074 |
| 1013 | nmdc:mga05p37_47092_c1 | 3300050507 | Bacteria | 5303 |
| 1014 | nmdc:mga05p37_512131_c1 | 3300050507 | Bacteria | 1374 |
| 1015 | nmdc:mga09592_20752_c1 | 3300050508 | Bacteria | 5407 |
| 1016 | nmdc:mga09592_2601_c1 | 3300050508 | Bacteria | 14611 |
| 1017 | nmdc:mga0qj67_134130_c1 | 3300050509 | Bacteria | 2006 |
| 1018 | nmdc:mga0qj67_50765_c1 | 3300050509 | Bacteria | 3280 |
| 1019 | nmdc:mga0qj67_551023_c1 | 3300050509 | Bacteria | 925 |
| 1020 | nmdc:mga0qj67_65941_c1 | 3300050509 | Bacteria | 2883 |
| 1021 | nmdc:mga06r32_250622_c2 | 3300050510 | Bacteria | 1011 |
| 1022 | nmdc:mga06r32_307479_c1 | 3300050510 | Bacteria | 1571 |
| 1023 | nmdc:mga06r32_349126_c1 | 3300050510 | Bacteria | 1464 |
| 1024 | nmdc:mga06r32_397_c1 | 3300050510 | Bacteria | 36835 |
| 1025 | nmdc:mga08y16_122069_c1 | 3300050511 | Bacteria | 2711 |
| 1026 | nmdc:mga08y16_124566_c1 | 3300050511 | Bacteria | 2681 |
| 1027 | nmdc:mga08y16_155771_c1 | 3300050511 | Bacteria | 2374 |
| 1028 | nmdc:mga08y16_184_c1 | 3300050511 | Bacteria | 55479 |
| 1029 | nmdc:mga08y16_270713_c1 | 3300050511 | Bacteria | 1753 |
| 1030 | nmdc:mga08y16_321525_c1 | 3300050511 | Bacteria | 1593 |
| 1031 | nmdc:mga08y16_90408_c1 | 3300050511 | Bacteria | 3191 |
| 1032 | nmdc:mga0n895_381227_c1 | 3300050512 | Bacteria | 1427 |
| 1033 | nmdc:mga0n895_445606_c1 | 3300050512 | Bacteria | 1307 |
| 1034 | nmdc:mga0n895_834709_c1 | 3300050512 | Bacteria | 910 |
| 1035 | nmdc:mga0n895_96376_c1 | 3300050512 | Bacteria | 2963 |
| 1036 | nmdc:mga0rr50_282808_c1 | 3300050513 | Bacteria | 1384 |
| 1037 | nmdc:mga0rr50_64490_c1 | 3300050513 | Bacteria | 2771 |
| 1038 | nmdc:mga0rr50_70704_c1 | 3300050513 | Bacteria | 2660 |
| 1039 | nmdc:mga08x19_103158_c1 | 3300050514 | Bacteria | 1894 |
| 1040 | nmdc:mga08x19_138367_c1 | 3300050514 | Bacteria | 1643 |
| 1041 | nmdc:mga08x19_14_c1 | 3300050514 | Bacteria | 365567 |
| 1042 | nmdc:mga0a205_203406_c1 | 3300050515 | Bacteria | 1870 |
| 1043 | nmdc:mga0sz30_19112_c1 | 3300050516 | Bacteria | 842 |
| 1044 | nmdc:mga0sz30_38510_c1 | 3300050516 | Bacteria | 1162 |
| 1045 | nmdc:mga0sz30_56787_c1 | 3300050516 | Bacteria | 1668 |
| 1046 | Ga0495601_0000007 | 3300053077 | Bacteria | 365972 |
| 1047 | Ga0495601_0005541 | 3300053077 | Bacteria | 7365 |
| 1048 | Ga0495601_0012397 | 3300053077 | Bacteria | 5114 |
| 1049 | Ga0495601_0301767 | 3300053077 | Bacteria | 1043 |
| 1050 | Ga0495612_0000053 | 3300053078 | Bacteria | 52880 |
| 1051 | Ga0495612_0001301 | 3300053078 | Bacteria | 10300 |
| 1052 | Ga0495612_0002727 | 3300053078 | Bacteria | 7308 |
| 1053 | Ga0495612_0271565 | 3300053078 | Bacteria | 757 |
| 1054 | Ga0495655_0034961 | 3300053083 | Bacteria | 1247 |
| 1055 | Ga0495595_0000031 | 3300053084 | Bacteria | 89199 |
| 1056 | Ga0495595_0005529 | 3300053084 | Bacteria | 5117 |
| 1057 | Ga0495595_0010781 | 3300053084 | Bacteria | 3808 |
| 1058 | Ga0495595_0030894 | 3300053084 | Bacteria | 2405 |
| 1059 | Ga0495595_0088479 | 3300053084 | Bacteria | 1483 |
| 1060 | Ga0495595_0274711 | 3300053084 | Bacteria | 845 |
| 1061 | Ga0495619_0000023 | 3300053085 | Bacteria | 182266 |
| 1062 | Ga0495619_0003219 | 3300053085 | Bacteria | 10571 |
| 1063 | Ga0495619_0013374 | 3300053085 | Bacteria | 5170 |
| 1064 | Ga0495619_0024881 | 3300053085 | Bacteria | 3841 |
| 1065 | Ga0495619_0058559 | 3300053085 | Bacteria | 2557 |
| 1066 | Ga0495619_0230447 | 3300053085 | Bacteria | 1283 |
| 1067 | Ga0495619_0643639 | 3300053085 | Bacteria | 723 |
| 1068 | Ga0500644_0072537 | 3300053088 | Bacteria | 1244 |
| 1069 | Ga0500646_0081659 | 3300053090 | Bacteria | 987 |
| 1070 | Ga0500583_0162939 | 3300053092 | Bacteria | 1111 |
| 1071 | Ga0500651_0039858 | 3300053093 | Bacteria | 2958 |
| 1072 | Ga0500651_0121043 | 3300053093 | Bacteria | 1589 |
| 1073 | Ga0500651_0139892 | 3300053093 | Unclassified | 1460 |
| 1074 | Ga0500651_0144194 | 3300053093 | Bacteria | 1433 |
| 1075 | Ga0500566_0000499 | 3300053094 | Bacteria | 21864 |
| 1076 | Ga0500641_0018535 | 3300053096 | Bacteria | 2619 |
| 1077 | Ga0500650_0002506 | 3300053098 | Bacteria | 6075 |
| 1078 | Ga0500555_003654 | 3300053103 | Bacteria | 4379 |
| 1079 | Ga0500556_0000004 | 3300053104 | Bacteria | 666287 |
| 1080 | Ga0500562_067349 | 3300053108 | Bacteria | 965 |
| 1081 | Ga0500569_033050 | 3300053109 | Bacteria | 1467 |
| 1082 | Ga0500593_069737 | 3300053117 | Bacteria | 1527 |
| 1083 | Ga0500594_0123260 | 3300053118 | Bacteria | 815 |
| 1084 | Ga0500595_000731 | 3300053119 | Bacteria | 19548 |
| 1085 | Ga0500595_022769 | 3300053119 | Bacteria | 2211 |
| 1086 | Ga0500614_022675 | 3300053123 | Bacteria | 1468 |
| 1087 | Ga0500618_001267 | 3300053125 | Bacteria | 11733 |
| 1088 | Ga0500642_0000010 | 3300053130 | Bacteria | 272552 |
| 1089 | Ga0500642_0000887 | 3300053130 | Bacteria | 8708 |
| 1090 | Ga0500642_0009847 | 3300053130 | Bacteria | 3341 |
| 1091 | Ga0500642_0124487 | 3300053130 | Bacteria | 1207 |
| 1092 | Ga0500652_000063 | 3300053131 | Bacteria | 46678 |
| 1093 | Ga0500658_0073848 | 3300053134 | Bacteria | 1445 |
| 1094 | Ga0500568_0000388 | 3300053139 | Bacteria | 33489 |
| 1095 | Ga0500568_0013508 | 3300053139 | Bacteria | 3720 |
| 1096 | Ga0500577_0031982 | 3300053142 | Bacteria | 1846 |
| 1097 | Ga0500577_0036118 | 3300053142 | Bacteria | 1767 |
| 1098 | Ga0500577_0079257 | 3300053142 | Bacteria | 1306 |
| 1099 | Ga0500588_0000561 | 3300053146 | Bacteria | 6037 |
| 1100 | Ga0500588_0012298 | 3300053146 | Bacteria | 2119 |
| 1101 | Ga0500588_0016324 | 3300053146 | Bacteria | 1919 |
| 1102 | Ga0500588_0037346 | 3300053146 | Bacteria | 1442 |
| 1103 | Ga0500604_0002284 | 3300053151 | Bacteria | 5248 |
| 1104 | Ga0500604_0012185 | 3300053151 | Bacteria | 2318 |
| 1105 | Ga0500604_0049761 | 3300053151 | Bacteria | 1289 |
| 1106 | Ga0500616_0000014 | 3300053153 | Bacteria | 637918 |
| 1107 | Ga0500616_0000888 | 3300053153 | Bacteria | 32969 |
| 1108 | Ga0500616_0011431 | 3300053153 | Bacteria | 5242 |
| 1109 | Ga0500619_020780 | 3300053154 | Bacteria | 1882 |
| 1110 | Ga0500622_0000266 | 3300053156 | Bacteria | 53524 |
| 1111 | Ga0500627_0033807 | 3300053158 | Bacteria | 2163 |
| 1112 | Ga0500633_0038306 | 3300053160 | Bacteria | 1596 |
| 1113 | Ga0500634_0249411 | 3300053161 | Bacteria | 739 |
| 1114 | Ga0500636_0001741 | 3300053177 | Bacteria | 11927 |
| 1115 | Ga0500570_069807 | 3300053724 | Bacteria | 1646 |
| 1116 | Ga0500645_021692 | 3300053730 | Bacteria | 1981 |
| 1117 | Ga0500609_002904 | 3300053731 | Bacteria | 2439 |
| 1118 | Ga0500601_000022 | 3300053737 | Bacteria | 34845 |
| 1119 | Ga0501084_0034090 | 3300054114 | Bacteria | 4257 |
| 1120 | Ga0501084_0083270 | 3300054114 | Bacteria | 2685 |
| 1121 | Ga0501084_0083298 | 3300054114 | Bacteria | 2684 |
| 1122 | Ga0501084_0336590 | 3300054114 | Bacteria | 1275 |
| 1123 | Ga0501084_0337175 | 3300054114 | Bacteria | 1274 |
| 1124 | Ga0501084_0384489 | 3300054114 | Bacteria | 1186 |
| 1125 | Ga0500661_021571 | 3300055283 | Bacteria | 1143 |
| 1126 | Ga0501082_0001543 | 3300060353 | Bacteria | 20276 |
| 1127 | Ga0501082_0007592 | 3300060353 | Bacteria | 9353 |
| 1128 | Ga0501082_0021973 | 3300060353 | Bacteria | 5501 |
| 1129 | Ga0501082_0051744 | 3300060353 | Bacteria | 3540 |
| 1130 | Ga0501082_0299310 | 3300060353 | Bacteria | 1401 |
| 1131 | Ga0501082_0323962 | 3300060353 | Bacteria | 1343 |
| 1132 | Ga0501082_0694267 | 3300060353 | Bacteria | 891 |
| 1133 | Ga0466962_0155906 | 3300061719 | Bacteria | 1109 |
| 1134 | Ga0530510_0117097 | 3300061734 | Bacteria | 1954 |
| 1135 | Ga0530510_0172919 | 3300061734 | Unclassified | 1600 |
| 1136 | Ga0530510_0222121 | 3300061734 | Bacteria | 1404 |
| 1137 | Ga0530510_0540371 | 3300061734 | Bacteria | 885 |
| 1138 | Ga0530510_0570628 | 3300061734 | Bacteria | 860 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049581 | Ga0501047_0001775 | Ga0501047_0001775_5779_6414 | 189 |
| 2 | 3300049742 | Ga0501080_0009753 | Ga0501080_0009753_3131_3766 | 189 |
| 3 | 3300039438 | Ga0436360_0320708 | Ga0436360_0320708_2930_3580 | 194 |
| 4 | 3300044765 | Ga0466970_0243946 | Ga0466970_0243946_214_876 | 199 |
| 5 | 3300003322 | rootL2_10291390 | rootL2_102913902 | 203 |
| 6 | 3300005985 | Ga0081539_10015587 | Ga0081539_100155874 | 203 |
| 7 | 3300031456 | Ga0307513_10451469 | Ga0307513_104514692 | 203 |
| 8 | 3300045976 | Ga0466967_0069388 | Ga0466967_0069388_389_1015 | 203 |
| 9 | 3300047472 | Ga0495686_0214595 | Ga0495686_0214595_227_847 | 203 |
| 10 | 3300049571 | Ga0501034_0708855 | Ga0501034_0708855_123_743 | 203 |
| 11 | 3300049579 | Ga0501043_0145326 | Ga0501043_0145326_168_788 | 203 |
| 12 | 3300049579 | Ga0501043_0832478 | Ga0501043_0832478_16_636 | 203 |
| 13 | 3300049581 | Ga0501047_0327509 | Ga0501047_0327509_595_1215 | 203 |
| 14 | 3300049586 | Ga0501070_0256771 | Ga0501070_0256771_221_841 | 203 |
| 15 | 3300049589 | Ga0501073_0377293 | Ga0501073_0377293_320_940 | 203 |
| 16 | 3300049742 | Ga0501080_0035262 | Ga0501080_0035262_1546_2166 | 203 |
| 17 | 3300049742 | Ga0501080_0540662 | Ga0501080_0540662_399_1019 | 203 |
| 18 | 3300049822 | Ga0501035_0036440 | Ga0501035_0036440_593_1213 | 203 |
| 19 | 3300049823 | Ga0501044_0262961 | Ga0501044_0262961_465_1085 | 203 |
| 20 | 3300053146 | Ga0500588_0000561 | Ga0500588_0000561_3369_3989 | 203 |
| 21 | 3300053153 | Ga0500616_0000888 | Ga0500616_0000888_26303_26923 | 203 |
| 22 | 3300003316 | rootH1_10021619 | rootH1_100216192 | 205 |
| 23 | 3300003320 | rootH2_10032559 | rootH2_1003255912 | 205 |
| 24 | 3300005262 | Ga0065165_1028635 | Ga0065165_10286352 | 205 |
| 25 | 3300005844 | Ga0068862_100029912 | Ga0068862_1000299123 | 205 |
| 26 | 3300025297 | Ga0209758_1000059 | Ga0209758_1000059231 | 205 |
| 27 | 3300025297 | Ga0209758_1046740 | Ga0209758_10467402 | 205 |
| 28 | 3300025298 | Ga0209050_1002314 | Ga0209050_10023142 | 205 |
| 29 | 3300025299 | Ga0209256_1068092 | Ga0209256_10680921 | 205 |
| 30 | 3300025304 | Ga0209257_1000114 | Ga0209257_1000114224 | 205 |
| 31 | 3300025304 | Ga0209257_1019160 | Ga0209257_10191602 | 205 |
| 32 | 3300029957 | Ga0265324_10060633 | Ga0265324_100606332 | 205 |
| 33 | 3300030522 | Ga0307512_10186941 | Ga0307512_101869411 | 205 |
| 34 | 3300031239 | Ga0265328_10012454 | Ga0265328_100124543 | 205 |
| 35 | 3300031250 | Ga0265331_10000333 | Ga0265331_100003335 | 205 |
| 36 | 3300041459 | Ga0451800_0784539 | Ga0451800_0784539_394_1032 | 205 |
| 37 | 3300041505 | Ga0451849_0087101 | Ga0451849_0087101_23_661 | 205 |
| 38 | 3300044673 | Ga0453683_0473469 | Ga0453683_0473469_158_781 | 205 |
| 39 | 3300044712 | Ga0453684_0000006 | Ga0453684_0000006_586943_587572 | 205 |
| 40 | 3300044712 | Ga0453684_0000031 | Ga0453684_0000031_387711_388337 | 205 |
| 41 | 3300044712 | Ga0453684_0008102 | Ga0453684_0008102_17995_18618 | 205 |
| 42 | 3300044712 | Ga0453684_0313101 | Ga0453684_0313101_1086_1709 | 205 |
| 43 | 3300046660 | Ga0495625_0325743 | Ga0495625_0325743_32_670 | 205 |
| 44 | 3300049571 | Ga0501034_0093059 | Ga0501034_0093059_571_1206 | 205 |
| 45 | 3300049574 | Ga0501038_0224760 | Ga0501038_0224760_84_713 | 205 |
| 46 | 3300049575 | Ga0501039_0195945 | Ga0501039_0195945_23_658 | 205 |
| 47 | 3300049579 | Ga0501043_0028972 | Ga0501043_0028972_1812_2447 | 205 |
| 48 | 3300049579 | Ga0501043_0539355 | Ga0501043_0539355_63_692 | 205 |
| 49 | 3300049580 | Ga0501046_0267391 | Ga0501046_0267391_386_1021 | 205 |
| 50 | 3300049583 | Ga0501067_0089828 | Ga0501067_0089828_614_1243 | 205 |
| 51 | 3300049584 | Ga0501068_0005782 | Ga0501068_0005782_813_1448 | 205 |
| 52 | 3300049585 | Ga0501069_0051069 | Ga0501069_0051069_1136_1771 | 205 |
| 53 | 3300049586 | Ga0501070_0245748 | Ga0501070_0245748_559_1188 | 205 |
| 54 | 3300049588 | Ga0501072_0327898 | Ga0501072_0327898_80_715 | 205 |
| 55 | 3300049589 | Ga0501073_0016110 | Ga0501073_0016110_1866_2495 | 205 |
| 56 | 3300049590 | Ga0501074_0046562 | Ga0501074_0046562_2360_2989 | 205 |
| 57 | 3300049741 | Ga0501079_0312730 | Ga0501079_0312730_223_858 | 205 |
| 58 | 3300049742 | Ga0501080_0045183 | Ga0501080_0045183_279_908 | 205 |
| 59 | 3300049742 | Ga0501080_0504689 | Ga0501080_0504689_101_730 | 205 |
| 60 | 3300049744 | Ga0501083_0144139 | Ga0501083_0144139_394_1023 | 205 |
| 61 | 3300049822 | Ga0501035_0620731 | Ga0501035_0620731_230_859 | 205 |
| 62 | 3300049823 | Ga0501044_0002291 | Ga0501044_0002291_12817_13452 | 205 |
| 63 | 3300049823 | Ga0501044_0404528 | Ga0501044_0404528_417_1046 | 205 |
| 64 | 3300053092 | Ga0500583_0162939 | Ga0500583_0162939_115_753 | 205 |
| 65 | 3300053093 | Ga0500651_0039858 | Ga0500651_0039858_2045_2683 | 205 |
| 66 | 3300053093 | Ga0500651_0121043 | Ga0500651_0121043_397_1035 | 205 |
| 67 | 3300053103 | Ga0500555_003654 | Ga0500555_003654_3501_4139 | 205 |
| 68 | 3300053119 | Ga0500595_000731 | Ga0500595_000731_9309_9947 | 205 |
| 69 | 3300053123 | Ga0500614_022675 | Ga0500614_022675_139_777 | 205 |
| 70 | 3300053130 | Ga0500642_0000887 | Ga0500642_0000887_7278_7916 | 205 |
| 71 | 3300053139 | Ga0500568_0013508 | Ga0500568_0013508_2050_2688 | 205 |
| 72 | 3300053142 | Ga0500577_0031982 | Ga0500577_0031982_1046_1684 | 205 |
| 73 | 3300053142 | Ga0500577_0036118 | Ga0500577_0036118_1091_1720 | 205 |
| 74 | 3300053146 | Ga0500588_0012298 | Ga0500588_0012298_1058_1696 | 205 |
| 75 | 3300053146 | Ga0500588_0016324 | Ga0500588_0016324_424_1062 | 205 |
| 76 | 3300053151 | Ga0500604_0002284 | Ga0500604_0002284_462_1097 | 205 |
| 77 | 3300053151 | Ga0500604_0049761 | Ga0500604_0049761_124_762 | 205 |
| 78 | 3300053161 | Ga0500634_0249411 | Ga0500634_0249411_72_710 | 205 |
| 79 | 3300053731 | Ga0500609_002904 | Ga0500609_002904_675_1307 | 205 |
| 80 | 3300060353 | Ga0501082_0001543 | Ga0501082_0001543_17949_18584 | 205 |
| 81 | 3300031251 | Ga0265327_10000775 | Ga0265327_1000077541 | 206 |
| 82 | iso_pu_bacteria | 2643221576 | 2643892612 | 206 |
| 83 | iso_pu_bacteria | 2643221590 | 2643962061 | 206 |
| 84 | iso_pu_bacteria | 2643221617 | 2644098735 | 206 |
| 85 | iso_pu_bacteria | 2643221620 | 2644116096 | 206 |
| 86 | 3300005563 | Ga0068855_100136130 | Ga0068855_1001361302 | 207 |
| 87 | 3300005618 | Ga0068864_100418600 | Ga0068864_1004186001 | 207 |
| 88 | 3300005843 | Ga0068860_100216486 | Ga0068860_1002164862 | 207 |
| 89 | 3300009093 | Ga0105240_10026738 | Ga0105240_100267384 | 207 |
| 90 | 3300025913 | Ga0207695_10050992 | Ga0207695_100509922 | 207 |
| 91 | 3300025949 | Ga0207667_10354994 | Ga0207667_103549942 | 207 |
| 92 | 3300026095 | Ga0207676_10308045 | Ga0207676_103080451 | 207 |
| 93 | 3300031251 | Ga0265327_10091170 | Ga0265327_100911702 | 207 |
| 94 | 3300035083 | Ga0373926_0162366 | Ga0373926_0162366_63_695 | 207 |
| 95 | 3300035116 | Ga0373945_0017489 | Ga0373945_0017489_1140_1772 | 207 |
| 96 | 3300035170 | Ga0373943_0002159 | Ga0373943_0002159_1794_2426 | 207 |
| 97 | 3300035692 | Ga0373935_0034107 | Ga0373935_0034107_49_681 | 207 |
| 98 | 3300035725 | Ga0373947_0016255 | Ga0373947_0016255_879_1511 | 207 |
| 99 | 3300037068 | Ga0373925_0004278 | Ga0373925_0004278_4167_4799 | 207 |
| 100 | 3300047319 | Ga0495674_0479164 | Ga0495674_0479164_324_956 | 207 |
| 101 | 3300053093 | Ga0500651_0139892 | Ga0500651_0139892_513_1181 | 207 |
| 102 | 3300009545 | Ga0105237_10047128 | Ga0105237_100471284 | 208 |
| 103 | 3300025914 | Ga0207671_10087282 | Ga0207671_100872822 | 208 |
| 104 | 3300037418 | Ga0395900_0534211 | Ga0395900_0534211_119_778 | 208 |
| 105 | 3300037466 | Ga0395898_0179458 | Ga0395898_0179458_973_1638 | 208 |
| 106 | 3300038443 | Ga0395901_0266328 | Ga0395901_0266328_138_803 | 208 |
| 107 | 3300044683 | Ga0466965_0102315 | Ga0466965_0102315_393_1067 | 208 |
| 108 | 3300044712 | Ga0453684_0112756 | Ga0453684_0112756_1840_2514 | 208 |
| 109 | iso_pu_bacteria | 2643221604 | 2644034770 | 208 |
| 110 | iso_pu_bacteria | 2738541305 | 2738872000 | 208 |
| 111 | iso_pu_bacteria | 2811994874 | 2812329952 | 208 |
| 112 | 3300005336 | Ga0070680_100698473 | Ga0070680_1006984731 | 210 |
| 113 | 3300035113 | Ga0373936_0165075 | Ga0373936_0165075_87_737 | 210 |
| 114 | 3300035695 | Ga0373927_0029730 | Ga0373927_0029730_2770_3420 | 210 |
| 115 | 3300035725 | Ga0373947_0001498 | Ga0373947_0001498_9437_10087 | 210 |
| 116 | 3300037068 | Ga0373925_0006000 | Ga0373925_0006000_4558_5208 | 210 |
| 117 | 3300046455 | Ga0495603_0001017 | Ga0495603_0001017_6160_6810 | 210 |
| 118 | 3300046459 | Ga0495629_0001626 | Ga0495629_0001626_15_665 | 210 |
| 119 | 3300046461 | Ga0495641_0114372 | Ga0495641_0114372_168_818 | 210 |
| 120 | 3300046472 | Ga0495580_0000806 | Ga0495580_0000806_21922_22572 | 210 |
| 121 | 3300046473 | Ga0495582_0001348 | Ga0495582_0001348_6086_6736 | 210 |
| 122 | 3300046475 | Ga0495639_0001292 | Ga0495639_0001292_8533_9183 | 210 |
| 123 | 3300046499 | Ga0495594_0000401 | Ga0495594_0000401_5762_6412 | 210 |
| 124 | 3300046557 | Ga0495622_0046788 | Ga0495622_0046788_970_1620 | 210 |
| 125 | 3300046642 | Ga0495634_0297489 | Ga0495634_0297489_30_680 | 210 |
| 126 | 3300046663 | Ga0495635_0135616 | Ga0495635_0135616_540_1190 | 210 |
| 127 | 3300046674 | Ga0495588_0005816 | Ga0495588_0005816_2978_3628 | 210 |
| 128 | 3300046681 | Ga0495647_0006744 | Ga0495647_0006744_1503_2153 | 210 |
| 129 | 3300046683 | Ga0495658_0003498 | Ga0495658_0003498_3954_4604 | 210 |
| 130 | 3300046689 | Ga0495613_0000508 | Ga0495613_0000508_24613_25263 | 210 |
| 131 | 3300046690 | Ga0495624_0032723 | Ga0495624_0032723_181_831 | 210 |
| 132 | 3300047322 | Ga0495680_0040382 | Ga0495680_0040382_2778_3428 | 210 |
| 133 | 3300047673 | Ga0495593_0003599 | Ga0495593_0003599_6284_6934 | 210 |
| 134 | 3300048089 | Ga0495614_0299412 | Ga0495614_0299412_82_732 | 210 |
| 135 | 3300049568 | Ga0501031_0045287 | Ga0501031_0045287_1862_2518 | 210 |
| 136 | 3300049569 | Ga0501032_0055122 | Ga0501032_0055122_1228_1884 | 210 |
| 137 | 3300049570 | Ga0501033_0127122 | Ga0501033_0127122_82_738 | 210 |
| 138 | 3300049572 | Ga0501036_0069973 | Ga0501036_0069973_192_848 | 210 |
| 139 | 3300049574 | Ga0501038_0137111 | Ga0501038_0137111_1267_1923 | 210 |
| 140 | 3300049575 | Ga0501039_0180494 | Ga0501039_0180494_183_839 | 210 |
| 141 | 3300049576 | Ga0501040_0066629 | Ga0501040_0066629_1307_1963 | 210 |
| 142 | 3300049577 | Ga0501041_0054388 | Ga0501041_0054388_1387_2043 | 210 |
| 143 | 3300049578 | Ga0501042_0039496 | Ga0501042_0039496_336_992 | 210 |
| 144 | 3300049579 | Ga0501043_0049051 | Ga0501043_0049051_2352_3008 | 210 |
| 145 | 3300049580 | Ga0501046_0029021 | Ga0501046_0029021_2239_2895 | 210 |
| 146 | 3300049584 | Ga0501068_0327630 | Ga0501068_0327630_24_680 | 210 |
| 147 | 3300049585 | Ga0501069_0246239 | Ga0501069_0246239_119_775 | 210 |
| 148 | 3300049589 | Ga0501073_0382846 | Ga0501073_0382846_50_706 | 210 |
| 149 | 3300049590 | Ga0501074_0180689 | Ga0501074_0180689_405_1061 | 210 |
| 150 | 3300049591 | Ga0501075_0010200 | Ga0501075_0010200_2892_3548 | 210 |
| 151 | 3300049592 | Ga0501076_0009793 | Ga0501076_0009793_1760_2416 | 210 |
| 152 | 3300049741 | Ga0501079_0042950 | Ga0501079_0042950_1752_2408 | 210 |
| 153 | 3300049742 | Ga0501080_0011995 | Ga0501080_0011995_5052_5708 | 210 |
| 154 | 3300049743 | Ga0501081_0018902 | Ga0501081_0018902_1134_1790 | 210 |
| 155 | 3300049744 | Ga0501083_0030007 | Ga0501083_0030007_241_897 | 210 |
| 156 | 3300049822 | Ga0501035_0330562 | Ga0501035_0330562_486_1142 | 210 |
| 157 | 3300049824 | Ga0501045_0038834 | Ga0501045_0038834_2758_3414 | 210 |
| 158 | 3300053084 | Ga0495595_0010781 | Ga0495595_0010781_1367_2017 | 210 |
| 159 | 3300053085 | Ga0495619_0013374 | Ga0495619_0013374_3733_4383 | 210 |
| 160 | 3300054114 | Ga0501084_0083298 | Ga0501084_0083298_901_1557 | 210 |
| 161 | 3300060353 | Ga0501082_0051744 | Ga0501082_0051744_2100_2756 | 210 |
| 162 | 3300061734 | Ga0530510_0172919 | Ga0530510_0172919_828_1484 | 210 |
| 163 | 3300025254 | Ga0209148_1001585 | Ga0209148_10015853 | 211 |
| 164 | 3300048929 | Ga0496126_0424088 | Ga0496126_0424088_300_995 | 212 |
| 165 | 3300037068 | Ga0373925_0594639 | Ga0373925_0594639_196_846 | 213 |
| 166 | 3300005336 | Ga0070680_100022351 | Ga0070680_1000223513 | 217 |
| 167 | 3300005337 | Ga0070682_100008050 | Ga0070682_1000080506 | 217 |
| 168 | 3300005341 | Ga0070691_10120209 | Ga0070691_101202092 | 217 |
| 169 | 3300005366 | Ga0070659_100043352 | Ga0070659_1000433524 | 217 |
| 170 | 3300005455 | Ga0070663_100099777 | Ga0070663_1000997773 | 217 |
| 171 | 3300005458 | Ga0070681_10030828 | Ga0070681_100308286 | 217 |
| 172 | 3300005530 | Ga0070679_100016290 | Ga0070679_1000162907 | 217 |
| 173 | 3300005539 | Ga0068853_100011139 | Ga0068853_1000111393 | 217 |
| 174 | 3300005547 | Ga0070693_100012903 | Ga0070693_1000129033 | 217 |
| 175 | 3300005549 | Ga0070704_100334507 | Ga0070704_1003345071 | 217 |
| 176 | 3300005563 | Ga0068855_100074040 | Ga0068855_1000740402 | 217 |
| 177 | 3300013307 | Ga0157372_10016504 | Ga0157372_100165045 | 217 |
| 178 | 3300025912 | Ga0207707_10045123 | Ga0207707_100451232 | 217 |
| 179 | 3300025921 | Ga0207652_10413202 | Ga0207652_104132022 | 217 |
| 180 | 3300025949 | Ga0207667_10358477 | Ga0207667_103584772 | 217 |
| 181 | 3300026041 | Ga0207639_10012134 | Ga0207639_100121343 | 217 |
| 182 | 3300026067 | Ga0207678_10121665 | Ga0207678_101216653 | 217 |
| 183 | 3300039447 | Ga0436361_0622258 | Ga0436361_0622258_1006_1677 | 217 |
| 184 | 3300050495 | nmdc:mga04h51_19183_c1 | nmdc:mga04h51_19183_c1_150_818 | 217 |
| 185 | 3300050513 | nmdc:mga0rr50_64490_c1 | nmdc:mga0rr50_64490_c1_407_1075 | 217 |
| 186 | 3300050514 | nmdc:mga08x19_14_c1 | nmdc:mga08x19_14_c1_309279_309947 | 217 |
| 187 | 3300054114 | Ga0501084_0337175 | Ga0501084_0337175_14_685 | 217 |
| 188 | 3300003354 | JGI25160J50197_1001950 | JGI25160J50197_10019508 | 218 |
| 189 | 3300005355 | Ga0070671_100390424 | Ga0070671_1003904242 | 218 |
| 190 | 3300005435 | Ga0070714_100000556 | Ga0070714_1000005564 | 218 |
| 191 | 3300005437 | Ga0070710_10002571 | Ga0070710_100025714 | 218 |
| 192 | 3300005439 | Ga0070711_100017293 | Ga0070711_1000172932 | 218 |
| 193 | 3300005539 | Ga0068853_100037050 | Ga0068853_1000370502 | 218 |
| 194 | 3300005614 | Ga0068856_100246984 | Ga0068856_1002469842 | 218 |
| 195 | 3300006028 | Ga0070717_10059609 | Ga0070717_100596092 | 218 |
| 196 | 3300006038 | Ga0075365_10078435 | Ga0075365_100784353 | 218 |
| 197 | 3300006173 | Ga0070716_100022930 | Ga0070716_1000229303 | 218 |
| 198 | 3300006175 | Ga0070712_100033476 | Ga0070712_1000334762 | 218 |
| 199 | 3300006178 | Ga0075367_10140312 | Ga0075367_101403121 | 218 |
| 200 | 3300006178 | Ga0075367_10172944 | Ga0075367_101729442 | 218 |
| 201 | 3300006186 | Ga0075369_10005025 | Ga0075369_100050254 | 218 |
| 202 | 3300009174 | Ga0105241_10116553 | Ga0105241_101165532 | 218 |
| 203 | 3300009545 | Ga0105237_10092024 | Ga0105237_100920242 | 218 |
| 204 | 3300009545 | Ga0105237_10640661 | Ga0105237_106406612 | 218 |
| 205 | 3300009551 | Ga0105238_10277946 | Ga0105238_102779462 | 218 |
| 206 | 3300010375 | Ga0105239_10007779 | Ga0105239_1000777915 | 218 |
| 207 | 3300013100 | Ga0157373_10242012 | Ga0157373_102420122 | 218 |
| 208 | 3300013297 | Ga0157378_11203288 | Ga0157378_112032881 | 218 |
| 209 | 3300025254 | Ga0209148_1000274 | Ga0209148_100027433 | 218 |
| 210 | 3300025297 | Ga0209758_1001908 | Ga0209758_10019089 | 218 |
| 211 | 3300025297 | Ga0209758_1036239 | Ga0209758_10362392 | 218 |
| 212 | 3300025302 | Ga0207426_1000143 | Ga0207426_1000143162 | 218 |
| 213 | 3300025304 | Ga0209257_1030530 | Ga0209257_10305302 | 218 |
| 214 | 3300025898 | Ga0207692_10009902 | Ga0207692_100099022 | 218 |
| 215 | 3300025906 | Ga0207699_10001003 | Ga0207699_1000100310 | 218 |
| 216 | 3300025911 | Ga0207654_10063597 | Ga0207654_100635972 | 218 |
| 217 | 3300025915 | Ga0207693_10045948 | Ga0207693_100459482 | 218 |
| 218 | 3300025916 | Ga0207663_10012503 | Ga0207663_100125032 | 218 |
| 219 | 3300025924 | Ga0207694_10175041 | Ga0207694_101750412 | 218 |
| 220 | 3300025929 | Ga0207664_10030708 | Ga0207664_100307082 | 218 |
| 221 | 3300025939 | Ga0207665_10029125 | Ga0207665_100291253 | 218 |
| 222 | 3300026041 | Ga0207639_10143515 | Ga0207639_101435152 | 218 |
| 223 | 3300026078 | Ga0207702_10543101 | Ga0207702_105431012 | 218 |
| 224 | 3300031344 | Ga0265316_10374520 | Ga0265316_103745202 | 218 |
| 225 | 3300044694 | Ga0466963_0017811 | Ga0466963_0017811_1388_2074 | 218 |
| 226 | 3300044706 | Ga0466964_0163810 | Ga0466964_0163810_147_833 | 218 |
| 227 | 3300045976 | Ga0466967_0024864 | Ga0466967_0024864_1644_2330 | 218 |
| 228 | 3300048928 | Ga0496125_0090833 | Ga0496125_0090833_320_1006 | 218 |
| 229 | 3300049584 | Ga0501068_0325772 | Ga0501068_0325772_180_854 | 218 |
| 230 | 3300049587 | Ga0501071_0083235 | Ga0501071_0083235_335_1009 | 218 |
| 231 | 3300049588 | Ga0501072_0086538 | Ga0501072_0086538_145_819 | 218 |
| 232 | 3300049591 | Ga0501075_0040287 | Ga0501075_0040287_225_899 | 218 |
| 233 | 3300049593 | Ga0501077_0118183 | Ga0501077_0118183_592_1266 | 218 |
| 234 | 3300049741 | Ga0501079_0020198 | Ga0501079_0020198_2145_2819 | 218 |
| 235 | 3300049743 | Ga0501081_0027216 | Ga0501081_0027216_1308_1982 | 218 |
| 236 | 3300050491 | nmdc:mga00v17_79322_c1 | nmdc:mga00v17_79322_c1_1332_2018 | 218 |
| 237 | 3300050492 | nmdc:mga0yw44_54507_c1 | nmdc:mga0yw44_54507_c1_1066_1752 | 218 |
| 238 | 3300053119 | Ga0500595_022769 | Ga0500595_022769_570_1256 | 218 |
| 239 | 3300053125 | Ga0500618_001267 | Ga0500618_001267_1370_2059 | 218 |
| 240 | 3300053130 | Ga0500642_0009847 | Ga0500642_0009847_2524_3210 | 218 |
| 241 | 3300053737 | Ga0500601_000022 | Ga0500601_000022_937_1623 | 218 |
| 242 | 3300054114 | Ga0501084_0034090 | Ga0501084_0034090_2927_3601 | 218 |
| 243 | 3300055283 | Ga0500661_021571 | Ga0500661_021571_192_878 | 218 |
| 244 | 3300060353 | Ga0501082_0021973 | Ga0501082_0021973_3216_3890 | 218 |
| 245 | 3300061719 | Ga0466962_0155906 | Ga0466962_0155906_412_1098 | 218 |
| 246 | 3300061734 | Ga0530510_0117097 | Ga0530510_0117097_114_788 | 218 |
| 247 | iso_pu_bacteria | 2791355197 | 2793068239 | 218 |
| 248 | iso_pu_bacteria | 2824653114 | 2824656246 | 218 |
| 249 | iso_pu_bacteria | 2824661429 | 2824665657 | 218 |
| 250 | iso_pu_bacteria | 2844315083 | 2844318741 | 218 |
| 251 | iso_pu_bacteria | 2906602504 | 2906604430 | 218 |
| 252 | iso_pu_bacteria | 8056967851 | 8056973131 | 218 |
| 253 | 3300005536 | Ga0070697_100039437 | Ga0070697_1000394373 | 219 |
| 254 | 3300005545 | Ga0070695_100008588 | Ga0070695_1000085883 | 219 |
| 255 | 3300005546 | Ga0070696_100007312 | Ga0070696_1000073124 | 219 |
| 256 | 3300005549 | Ga0070704_100002394 | Ga0070704_1000023947 | 219 |
| 257 | 3300005577 | Ga0068857_100156103 | Ga0068857_1001561032 | 219 |
| 258 | 3300006038 | Ga0075365_10047027 | Ga0075365_100470272 | 219 |
| 259 | 3300006051 | Ga0075364_10083572 | Ga0075364_100835722 | 219 |
| 260 | 3300006163 | Ga0070715_10174973 | Ga0070715_101749732 | 219 |
| 261 | 3300006186 | Ga0075369_10189107 | Ga0075369_101891071 | 219 |
| 262 | 3300006195 | Ga0075366_10404603 | Ga0075366_104046032 | 219 |
| 263 | 3300006914 | Ga0075436_100000477 | Ga0075436_1000004773 | 219 |
| 264 | 3300007076 | Ga0075435_100076627 | Ga0075435_1000766273 | 219 |
| 265 | 3300009174 | Ga0105241_10024393 | Ga0105241_100243934 | 219 |
| 266 | 3300010375 | Ga0105239_10307471 | Ga0105239_103074712 | 219 |
| 267 | 3300013100 | Ga0157373_10015435 | Ga0157373_100154352 | 219 |
| 268 | 3300025905 | Ga0207685_10061678 | Ga0207685_100616782 | 219 |
| 269 | 3300026067 | Ga0207678_10038702 | Ga0207678_100387022 | 219 |
| 270 | 3300026116 | Ga0207674_10184805 | Ga0207674_101848052 | 219 |
| 271 | 3300027866 | Ga0209813_10039324 | Ga0209813_100393242 | 219 |
| 272 | 3300028379 | Ga0268266_10319538 | Ga0268266_103195382 | 219 |
| 273 | 3300028794 | Ga0307515_10091636 | Ga0307515_100916363 | 219 |
| 274 | 3300035724 | Ga0373933_0000007 | Ga0373933_0000007_88028_88717 | 219 |
| 275 | 3300042005 | Ga0439448_0084842 | Ga0439448_0084842_236_910 | 219 |
| 276 | 3300046460 | Ga0495638_0011195 | Ga0495638_0011195_4181_4867 | 219 |
| 277 | 3300046501 | Ga0495607_0103777 | Ga0495607_0103777_159_845 | 219 |
| 278 | 3300046507 | Ga0495606_0110584 | Ga0495606_0110584_589_1275 | 219 |
| 279 | 3300046512 | Ga0495610_0021653 | Ga0495610_0021653_888_1574 | 219 |
| 280 | 3300046515 | Ga0495620_0064800 | Ga0495620_0064800_106_792 | 219 |
| 281 | 3300046518 | Ga0495631_0020740 | Ga0495631_0020740_228_914 | 219 |
| 282 | 3300046524 | Ga0495648_0082144 | Ga0495648_0082144_200_886 | 219 |
| 283 | 3300046648 | Ga0495611_0251504 | Ga0495611_0251504_80_766 | 219 |
| 284 | 3300046660 | Ga0495625_0034767 | Ga0495625_0034767_816_1502 | 219 |
| 285 | 3300046660 | Ga0495625_0346003 | Ga0495625_0346003_228_890 | 219 |
| 286 | 3300046665 | Ga0495661_0016354 | Ga0495661_0016354_59_745 | 219 |
| 287 | 3300046691 | Ga0495670_0005031 | Ga0495670_0005031_1054_1740 | 219 |
| 288 | 3300046692 | Ga0495671_0088284 | Ga0495671_0088284_702_1388 | 219 |
| 289 | 3300047472 | Ga0495686_0262390 | Ga0495686_0262390_175_861 | 219 |
| 290 | 3300048919 | Ga0496116_0001851 | Ga0496116_0001851_15434_16120 | 219 |
| 291 | 3300048920 | Ga0496117_0121378 | Ga0496117_0121378_460_1146 | 219 |
| 292 | 3300048923 | Ga0496120_0300990 | Ga0496120_0300990_32_718 | 219 |
| 293 | 3300048924 | Ga0496121_0013940 | Ga0496121_0013940_6624_7310 | 219 |
| 294 | 3300048925 | Ga0496122_0054736 | Ga0496122_0054736_170_856 | 219 |
| 295 | 3300048926 | Ga0496123_0226992 | Ga0496123_0226992_186_872 | 219 |
| 296 | 3300048928 | Ga0496125_0029721 | Ga0496125_0029721_4060_4746 | 219 |
| 297 | 3300049571 | Ga0501034_0269075 | Ga0501034_0269075_596_1285 | 219 |
| 298 | 3300049572 | Ga0501036_0124437 | Ga0501036_0124437_595_1284 | 219 |
| 299 | 3300049574 | Ga0501038_0047640 | Ga0501038_0047640_2003_2692 | 219 |
| 300 | 3300049574 | Ga0501038_0310331 | Ga0501038_0310331_196_885 | 219 |
| 301 | 3300049581 | Ga0501047_0127392 | Ga0501047_0127392_1257_1946 | 219 |
| 302 | 3300049583 | Ga0501067_0165649 | Ga0501067_0165649_196_885 | 219 |
| 303 | 3300049584 | Ga0501068_0154246 | Ga0501068_0154246_441_1130 | 219 |
| 304 | 3300049589 | Ga0501073_0004541 | Ga0501073_0004541_8032_8721 | 219 |
| 305 | 3300049742 | Ga0501080_0023180 | Ga0501080_0023180_590_1279 | 219 |
| 306 | 3300050491 | nmdc:mga00v17_4955_c1 | nmdc:mga00v17_4955_c1_128_814 | 219 |
| 307 | 3300050496 | nmdc:mga07m45_12481_c1 | nmdc:mga07m45_12481_c1_3395_4081 | 219 |
| 308 | 3300050516 | nmdc:mga0sz30_19112_c1 | nmdc:mga0sz30_19112_c1_49_735 | 219 |
| 309 | 3300053088 | Ga0500644_0072537 | Ga0500644_0072537_210_896 | 219 |
| 310 | 3300053090 | Ga0500646_0081659 | Ga0500646_0081659_49_735 | 219 |
| 311 | 3300053093 | Ga0500651_0144194 | Ga0500651_0144194_626_1312 | 219 |
| 312 | 3300053094 | Ga0500566_0000499 | Ga0500566_0000499_13630_14316 | 219 |
| 313 | 3300053096 | Ga0500641_0018535 | Ga0500641_0018535_1826_2512 | 219 |
| 314 | 3300053098 | Ga0500650_0002506 | Ga0500650_0002506_4540_5226 | 219 |
| 315 | 3300053104 | Ga0500556_0000004 | Ga0500556_0000004_46297_46983 | 219 |
| 316 | 3300053108 | Ga0500562_067349 | Ga0500562_067349_33_695 | 219 |
| 317 | 3300053109 | Ga0500569_033050 | Ga0500569_033050_596_1282 | 219 |
| 318 | 3300053118 | Ga0500594_0123260 | Ga0500594_0123260_99_785 | 219 |
| 319 | 3300053130 | Ga0500642_0000010 | Ga0500642_0000010_139252_139938 | 219 |
| 320 | 3300053131 | Ga0500652_000063 | Ga0500652_000063_17115_17801 | 219 |
| 321 | 3300053139 | Ga0500568_0000388 | Ga0500568_0000388_11228_11914 | 219 |
| 322 | 3300053146 | Ga0500588_0037346 | Ga0500588_0037346_148_834 | 219 |
| 323 | 3300053151 | Ga0500604_0012185 | Ga0500604_0012185_596_1282 | 219 |
| 324 | 3300053153 | Ga0500616_0000014 | Ga0500616_0000014_63488_64174 | 219 |
| 325 | 3300053154 | Ga0500619_020780 | Ga0500619_020780_613_1299 | 219 |
| 326 | 3300053156 | Ga0500622_0000266 | Ga0500622_0000266_50353_51039 | 219 |
| 327 | 3300053158 | Ga0500627_0033807 | Ga0500627_0033807_59_745 | 219 |
| 328 | 3300053160 | Ga0500633_0038306 | Ga0500633_0038306_507_1193 | 219 |
| 329 | 3300053177 | Ga0500636_0001741 | Ga0500636_0001741_8511_9200 | 219 |
| 330 | 3300053724 | Ga0500570_069807 | Ga0500570_069807_271_957 | 219 |
| 331 | 3300053730 | Ga0500645_021692 | Ga0500645_021692_474_1160 | 219 |
| 332 | 3300054114 | Ga0501084_0336590 | Ga0501084_0336590_531_1220 | 219 |
| 333 | 3300060353 | Ga0501082_0299310 | Ga0501082_0299310_247_936 | 219 |
| 334 | iso_pu_bacteria | 2602042107 | 2603859168 | 219 |
| 335 | iso_pu_bacteria | 2857524615 | 2857527779 | 219 |
| 336 | iso_pu_bacteria | 2893066018 | 2893066499 | 219 |
| 337 | iso_pu_bacteria | 2919073203 | 2919079445 | 219 |
| 338 | 3300006048 | Ga0075363_100288731 | Ga0075363_1002887311 | 220 |
| 339 | 3300009094 | Ga0111539_10083183 | Ga0111539_100831835 | 220 |
| 340 | 3300013297 | Ga0157378_10142728 | Ga0157378_101427282 | 220 |
| 341 | 3300031247 | Ga0265340_10034405 | Ga0265340_100344053 | 220 |
| 342 | 3300031616 | Ga0307508_10047520 | Ga0307508_100475203 | 220 |
| 343 | 3300033544 | Ga0316215_1000920 | Ga0316215_10009203 | 220 |
| 344 | 3300035724 | Ga0373933_0056949 | Ga0373933_0056949_193_861 | 220 |
| 345 | 3300036401 | Ga0373937_0047656 | Ga0373937_0047656_1804_2472 | 220 |
| 346 | 3300036459 | Ga0372808_000937 | Ga0372808_000937_391_1083 | 220 |
| 347 | 3300039437 | Ga0436365_0368397 | Ga0436365_0368397_2010_2672 | 220 |
| 348 | 3300048908 | Ga0496105_0031349 | Ga0496105_0031349_3300_4016 | 220 |
| 349 | 3300048909 | Ga0496106_0174483 | Ga0496106_0174483_206_868 | 220 |
| 350 | 3300048912 | Ga0496109_0233656 | Ga0496109_0233656_364_1026 | 220 |
| 351 | 3300048913 | Ga0496110_0238597 | Ga0496110_0238597_713_1375 | 220 |
| 352 | 3300048916 | Ga0496113_0421480 | Ga0496113_0421480_352_1014 | 220 |
| 353 | 3300048918 | Ga0496115_0030851 | Ga0496115_0030851_2704_3366 | 220 |
| 354 | 3300049571 | Ga0501034_0056596 | Ga0501034_0056596_1128_1820 | 220 |
| 355 | 3300050507 | nmdc:mga05p37_512131_c1 | nmdc:mga05p37_512131_c1_298_960 | 220 |
| 356 | 3300050511 | nmdc:mga08y16_124566_c1 | nmdc:mga08y16_124566_c1_20_682 | 220 |
| 357 | 3300005353 | Ga0070669_100324818 | Ga0070669_1003248182 | 221 |
| 358 | 3300005355 | Ga0070671_100178959 | Ga0070671_1001789592 | 221 |
| 359 | 3300005356 | Ga0070674_100116254 | Ga0070674_1001162542 | 221 |
| 360 | 3300005983 | Ga0081540_1017139 | Ga0081540_10171392 | 221 |
| 361 | 3300006038 | Ga0075365_10333070 | Ga0075365_103330702 | 221 |
| 362 | 3300006038 | Ga0075365_10386415 | Ga0075365_103864152 | 221 |
| 363 | 3300006042 | Ga0075368_10065813 | Ga0075368_100658132 | 221 |
| 364 | 3300006042 | Ga0075368_10194856 | Ga0075368_101948562 | 221 |
| 365 | 3300006048 | Ga0075363_100076097 | Ga0075363_1000760972 | 221 |
| 366 | 3300006048 | Ga0075363_100137181 | Ga0075363_1001371812 | 221 |
| 367 | 3300006178 | Ga0075367_10218491 | Ga0075367_102184911 | 221 |
| 368 | 3300006186 | Ga0075369_10047996 | Ga0075369_100479962 | 221 |
| 369 | 3300006195 | Ga0075366_10193129 | Ga0075366_101931291 | 221 |
| 370 | 3300006847 | Ga0075431_100064062 | Ga0075431_1000640624 | 221 |
| 371 | 3300006852 | Ga0075433_10298209 | Ga0075433_102982092 | 221 |
| 372 | 3300009094 | Ga0111539_10106273 | Ga0111539_101062732 | 221 |
| 373 | 3300011119 | Ga0105246_10557154 | Ga0105246_105571542 | 221 |
| 374 | 3300013307 | Ga0157372_11029520 | Ga0157372_110295201 | 221 |
| 375 | 3300025921 | Ga0207652_10043743 | Ga0207652_100437432 | 221 |
| 376 | 3300025923 | Ga0207681_10364887 | Ga0207681_103648872 | 221 |
| 377 | 3300027866 | Ga0209813_10074582 | Ga0209813_100745822 | 221 |
| 378 | 3300031241 | Ga0265325_10014052 | Ga0265325_100140522 | 221 |
| 379 | 3300031595 | Ga0265313_10073434 | Ga0265313_100734342 | 221 |
| 380 | 3300035114 | Ga0373939_0001290 | Ga0373939_0001290_1350_2015 | 221 |
| 381 | 3300046491 | Ga0495584_0008719 | Ga0495584_0008719_1875_2540 | 221 |
| 382 | 3300048903 | Ga0496100_0010730 | Ga0496100_0010730_3254_3922 | 221 |
| 383 | 3300048904 | Ga0496101_0020299 | Ga0496101_0020299_1358_2026 | 221 |
| 384 | 3300048905 | Ga0496102_0002933 | Ga0496102_0002933_7541_8209 | 221 |
| 385 | 3300048907 | Ga0496104_0010922 | Ga0496104_0010922_4888_5556 | 221 |
| 386 | 3300048909 | Ga0496106_0016428 | Ga0496106_0016428_4284_4952 | 221 |
| 387 | 3300048910 | Ga0496107_0007435 | Ga0496107_0007435_2840_3508 | 221 |
| 388 | 3300048911 | Ga0496108_0057975 | Ga0496108_0057975_613_1281 | 221 |
| 389 | 3300048912 | Ga0496109_0014804 | Ga0496109_0014804_3412_4080 | 221 |
| 390 | 3300048913 | Ga0496110_0002156 | Ga0496110_0002156_2633_3301 | 221 |
| 391 | 3300048914 | Ga0496111_0034140 | Ga0496111_0034140_742_1410 | 221 |
| 392 | 3300048915 | Ga0496112_0020476 | Ga0496112_0020476_3684_4352 | 221 |
| 393 | 3300048916 | Ga0496113_0009756 | Ga0496113_0009756_3462_4130 | 221 |
| 394 | 3300048918 | Ga0496115_0037797 | Ga0496115_0037797_406_1074 | 221 |
| 395 | 3300049571 | Ga0501034_0023489 | Ga0501034_0023489_4207_4872 | 221 |
| 396 | 3300049581 | Ga0501047_0095778 | Ga0501047_0095778_655_1320 | 221 |
| 397 | 3300049582 | Ga0501048_0578936 | Ga0501048_0578936_102_767 | 221 |
| 398 | 3300049585 | Ga0501069_0035200 | Ga0501069_0035200_44_709 | 221 |
| 399 | 3300049585 | Ga0501069_0108775 | Ga0501069_0108775_172_837 | 221 |
| 400 | 3300049586 | Ga0501070_0044484 | Ga0501070_0044484_511_1176 | 221 |
| 401 | 3300049586 | Ga0501070_0123635 | Ga0501070_0123635_419_1084 | 221 |
| 402 | 3300049586 | Ga0501070_0132694 | Ga0501070_0132694_516_1181 | 221 |
| 403 | 3300049586 | Ga0501070_0154409 | Ga0501070_0154409_973_1638 | 221 |
| 404 | 3300049586 | Ga0501070_0191252 | Ga0501070_0191252_864_1529 | 221 |
| 405 | 3300049589 | Ga0501073_0183423 | Ga0501073_0183423_555_1226 | 221 |
| 406 | 3300049589 | Ga0501073_0334461 | Ga0501073_0334461_344_1009 | 221 |
| 407 | 3300049590 | Ga0501074_0010349 | Ga0501074_0010349_494_1159 | 221 |
| 408 | 3300049742 | Ga0501080_0008717 | Ga0501080_0008717_8006_8671 | 221 |
| 409 | 3300049742 | Ga0501080_0022269 | Ga0501080_0022269_1048_1713 | 221 |
| 410 | 3300049742 | Ga0501080_0236493 | Ga0501080_0236493_591_1262 | 221 |
| 411 | 3300049744 | Ga0501083_0181223 | Ga0501083_0181223_270_950 | 221 |
| 412 | 3300049744 | Ga0501083_0418990 | Ga0501083_0418990_82_747 | 221 |
| 413 | 3300049822 | Ga0501035_0004729 | Ga0501035_0004729_11082_11747 | 221 |
| 414 | 3300049823 | Ga0501044_0093602 | Ga0501044_0093602_691_1356 | 221 |
| 415 | 3300050490 | nmdc:mga03n38_59258_c1 | nmdc:mga03n38_59258_c1_873_1538 | 221 |
| 416 | 3300050491 | nmdc:mga00v17_149620_c1 | nmdc:mga00v17_149620_c1_551_1216 | 221 |
| 417 | 3300050492 | nmdc:mga0yw44_98989_c1 | nmdc:mga0yw44_98989_c1_615_1280 | 221 |
| 418 | 3300050495 | nmdc:mga04h51_121630_c1 | nmdc:mga04h51_121630_c1_49_714 | 221 |
| 419 | 3300050495 | nmdc:mga04h51_148960_c1 | nmdc:mga04h51_148960_c1_169_834 | 221 |
| 420 | 3300050510 | nmdc:mga06r32_349126_c1 | nmdc:mga06r32_349126_c1_199_864 | 221 |
| 421 | 3300050511 | nmdc:mga08y16_90408_c1 | nmdc:mga08y16_90408_c1_2360_3025 | 221 |
| 422 | 3300050516 | nmdc:mga0sz30_38510_c1 | nmdc:mga0sz30_38510_c1_345_1013 | 221 |
| 423 | 3300050516 | nmdc:mga0sz30_56787_c1 | nmdc:mga0sz30_56787_c1_565_1230 | 221 |
| 424 | 3300060353 | Ga0501082_0323962 | Ga0501082_0323962_500_1165 | 221 |
| 425 | 3300001976 | JGI24752J21851_1007459 | JGI24752J21851_10074592 | 222 |
| 426 | 3300001990 | JGI24737J22298_10012530 | JGI24737J22298_100125302 | 222 |
| 427 | 3300001991 | JGI24743J22301_10000134 | JGI24743J22301_100001346 | 222 |
| 428 | 3300002070 | JGI24750J21931_1000851 | JGI24750J21931_10008512 | 222 |
| 429 | 3300002073 | JGI24745J21846_1001252 | JGI24745J21846_10012522 | 222 |
| 430 | 3300002074 | JGI24748J21848_1001597 | JGI24748J21848_10015972 | 222 |
| 431 | 3300002076 | JGI24749J21850_1000509 | JGI24749J21850_10005095 | 222 |
| 432 | 3300002077 | JGI24744J21845_10002294 | JGI24744J21845_100022942 | 222 |
| 433 | 3300002239 | JGI24034J26672_10002367 | JGI24034J26672_100023672 | 222 |
| 434 | 3300002459 | JGI24751J29686_10001980 | JGI24751J29686_100019802 | 222 |
| 435 | 3300003215 | JGI25153J46596_10006534 | JGI25153J46596_100065343 | 222 |
| 436 | 3300005329 | Ga0070683_100269295 | Ga0070683_1002692952 | 222 |
| 437 | 3300005330 | Ga0070690_100028892 | Ga0070690_1000288923 | 222 |
| 438 | 3300005331 | Ga0070670_100013394 | Ga0070670_1000133945 | 222 |
| 439 | 3300005331 | Ga0070670_100020400 | Ga0070670_1000204002 | 222 |
| 440 | 3300005334 | Ga0068869_100028205 | Ga0068869_1000282052 | 222 |
| 441 | 3300005336 | Ga0070680_100002406 | Ga0070680_1000024064 | 222 |
| 442 | 3300005336 | Ga0070680_100343800 | Ga0070680_1003438002 | 222 |
| 443 | 3300005338 | Ga0068868_100007445 | Ga0068868_1000074455 | 222 |
| 444 | 3300005339 | Ga0070660_100222309 | Ga0070660_1002223092 | 222 |
| 445 | 3300005340 | Ga0070689_100075714 | Ga0070689_1000757143 | 222 |
| 446 | 3300005343 | Ga0070687_100001322 | Ga0070687_1000013228 | 222 |
| 447 | 3300005343 | Ga0070687_100079089 | Ga0070687_1000790892 | 222 |
| 448 | 3300005344 | Ga0070661_100077062 | Ga0070661_1000770623 | 222 |
| 449 | 3300005347 | Ga0070668_100012197 | Ga0070668_1000121972 | 222 |
| 450 | 3300005353 | Ga0070669_100065344 | Ga0070669_1000653443 | 222 |
| 451 | 3300005353 | Ga0070669_100086295 | Ga0070669_1000862952 | 222 |
| 452 | 3300005353 | Ga0070669_100331888 | Ga0070669_1003318882 | 222 |
| 453 | 3300005354 | Ga0070675_100035184 | Ga0070675_1000351843 | 222 |
| 454 | 3300005355 | Ga0070671_100013663 | Ga0070671_1000136633 | 222 |
| 455 | 3300005355 | Ga0070671_100162171 | Ga0070671_1001621712 | 222 |
| 456 | 3300005355 | Ga0070671_100497137 | Ga0070671_1004971372 | 222 |
| 457 | 3300005356 | Ga0070674_100002023 | Ga0070674_1000020232 | 222 |
| 458 | 3300005356 | Ga0070674_100413441 | Ga0070674_1004134412 | 222 |
| 459 | 3300005364 | Ga0070673_100012244 | Ga0070673_1000122443 | 222 |
| 460 | 3300005364 | Ga0070673_100078176 | Ga0070673_1000781762 | 222 |
| 461 | 3300005364 | Ga0070673_100081066 | Ga0070673_1000810662 | 222 |
| 462 | 3300005365 | Ga0070688_100006730 | Ga0070688_1000067305 | 222 |
| 463 | 3300005365 | Ga0070688_100020200 | Ga0070688_1000202003 | 222 |
| 464 | 3300005365 | Ga0070688_100044398 | Ga0070688_1000443982 | 222 |
| 465 | 3300005366 | Ga0070659_100311580 | Ga0070659_1003115802 | 222 |
| 466 | 3300005367 | Ga0070667_100006086 | Ga0070667_1000060865 | 222 |
| 467 | 3300005367 | Ga0070667_100084771 | Ga0070667_1000847712 | 222 |
| 468 | 3300005436 | Ga0070713_101169477 | Ga0070713_1011694771 | 222 |
| 469 | 3300005437 | Ga0070710_10018625 | Ga0070710_100186253 | 222 |
| 470 | 3300005438 | Ga0070701_10000544 | Ga0070701_100005448 | 222 |
| 471 | 3300005439 | Ga0070711_100179886 | Ga0070711_1001798862 | 222 |
| 472 | 3300005439 | Ga0070711_100477130 | Ga0070711_1004771301 | 222 |
| 473 | 3300005441 | Ga0070700_100014905 | Ga0070700_1000149053 | 222 |
| 474 | 3300005455 | Ga0070663_100522804 | Ga0070663_1005228041 | 222 |
| 475 | 3300005456 | Ga0070678_100033394 | Ga0070678_1000333942 | 222 |
| 476 | 3300005456 | Ga0070678_100042057 | Ga0070678_1000420572 | 222 |
| 477 | 3300005456 | Ga0070678_100065144 | Ga0070678_1000651441 | 222 |
| 478 | 3300005458 | Ga0070681_10036642 | Ga0070681_100366423 | 222 |
| 479 | 3300005459 | Ga0068867_100006600 | Ga0068867_1000066005 | 222 |
| 480 | 3300005459 | Ga0068867_100112569 | Ga0068867_1001125692 | 222 |
| 481 | 3300005466 | Ga0070685_10001171 | Ga0070685_1000117110 | 222 |
| 482 | 3300005471 | Ga0070698_100407018 | Ga0070698_1004070181 | 222 |
| 483 | 3300005530 | Ga0070679_100010449 | Ga0070679_1000104495 | 222 |
| 484 | 3300005535 | Ga0070684_100111632 | Ga0070684_1001116321 | 222 |
| 485 | 3300005539 | Ga0068853_100028508 | Ga0068853_1000285084 | 222 |
| 486 | 3300005543 | Ga0070672_100007959 | Ga0070672_1000079592 | 222 |
| 487 | 3300005544 | Ga0070686_100242105 | Ga0070686_1002421052 | 222 |
| 488 | 3300005544 | Ga0070686_100615599 | Ga0070686_1006155991 | 222 |
| 489 | 3300005548 | Ga0070665_100031361 | Ga0070665_1000313615 | 222 |
| 490 | 3300005549 | Ga0070704_100081333 | Ga0070704_1000813332 | 222 |
| 491 | 3300005549 | Ga0070704_100103455 | Ga0070704_1001034553 | 222 |
| 492 | 3300005563 | Ga0068855_100144161 | Ga0068855_1001441613 | 222 |
| 493 | 3300005564 | Ga0070664_100051607 | Ga0070664_1000516074 | 222 |
| 494 | 3300005578 | Ga0068854_100103200 | Ga0068854_1001032002 | 222 |
| 495 | 3300005614 | Ga0068856_100110413 | Ga0068856_1001104132 | 222 |
| 496 | 3300005615 | Ga0070702_100036072 | Ga0070702_1000360722 | 222 |
| 497 | 3300005615 | Ga0070702_100218091 | Ga0070702_1002180912 | 222 |
| 498 | 3300005615 | Ga0070702_100259079 | Ga0070702_1002590792 | 222 |
| 499 | 3300005615 | Ga0070702_100346934 | Ga0070702_1003469342 | 222 |
| 500 | 3300005617 | Ga0068859_100149112 | Ga0068859_1001491122 | 222 |
| 501 | 3300005617 | Ga0068859_100193521 | Ga0068859_1001935212 | 222 |
| 502 | 3300005618 | Ga0068864_100397581 | Ga0068864_1003975812 | 222 |
| 503 | 3300005840 | Ga0068870_10005222 | Ga0068870_100052225 | 222 |
| 504 | 3300005841 | Ga0068863_100007012 | Ga0068863_10000701210 | 222 |
| 505 | 3300005841 | Ga0068863_100155966 | Ga0068863_1001559662 | 222 |
| 506 | 3300005841 | Ga0068863_100500957 | Ga0068863_1005009571 | 222 |
| 507 | 3300005842 | Ga0068858_100016071 | Ga0068858_1000160714 | 222 |
| 508 | 3300005842 | Ga0068858_100383926 | Ga0068858_1003839262 | 222 |
| 509 | 3300005843 | Ga0068860_100040442 | Ga0068860_1000404424 | 222 |
| 510 | 3300005844 | Ga0068862_100011484 | Ga0068862_1000114845 | 222 |
| 511 | 3300005844 | Ga0068862_100840405 | Ga0068862_1008404052 | 222 |
| 512 | 3300005844 | Ga0068862_101167701 | Ga0068862_1011677011 | 222 |
| 513 | 3300005937 | Ga0081455_10010899 | Ga0081455_100108999 | 222 |
| 514 | 3300005937 | Ga0081455_10033604 | Ga0081455_100336044 | 222 |
| 515 | 3300005937 | Ga0081455_10469817 | Ga0081455_104698171 | 222 |
| 516 | 3300005981 | Ga0081538_10029065 | Ga0081538_100290653 | 222 |
| 517 | 3300005981 | Ga0081538_10034984 | Ga0081538_100349843 | 222 |
| 518 | 3300005981 | Ga0081538_10078950 | Ga0081538_100789502 | 222 |
| 519 | 3300006028 | Ga0070717_10022811 | Ga0070717_100228114 | 222 |
| 520 | 3300006028 | Ga0070717_10057188 | Ga0070717_100571883 | 222 |
| 521 | 3300006028 | Ga0070717_10167415 | Ga0070717_101674152 | 222 |
| 522 | 3300006028 | Ga0070717_10310901 | Ga0070717_103109012 | 222 |
| 523 | 3300006038 | Ga0075365_10001017 | Ga0075365_100010173 | 222 |
| 524 | 3300006038 | Ga0075365_10007361 | Ga0075365_100073612 | 222 |
| 525 | 3300006038 | Ga0075365_10026251 | Ga0075365_100262512 | 222 |
| 526 | 3300006038 | Ga0075365_10041020 | Ga0075365_100410202 | 222 |
| 527 | 3300006038 | Ga0075365_10141855 | Ga0075365_101418552 | 222 |
| 528 | 3300006048 | Ga0075363_100151318 | Ga0075363_1001513182 | 222 |
| 529 | 3300006051 | Ga0075364_10033452 | Ga0075364_100334522 | 222 |
| 530 | 3300006163 | Ga0070715_10127066 | Ga0070715_101270661 | 222 |
| 531 | 3300006175 | Ga0070712_100004847 | Ga0070712_10000484710 | 222 |
| 532 | 3300006175 | Ga0070712_100088621 | Ga0070712_1000886212 | 222 |
| 533 | 3300006177 | Ga0075362_10013531 | Ga0075362_100135312 | 222 |
| 534 | 3300006177 | Ga0075362_10051552 | Ga0075362_100515522 | 222 |
| 535 | 3300006178 | Ga0075367_10047397 | Ga0075367_100473972 | 222 |
| 536 | 3300006178 | Ga0075367_10305587 | Ga0075367_103055872 | 222 |
| 537 | 3300006195 | Ga0075366_10008616 | Ga0075366_100086163 | 222 |
| 538 | 3300006195 | Ga0075366_10013786 | Ga0075366_100137865 | 222 |
| 539 | 3300006195 | Ga0075366_10036925 | Ga0075366_100369253 | 222 |
| 540 | 3300006353 | Ga0075370_10027696 | Ga0075370_100276962 | 222 |
| 541 | 3300006353 | Ga0075370_10099290 | Ga0075370_100992902 | 222 |
| 542 | 3300006358 | Ga0068871_100067335 | Ga0068871_1000673352 | 222 |
| 543 | 3300006358 | Ga0068871_100113778 | Ga0068871_1001137782 | 222 |
| 544 | 3300006844 | Ga0075428_100001218 | Ga0075428_10000121811 | 222 |
| 545 | 3300006844 | Ga0075428_100022676 | Ga0075428_1000226766 | 222 |
| 546 | 3300006844 | Ga0075428_100573027 | Ga0075428_1005730272 | 222 |
| 547 | 3300006844 | Ga0075428_100624086 | Ga0075428_1006240862 | 222 |
| 548 | 3300006846 | Ga0075430_100000152 | Ga0075430_10000015238 | 222 |
| 549 | 3300006846 | Ga0075430_100025527 | Ga0075430_1000255275 | 222 |
| 550 | 3300006846 | Ga0075430_100045037 | Ga0075430_1000450372 | 222 |
| 551 | 3300006846 | Ga0075430_100198426 | Ga0075430_1001984262 | 222 |
| 552 | 3300006847 | Ga0075431_100000613 | Ga0075431_10000061314 | 222 |
| 553 | 3300006847 | Ga0075431_100010947 | Ga0075431_1000109474 | 222 |
| 554 | 3300006847 | Ga0075431_100062491 | Ga0075431_1000624911 | 222 |
| 555 | 3300006847 | Ga0075431_100582744 | Ga0075431_1005827442 | 222 |
| 556 | 3300006847 | Ga0075431_101208336 | Ga0075431_1012083361 | 222 |
| 557 | 3300006852 | Ga0075433_10059850 | Ga0075433_100598503 | 222 |
| 558 | 3300006871 | Ga0075434_100017361 | Ga0075434_1000173614 | 222 |
| 559 | 3300006871 | Ga0075434_100056047 | Ga0075434_1000560474 | 222 |
| 560 | 3300006871 | Ga0075434_100269646 | Ga0075434_1002696461 | 222 |
| 561 | 3300006880 | Ga0075429_100004424 | Ga0075429_1000044244 | 222 |
| 562 | 3300006880 | Ga0075429_100274586 | Ga0075429_1002745862 | 222 |
| 563 | 3300006880 | Ga0075429_100429975 | Ga0075429_1004299752 | 222 |
| 564 | 3300006881 | Ga0068865_100098503 | Ga0068865_1000985033 | 222 |
| 565 | 3300006881 | Ga0068865_100403720 | Ga0068865_1004037202 | 222 |
| 566 | 3300006914 | Ga0075436_100028761 | Ga0075436_1000287611 | 222 |
| 567 | 3300006914 | Ga0075436_100520032 | Ga0075436_1005200321 | 222 |
| 568 | 3300006931 | Ga0097620_100149123 | Ga0097620_1001491232 | 222 |
| 569 | 3300006931 | Ga0097620_100193536 | Ga0097620_1001935362 | 222 |
| 570 | 3300007076 | Ga0075435_100079110 | Ga0075435_1000791102 | 222 |
| 571 | 3300007265 | Ga0099794_10089867 | Ga0099794_100898672 | 222 |
| 572 | 3300007788 | Ga0099795_10001007 | Ga0099795_100010074 | 222 |
| 573 | 3300007788 | Ga0099795_10025722 | Ga0099795_100257221 | 222 |
| 574 | 3300009011 | Ga0105251_10054542 | Ga0105251_100545421 | 222 |
| 575 | 3300009094 | Ga0111539_10000840 | Ga0111539_1000084013 | 222 |
| 576 | 3300009094 | Ga0111539_10044534 | Ga0111539_100445342 | 222 |
| 577 | 3300009094 | Ga0111539_10089489 | Ga0111539_100894893 | 222 |
| 578 | 3300009094 | Ga0111539_10168821 | Ga0111539_101688212 | 222 |
| 579 | 3300009094 | Ga0111539_10241880 | Ga0111539_102418802 | 222 |
| 580 | 3300009098 | Ga0105245_10028096 | Ga0105245_100280963 | 222 |
| 581 | 3300009098 | Ga0105245_10201889 | Ga0105245_102018892 | 222 |
| 582 | 3300009101 | Ga0105247_10110832 | Ga0105247_101108322 | 222 |
| 583 | 3300009101 | Ga0105247_10228451 | Ga0105247_102284512 | 222 |
| 584 | 3300009147 | Ga0114129_10000320 | Ga0114129_1000032046 | 222 |
| 585 | 3300009147 | Ga0114129_10002097 | Ga0114129_100020978 | 222 |
| 586 | 3300009147 | Ga0114129_10051669 | Ga0114129_100516696 | 222 |
| 587 | 3300009147 | Ga0114129_10061592 | Ga0114129_100615922 | 222 |
| 588 | 3300009147 | Ga0114129_11430534 | Ga0114129_114305341 | 222 |
| 589 | 3300009148 | Ga0105243_10023744 | Ga0105243_100237444 | 222 |
| 590 | 3300009148 | Ga0105243_10221733 | Ga0105243_102217332 | 222 |
| 591 | 3300009174 | Ga0105241_10075452 | Ga0105241_100754522 | 222 |
| 592 | 3300009174 | Ga0105241_10639123 | Ga0105241_106391232 | 222 |
| 593 | 3300009176 | Ga0105242_10102353 | Ga0105242_101023532 | 222 |
| 594 | 3300009176 | Ga0105242_10390973 | Ga0105242_103909732 | 222 |
| 595 | 3300009177 | Ga0105248_10039516 | Ga0105248_100395165 | 222 |
| 596 | 3300009177 | Ga0105248_10629824 | Ga0105248_106298241 | 222 |
| 597 | 3300009551 | Ga0105238_10080512 | Ga0105238_100805122 | 222 |
| 598 | 3300009551 | Ga0105238_10855019 | Ga0105238_108550192 | 222 |
| 599 | 3300010159 | Ga0099796_10006006 | Ga0099796_100060062 | 222 |
| 600 | 3300010159 | Ga0099796_10043499 | Ga0099796_100434992 | 222 |
| 601 | 3300010159 | Ga0099796_10048748 | Ga0099796_100487481 | 222 |
| 602 | 3300011119 | Ga0105246_10076930 | Ga0105246_100769302 | 222 |
| 603 | 3300011119 | Ga0105246_10103701 | Ga0105246_101037012 | 222 |
| 604 | 3300011119 | Ga0105246_10241714 | Ga0105246_102417142 | 222 |
| 605 | 3300013296 | Ga0157374_10144995 | Ga0157374_101449952 | 222 |
| 606 | 3300013297 | Ga0157378_10430782 | Ga0157378_104307822 | 222 |
| 607 | 3300013306 | Ga0163162_10090461 | Ga0163162_100904612 | 222 |
| 608 | 3300013306 | Ga0163162_10736081 | Ga0163162_107360811 | 222 |
| 609 | 3300013308 | Ga0157375_10369079 | Ga0157375_103690792 | 222 |
| 610 | 3300014325 | Ga0163163_10039625 | Ga0163163_100396254 | 222 |
| 611 | 3300014325 | Ga0163163_10623628 | Ga0163163_106236282 | 222 |
| 612 | 3300014326 | Ga0157380_10084701 | Ga0157380_100847012 | 222 |
| 613 | 3300014326 | Ga0157380_10137661 | Ga0157380_101376612 | 222 |
| 614 | 3300014745 | Ga0157377_10005862 | Ga0157377_100058625 | 222 |
| 615 | 3300014968 | Ga0157379_10056034 | Ga0157379_100560342 | 222 |
| 616 | 3300014968 | Ga0157379_10144281 | Ga0157379_101442812 | 222 |
| 617 | 3300014969 | Ga0157376_10111300 | Ga0157376_101113003 | 222 |
| 618 | 3300014969 | Ga0157376_10571090 | Ga0157376_105710902 | 222 |
| 619 | 3300017792 | Ga0163161_10009501 | Ga0163161_100095014 | 222 |
| 620 | 3300024225 | Ga0224572_1001576 | Ga0224572_10015762 | 222 |
| 621 | 3300025297 | Ga0209758_1001730 | Ga0209758_10017303 | 222 |
| 622 | 3300025898 | Ga0207692_10029373 | Ga0207692_100293732 | 222 |
| 623 | 3300025899 | Ga0207642_10000663 | Ga0207642_100006634 | 222 |
| 624 | 3300025899 | Ga0207642_10138146 | Ga0207642_101381462 | 222 |
| 625 | 3300025900 | Ga0207710_10023256 | Ga0207710_100232562 | 222 |
| 626 | 3300025901 | Ga0207688_10000130 | Ga0207688_1000013023 | 222 |
| 627 | 3300025901 | Ga0207688_10068808 | Ga0207688_100688083 | 222 |
| 628 | 3300025901 | Ga0207688_10273334 | Ga0207688_102733342 | 222 |
| 629 | 3300025904 | Ga0207647_10002385 | Ga0207647_1000238515 | 222 |
| 630 | 3300025907 | Ga0207645_10049854 | Ga0207645_100498543 | 222 |
| 631 | 3300025908 | Ga0207643_10001981 | Ga0207643_100019812 | 222 |
| 632 | 3300025909 | Ga0207705_10315453 | Ga0207705_103154532 | 222 |
| 633 | 3300025912 | Ga0207707_10121547 | Ga0207707_101215472 | 222 |
| 634 | 3300025915 | Ga0207693_10004368 | Ga0207693_100043688 | 222 |
| 635 | 3300025915 | Ga0207693_10062706 | Ga0207693_100627063 | 222 |
| 636 | 3300025915 | Ga0207693_10080870 | Ga0207693_100808702 | 222 |
| 637 | 3300025915 | Ga0207693_10253175 | Ga0207693_102531752 | 222 |
| 638 | 3300025916 | Ga0207663_10046371 | Ga0207663_100463711 | 222 |
| 639 | 3300025917 | Ga0207660_10174649 | Ga0207660_101746492 | 222 |
| 640 | 3300025917 | Ga0207660_10294967 | Ga0207660_102949672 | 222 |
| 641 | 3300025918 | Ga0207662_10147737 | Ga0207662_101477372 | 222 |
| 642 | 3300025919 | Ga0207657_10032651 | Ga0207657_100326513 | 222 |
| 643 | 3300025921 | Ga0207652_10102515 | Ga0207652_101025152 | 222 |
| 644 | 3300025923 | Ga0207681_10054305 | Ga0207681_100543052 | 222 |
| 645 | 3300025924 | Ga0207694_10127645 | Ga0207694_101276452 | 222 |
| 646 | 3300025925 | Ga0207650_10004418 | Ga0207650_100044181 | 222 |
| 647 | 3300025925 | Ga0207650_10014049 | Ga0207650_100140493 | 222 |
| 648 | 3300025925 | Ga0207650_10025768 | Ga0207650_100257682 | 222 |
| 649 | 3300025926 | Ga0207659_10012143 | Ga0207659_100121436 | 222 |
| 650 | 3300025926 | Ga0207659_10066708 | Ga0207659_100667081 | 222 |
| 651 | 3300025926 | Ga0207659_10099922 | Ga0207659_100999222 | 222 |
| 652 | 3300025927 | Ga0207687_10005289 | Ga0207687_100052898 | 222 |
| 653 | 3300025927 | Ga0207687_10061597 | Ga0207687_100615973 | 222 |
| 654 | 3300025928 | Ga0207700_10058615 | Ga0207700_100586152 | 222 |
| 655 | 3300025928 | Ga0207700_10084407 | Ga0207700_100844072 | 222 |
| 656 | 3300025928 | Ga0207700_10452787 | Ga0207700_104527872 | 222 |
| 657 | 3300025928 | Ga0207700_10977642 | Ga0207700_109776421 | 222 |
| 658 | 3300025929 | Ga0207664_10156957 | Ga0207664_101569572 | 222 |
| 659 | 3300025929 | Ga0207664_10182416 | Ga0207664_101824162 | 222 |
| 660 | 3300025931 | Ga0207644_10006827 | Ga0207644_100068272 | 222 |
| 661 | 3300025931 | Ga0207644_10025164 | Ga0207644_100251643 | 222 |
| 662 | 3300025931 | Ga0207644_10102456 | Ga0207644_101024561 | 222 |
| 663 | 3300025933 | Ga0207706_10002801 | Ga0207706_100028013 | 222 |
| 664 | 3300025934 | Ga0207686_10054100 | Ga0207686_100541002 | 222 |
| 665 | 3300025935 | Ga0207709_10015455 | Ga0207709_100154554 | 222 |
| 666 | 3300025935 | Ga0207709_10177333 | Ga0207709_101773332 | 222 |
| 667 | 3300025936 | Ga0207670_10021754 | Ga0207670_100217544 | 222 |
| 668 | 3300025936 | Ga0207670_10052934 | Ga0207670_100529342 | 222 |
| 669 | 3300025936 | Ga0207670_10076670 | Ga0207670_100766702 | 222 |
| 670 | 3300025936 | Ga0207670_10305155 | Ga0207670_103051552 | 222 |
| 671 | 3300025937 | Ga0207669_10007567 | Ga0207669_100075672 | 222 |
| 672 | 3300025938 | Ga0207704_10196064 | Ga0207704_101960642 | 222 |
| 673 | 3300025939 | Ga0207665_10281471 | Ga0207665_102814712 | 222 |
| 674 | 3300025940 | Ga0207691_10011407 | Ga0207691_100114075 | 222 |
| 675 | 3300025940 | Ga0207691_10540575 | Ga0207691_105405752 | 222 |
| 676 | 3300025941 | Ga0207711_10016266 | Ga0207711_100162663 | 222 |
| 677 | 3300025941 | Ga0207711_10090712 | Ga0207711_100907122 | 222 |
| 678 | 3300025942 | Ga0207689_10000756 | Ga0207689_1000075622 | 222 |
| 679 | 3300025945 | Ga0207679_10024806 | Ga0207679_100248063 | 222 |
| 680 | 3300025960 | Ga0207651_10003263 | Ga0207651_100032633 | 222 |
| 681 | 3300025960 | Ga0207651_10007290 | Ga0207651_100072902 | 222 |
| 682 | 3300025960 | Ga0207651_10072681 | Ga0207651_100726813 | 222 |
| 683 | 3300025960 | Ga0207651_10799889 | Ga0207651_107998891 | 222 |
| 684 | 3300025961 | Ga0207712_10017551 | Ga0207712_100175514 | 222 |
| 685 | 3300025972 | Ga0207668_10028885 | Ga0207668_100288852 | 222 |
| 686 | 3300025972 | Ga0207668_10485434 | Ga0207668_104854342 | 222 |
| 687 | 3300025972 | Ga0207668_10767144 | Ga0207668_107671441 | 222 |
| 688 | 3300025981 | Ga0207640_10015569 | Ga0207640_100155694 | 222 |
| 689 | 3300026023 | Ga0207677_10006114 | Ga0207677_100061144 | 222 |
| 690 | 3300026035 | Ga0207703_10011569 | Ga0207703_100115696 | 222 |
| 691 | 3300026035 | Ga0207703_10783315 | Ga0207703_107833152 | 222 |
| 692 | 3300026067 | Ga0207678_10042400 | Ga0207678_100424002 | 222 |
| 693 | 3300026075 | Ga0207708_10004345 | Ga0207708_100043452 | 222 |
| 694 | 3300026088 | Ga0207641_10058535 | Ga0207641_100585354 | 222 |
| 695 | 3300026088 | Ga0207641_10162421 | Ga0207641_101624212 | 222 |
| 696 | 3300026088 | Ga0207641_10991663 | Ga0207641_109916631 | 222 |
| 697 | 3300026089 | Ga0207648_10009209 | Ga0207648_100092094 | 222 |
| 698 | 3300026089 | Ga0207648_10060490 | Ga0207648_100604903 | 222 |
| 699 | 3300026095 | Ga0207676_10007771 | Ga0207676_100077716 | 222 |
| 700 | 3300026095 | Ga0207676_10132024 | Ga0207676_101320242 | 222 |
| 701 | 3300026118 | Ga0207675_100004438 | Ga0207675_1000044383 | 222 |
| 702 | 3300026121 | Ga0207683_10015749 | Ga0207683_100157492 | 222 |
| 703 | 3300026121 | Ga0207683_10049872 | Ga0207683_100498723 | 222 |
| 704 | 3300026121 | Ga0207683_10090523 | Ga0207683_100905232 | 222 |
| 705 | 3300026121 | Ga0207683_10572721 | Ga0207683_105727212 | 222 |
| 706 | 3300026142 | Ga0207698_10115378 | Ga0207698_101153782 | 222 |
| 707 | 3300027866 | Ga0209813_10005872 | Ga0209813_100058722 | 222 |
| 708 | 3300027907 | Ga0207428_10017604 | Ga0207428_100176044 | 222 |
| 709 | 3300027907 | Ga0207428_10066313 | Ga0207428_100663133 | 222 |
| 710 | 3300027907 | Ga0207428_10123330 | Ga0207428_101233301 | 222 |
| 711 | 3300028379 | Ga0268266_10209882 | Ga0268266_102098822 | 222 |
| 712 | 3300028380 | Ga0268265_10015994 | Ga0268265_100159942 | 222 |
| 713 | 3300028381 | Ga0268264_10244109 | Ga0268264_102441092 | 222 |
| 714 | 3300028381 | Ga0268264_10733889 | Ga0268264_107338892 | 222 |
| 715 | 3300030760 | Ga0265762_1004526 | Ga0265762_10045262 | 222 |
| 716 | 3300030763 | Ga0265763_1001918 | Ga0265763_10019182 | 222 |
| 717 | 3300031548 | Ga0307408_100242164 | Ga0307408_1002421642 | 222 |
| 718 | 3300035083 | Ga0373926_0006659 | Ga0373926_0006659_1798_2472 | 222 |
| 719 | 3300035085 | Ga0373929_0010236 | Ga0373929_0010236_495_1163 | 222 |
| 720 | 3300035088 | Ga0373940_0007997 | Ga0373940_0007997_455_1123 | 222 |
| 721 | 3300035089 | Ga0373944_0001173 | Ga0373944_0001173_3262_3936 | 222 |
| 722 | 3300035111 | Ga0373923_0002035 | Ga0373923_0002035_2252_2920 | 222 |
| 723 | 3300035113 | Ga0373936_0001796 | Ga0373936_0001796_639_1307 | 222 |
| 724 | 3300035113 | Ga0373936_0047960 | Ga0373936_0047960_560_1228 | 222 |
| 725 | 3300035116 | Ga0373945_0005121 | Ga0373945_0005121_2709_3377 | 222 |
| 726 | 3300035116 | Ga0373945_0007492 | Ga0373945_0007492_889_1563 | 222 |
| 727 | 3300035116 | Ga0373945_0007797 | Ga0373945_0007797_1040_1714 | 222 |
| 728 | 3300035117 | Ga0373953_0032305 | Ga0373953_0032305_523_1191 | 222 |
| 729 | 3300035119 | Ga0373956_0012955 | Ga0373956_0012955_490_1158 | 222 |
| 730 | 3300035119 | Ga0373956_0037590 | Ga0373956_0037590_516_1184 | 222 |
| 731 | 3300035170 | Ga0373943_0000381 | Ga0373943_0000381_14208_14882 | 222 |
| 732 | 3300035170 | Ga0373943_0015098 | Ga0373943_0015098_736_1404 | 222 |
| 733 | 3300035170 | Ga0373943_0031493 | Ga0373943_0031493_1084_1752 | 222 |
| 734 | 3300035170 | Ga0373943_0077253 | Ga0373943_0077253_646_1314 | 222 |
| 735 | 3300035170 | Ga0373943_0224374 | Ga0373943_0224374_262_936 | 222 |
| 736 | 3300035171 | Ga0373946_0002070 | Ga0373946_0002070_1240_1908 | 222 |
| 737 | 3300035171 | Ga0373946_0036439 | Ga0373946_0036439_365_1099 | 222 |
| 738 | 3300035171 | Ga0373946_0052451 | Ga0373946_0052451_875_1549 | 222 |
| 739 | 3300035172 | Ga0373955_0002179 | Ga0373955_0002179_2000_2668 | 222 |
| 740 | 3300035172 | Ga0373955_0007537 | Ga0373955_0007537_191_859 | 222 |
| 741 | 3300035242 | Ga0373962_0041982 | Ga0373962_0041982_604_1272 | 222 |
| 742 | 3300035410 | Ga0373924_0015268 | Ga0373924_0015268_1678_2346 | 222 |
| 743 | 3300035410 | Ga0373924_0031708 | Ga0373924_0031708_781_1515 | 222 |
| 744 | 3300035410 | Ga0373924_0102603 | Ga0373924_0102603_496_1164 | 222 |
| 745 | 3300035691 | Ga0373931_0086002 | Ga0373931_0086002_348_1016 | 222 |
| 746 | 3300035692 | Ga0373935_0000006 | Ga0373935_0000006_27358_28026 | 222 |
| 747 | 3300035692 | Ga0373935_0049660 | Ga0373935_0049660_1458_2132 | 222 |
| 748 | 3300035692 | Ga0373935_0053179 | Ga0373935_0053179_454_1122 | 222 |
| 749 | 3300035692 | Ga0373935_0105630 | Ga0373935_0105630_566_1234 | 222 |
| 750 | 3300035692 | Ga0373935_0170453 | Ga0373935_0170453_630_1298 | 222 |
| 751 | 3300035695 | Ga0373927_0003706 | Ga0373927_0003706_7560_8234 | 222 |
| 752 | 3300035695 | Ga0373927_0013209 | Ga0373927_0013209_4664_5338 | 222 |
| 753 | 3300035695 | Ga0373927_0015339 | Ga0373927_0015339_1992_2660 | 222 |
| 754 | 3300035695 | Ga0373927_0015712 | Ga0373927_0015712_3137_3805 | 222 |
| 755 | 3300035695 | Ga0373927_0018500 | Ga0373927_0018500_216_884 | 222 |
| 756 | 3300035695 | Ga0373927_0171463 | Ga0373927_0171463_595_1263 | 222 |
| 757 | 3300035695 | Ga0373927_0238671 | Ga0373927_0238671_385_1053 | 222 |
| 758 | 3300035695 | Ga0373927_0547269 | Ga0373927_0547269_25_693 | 222 |
| 759 | 3300035724 | Ga0373933_0004171 | Ga0373933_0004171_1176_1844 | 222 |
| 760 | 3300035725 | Ga0373947_0000419 | Ga0373947_0000419_20650_21324 | 222 |
| 761 | 3300035725 | Ga0373947_0003146 | Ga0373947_0003146_5657_6331 | 222 |
| 762 | 3300035725 | Ga0373947_0006728 | Ga0373947_0006728_3021_3689 | 222 |
| 763 | 3300035725 | Ga0373947_0019872 | Ga0373947_0019872_2071_2739 | 222 |
| 764 | 3300035725 | Ga0373947_0033265 | Ga0373947_0033265_1175_1843 | 222 |
| 765 | 3300035725 | Ga0373947_0105033 | Ga0373947_0105033_285_953 | 222 |
| 766 | 3300035725 | Ga0373947_0139717 | Ga0373947_0139717_689_1357 | 222 |
| 767 | 3300036401 | Ga0373937_0000124 | Ga0373937_0000124_5856_6524 | 222 |
| 768 | 3300036401 | Ga0373937_0018439 | Ga0373937_0018439_617_1285 | 222 |
| 769 | 3300036401 | Ga0373937_0025281 | Ga0373937_0025281_1736_2470 | 222 |
| 770 | 3300037068 | Ga0373925_0000210 | Ga0373925_0000210_39554_40222 | 222 |
| 771 | 3300037068 | Ga0373925_0006086 | Ga0373925_0006086_5603_6277 | 222 |
| 772 | 3300037068 | Ga0373925_0026431 | Ga0373925_0026431_1053_1721 | 222 |
| 773 | 3300037068 | Ga0373925_0032271 | Ga0373925_0032271_1362_2036 | 222 |
| 774 | 3300037068 | Ga0373925_0083949 | Ga0373925_0083949_1571_2239 | 222 |
| 775 | 3300037068 | Ga0373925_0284217 | Ga0373925_0284217_72_740 | 222 |
| 776 | 3300039437 | Ga0436365_1370429 | Ga0436365_1370429_93_761 | 222 |
| 777 | 3300041486 | Ga0451807_2166610 | Ga0451807_2166610_182_850 | 222 |
| 778 | 3300042013 | Ga0439456_078854 | Ga0439456_078854_56_724 | 222 |
| 779 | 3300044712 | Ga0453684_1220544 | Ga0453684_1220544_57_725 | 222 |
| 780 | 3300046452 | Ga0495617_078930 | Ga0495617_078930_337_1005 | 222 |
| 781 | 3300046454 | Ga0495592_0000020 | Ga0495592_0000020_72533_73201 | 222 |
| 782 | 3300046454 | Ga0495592_0026318 | Ga0495592_0026318_814_1482 | 222 |
| 783 | 3300046454 | Ga0495592_0034109 | Ga0495592_0034109_2871_3605 | 222 |
| 784 | 3300046454 | Ga0495592_0095454 | Ga0495592_0095454_445_1119 | 222 |
| 785 | 3300046459 | Ga0495629_0006124 | Ga0495629_0006124_1159_1827 | 222 |
| 786 | 3300046459 | Ga0495629_0008249 | Ga0495629_0008249_5456_6124 | 222 |
| 787 | 3300046459 | Ga0495629_0044612 | Ga0495629_0044612_1412_2086 | 222 |
| 788 | 3300046459 | Ga0495629_0258401 | Ga0495629_0258401_137_871 | 222 |
| 789 | 3300046459 | Ga0495629_0444729 | Ga0495629_0444729_62_730 | 222 |
| 790 | 3300046462 | Ga0495651_0000282 | Ga0495651_0000282_35427_36095 | 222 |
| 791 | 3300046462 | Ga0495651_0001410 | Ga0495651_0001410_6618_7286 | 222 |
| 792 | 3300046463 | Ga0495653_0000046 | Ga0495653_0000046_67597_68265 | 222 |
| 793 | 3300046463 | Ga0495653_0001155 | Ga0495653_0001155_5516_6184 | 222 |
| 794 | 3300046463 | Ga0495653_0092433 | Ga0495653_0092433_607_1281 | 222 |
| 795 | 3300046472 | Ga0495580_0147371 | Ga0495580_0147371_422_1096 | 222 |
| 796 | 3300046473 | Ga0495582_0059585 | Ga0495582_0059585_38_772 | 222 |
| 797 | 3300046473 | Ga0495582_0096554 | Ga0495582_0096554_461_1129 | 222 |
| 798 | 3300046475 | Ga0495639_0133006 | Ga0495639_0133006_370_1038 | 222 |
| 799 | 3300046475 | Ga0495639_0146341 | Ga0495639_0146341_309_977 | 222 |
| 800 | 3300046475 | Ga0495639_0307503 | Ga0495639_0307503_32_700 | 222 |
| 801 | 3300046476 | Ga0495662_0001018 | Ga0495662_0001018_8900_9574 | 222 |
| 802 | 3300046476 | Ga0495662_0130074 | Ga0495662_0130074_405_1073 | 222 |
| 803 | 3300046476 | Ga0495662_0139554 | Ga0495662_0139554_423_1091 | 222 |
| 804 | 3300046477 | Ga0495664_0000017 | Ga0495664_0000017_67538_68206 | 222 |
| 805 | 3300046477 | Ga0495664_0000670 | Ga0495664_0000670_13427_14101 | 222 |
| 806 | 3300046477 | Ga0495664_0064886 | Ga0495664_0064886_739_1407 | 222 |
| 807 | 3300046491 | Ga0495584_0032467 | Ga0495584_0032467_553_1344 | 222 |
| 808 | 3300046491 | Ga0495584_0187068 | Ga0495584_0187068_188_856 | 222 |
| 809 | 3300046501 | Ga0495607_0104439 | Ga0495607_0104439_521_1312 | 222 |
| 810 | 3300046501 | Ga0495607_0233215 | Ga0495607_0233215_39_707 | 222 |
| 811 | 3300046511 | Ga0495608_0000250 | Ga0495608_0000250_26806_27474 | 222 |
| 812 | 3300046511 | Ga0495608_0010843 | Ga0495608_0010843_858_1526 | 222 |
| 813 | 3300046511 | Ga0495608_0081432 | Ga0495608_0081432_839_1573 | 222 |
| 814 | 3300046513 | Ga0495616_0071391 | Ga0495616_0071391_340_1131 | 222 |
| 815 | 3300046513 | Ga0495616_0191170 | Ga0495616_0191170_197_865 | 222 |
| 816 | 3300046514 | Ga0495618_0000059 | Ga0495618_0000059_67519_68187 | 222 |
| 817 | 3300046514 | Ga0495618_0002157 | Ga0495618_0002157_5592_6266 | 222 |
| 818 | 3300046514 | Ga0495618_0002703 | Ga0495618_0002703_6193_6861 | 222 |
| 819 | 3300046514 | Ga0495618_0237435 | Ga0495618_0237435_46_720 | 222 |
| 820 | 3300046516 | Ga0495628_0000022 | Ga0495628_0000022_40684_41352 | 222 |
| 821 | 3300046516 | Ga0495628_0015475 | Ga0495628_0015475_4167_4835 | 222 |
| 822 | 3300046516 | Ga0495628_0056961 | Ga0495628_0056961_33_701 | 222 |
| 823 | 3300046516 | Ga0495628_0245684 | Ga0495628_0245684_506_1240 | 222 |
| 824 | 3300046517 | Ga0495630_0000758 | Ga0495630_0000758_11617_12285 | 222 |
| 825 | 3300046517 | Ga0495630_0011807 | Ga0495630_0011807_750_1424 | 222 |
| 826 | 3300046517 | Ga0495630_0104242 | Ga0495630_0104242_44_712 | 222 |
| 827 | 3300046517 | Ga0495630_0310229 | Ga0495630_0310229_143_811 | 222 |
| 828 | 3300046517 | Ga0495630_0347433 | Ga0495630_0347433_194_862 | 222 |
| 829 | 3300046520 | Ga0495637_0135961 | Ga0495637_0135961_165_833 | 222 |
| 830 | 3300046522 | Ga0495643_0215295 | Ga0495643_0215295_138_806 | 222 |
| 831 | 3300046523 | Ga0495644_0095070 | Ga0495644_0095070_144_935 | 222 |
| 832 | 3300046525 | Ga0495663_0063692 | Ga0495663_0063692_449_1117 | 222 |
| 833 | 3300046526 | Ga0495666_0114782 | Ga0495666_0114782_420_1094 | 222 |
| 834 | 3300046526 | Ga0495666_0204169 | Ga0495666_0204169_164_832 | 222 |
| 835 | 3300046529 | Ga0495652_0000008 | Ga0495652_0000008_302286_302954 | 222 |
| 836 | 3300046529 | Ga0495652_0001912 | Ga0495652_0001912_5470_6138 | 222 |
| 837 | 3300046529 | Ga0495652_0026195 | Ga0495652_0026195_596_1270 | 222 |
| 838 | 3300046529 | Ga0495652_0153943 | Ga0495652_0153943_379_1113 | 222 |
| 839 | 3300046529 | Ga0495652_0365284 | Ga0495652_0365284_329_997 | 222 |
| 840 | 3300046531 | Ga0495665_0123950 | Ga0495665_0123950_643_1311 | 222 |
| 841 | 3300046531 | Ga0495665_0137291 | Ga0495665_0137291_264_932 | 222 |
| 842 | 3300046531 | Ga0495665_0269460 | Ga0495665_0269460_89_823 | 222 |
| 843 | 3300046533 | Ga0495640_0000029 | Ga0495640_0000029_11508_12176 | 222 |
| 844 | 3300046533 | Ga0495640_0008277 | Ga0495640_0008277_6996_7670 | 222 |
| 845 | 3300046533 | Ga0495640_0012288 | Ga0495640_0012288_3869_4543 | 222 |
| 846 | 3300046533 | Ga0495640_0033432 | Ga0495640_0033432_789_1457 | 222 |
| 847 | 3300046533 | Ga0495640_0092337 | Ga0495640_0092337_904_1572 | 222 |
| 848 | 3300046535 | Ga0495586_0010651 | Ga0495586_0010651_3550_4224 | 222 |
| 849 | 3300046536 | Ga0495587_0000019 | Ga0495587_0000019_93929_94597 | 222 |
| 850 | 3300046536 | Ga0495587_0006011 | Ga0495587_0006011_1143_1811 | 222 |
| 851 | 3300046537 | Ga0495598_0010537 | Ga0495598_0010537_186_854 | 222 |
| 852 | 3300046543 | Ga0495645_0000006 | Ga0495645_0000006_112426_113094 | 222 |
| 853 | 3300046543 | Ga0495645_0008317 | Ga0495645_0008317_6283_6957 | 222 |
| 854 | 3300046543 | Ga0495645_0175214 | Ga0495645_0175214_17_751 | 222 |
| 855 | 3300046543 | Ga0495645_0204885 | Ga0495645_0204885_306_974 | 222 |
| 856 | 3300046557 | Ga0495622_0118276 | Ga0495622_0118276_141_809 | 222 |
| 857 | 3300046558 | Ga0495633_0061264 | Ga0495633_0061264_685_1353 | 222 |
| 858 | 3300046559 | Ga0495667_0000061 | Ga0495667_0000061_26627_27295 | 222 |
| 859 | 3300046559 | Ga0495667_0000879 | Ga0495667_0000879_4141_4809 | 222 |
| 860 | 3300046615 | Ga0495656_0001123 | Ga0495656_0001123_3443_4111 | 222 |
| 861 | 3300046615 | Ga0495656_0034826 | Ga0495656_0034826_1092_1760 | 222 |
| 862 | 3300046616 | Ga0495668_0053325 | Ga0495668_0053325_71_739 | 222 |
| 863 | 3300046642 | Ga0495634_0001212 | Ga0495634_0001212_19221_19889 | 222 |
| 864 | 3300046642 | Ga0495634_0001468 | Ga0495634_0001468_12699_13367 | 222 |
| 865 | 3300046642 | Ga0495634_0007204 | Ga0495634_0007204_137_811 | 222 |
| 866 | 3300046642 | Ga0495634_0007643 | Ga0495634_0007643_4161_4835 | 222 |
| 867 | 3300046642 | Ga0495634_0189376 | Ga0495634_0189376_111_845 | 222 |
| 868 | 3300046663 | Ga0495635_0000023 | Ga0495635_0000023_94161_94829 | 222 |
| 869 | 3300046663 | Ga0495635_0009308 | Ga0495635_0009308_1134_1808 | 222 |
| 870 | 3300046663 | Ga0495635_0050714 | Ga0495635_0050714_1395_2063 | 222 |
| 871 | 3300046663 | Ga0495635_0169013 | Ga0495635_0169013_374_1048 | 222 |
| 872 | 3300046665 | Ga0495661_0018986 | Ga0495661_0018986_908_1576 | 222 |
| 873 | 3300046675 | Ga0495657_0000099 | Ga0495657_0000099_74293_74961 | 222 |
| 874 | 3300046675 | Ga0495657_0031948 | Ga0495657_0031948_336_1004 | 222 |
| 875 | 3300046678 | Ga0495599_0000039 | Ga0495599_0000039_3100_3768 | 222 |
| 876 | 3300046678 | Ga0495599_0068733 | Ga0495599_0068733_745_1413 | 222 |
| 877 | 3300046678 | Ga0495599_0183154 | Ga0495599_0183154_187_861 | 222 |
| 878 | 3300046679 | Ga0495623_0000253 | Ga0495623_0000253_30703_31371 | 222 |
| 879 | 3300046679 | Ga0495623_0002814 | Ga0495623_0002814_8987_9655 | 222 |
| 880 | 3300046679 | Ga0495623_0163132 | Ga0495623_0163132_402_1136 | 222 |
| 881 | 3300046680 | Ga0495646_0000017 | Ga0495646_0000017_26604_27272 | 222 |
| 882 | 3300046680 | Ga0495646_0010331 | Ga0495646_0010331_661_1329 | 222 |
| 883 | 3300046680 | Ga0495646_0115426 | Ga0495646_0115426_216_1007 | 222 |
| 884 | 3300046680 | Ga0495646_0156346 | Ga0495646_0156346_161_895 | 222 |
| 885 | 3300046681 | Ga0495647_0068679 | Ga0495647_0068679_478_1146 | 222 |
| 886 | 3300046683 | Ga0495658_0036061 | Ga0495658_0036061_164_832 | 222 |
| 887 | 3300046683 | Ga0495658_0046803 | Ga0495658_0046803_1049_1717 | 222 |
| 888 | 3300046683 | Ga0495658_0069182 | Ga0495658_0069182_551_1285 | 222 |
| 889 | 3300046683 | Ga0495658_0082845 | Ga0495658_0082845_711_1379 | 222 |
| 890 | 3300046683 | Ga0495658_0165063 | Ga0495658_0165063_197_871 | 222 |
| 891 | 3300046684 | Ga0495669_0090032 | Ga0495669_0090032_140_808 | 222 |
| 892 | 3300046689 | Ga0495613_0026976 | Ga0495613_0026976_1129_1797 | 222 |
| 893 | 3300046689 | Ga0495613_0049670 | Ga0495613_0049670_198_866 | 222 |
| 894 | 3300046689 | Ga0495613_0597593 | Ga0495613_0597593_14_682 | 222 |
| 895 | 3300046690 | Ga0495624_0036798 | Ga0495624_0036798_294_962 | 222 |
| 896 | 3300046690 | Ga0495624_0047972 | Ga0495624_0047972_1819_2493 | 222 |
| 897 | 3300046690 | Ga0495624_0107846 | Ga0495624_0107846_685_1353 | 222 |
| 898 | 3300046690 | Ga0495624_0208057 | Ga0495624_0208057_138_806 | 222 |
| 899 | 3300046694 | Ga0495649_0073715 | Ga0495649_0073715_558_1226 | 222 |
| 900 | 3300046694 | Ga0495649_0100214 | Ga0495649_0100214_675_1466 | 222 |
| 901 | 3300046794 | Ga0495589_0282080 | Ga0495589_0282080_19_687 | 222 |
| 902 | 3300046809 | Ga0495600_0000030 | Ga0495600_0000030_21470_22138 | 222 |
| 903 | 3300047315 | Ga0495581_0015077 | Ga0495581_0015077_3079_3747 | 222 |
| 904 | 3300047315 | Ga0495581_0071686 | Ga0495581_0071686_394_1068 | 222 |
| 905 | 3300047315 | Ga0495581_0078613 | Ga0495581_0078613_972_1640 | 222 |
| 906 | 3300047315 | Ga0495581_0163574 | Ga0495581_0163574_464_1138 | 222 |
| 907 | 3300047317 | Ga0495604_0000030 | Ga0495604_0000030_97118_97786 | 222 |
| 908 | 3300047317 | Ga0495604_0000662 | Ga0495604_0000662_24246_24914 | 222 |
| 909 | 3300047317 | Ga0495604_0515409 | Ga0495604_0515409_66_740 | 222 |
| 910 | 3300047319 | Ga0495674_0000009 | Ga0495674_0000009_269000_269668 | 222 |
| 911 | 3300047319 | Ga0495674_0002163 | Ga0495674_0002163_6489_7163 | 222 |
| 912 | 3300047319 | Ga0495674_0013531 | Ga0495674_0013531_4929_5597 | 222 |
| 913 | 3300047321 | Ga0495676_0104282 | Ga0495676_0104282_526_1200 | 222 |
| 914 | 3300047321 | Ga0495676_0116718 | Ga0495676_0116718_1017_1685 | 222 |
| 915 | 3300047321 | Ga0495676_0120623 | Ga0495676_0120623_848_1516 | 222 |
| 916 | 3300047321 | Ga0495676_0192362 | Ga0495676_0192362_491_1159 | 222 |
| 917 | 3300047321 | Ga0495676_0200553 | Ga0495676_0200553_86_754 | 222 |
| 918 | 3300047321 | Ga0495676_0241159 | Ga0495676_0241159_54_728 | 222 |
| 919 | 3300047322 | Ga0495680_0000359 | Ga0495680_0000359_11515_12183 | 222 |
| 920 | 3300047322 | Ga0495680_0001209 | Ga0495680_0001209_23289_23957 | 222 |
| 921 | 3300047322 | Ga0495680_0238091 | Ga0495680_0238091_160_834 | 222 |
| 922 | 3300047322 | Ga0495680_0339882 | Ga0495680_0339882_255_989 | 222 |
| 923 | 3300047444 | Ga0495675_0000056 | Ga0495675_0000056_27638_28306 | 222 |
| 924 | 3300047444 | Ga0495675_0008977 | Ga0495675_0008977_1072_1740 | 222 |
| 925 | 3300047471 | Ga0495684_0000056 | Ga0495684_0000056_11537_12205 | 222 |
| 926 | 3300047471 | Ga0495684_0001278 | Ga0495684_0001278_7415_8089 | 222 |
| 927 | 3300047471 | Ga0495684_0074981 | Ga0495684_0074981_1038_1712 | 222 |
| 928 | 3300047673 | Ga0495593_0003363 | Ga0495593_0003363_6790_7458 | 222 |
| 929 | 3300047673 | Ga0495593_0127986 | Ga0495593_0127986_44_712 | 222 |
| 930 | 3300048088 | Ga0495602_0000006 | Ga0495602_0000006_67488_68156 | 222 |
| 931 | 3300048088 | Ga0495602_0000539 | Ga0495602_0000539_7058_7726 | 222 |
| 932 | 3300048088 | Ga0495602_0244967 | Ga0495602_0244967_633_1301 | 222 |
| 933 | 3300048088 | Ga0495602_0549334 | Ga0495602_0549334_35_703 | 222 |
| 934 | 3300048089 | Ga0495614_0137271 | Ga0495614_0137271_73_741 | 222 |
| 935 | 3300048903 | Ga0496100_0000926 | Ga0496100_0000926_4314_5105 | 222 |
| 936 | 3300048903 | Ga0496100_0007931 | Ga0496100_0007931_4428_5096 | 222 |
| 937 | 3300048903 | Ga0496100_0116252 | Ga0496100_0116252_1113_1781 | 222 |
| 938 | 3300048903 | Ga0496100_0209142 | Ga0496100_0209142_224_892 | 222 |
| 939 | 3300048904 | Ga0496101_0004497 | Ga0496101_0004497_1007_1798 | 222 |
| 940 | 3300048904 | Ga0496101_0032008 | Ga0496101_0032008_164_832 | 222 |
| 941 | 3300048905 | Ga0496102_0005716 | Ga0496102_0005716_3264_4055 | 222 |
| 942 | 3300048907 | Ga0496104_0008179 | Ga0496104_0008179_1266_2057 | 222 |
| 943 | 3300048907 | Ga0496104_0039756 | Ga0496104_0039756_3418_4086 | 222 |
| 944 | 3300048907 | Ga0496104_0077661 | Ga0496104_0077661_69_737 | 222 |
| 945 | 3300048907 | Ga0496104_0222826 | Ga0496104_0222826_968_1639 | 222 |
| 946 | 3300048908 | Ga0496105_0005555 | Ga0496105_0005555_5926_6594 | 222 |
| 947 | 3300048908 | Ga0496105_0020686 | Ga0496105_0020686_3633_4424 | 222 |
| 948 | 3300048908 | Ga0496105_0029456 | Ga0496105_0029456_2367_3035 | 222 |
| 949 | 3300048908 | Ga0496105_0267976 | Ga0496105_0267976_454_1188 | 222 |
| 950 | 3300048908 | Ga0496105_0322327 | Ga0496105_0322327_555_1226 | 222 |
| 951 | 3300048909 | Ga0496106_0004750 | Ga0496106_0004750_7443_8234 | 222 |
| 952 | 3300048909 | Ga0496106_0015351 | Ga0496106_0015351_2897_3565 | 222 |
| 953 | 3300048909 | Ga0496106_0117374 | Ga0496106_0117374_973_1641 | 222 |
| 954 | 3300048910 | Ga0496107_0010058 | Ga0496107_0010058_1113_1781 | 222 |
| 955 | 3300048910 | Ga0496107_0091732 | Ga0496107_0091732_1266_2057 | 222 |
| 956 | 3300048911 | Ga0496108_0001187 | Ga0496108_0001187_18112_18903 | 222 |
| 957 | 3300048911 | Ga0496108_0022989 | Ga0496108_0022989_344_1015 | 222 |
| 958 | 3300048911 | Ga0496108_0037474 | Ga0496108_0037474_600_1268 | 222 |
| 959 | 3300048911 | Ga0496108_0481587 | Ga0496108_0481587_144_812 | 222 |
| 960 | 3300048912 | Ga0496109_0003628 | Ga0496109_0003628_439_1107 | 222 |
| 961 | 3300048912 | Ga0496109_0005207 | Ga0496109_0005207_3892_4683 | 222 |
| 962 | 3300048912 | Ga0496109_0005449 | Ga0496109_0005449_3064_3735 | 222 |
| 963 | 3300048912 | Ga0496109_0644463 | Ga0496109_0644463_255_923 | 222 |
| 964 | 3300048913 | Ga0496110_0001389 | Ga0496110_0001389_10161_10952 | 222 |
| 965 | 3300048913 | Ga0496110_0008745 | Ga0496110_0008745_6676_7347 | 222 |
| 966 | 3300048913 | Ga0496110_0012668 | Ga0496110_0012668_6024_6692 | 222 |
| 967 | 3300048913 | Ga0496110_0184014 | Ga0496110_0184014_565_1344 | 222 |
| 968 | 3300048914 | Ga0496111_0001694 | Ga0496111_0001694_3765_4433 | 222 |
| 969 | 3300048914 | Ga0496111_0018942 | Ga0496111_0018942_2110_2901 | 222 |
| 970 | 3300048914 | Ga0496111_0023129 | Ga0496111_0023129_2146_2817 | 222 |
| 971 | 3300048915 | Ga0496112_0001346 | Ga0496112_0001346_2409_3200 | 222 |
| 972 | 3300048915 | Ga0496112_0001940 | Ga0496112_0001940_14349_15083 | 222 |
| 973 | 3300048915 | Ga0496112_0057488 | Ga0496112_0057488_2682_3353 | 222 |
| 974 | 3300048915 | Ga0496112_0306561 | Ga0496112_0306561_647_1315 | 222 |
| 975 | 3300048916 | Ga0496113_0001229 | Ga0496113_0001229_2660_3451 | 222 |
| 976 | 3300048916 | Ga0496113_0003069 | Ga0496113_0003069_3290_3958 | 222 |
| 977 | 3300048916 | Ga0496113_0046514 | Ga0496113_0046514_672_1343 | 222 |
| 978 | 3300048916 | Ga0496113_0710337 | Ga0496113_0710337_81_749 | 222 |
| 979 | 3300048917 | Ga0496114_0017584 | Ga0496114_0017584_1241_1909 | 222 |
| 980 | 3300048917 | Ga0496114_0067775 | Ga0496114_0067775_1479_2147 | 222 |
| 981 | 3300048917 | Ga0496114_0093566 | Ga0496114_0093566_997_1788 | 222 |
| 982 | 3300048917 | Ga0496114_0393844 | Ga0496114_0393844_403_1074 | 222 |
| 983 | 3300048918 | Ga0496115_0003119 | Ga0496115_0003119_8347_9138 | 222 |
| 984 | 3300048918 | Ga0496115_0010171 | Ga0496115_0010171_3574_4242 | 222 |
| 985 | 3300048918 | Ga0496115_0061881 | Ga0496115_0061881_1116_1895 | 222 |
| 986 | 3300049568 | Ga0501031_0048768 | Ga0501031_0048768_1951_2619 | 222 |
| 987 | 3300049568 | Ga0501031_0092149 | Ga0501031_0092149_568_1257 | 222 |
| 988 | 3300049569 | Ga0501032_0013003 | Ga0501032_0013003_2988_3665 | 222 |
| 989 | 3300049569 | Ga0501032_0022105 | Ga0501032_0022105_1849_2526 | 222 |
| 990 | 3300049569 | Ga0501032_0048876 | Ga0501032_0048876_619_1296 | 222 |
| 991 | 3300049569 | Ga0501032_0093051 | Ga0501032_0093051_248_916 | 222 |
| 992 | 3300049570 | Ga0501033_0017990 | Ga0501033_0017990_2167_2844 | 222 |
| 993 | 3300049570 | Ga0501033_0033329 | Ga0501033_0033329_1226_1894 | 222 |
| 994 | 3300049571 | Ga0501034_0002201 | Ga0501034_0002201_7858_8535 | 222 |
| 995 | 3300049571 | Ga0501034_0031875 | Ga0501034_0031875_268_936 | 222 |
| 996 | 3300049571 | Ga0501034_0050893 | Ga0501034_0050893_1113_1790 | 222 |
| 997 | 3300049571 | Ga0501034_0081474 | Ga0501034_0081474_2211_2879 | 222 |
| 998 | 3300049571 | Ga0501034_0127324 | Ga0501034_0127324_1197_1886 | 222 |
| 999 | 3300049571 | Ga0501034_0158572 | Ga0501034_0158572_1038_1715 | 222 |
| 1000 | 3300049571 | Ga0501034_0283883 | Ga0501034_0283883_738_1406 | 222 |
| 1001 | 3300049571 | Ga0501034_0345771 | Ga0501034_0345771_186_863 | 222 |
| 1002 | 3300049572 | Ga0501036_0007818 | Ga0501036_0007818_6653_7321 | 222 |
| 1003 | 3300049572 | Ga0501036_0016265 | Ga0501036_0016265_5229_5906 | 222 |
| 1004 | 3300049572 | Ga0501036_0058284 | Ga0501036_0058284_2409_3086 | 222 |
| 1005 | 3300049572 | Ga0501036_0062481 | Ga0501036_0062481_1717_2394 | 222 |
| 1006 | 3300049572 | Ga0501036_0136118 | Ga0501036_0136118_851_1540 | 222 |
| 1007 | 3300049573 | Ga0501037_0005054 | Ga0501037_0005054_174_851 | 222 |
| 1008 | 3300049573 | Ga0501037_0009480 | Ga0501037_0009480_5614_6291 | 222 |
| 1009 | 3300049573 | Ga0501037_0126480 | Ga0501037_0126480_362_1039 | 222 |
| 1010 | 3300049573 | Ga0501037_0417485 | Ga0501037_0417485_197_868 | 222 |
| 1011 | 3300049574 | Ga0501038_0018363 | Ga0501038_0018363_4505_5173 | 222 |
| 1012 | 3300049574 | Ga0501038_0037433 | Ga0501038_0037433_2421_3098 | 222 |
| 1013 | 3300049574 | Ga0501038_0173305 | Ga0501038_0173305_154_831 | 222 |
| 1014 | 3300049574 | Ga0501038_0342794 | Ga0501038_0342794_139_807 | 222 |
| 1015 | 3300049575 | Ga0501039_0088736 | Ga0501039_0088736_1683_2360 | 222 |
| 1016 | 3300049575 | Ga0501039_0126551 | Ga0501039_0126551_1006_1683 | 222 |
| 1017 | 3300049575 | Ga0501039_0356505 | Ga0501039_0356505_157_825 | 222 |
| 1018 | 3300049576 | Ga0501040_0093026 | Ga0501040_0093026_1023_1712 | 222 |
| 1019 | 3300049576 | Ga0501040_0451038 | Ga0501040_0451038_220_891 | 222 |
| 1020 | 3300049578 | Ga0501042_0199294 | Ga0501042_0199294_463_1140 | 222 |
| 1021 | 3300049579 | Ga0501043_0001843 | Ga0501043_0001843_12268_12945 | 222 |
| 1022 | 3300049579 | Ga0501043_0052764 | Ga0501043_0052764_1547_2224 | 222 |
| 1023 | 3300049579 | Ga0501043_0149423 | Ga0501043_0149423_1141_1809 | 222 |
| 1024 | 3300049579 | Ga0501043_0230029 | Ga0501043_0230029_175_852 | 222 |
| 1025 | 3300049579 | Ga0501043_0346698 | Ga0501043_0346698_309_995 | 222 |
| 1026 | 3300049580 | Ga0501046_0042972 | Ga0501046_0042972_263_931 | 222 |
| 1027 | 3300049580 | Ga0501046_0046372 | Ga0501046_0046372_1790_2479 | 222 |
| 1028 | 3300049580 | Ga0501046_0213269 | Ga0501046_0213269_471_1148 | 222 |
| 1029 | 3300049581 | Ga0501047_0000010 | Ga0501047_0000010_61977_62654 | 222 |
| 1030 | 3300049581 | Ga0501047_0014495 | Ga0501047_0014495_4332_5000 | 222 |
| 1031 | 3300049581 | Ga0501047_0289149 | Ga0501047_0289149_36_704 | 222 |
| 1032 | 3300049582 | Ga0501048_0004920 | Ga0501048_0004920_6481_7158 | 222 |
| 1033 | 3300049582 | Ga0501048_0016921 | Ga0501048_0016921_144_812 | 222 |
| 1034 | 3300049582 | Ga0501048_0111287 | Ga0501048_0111287_21_698 | 222 |
| 1035 | 3300049583 | Ga0501067_0325256 | Ga0501067_0325256_110_778 | 222 |
| 1036 | 3300049584 | Ga0501068_0103009 | Ga0501068_0103009_1080_1757 | 222 |
| 1037 | 3300049584 | Ga0501068_0111004 | Ga0501068_0111004_992_1660 | 222 |
| 1038 | 3300049584 | Ga0501068_0191423 | Ga0501068_0191423_57_746 | 222 |
| 1039 | 3300049585 | Ga0501069_0102789 | Ga0501069_0102789_393_1070 | 222 |
| 1040 | 3300049585 | Ga0501069_0124177 | Ga0501069_0124177_664_1332 | 222 |
| 1041 | 3300049586 | Ga0501070_0056695 | Ga0501070_0056695_1261_1950 | 222 |
| 1042 | 3300049586 | Ga0501070_0102058 | Ga0501070_0102058_1029_1706 | 222 |
| 1043 | 3300049586 | Ga0501070_0202789 | Ga0501070_0202789_565_1254 | 222 |
| 1044 | 3300049586 | Ga0501070_0242180 | Ga0501070_0242180_394_1071 | 222 |
| 1045 | 3300049587 | Ga0501071_0155413 | Ga0501071_0155413_154_822 | 222 |
| 1046 | 3300049588 | Ga0501072_0033081 | Ga0501072_0033081_2890_3579 | 222 |
| 1047 | 3300049588 | Ga0501072_0062220 | Ga0501072_0062220_1938_2615 | 222 |
| 1048 | 3300049588 | Ga0501072_0258493 | Ga0501072_0258493_409_1077 | 222 |
| 1049 | 3300049588 | Ga0501072_0461682 | Ga0501072_0461682_24_695 | 222 |
| 1050 | 3300049589 | Ga0501073_0033338 | Ga0501073_0033338_622_1299 | 222 |
| 1051 | 3300049589 | Ga0501073_0072315 | Ga0501073_0072315_1146_1814 | 222 |
| 1052 | 3300049589 | Ga0501073_0124554 | Ga0501073_0124554_244_933 | 222 |
| 1053 | 3300049590 | Ga0501074_0009189 | Ga0501074_0009189_3048_3725 | 222 |
| 1054 | 3300049590 | Ga0501074_0192647 | Ga0501074_0192647_121_789 | 222 |
| 1055 | 3300049591 | Ga0501075_0600613 | Ga0501075_0600613_114_803 | 222 |
| 1056 | 3300049592 | Ga0501076_0078679 | Ga0501076_0078679_27_704 | 222 |
| 1057 | 3300049592 | Ga0501076_0247431 | Ga0501076_0247431_761_1429 | 222 |
| 1058 | 3300049592 | Ga0501076_0337393 | Ga0501076_0337393_236_904 | 222 |
| 1059 | 3300049592 | Ga0501076_0400388 | Ga0501076_0400388_101_772 | 222 |
| 1060 | 3300049741 | Ga0501079_0066627 | Ga0501079_0066627_1567_2235 | 222 |
| 1061 | 3300049741 | Ga0501079_0291895 | Ga0501079_0291895_477_1166 | 222 |
| 1062 | 3300049742 | Ga0501080_0000314 | Ga0501080_0000314_5336_6013 | 222 |
| 1063 | 3300049742 | Ga0501080_0006102 | Ga0501080_0006102_9594_10262 | 222 |
| 1064 | 3300049742 | Ga0501080_0081340 | Ga0501080_0081340_1134_1802 | 222 |
| 1065 | 3300049742 | Ga0501080_0177989 | Ga0501080_0177989_1230_1919 | 222 |
| 1066 | 3300049742 | Ga0501080_0254933 | Ga0501080_0254933_635_1312 | 222 |
| 1067 | 3300049743 | Ga0501081_0148981 | Ga0501081_0148981_679_1347 | 222 |
| 1068 | 3300049743 | Ga0501081_0533896 | Ga0501081_0533896_120_854 | 222 |
| 1069 | 3300049744 | Ga0501083_0005058 | Ga0501083_0005058_5225_5902 | 222 |
| 1070 | 3300049822 | Ga0501035_0011561 | Ga0501035_0011561_7078_7746 | 222 |
| 1071 | 3300049822 | Ga0501035_0030708 | Ga0501035_0030708_2386_3063 | 222 |
| 1072 | 3300049823 | Ga0501044_0000116 | Ga0501044_0000116_63971_64639 | 222 |
| 1073 | 3300049823 | Ga0501044_0003610 | Ga0501044_0003610_12601_13278 | 222 |
| 1074 | 3300049823 | Ga0501044_0078352 | Ga0501044_0078352_2568_3236 | 222 |
| 1075 | 3300049823 | Ga0501044_0125313 | Ga0501044_0125313_568_1257 | 222 |
| 1076 | 3300049824 | Ga0501045_0361097 | Ga0501045_0361097_375_1052 | 222 |
| 1077 | 3300049824 | Ga0501045_0520249 | Ga0501045_0520249_38_706 | 222 |
| 1078 | 3300050489 | nmdc:mga03683_1213_c2 | nmdc:mga03683_1213_c2_2583_3269 | 222 |
| 1079 | 3300050489 | nmdc:mga03683_44154_c1 | nmdc:mga03683_44154_c1_1079_1747 | 222 |
| 1080 | 3300050490 | nmdc:mga03n38_331637_c1 | nmdc:mga03n38_331637_c1_34_720 | 222 |
| 1081 | 3300050490 | nmdc:mga03n38_9563_c1 | nmdc:mga03n38_9563_c1_2658_3344 | 222 |
| 1082 | 3300050491 | nmdc:mga00v17_24709_c1 | nmdc:mga00v17_24709_c1_878_1546 | 222 |
| 1083 | 3300050491 | nmdc:mga00v17_28997_c1 | nmdc:mga00v17_28997_c1_778_1464 | 222 |
| 1084 | 3300050492 | nmdc:mga0yw44_11062_c1 | nmdc:mga0yw44_11062_c1_2070_2738 | 222 |
| 1085 | 3300050492 | nmdc:mga0yw44_116513_c1 | nmdc:mga0yw44_116513_c1_327_1118 | 222 |
| 1086 | 3300050492 | nmdc:mga0yw44_4079_c1 | nmdc:mga0yw44_4079_c1_1403_2071 | 222 |
| 1087 | 3300050492 | nmdc:mga0yw44_580_c1 | nmdc:mga0yw44_580_c1_11361_12029 | 222 |
| 1088 | 3300050492 | nmdc:mga0yw44_63973_c1 | nmdc:mga0yw44_63973_c1_1363_2031 | 222 |
| 1089 | 3300050492 | nmdc:mga0yw44_69664_c1 | nmdc:mga0yw44_69664_c1_81_767 | 222 |
| 1090 | 3300050493 | nmdc:mga0k408_142046_c1 | nmdc:mga0k408_142046_c1_664_1332 | 222 |
| 1091 | 3300050493 | nmdc:mga0k408_47462_c1 | nmdc:mga0k408_47462_c1_492_1160 | 222 |
| 1092 | 3300050494 | nmdc:mga06z11_15735_c2 | nmdc:mga06z11_15735_c2_549_1235 | 222 |
| 1093 | 3300050494 | nmdc:mga06z11_169845_c1 | nmdc:mga06z11_169845_c1_245_913 | 222 |
| 1094 | 3300050494 | nmdc:mga06z11_33677_c1 | nmdc:mga06z11_33677_c1_1213_1881 | 222 |
| 1095 | 3300050494 | nmdc:mga06z11_44729_c1 | nmdc:mga06z11_44729_c1_1217_2041 | 222 |
| 1096 | 3300050495 | nmdc:mga04h51_6680_c1 | nmdc:mga04h51_6680_c1_2034_2720 | 222 |
| 1097 | 3300050496 | nmdc:mga07m45_46338_c1 | nmdc:mga07m45_46338_c1_1659_2345 | 222 |
| 1098 | 3300050507 | nmdc:mga05p37_11744_c1 | nmdc:mga05p37_11744_c1_8378_9046 | 222 |
| 1099 | 3300050507 | nmdc:mga05p37_374_c1 | nmdc:mga05p37_374_c1_42071_42739 | 222 |
| 1100 | 3300050507 | nmdc:mga05p37_47092_c1 | nmdc:mga05p37_47092_c1_1115_1783 | 222 |
| 1101 | 3300050508 | nmdc:mga09592_20752_c1 | nmdc:mga09592_20752_c1_3629_4297 | 222 |
| 1102 | 3300050508 | nmdc:mga09592_2601_c1 | nmdc:mga09592_2601_c1_7548_8216 | 222 |
| 1103 | 3300050509 | nmdc:mga0qj67_134130_c1 | nmdc:mga0qj67_134130_c1_133_801 | 222 |
| 1104 | 3300050509 | nmdc:mga0qj67_50765_c1 | nmdc:mga0qj67_50765_c1_1996_2664 | 222 |
| 1105 | 3300050509 | nmdc:mga0qj67_551023_c1 | nmdc:mga0qj67_551023_c1_239_907 | 222 |
| 1106 | 3300050509 | nmdc:mga0qj67_65941_c1 | nmdc:mga0qj67_65941_c1_462_1130 | 222 |
| 1107 | 3300050510 | nmdc:mga06r32_250622_c2 | nmdc:mga06r32_250622_c2_208_879 | 222 |
| 1108 | 3300050510 | nmdc:mga06r32_307479_c1 | nmdc:mga06r32_307479_c1_276_944 | 222 |
| 1109 | 3300050510 | nmdc:mga06r32_397_c1 | nmdc:mga06r32_397_c1_7146_7814 | 222 |
| 1110 | 3300050511 | nmdc:mga08y16_122069_c1 | nmdc:mga08y16_122069_c1_160_951 | 222 |
| 1111 | 3300050511 | nmdc:mga08y16_155771_c1 | nmdc:mga08y16_155771_c1_576_1244 | 222 |
| 1112 | 3300050511 | nmdc:mga08y16_184_c1 | nmdc:mga08y16_184_c1_30518_31186 | 222 |
| 1113 | 3300050511 | nmdc:mga08y16_270713_c1 | nmdc:mga08y16_270713_c1_692_1360 | 222 |
| 1114 | 3300050511 | nmdc:mga08y16_321525_c1 | nmdc:mga08y16_321525_c1_318_986 | 222 |
| 1115 | 3300050512 | nmdc:mga0n895_381227_c1 | nmdc:mga0n895_381227_c1_110_778 | 222 |
| 1116 | 3300050512 | nmdc:mga0n895_445606_c1 | nmdc:mga0n895_445606_c1_491_1159 | 222 |
| 1117 | 3300050512 | nmdc:mga0n895_834709_c1 | nmdc:mga0n895_834709_c1_44_835 | 222 |
| 1118 | 3300050512 | nmdc:mga0n895_96376_c1 | nmdc:mga0n895_96376_c1_1190_1858 | 222 |
| 1119 | 3300050513 | nmdc:mga0rr50_282808_c1 | nmdc:mga0rr50_282808_c1_381_1049 | 222 |
| 1120 | 3300050513 | nmdc:mga0rr50_70704_c1 | nmdc:mga0rr50_70704_c1_1172_1840 | 222 |
| 1121 | 3300050514 | nmdc:mga08x19_103158_c1 | nmdc:mga08x19_103158_c1_1190_1858 | 222 |
| 1122 | 3300050514 | nmdc:mga08x19_138367_c1 | nmdc:mga08x19_138367_c1_215_889 | 222 |
| 1123 | 3300050515 | nmdc:mga0a205_203406_c1 | nmdc:mga0a205_203406_c1_217_885 | 222 |
| 1124 | 3300053077 | Ga0495601_0000007 | Ga0495601_0000007_297902_298570 | 222 |
| 1125 | 3300053077 | Ga0495601_0005541 | Ga0495601_0005541_2531_3199 | 222 |
| 1126 | 3300053077 | Ga0495601_0012397 | Ga0495601_0012397_2582_3256 | 222 |
| 1127 | 3300053077 | Ga0495601_0301767 | Ga0495601_0301767_105_773 | 222 |
| 1128 | 3300053078 | Ga0495612_0000053 | Ga0495612_0000053_40684_41352 | 222 |
| 1129 | 3300053078 | Ga0495612_0001301 | Ga0495612_0001301_3321_3995 | 222 |
| 1130 | 3300053078 | Ga0495612_0002727 | Ga0495612_0002727_4808_5476 | 222 |
| 1131 | 3300053078 | Ga0495612_0271565 | Ga0495612_0271565_74_742 | 222 |
| 1132 | 3300053083 | Ga0495655_0034961 | Ga0495655_0034961_246_914 | 222 |
| 1133 | 3300053084 | Ga0495595_0000031 | Ga0495595_0000031_55169_55837 | 222 |
| 1134 | 3300053084 | Ga0495595_0005529 | Ga0495595_0005529_3290_3958 | 222 |
| 1135 | 3300053084 | Ga0495595_0030894 | Ga0495595_0030894_709_1377 | 222 |
| 1136 | 3300053084 | Ga0495595_0088479 | Ga0495595_0088479_45_779 | 222 |
| 1137 | 3300053084 | Ga0495595_0274711 | Ga0495595_0274711_102_770 | 222 |
| 1138 | 3300053085 | Ga0495619_0000023 | Ga0495619_0000023_98031_98699 | 222 |
| 1139 | 3300053085 | Ga0495619_0003219 | Ga0495619_0003219_5116_5790 | 222 |
| 1140 | 3300053085 | Ga0495619_0024881 | Ga0495619_0024881_1475_2143 | 222 |
| 1141 | 3300053085 | Ga0495619_0058559 | Ga0495619_0058559_1788_2456 | 222 |
| 1142 | 3300053085 | Ga0495619_0230447 | Ga0495619_0230447_506_1240 | 222 |
| 1143 | 3300053085 | Ga0495619_0643639 | Ga0495619_0643639_13_681 | 222 |
| 1144 | 3300053117 | Ga0500593_069737 | Ga0500593_069737_67_813 | 222 |
| 1145 | 3300053130 | Ga0500642_0124487 | Ga0500642_0124487_166_834 | 222 |
| 1146 | 3300053134 | Ga0500658_0073848 | Ga0500658_0073848_540_1208 | 222 |
| 1147 | 3300053142 | Ga0500577_0079257 | Ga0500577_0079257_35_703 | 222 |
| 1148 | 3300053153 | Ga0500616_0011431 | Ga0500616_0011431_3115_3783 | 222 |
| 1149 | 3300054114 | Ga0501084_0083270 | Ga0501084_0083270_1526_2194 | 222 |
| 1150 | 3300054114 | Ga0501084_0384489 | Ga0501084_0384489_319_987 | 222 |
| 1151 | 3300060353 | Ga0501082_0007592 | Ga0501082_0007592_445_1113 | 222 |
| 1152 | 3300060353 | Ga0501082_0694267 | Ga0501082_0694267_200_877 | 222 |
| 1153 | 3300061734 | Ga0530510_0222121 | Ga0530510_0222121_243_911 | 222 |
| 1154 | 3300061734 | Ga0530510_0540371 | Ga0530510_0540371_160_828 | 222 |
| 1155 | 3300061734 | Ga0530510_0570628 | Ga0530510_0570628_20_688 | 222 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5x98-assembly1.cif.gz_A | y162f mutant of thermus thermophilus hb8 thymidylate kinase | 0.9583 | 3 | 206 |
| 5xal-assembly1.cif.gz_B | y99f mutant of thermus thermophilus hb8 thymidylate kinase | 0.9581 | 3 | 206 |
| 5x8a-assembly1.cif.gz_B | crystal structure of atp bound thymidylate kinase from thermus thermophilus hb8 | 0.9578 | 3 | 206 |
| 5x8d-assembly1.cif.gz_B | d90l mutant of thermus thermophilus hb8 thymidylate kinase | 0.9577 | 3 | 206 |
| 3hjn-assembly1.cif.gz_B | crystal structure of thymidylate kinase in complex with dtdp and adp from thermotoga maritima | 0.9559 | 5 | 202 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5x7jB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9463 | 3 | 208 | 3.40.50.300 |
| 2pbrA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9408 | 5 | 206 | 3.40.50.300 |
| 3uwoB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9389 | 3 | 208 | 3.40.50.300 |
| 5x7jB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9325 | 3 | 208 | 3.40.50.300 |
| 2z0hB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9306 | 5 | 202 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A537P924-F1-model_v4 | Thymidylate kinase (EC 2.7.4.9) (dTMP kinase) | 0.9974 | 1 | 186 |
GO:0004798
GO:0005524 GO:0005829 GO:0006227 GO:0006233 GO:0006235 |
| AF-A0A537T9L3-F1-model_v4 | Thymidylate kinase (EC 2.7.4.9) (dTMP kinase) | 0.9969 | 1 | 210 |
GO:0004798
GO:0005524 GO:0005829 GO:0006227 GO:0006233 GO:0006235 |
| AF-A0A2P8NJ21-F1-model_v4 | Thymidylate kinase (EC 2.7.4.9) (dTMP kinase) | 0.9918 | 1 | 209 |
GO:0004798
GO:0005524 GO:0005829 GO:0006227 GO:0006233 GO:0006235 |
| AF-A0A3D2CX13-F1-model_v4 | deleted | 0.9906 | 1 | 173 |
|
| AF-A0A0A8K505-F1-model_v4 | Thymidylate kinase (EC 2.7.4.9) (dTMP kinase) | 0.9896 | 2 | 209 |
GO:0004798
GO:0005524 GO:0005829 GO:0006227 GO:0006233 GO:0006235 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar