F490929

General Info

Members Datasets Scaffolds Average Seq Length
1155 465 1138 225

Family's Representative Sequence

Representative Sequence 3300048929|Ga0496126_0424088|Ga0496126_0424088_300_995
Length 231
Sequence MPAAGPQPDTTTRISRFITVEGGEGGGKSTQLRRLAELLQAQGEVVCLTREPGGAPGAEDIRRLLVEGDPGRWTPESEALLHFAARADHLARVIRPALTAGQWVLCDRFADSTIAYQGYGHGLDMAWLQALRRQIVGPTEPGLTIILDLPIEVGLARAAKRQQPNAAAPQAAEDRYERMDRGFHQRLRDGFLAIAAAEPGRCKVVDADRPVDEIASDLLSVMNRRFALKLF

Samples

Sample ID Description Type Environment
1 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
2 2643221576 Nocardioides sp. Root614 Isolate Unclassified
3 2643221590 Nocardioides sp. Root682 Isolate Unclassified
4 2643221604 Nocardioides sp. Root190 Isolate Unclassified
5 2643221617 Nocardioides sp. Root79 Isolate Unclassified
6 2643221620 Nocardioides sp. Root240 Isolate Unclassified
7 2738541305 Nocardioides sp. CF167 Isolate Unclassified
8 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
9 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
10 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
11 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
12 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
13 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
14 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
15 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
16 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
17 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
18 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
19 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
20 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
21 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
22 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
23 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
24 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
25 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
26 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
27 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
28 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
29 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
30 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
31 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
32 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
33 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
34 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
35 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
36 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
37 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
38 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
39 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
40 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
41 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
42 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
43 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
44 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
45 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
46 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
47 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
48 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
49 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
50 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
51 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
52 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
53 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
54 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
55 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
56 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
57 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
58 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
59 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
60 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
61 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
62 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
63 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
64 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
65 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
66 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
67 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
68 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
69 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
70 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
71 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
72 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
73 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
74 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
75 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
76 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
77 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
78 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
79 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
80 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
81 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
82 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
83 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
84 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
85 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
86 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
87 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
88 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
89 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
90 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
91 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
92 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
93 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
94 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
95 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
96 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
97 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
98 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
99 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
100 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
101 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
102 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
103 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
104 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
105 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
106 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
107 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
108 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
109 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
110 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
111 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
112 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
113 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
114 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
115 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
116 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
117 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
118 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
119 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
120 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
121 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
122 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
123 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
124 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
125 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
126 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
127 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
128 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
129 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
130 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
131 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
132 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
133 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
134 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
135 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
136 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
137 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
138 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
139 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
140 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
141 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
142 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
143 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
144 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
145 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
146 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
147 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
148 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
149 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
150 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
151 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
152 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
153 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
154 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
212 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
213 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
217 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
218 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
219 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
220 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
221 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
222 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
223 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
224 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
225 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
226 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
227 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
228 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
229 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
230 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
231 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
232 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
233 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
234 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
235 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
236 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
237 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
238 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
239 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
240 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
241 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
242 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
243 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
244 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
245 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
246 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
247 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
248 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
249 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
250 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
251 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
252 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
253 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
254 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
255 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
256 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
257 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
258 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
259 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
260 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
261 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
262 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
263 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
264 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
265 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
266 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
267 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
268 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
269 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
270 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
271 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
272 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
273 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
274 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
275 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
276 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
277 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
278 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
279 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
280 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
281 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
282 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
283 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
284 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
285 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
286 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
287 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
288 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
289 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
290 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
291 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
292 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
293 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
294 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
295 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
296 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
297 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
298 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
299 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
300 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
301 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
302 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
303 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
304 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
305 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
306 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
307 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
308 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
309 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
310 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
311 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
312 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
313 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
314 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
315 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
316 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
317 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
318 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
319 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
320 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
321 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
322 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
323 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
324 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
325 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
326 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
327 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
328 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
329 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
330 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
331 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
332 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
333 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
334 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
335 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
336 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
337 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
338 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
339 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
340 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
341 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
342 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
343 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
344 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
345 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
346 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
347 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
348 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
349 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
350 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
351 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
352 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
353 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
354 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
355 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
356 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
357 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
358 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
359 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
360 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
361 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
362 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
363 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
364 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
365 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
366 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
367 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
368 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
369 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
370 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
371 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
372 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
373 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
374 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
375 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
376 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
377 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
378 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
379 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
380 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
381 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
382 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
383 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
384 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
385 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
386 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
387 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
388 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
389 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
390 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
391 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
392 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
393 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
394 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
395 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
396 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
397 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
398 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
399 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
400 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
401 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
402 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
403 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
404 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
405 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
406 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
407 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
408 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
409 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
410 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
411 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
412 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
413 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
414 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
415 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
416 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
417 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
418 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
419 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
420 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
421 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
422 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
423 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
424 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
425 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
426 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
427 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
428 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
429 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
430 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
431 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
432 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
433 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
434 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
435 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
436 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
437 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
438 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
439 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
440 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
441 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
442 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
443 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
444 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
445 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
446 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
447 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
448 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
449 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
450 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
451 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
452 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
453 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
454 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
455 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
456 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
457 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
458 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
459 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
460 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
461 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
462 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
463 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
464 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
465 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.27
Metatranscriptomes 0.26
Isolates 1.47

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.95
Nodule 0.17
Rhizoplane 6.32
Rhizosphere 78.53
Stem 0
Stem Tuber 0
Unclassified 3.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24752J21851_1007459 3300001976 Bacteria 1427
2 JGI24737J22298_10012530 3300001990 Bacteria 2765
3 JGI24743J22301_10000134 3300001991 Bacteria 7428
4 JGI24750J21931_1000851 3300002070 Bacteria 4209
5 JGI24745J21846_1001252 3300002073 Bacteria 2447
6 JGI24748J21848_1001597 3300002074 Bacteria 2522
7 JGI24749J21850_1000509 3300002076 Bacteria 5726
8 JGI24744J21845_10002294 3300002077 Bacteria 3897
9 JGI24034J26672_10002367 3300002239 Bacteria 2584
10 JGI24751J29686_10001980 3300002459 Bacteria 4179
11 JGI25153J46596_10006534 3300003215 Bacteria 5878
12 rootH1_10021619 3300003316 Bacteria 1264
13 rootH2_10032559 3300003320 Bacteria 12792
14 rootL2_10291390 3300003322 Bacteria 1056
15 JGI25160J50197_1001950 3300003354 Bacteria 9853
16 Ga0065165_1028635 3300005262 Bacteria 1796
17 Ga0070683_100269295 3300005329 Bacteria 1620
18 Ga0070690_100028892 3300005330 Bacteria 3437
19 Ga0070670_100013394 3300005331 Bacteria 7024
20 Ga0070670_100020400 3300005331 Bacteria 5697
21 Ga0068869_100028205 3300005334 Bacteria 3921
22 Ga0070680_100002406 3300005336 Bacteria 13858
23 Ga0070680_100022351 3300005336 Bacteria 5037
24 Ga0070680_100343800 3300005336 Bacteria 1268
25 Ga0070680_100698473 3300005336 Unclassified 873
26 Ga0070682_100008050 3300005337 Bacteria 5937
27 Ga0068868_100007445 3300005338 Bacteria 7795
28 Ga0070660_100222309 3300005339 Bacteria 1535
29 Ga0070689_100075714 3300005340 Bacteria 2636
30 Ga0070691_10120209 3300005341 Bacteria 1322
31 Ga0070687_100001322 3300005343 Bacteria 8663
32 Ga0070687_100079089 3300005343 Bacteria 1789
33 Ga0070661_100077062 3300005344 Bacteria 2457
34 Ga0070668_100012197 3300005347 Bacteria 6401
35 Ga0070669_100065344 3300005353 Bacteria 2680
36 Ga0070669_100086295 3300005353 Bacteria 2345
37 Ga0070669_100324818 3300005353 Bacteria 1243
38 Ga0070669_100331888 3300005353 Bacteria 1230
39 Ga0070675_100035184 3300005354 Bacteria 4068
40 Ga0070671_100013663 3300005355 Bacteria 6548
41 Ga0070671_100162171 3300005355 Bacteria 1890
42 Ga0070671_100178959 3300005355 Bacteria 1795
43 Ga0070671_100390424 3300005355 Bacteria 1190
44 Ga0070671_100497137 3300005355 Unclassified 1049
45 Ga0070674_100002023 3300005356 Bacteria 11113
46 Ga0070674_100116254 3300005356 Bacteria 1973
47 Ga0070674_100413441 3300005356 Bacteria 1105
48 Ga0070673_100012244 3300005364 Bacteria 5884
49 Ga0070673_100078176 3300005364 Bacteria 2676
50 Ga0070673_100081066 3300005364 Bacteria 2631
51 Ga0070688_100006730 3300005365 Bacteria 6160
52 Ga0070688_100020200 3300005365 Bacteria 3869
53 Ga0070688_100044398 3300005365 Bacteria 2743
54 Ga0070659_100043352 3300005366 Bacteria 3519
55 Ga0070659_100311580 3300005366 Bacteria 1314
56 Ga0070667_100006086 3300005367 Bacteria 10016
57 Ga0070667_100084771 3300005367 Bacteria 2716
58 Ga0070714_100000556 3300005435 Bacteria 26845
59 Ga0070713_101169477 3300005436 Bacteria 744
60 Ga0070710_10002571 3300005437 Bacteria 8617
61 Ga0070710_10018625 3300005437 Bacteria 3574
62 Ga0070701_10000544 3300005438 Bacteria 12999
63 Ga0070711_100017293 3300005439 Bacteria 4590
64 Ga0070711_100179886 3300005439 Bacteria 1619
65 Ga0070711_100477130 3300005439 Bacteria 1025
66 Ga0070700_100014905 3300005441 Bacteria 4396
67 Ga0070663_100099777 3300005455 Bacteria 2165
68 Ga0070663_100522804 3300005455 Bacteria 988
69 Ga0070678_100033394 3300005456 Bacteria 3572
70 Ga0070678_100042057 3300005456 Bacteria 3245
71 Ga0070678_100065144 3300005456 Bacteria 2704
72 Ga0070681_10030828 3300005458 Bacteria 5382
73 Ga0070681_10036642 3300005458 Bacteria 4924
74 Ga0068867_100006600 3300005459 Bacteria 8201
75 Ga0068867_100112569 3300005459 Bacteria 2093
76 Ga0070685_10001171 3300005466 Bacteria 14029
77 Ga0070698_100407018 3300005471 Bacteria 1294
78 Ga0070679_100010449 3300005530 Bacteria 8806
79 Ga0070679_100016290 3300005530 Bacteria 7163
80 Ga0070684_100111632 3300005535 Bacteria 2452
81 Ga0070697_100039437 3300005536 Bacteria 3819
82 Ga0068853_100011139 3300005539 Bacteria 7295
83 Ga0068853_100028508 3300005539 Bacteria 4697
84 Ga0068853_100037050 3300005539 Bacteria 4149
85 Ga0070672_100007959 3300005543 Bacteria 7240
86 Ga0070686_100242105 3300005544 Bacteria 1314
87 Ga0070686_100615599 3300005544 Bacteria 857
88 Ga0070695_100008588 3300005545 Bacteria 6068
89 Ga0070696_100007312 3300005546 Bacteria 7374
90 Ga0070693_100012903 3300005547 Bacteria 4243
91 Ga0070665_100031361 3300005548 Bacteria 5349
92 Ga0070704_100002394 3300005549 Bacteria 10529
93 Ga0070704_100081333 3300005549 Bacteria 2386
94 Ga0070704_100103455 3300005549 Bacteria 2151
95 Ga0070704_100334507 3300005549 Bacteria 1273
96 Ga0068855_100074040 3300005563 Bacteria 3956
97 Ga0068855_100136130 3300005563 Bacteria 2803
98 Ga0068855_100144161 3300005563 Bacteria 2713
99 Ga0070664_100051607 3300005564 Bacteria 3482
100 Ga0068857_100156103 3300005577 Bacteria 2069
101 Ga0068854_100103200 3300005578 Bacteria 2140
102 Ga0068856_100110413 3300005614 Bacteria 2747
103 Ga0068856_100246984 3300005614 Bacteria 1800
104 Ga0070702_100036072 3300005615 Bacteria 2736
105 Ga0070702_100218091 3300005615 Bacteria 1274
106 Ga0070702_100259079 3300005615 Bacteria 1183
107 Ga0070702_100346934 3300005615 Bacteria 1044
108 Ga0068859_100149112 3300005617 Bacteria 2415
109 Ga0068859_100193521 3300005617 Bacteria 2118
110 Ga0068864_100397581 3300005618 Bacteria 1309
111 Ga0068864_100418600 3300005618 Bacteria 1276
112 Ga0068870_10005222 3300005840 Bacteria 5652
113 Ga0068863_100007012 3300005841 Bacteria 11043
114 Ga0068863_100155966 3300005841 Bacteria 2186
115 Ga0068863_100500957 3300005841 Bacteria 1196
116 Ga0068858_100016071 3300005842 Bacteria 7031
117 Ga0068858_100383926 3300005842 Bacteria 1348
118 Ga0068860_100040442 3300005843 Bacteria 4455
119 Ga0068860_100216486 3300005843 Bacteria 1859
120 Ga0068862_100011484 3300005844 Bacteria 7311
121 Ga0068862_100029912 3300005844 Bacteria 4589
122 Ga0068862_100840405 3300005844 Bacteria 899
123 Ga0068862_101167701 3300005844 Bacteria 767
124 Ga0081455_10010899 3300005937 Bacteria 9174
125 Ga0081455_10033604 3300005937 Bacteria 4607
126 Ga0081455_10469817 3300005937 Bacteria 854
127 Ga0081538_10029065 3300005981 Bacteria 3785
128 Ga0081538_10034984 3300005981 Bacteria 3309
129 Ga0081538_10078950 3300005981 Bacteria 1763
130 Ga0081540_1017139 3300005983 Bacteria 4497
131 Ga0081539_10015587 3300005985 Bacteria 5512
132 Ga0070717_10022811 3300006028 Bacteria 4951
133 Ga0070717_10057188 3300006028 Bacteria 3224
134 Ga0070717_10059609 3300006028 Bacteria 3159
135 Ga0070717_10167415 3300006028 Bacteria 1910
136 Ga0070717_10310901 3300006028 Bacteria 1402
137 Ga0075365_10001017 3300006038 Bacteria 12044
138 Ga0075365_10007361 3300006038 Bacteria 6157
139 Ga0075365_10026251 3300006038 Bacteria 3696
140 Ga0075365_10041020 3300006038 Bacteria 3021
141 Ga0075365_10047027 3300006038 Bacteria 2835
142 Ga0075365_10078435 3300006038 Bacteria 2233
143 Ga0075365_10141855 3300006038 Bacteria 1668
144 Ga0075365_10333070 3300006038 Bacteria 1069
145 Ga0075365_10386415 3300006038 Bacteria 987
146 Ga0075368_10065813 3300006042 Bacteria 1456
147 Ga0075368_10194856 3300006042 Bacteria 856
148 Ga0075363_100076097 3300006048 Bacteria 1829
149 Ga0075363_100137181 3300006048 Bacteria 1375
150 Ga0075363_100151318 3300006048 Bacteria 1310
151 Ga0075363_100288731 3300006048 Bacteria 950
152 Ga0075364_10033452 3300006051 Bacteria 3311
153 Ga0075364_10083572 3300006051 Bacteria 2113
154 Ga0070715_10127066 3300006163 Bacteria 1222
155 Ga0070715_10174973 3300006163 Bacteria 1072
156 Ga0070716_100022930 3300006173 Bacteria 3305
157 Ga0070712_100004847 3300006175 Bacteria 8318
158 Ga0070712_100033476 3300006175 Bacteria 3478
159 Ga0070712_100088621 3300006175 Bacteria 2261
160 Ga0075362_10013531 3300006177 Bacteria 3268
161 Ga0075362_10051552 3300006177 Bacteria 1842
162 Ga0075367_10047397 3300006178 Bacteria 2528
163 Ga0075367_10140312 3300006178 Bacteria 1497
164 Ga0075367_10172944 3300006178 Bacteria 1346
165 Ga0075367_10218491 3300006178 Bacteria 1192
166 Ga0075367_10305587 3300006178 Bacteria 1001
167 Ga0075369_10005025 3300006186 Bacteria 4926
168 Ga0075369_10047996 3300006186 Bacteria 1842
169 Ga0075369_10189107 3300006186 Bacteria 948
170 Ga0075366_10008616 3300006195 Bacteria 5679
171 Ga0075366_10013786 3300006195 Bacteria 4607
172 Ga0075366_10036925 3300006195 Bacteria 2882
173 Ga0075366_10193129 3300006195 Bacteria 1237
174 Ga0075366_10404603 3300006195 Bacteria 840
175 Ga0075370_10027696 3300006353 Bacteria 3147
176 Ga0075370_10099290 3300006353 Bacteria 1684
177 Ga0068871_100067335 3300006358 Bacteria 2937
178 Ga0068871_100113778 3300006358 Bacteria 2279
179 Ga0075428_100001218 3300006844 Bacteria 27549
180 Ga0075428_100022676 3300006844 Bacteria 6949
181 Ga0075428_100573027 3300006844 Bacteria 1206
182 Ga0075428_100624086 3300006844 Bacteria 1150
183 Ga0075430_100000152 3300006846 Bacteria 44881
184 Ga0075430_100025527 3300006846 Bacteria 5027
185 Ga0075430_100045037 3300006846 Bacteria 3729
186 Ga0075430_100198426 3300006846 Bacteria 1667
187 Ga0075431_100000613 3300006847 Bacteria 30137
188 Ga0075431_100010947 3300006847 Bacteria 9128
189 Ga0075431_100062491 3300006847 Bacteria 3843
190 Ga0075431_100064062 3300006847 Bacteria 3795
191 Ga0075431_100582744 3300006847 Bacteria 1104
192 Ga0075431_101208336 3300006847 Bacteria 719
193 Ga0075433_10059850 3300006852 Bacteria 3333
194 Ga0075433_10298209 3300006852 Bacteria 1427
195 Ga0075434_100017361 3300006871 Bacteria 6930
196 Ga0075434_100056047 3300006871 Bacteria 3916
197 Ga0075434_100269646 3300006871 Bacteria 1721
198 Ga0075429_100004424 3300006880 Bacteria 12075
199 Ga0075429_100274586 3300006880 Bacteria 1476
200 Ga0075429_100429975 3300006880 Bacteria 1157
201 Ga0068865_100098503 3300006881 Bacteria 2136
202 Ga0068865_100403720 3300006881 Bacteria 1120
203 Ga0075436_100000477 3300006914 Bacteria 26044
204 Ga0075436_100028761 3300006914 Bacteria 3823
205 Ga0075436_100520032 3300006914 Bacteria 872
206 Ga0097620_100149123 3300006931 Bacteria 2415
207 Ga0097620_100193536 3300006931 Bacteria 2118
208 Ga0075435_100076627 3300007076 Bacteria 2741
209 Ga0075435_100079110 3300007076 Bacteria 2697
210 Ga0099794_10089867 3300007265 Bacteria 1523
211 Ga0099795_10001007 3300007788 Bacteria 5787
212 Ga0099795_10025722 3300007788 Bacteria 1976
213 Ga0105251_10054542 3300009011 Bacteria 1898
214 Ga0105240_10026738 3300009093 Bacteria 7568
215 Ga0111539_10000840 3300009094 Bacteria 39968
216 Ga0111539_10044534 3300009094 Bacteria 5317
217 Ga0111539_10083183 3300009094 Bacteria 3764
218 Ga0111539_10089489 3300009094 Bacteria 3617
219 Ga0111539_10106273 3300009094 Bacteria 3293
220 Ga0111539_10168821 3300009094 Bacteria 2557
221 Ga0111539_10241880 3300009094 Bacteria 2101
222 Ga0105245_10028096 3300009098 Bacteria 4958
223 Ga0105245_10201889 3300009098 Bacteria 1910
224 Ga0105247_10110832 3300009101 Bacteria 1766
225 Ga0105247_10228451 3300009101 Bacteria 1263
226 Ga0114129_10000320 3300009147 Bacteria 56319
227 Ga0114129_10002097 3300009147 Bacteria 27432
228 Ga0114129_10051669 3300009147 Bacteria 5770
229 Ga0114129_10061592 3300009147 Bacteria 5244
230 Ga0114129_11430534 3300009147 Bacteria 852
231 Ga0105243_10023744 3300009148 Bacteria 4674
232 Ga0105243_10221733 3300009148 Bacteria 1672
233 Ga0105241_10024393 3300009174 Bacteria 4490
234 Ga0105241_10075452 3300009174 Bacteria 2627
235 Ga0105241_10116553 3300009174 Bacteria 2145
236 Ga0105241_10639123 3300009174 Bacteria 965
237 Ga0105242_10102353 3300009176 Bacteria 2429
238 Ga0105242_10390973 3300009176 Bacteria 1295
239 Ga0105248_10039516 3300009177 Bacteria 5285
240 Ga0105248_10629824 3300009177 Bacteria 1210
241 Ga0105237_10047128 3300009545 Bacteria 4334
242 Ga0105237_10092024 3300009545 Bacteria 3022
243 Ga0105237_10640661 3300009545 Bacteria 1070
244 Ga0105238_10080512 3300009551 Bacteria 3246
245 Ga0105238_10277946 3300009551 Bacteria 1655
246 Ga0105238_10855019 3300009551 Bacteria 927
247 Ga0099796_10006006 3300010159 Bacteria 3078
248 Ga0099796_10043499 3300010159 Bacteria 1530
249 Ga0099796_10048748 3300010159 Bacteria 1462
250 Ga0105239_10007779 3300010375 Bacteria 12264
251 Ga0105239_10307471 3300010375 Bacteria 1786
252 Ga0105246_10076930 3300011119 Bacteria 2366
253 Ga0105246_10103701 3300011119 Bacteria 2076
254 Ga0105246_10241714 3300011119 Bacteria 1428
255 Ga0105246_10557154 3300011119 Bacteria 983
256 Ga0157373_10015435 3300013100 Bacteria 5584
257 Ga0157373_10242012 3300013100 Bacteria 1275
258 Ga0157374_10144995 3300013296 Bacteria 2306
259 Ga0157378_10142728 3300013297 Bacteria 2225
260 Ga0157378_10430782 3300013297 Bacteria 1305
261 Ga0157378_11203288 3300013297 Bacteria 797
262 Ga0163162_10090461 3300013306 Bacteria 3142
263 Ga0163162_10736081 3300013306 Bacteria 1106
264 Ga0157372_10016504 3300013307 Bacteria 7925
265 Ga0157372_11029520 3300013307 Bacteria 953
266 Ga0157375_10369079 3300013308 Bacteria 1601
267 Ga0163163_10039625 3300014325 Bacteria 4599
268 Ga0163163_10623628 3300014325 Bacteria 1142
269 Ga0157380_10084701 3300014326 Bacteria 2600
270 Ga0157380_10137661 3300014326 Bacteria 2092
271 Ga0157377_10005862 3300014745 Bacteria 5811
272 Ga0157379_10056034 3300014968 Bacteria 3523
273 Ga0157379_10144281 3300014968 Bacteria 2147
274 Ga0157376_10111300 3300014969 Bacteria 2411
275 Ga0157376_10571090 3300014969 Bacteria 1122
276 Ga0163161_10009501 3300017792 Bacteria 6729
277 Ga0224572_1001576 3300024225 Bacteria 3423
278 Ga0209148_1000274 3300025254 Bacteria 81201
279 Ga0209148_1001585 3300025254 Bacteria 10738
280 Ga0209758_1000059 3300025297 Bacteria 328458
281 Ga0209758_1001730 3300025297 Bacteria 24307
282 Ga0209758_1001908 3300025297 Bacteria 22695
283 Ga0209758_1036239 3300025297 Bacteria 1929
284 Ga0209758_1046740 3300025297 Bacteria 1556
285 Ga0209050_1002314 3300025298 Bacteria 16763
286 Ga0209256_1068092 3300025299 Bacteria 809
287 Ga0207426_1000143 3300025302 Bacteria 192948
288 Ga0209257_1000114 3300025304 Bacteria 233013
289 Ga0209257_1019160 3300025304 Bacteria 2592
290 Ga0209257_1030530 3300025304 Bacteria 1739
291 Ga0207692_10009902 3300025898 Bacteria 3996
292 Ga0207692_10029373 3300025898 Bacteria 2612
293 Ga0207642_10000663 3300025899 Bacteria 10572
294 Ga0207642_10138146 3300025899 Bacteria 1281
295 Ga0207710_10023256 3300025900 Bacteria 2663
296 Ga0207688_10000130 3300025901 Bacteria 31681
297 Ga0207688_10068808 3300025901 Bacteria 2006
298 Ga0207688_10273334 3300025901 Bacteria 1028
299 Ga0207647_10002385 3300025904 Bacteria 14262
300 Ga0207685_10061678 3300025905 Bacteria 1487
301 Ga0207699_10001003 3300025906 Bacteria 13374
302 Ga0207645_10049854 3300025907 Bacteria 2674
303 Ga0207643_10001981 3300025908 Bacteria 11312
304 Ga0207705_10315453 3300025909 Bacteria 1201
305 Ga0207654_10063597 3300025911 Bacteria 2166
306 Ga0207707_10045123 3300025912 Bacteria 3841
307 Ga0207707_10121547 3300025912 Bacteria 2283
308 Ga0207695_10050992 3300025913 Bacteria 4348
309 Ga0207671_10087282 3300025914 Unclassified 2346
310 Ga0207693_10004368 3300025915 Bacteria 11957
311 Ga0207693_10045948 3300025915 Bacteria 3431
312 Ga0207693_10062706 3300025915 Bacteria 2913
313 Ga0207693_10080870 3300025915 Bacteria 2543
314 Ga0207693_10253175 3300025915 Bacteria 1382
315 Ga0207663_10012503 3300025916 Bacteria 4591
316 Ga0207663_10046371 3300025916 Bacteria 2677
317 Ga0207660_10174649 3300025917 Bacteria 1665
318 Ga0207660_10294967 3300025917 Bacteria 1290
319 Ga0207662_10147737 3300025918 Bacteria 1493
320 Ga0207657_10032651 3300025919 Bacteria 4701
321 Ga0207652_10043743 3300025921 Bacteria 3813
322 Ga0207652_10102515 3300025921 Bacteria 2529
323 Ga0207652_10413202 3300025921 Bacteria 1217
324 Ga0207681_10054305 3300025923 Bacteria 2723
325 Ga0207681_10364887 3300025923 Bacteria 1159
326 Ga0207694_10127645 3300025924 Bacteria 2036
327 Ga0207694_10175041 3300025924 Bacteria 1739
328 Ga0207650_10004418 3300025925 Bacteria 9604
329 Ga0207650_10014049 3300025925 Bacteria 5559
330 Ga0207650_10025768 3300025925 Bacteria 4190
331 Ga0207659_10012143 3300025926 Bacteria 5464
332 Ga0207659_10066708 3300025926 Bacteria 2612
333 Ga0207659_10099922 3300025926 Bacteria 2185
334 Ga0207687_10005289 3300025927 Bacteria 8555
335 Ga0207687_10061597 3300025927 Bacteria 2650
336 Ga0207700_10058615 3300025928 Bacteria 2909
337 Ga0207700_10084407 3300025928 Bacteria 2489
338 Ga0207700_10452787 3300025928 Bacteria 1131
339 Ga0207700_10977642 3300025928 Bacteria 758
340 Ga0207664_10030708 3300025929 Bacteria 4105
341 Ga0207664_10156957 3300025929 Bacteria 1938
342 Ga0207664_10182416 3300025929 Bacteria 1803
343 Ga0207644_10006827 3300025931 Bacteria 7440
344 Ga0207644_10025164 3300025931 Bacteria 4091
345 Ga0207644_10102456 3300025931 Bacteria 2153
346 Ga0207706_10002801 3300025933 Bacteria 16940
347 Ga0207686_10054100 3300025934 Bacteria 2513
348 Ga0207709_10015455 3300025935 Bacteria 4233
349 Ga0207709_10177333 3300025935 Bacteria 1501
350 Ga0207670_10021754 3300025936 Bacteria 3962
351 Ga0207670_10052934 3300025936 Bacteria 2732
352 Ga0207670_10076670 3300025936 Bacteria 2327
353 Ga0207670_10305155 3300025936 Bacteria 1248
354 Ga0207669_10007567 3300025937 Bacteria 5035
355 Ga0207704_10196064 3300025938 Bacteria 1473
356 Ga0207665_10029125 3300025939 Bacteria 3651
357 Ga0207665_10281471 3300025939 Bacteria 1238
358 Ga0207691_10011407 3300025940 Bacteria 8528
359 Ga0207691_10540575 3300025940 Bacteria 988
360 Ga0207711_10016266 3300025941 Bacteria 6178
361 Ga0207711_10090712 3300025941 Bacteria 2687
362 Ga0207689_10000756 3300025942 Bacteria 31021
363 Ga0207679_10024806 3300025945 Bacteria 4115
364 Ga0207667_10354994 3300025949 Bacteria 1495
365 Ga0207667_10358477 3300025949 Bacteria 1487
366 Ga0207651_10003263 3300025960 Bacteria 7943
367 Ga0207651_10007290 3300025960 Bacteria 5879
368 Ga0207651_10072681 3300025960 Bacteria 2443
369 Ga0207651_10799889 3300025960 Bacteria 836
370 Ga0207712_10017551 3300025961 Bacteria 4650
371 Ga0207668_10028885 3300025972 Bacteria 3630
372 Ga0207668_10485434 3300025972 Bacteria 1060
373 Ga0207668_10767144 3300025972 Bacteria 852
374 Ga0207640_10015569 3300025981 Bacteria 4406
375 Ga0207677_10006114 3300026023 Bacteria 6574
376 Ga0207703_10011569 3300026035 Bacteria 6861
377 Ga0207703_10783315 3300026035 Bacteria 910
378 Ga0207639_10012134 3300026041 Bacteria 5994
379 Ga0207639_10143515 3300026041 Bacteria 1992
380 Ga0207678_10038702 3300026067 Bacteria 4142
381 Ga0207678_10042400 3300026067 Bacteria 3942
382 Ga0207678_10121665 3300026067 Bacteria 2227
383 Ga0207708_10004345 3300026075 Bacteria 10438
384 Ga0207702_10543101 3300026078 Bacteria 1136
385 Ga0207641_10058535 3300026088 Bacteria 3279
386 Ga0207641_10162421 3300026088 Bacteria 2032
387 Ga0207641_10991663 3300026088 Bacteria 836
388 Ga0207648_10009209 3300026089 Bacteria 9483
389 Ga0207648_10060490 3300026089 Bacteria 3303
390 Ga0207676_10007771 3300026095 Bacteria 7625
391 Ga0207676_10132024 3300026095 Bacteria 2125
392 Ga0207676_10308045 3300026095 Bacteria 1449
393 Ga0207674_10184805 3300026116 Bacteria 2035
394 Ga0207675_100004438 3300026118 Bacteria 13564
395 Ga0207683_10015749 3300026121 Bacteria 6434
396 Ga0207683_10049872 3300026121 Bacteria 3665
397 Ga0207683_10090523 3300026121 Bacteria 2725
398 Ga0207683_10572721 3300026121 Unclassified 1044
399 Ga0207698_10115378 3300026142 Bacteria 2261
400 Ga0209813_10005872 3300027866 Bacteria 3006
401 Ga0209813_10039324 3300027866 Bacteria 1433
402 Ga0209813_10074582 3300027866 Bacteria 1110
403 Ga0207428_10017604 3300027907 Bacteria 6127
404 Ga0207428_10066313 3300027907 Bacteria 2845
405 Ga0207428_10123330 3300027907 Bacteria 1985
406 Ga0268266_10209882 3300028379 Bacteria 1785
407 Ga0268266_10319538 3300028379 Bacteria 1453
408 Ga0268265_10015994 3300028380 Bacteria 5148
409 Ga0268264_10244109 3300028381 Bacteria 1665
410 Ga0268264_10733889 3300028381 Bacteria 983
411 Ga0307515_10091636 3300028794 Bacteria 3795
412 Ga0265324_10060633 3300029957 Bacteria 1293
413 Ga0307512_10186941 3300030522 Bacteria 1151
414 Ga0265762_1004526 3300030760 Bacteria 2488
415 Ga0265763_1001918 3300030763 Bacteria 1545
416 Ga0265328_10012454 3300031239 Bacteria 3384
417 Ga0265325_10014052 3300031241 Bacteria 4539
418 Ga0265340_10034405 3300031247 Bacteria 2520
419 Ga0265331_10000333 3300031250 Bacteria 50586
420 Ga0265327_10000775 3300031251 Bacteria 49295
421 Ga0265327_10091170 3300031251 Bacteria 1486
422 Ga0265316_10374520 3300031344 Bacteria 1028
423 Ga0307513_10451469 3300031456 Bacteria 1010
424 Ga0307408_100242164 3300031548 Bacteria 1483
425 Ga0265313_10073434 3300031595 Bacteria 1570
426 Ga0307508_10047520 3300031616 Bacteria 3827
427 Ga0316215_1000920 3300033544 Bacteria 2876
428 Ga0373926_0006659 3300035083 Bacteria 3836
429 Ga0373926_0162366 3300035083 Bacteria 853
430 Ga0373929_0010236 3300035085 Bacteria 1751
431 Ga0373940_0007997 3300035088 Bacteria 2410
432 Ga0373944_0001173 3300035089 Bacteria 6541
433 Ga0373923_0002035 3300035111 Bacteria 6094
434 Ga0373936_0001796 3300035113 Bacteria 7889
435 Ga0373936_0047960 3300035113 Bacteria 1724
436 Ga0373936_0165075 3300035113 Bacteria 966
437 Ga0373939_0001290 3300035114 Bacteria 6094
438 Ga0373945_0005121 3300035116 Bacteria 4184
439 Ga0373945_0007492 3300035116 Bacteria 3538
440 Ga0373945_0007797 3300035116 Bacteria 3473
441 Ga0373945_0017489 3300035116 Bacteria 2428
442 Ga0373953_0032305 3300035117 Bacteria 2041
443 Ga0373956_0012955 3300035119 Bacteria 3464
444 Ga0373956_0037590 3300035119 Bacteria 2140
445 Ga0373943_0000381 3300035170 Bacteria 18615
446 Ga0373943_0002159 3300035170 Bacteria 8946
447 Ga0373943_0015098 3300035170 Bacteria 3506
448 Ga0373943_0031493 3300035170 Bacteria 2516
449 Ga0373943_0077253 3300035170 Bacteria 1700
450 Ga0373943_0224374 3300035170 Bacteria 1047
451 Ga0373946_0002070 3300035171 Bacteria 7041
452 Ga0373946_0036439 3300035171 Bacteria 1995
453 Ga0373946_0052451 3300035171 Unclassified 1711
454 Ga0373955_0002179 3300035172 Bacteria 8483
455 Ga0373955_0007537 3300035172 Bacteria 5007
456 Ga0373962_0041982 3300035242 Bacteria 1292
457 Ga0373924_0015268 3300035410 Bacteria 2917
458 Ga0373924_0031708 3300035410 Bacteria 2127
459 Ga0373924_0102603 3300035410 Bacteria 1231
460 Ga0373931_0086002 3300035691 Bacteria 1744
461 Ga0373935_0000006 3300035692 Bacteria 121726
462 Ga0373935_0034107 3300035692 Bacteria 3171
463 Ga0373935_0049660 3300035692 Bacteria 2660
464 Ga0373935_0053179 3300035692 Bacteria 2576
465 Ga0373935_0105630 3300035692 Bacteria 1862
466 Ga0373935_0170453 3300035692 Bacteria 1489
467 Ga0373927_0003706 3300035695 Bacteria 10864
468 Ga0373927_0013209 3300035695 Bacteria 5492
469 Ga0373927_0015339 3300035695 Bacteria 5061
470 Ga0373927_0015712 3300035695 Bacteria 4998
471 Ga0373927_0018500 3300035695 Bacteria 4578
472 Ga0373927_0029730 3300035695 Bacteria 3563
473 Ga0373927_0171463 3300035695 Bacteria 1422
474 Ga0373927_0238671 3300035695 Bacteria 1194
475 Ga0373927_0547269 3300035695 Bacteria 765
476 Ga0373933_0000007 3300035724 Bacteria 123599
477 Ga0373933_0004171 3300035724 Bacteria 7960
478 Ga0373933_0056949 3300035724 Bacteria 2348
479 Ga0373947_0000419 3300035725 Bacteria 24144
480 Ga0373947_0001498 3300035725 Bacteria 14333
481 Ga0373947_0003146 3300035725 Bacteria 9827
482 Ga0373947_0006728 3300035725 Bacteria 6668
483 Ga0373947_0016255 3300035725 Bacteria 4277
484 Ga0373947_0019872 3300035725 Bacteria 3877
485 Ga0373947_0033265 3300035725 Bacteria 3042
486 Ga0373947_0105033 3300035725 Bacteria 1779
487 Ga0373947_0139717 3300035725 Bacteria 1553
488 Ga0373937_0000124 3300036401 Bacteria 73933
489 Ga0373937_0018439 3300036401 Bacteria 6233
490 Ga0373937_0025281 3300036401 Bacteria 5361
491 Ga0373937_0047656 3300036401 Bacteria 3922
492 Ga0372808_000937 3300036459 Bacteria 2747
493 Ga0373925_0000210 3300037068 Bacteria 63621
494 Ga0373925_0004278 3300037068 Bacteria 10818
495 Ga0373925_0006000 3300037068 Bacteria 8997
496 Ga0373925_0006086 3300037068 Bacteria 8923
497 Ga0373925_0026431 3300037068 Bacteria 4247
498 Ga0373925_0032271 3300037068 Bacteria 3854
499 Ga0373925_0083949 3300037068 Bacteria 2426
500 Ga0373925_0284217 3300037068 Bacteria 1333
501 Ga0373925_0594639 3300037068 Bacteria 911
502 Ga0395900_0534211 3300037418 Bacteria 1119
503 Ga0395898_0179458 3300037466 Bacteria 2024
504 Ga0395901_0266328 3300038443 Bacteria 1783
505 Ga0436365_0368397 3300039437 Bacteria 2822
506 Ga0436365_1370429 3300039437 Bacteria 3332
507 Ga0436360_0320708 3300039438 Bacteria 3652
508 Ga0436361_0622258 3300039447 Bacteria 7351
509 Ga0451800_0784539 3300041459 Bacteria 1043
510 Ga0451807_2166610 3300041486 Bacteria 950
511 Ga0451849_0087101 3300041505 Bacteria 725
512 Ga0439448_0084842 3300042005 Bacteria 1066
513 Ga0439456_078854 3300042013 Unclassified 734
514 Ga0453683_0473469 3300044673 Unclassified 811
515 Ga0466965_0102315 3300044683 Bacteria 1466
516 Ga0466963_0017811 3300044694 Bacteria 4432
517 Ga0466964_0163810 3300044706 Bacteria 1041
518 Ga0453684_0000006 3300044712 Bacteria 1364191
519 Ga0453684_0000031 3300044712 Bacteria 752632
520 Ga0453684_0008102 3300044712 Bacteria 18989
521 Ga0453684_0112756 3300044712 Unclassified 3300
522 Ga0453684_0313101 3300044712 Bacteria 1780
523 Ga0453684_1220544 3300044712 Bacteria 788
524 Ga0466970_0243946 3300044765 Bacteria 1006
525 Ga0466967_0024864 3300045976 Bacteria 4931
526 Ga0466967_0069388 3300045976 Bacteria 3150
527 Ga0495617_078930 3300046452 Bacteria 1079
528 Ga0495592_0000020 3300046454 Bacteria 140576
529 Ga0495592_0026318 3300046454 Bacteria 4411
530 Ga0495592_0034109 3300046454 Bacteria 3837
531 Ga0495592_0095454 3300046454 Unclassified 2127
532 Ga0495603_0001017 3300046455 Bacteria 16170
533 Ga0495629_0001626 3300046459 Bacteria 17663
534 Ga0495629_0006124 3300046459 Bacteria 8936
535 Ga0495629_0008249 3300046459 Bacteria 7659
536 Ga0495629_0044612 3300046459 Bacteria 3111
537 Ga0495629_0258401 3300046459 Bacteria 1197
538 Ga0495629_0444729 3300046459 Bacteria 878
539 Ga0495638_0011195 3300046460 Bacteria 6192
540 Ga0495641_0114372 3300046461 Bacteria 1203
541 Ga0495651_0000282 3300046462 Bacteria 39576
542 Ga0495651_0001410 3300046462 Bacteria 18660
543 Ga0495653_0000046 3300046463 Bacteria 113893
544 Ga0495653_0001155 3300046463 Bacteria 20322
545 Ga0495653_0092433 3300046463 Bacteria 2209
546 Ga0495580_0000806 3300046472 Bacteria 27108
547 Ga0495580_0147371 3300046472 Bacteria 1631
548 Ga0495582_0001348 3300046473 Bacteria 13795
549 Ga0495582_0059585 3300046473 Bacteria 2106
550 Ga0495582_0096554 3300046473 Bacteria 1652
551 Ga0495639_0001292 3300046475 Bacteria 11259
552 Ga0495639_0133006 3300046475 Bacteria 1192
553 Ga0495639_0146341 3300046475 Bacteria 1138
554 Ga0495639_0307503 3300046475 Bacteria 791
555 Ga0495662_0001018 3300046476 Bacteria 13751
556 Ga0495662_0130074 3300046476 Bacteria 1237
557 Ga0495662_0139554 3300046476 Bacteria 1193
558 Ga0495664_0000017 3300046477 Bacteria 172210
559 Ga0495664_0000670 3300046477 Bacteria 17396
560 Ga0495664_0064886 3300046477 Bacteria 2176
561 Ga0495584_0008719 3300046491 Bacteria 5244
562 Ga0495584_0032467 3300046491 Bacteria 2643
563 Ga0495584_0187068 3300046491 Bacteria 1052
564 Ga0495594_0000401 3300046499 Bacteria 21822
565 Ga0495607_0103777 3300046501 Bacteria 1518
566 Ga0495607_0104439 3300046501 Bacteria 1512
567 Ga0495607_0233215 3300046501 Bacteria 894
568 Ga0495606_0110584 3300046507 Bacteria 1658
569 Ga0495608_0000250 3300046511 Bacteria 39000
570 Ga0495608_0010843 3300046511 Bacteria 6352
571 Ga0495608_0081432 3300046511 Bacteria 2103
572 Ga0495610_0021653 3300046512 Bacteria 3529
573 Ga0495616_0071391 3300046513 Bacteria 1679
574 Ga0495616_0191170 3300046513 Bacteria 905
575 Ga0495618_0000059 3300046514 Bacteria 79623
576 Ga0495618_0002157 3300046514 Bacteria 12882
577 Ga0495618_0002703 3300046514 Bacteria 11302
578 Ga0495618_0237435 3300046514 Unclassified 1146
579 Ga0495620_0064800 3300046515 Bacteria 1510
580 Ga0495628_0000022 3300046516 Bacteria 140362
581 Ga0495628_0015475 3300046516 Bacteria 6370
582 Ga0495628_0056961 3300046516 Bacteria 3075
583 Ga0495628_0245684 3300046516 Bacteria 1337
584 Ga0495630_0000758 3300046517 Bacteria 22647
585 Ga0495630_0011807 3300046517 Bacteria 6330
586 Ga0495630_0104242 3300046517 Bacteria 2147
587 Ga0495630_0310229 3300046517 Bacteria 1206
588 Ga0495630_0347433 3300046517 Bacteria 1135
589 Ga0495631_0020740 3300046518 Bacteria 3067
590 Ga0495637_0135961 3300046520 Bacteria 936
591 Ga0495643_0215295 3300046522 Bacteria 914
592 Ga0495644_0095070 3300046523 Bacteria 1126
593 Ga0495648_0082144 3300046524 Bacteria 1830
594 Ga0495663_0063692 3300046525 Bacteria 1163
595 Ga0495666_0114782 3300046526 Bacteria 1264
596 Ga0495666_0204169 3300046526 Bacteria 908
597 Ga0495652_0000008 3300046529 Bacteria 343637
598 Ga0495652_0001912 3300046529 Bacteria 22147
599 Ga0495652_0026195 3300046529 Bacteria 5154
600 Ga0495652_0153943 3300046529 Bacteria 1792
601 Ga0495652_0365284 3300046529 Bacteria 1030
602 Ga0495665_0123950 3300046531 Bacteria 1353
603 Ga0495665_0137291 3300046531 Bacteria 1279
604 Ga0495665_0269460 3300046531 Bacteria 875
605 Ga0495640_0000029 3300046533 Bacteria 79567
606 Ga0495640_0008277 3300046533 Bacteria 8158
607 Ga0495640_0012288 3300046533 Bacteria 6548
608 Ga0495640_0033432 3300046533 Bacteria 3652
609 Ga0495640_0092337 3300046533 Bacteria 1996
610 Ga0495586_0010651 3300046535 Bacteria 4890
611 Ga0495587_0000019 3300046536 Bacteria 161972
612 Ga0495587_0006011 3300046536 Bacteria 7910
613 Ga0495598_0010537 3300046537 Bacteria 2216
614 Ga0495645_0000006 3300046543 Bacteria 382503
615 Ga0495645_0008317 3300046543 Bacteria 7243
616 Ga0495645_0175214 3300046543 Bacteria 1473
617 Ga0495645_0204885 3300046543 Bacteria 1335
618 Ga0495622_0046788 3300046557 Bacteria 2010
619 Ga0495622_0118276 3300046557 Bacteria 1211
620 Ga0495633_0061264 3300046558 Bacteria 1762
621 Ga0495667_0000061 3300046559 Bacteria 94650
622 Ga0495667_0000879 3300046559 Bacteria 19393
623 Ga0495656_0001123 3300046615 Bacteria 8705
624 Ga0495656_0034826 3300046615 Bacteria 2065
625 Ga0495668_0053325 3300046616 Bacteria 2236
626 Ga0495634_0001212 3300046642 Bacteria 23807
627 Ga0495634_0001468 3300046642 Bacteria 20895
628 Ga0495634_0007204 3300046642 Bacteria 8386
629 Ga0495634_0007643 3300046642 Bacteria 8097
630 Ga0495634_0189376 3300046642 Bacteria 1284
631 Ga0495634_0297489 3300046642 Bacteria 976
632 Ga0495611_0251504 3300046648 Bacteria 819
633 Ga0495625_0034767 3300046660 Bacteria 3717
634 Ga0495625_0325743 3300046660 Bacteria 977
635 Ga0495625_0346003 3300046660 Unclassified 941
636 Ga0495635_0000023 3300046663 Bacteria 153429
637 Ga0495635_0009308 3300046663 Bacteria 6862
638 Ga0495635_0050714 3300046663 Bacteria 2860
639 Ga0495635_0135616 3300046663 Bacteria 1678
640 Ga0495635_0169013 3300046663 Bacteria 1487
641 Ga0495661_0016354 3300046665 Bacteria 4920
642 Ga0495661_0018986 3300046665 Bacteria 4511
643 Ga0495588_0005816 3300046674 Bacteria 5516
644 Ga0495657_0000099 3300046675 Bacteria 76617
645 Ga0495657_0031948 3300046675 Bacteria 3677
646 Ga0495599_0000039 3300046678 Bacteria 98345
647 Ga0495599_0068733 3300046678 Bacteria 2211
648 Ga0495599_0183154 3300046678 Bacteria 1290
649 Ga0495623_0000253 3300046679 Bacteria 34266
650 Ga0495623_0002814 3300046679 Bacteria 11476
651 Ga0495623_0163132 3300046679 Bacteria 1308
652 Ga0495646_0000017 3300046680 Bacteria 123549
653 Ga0495646_0010331 3300046680 Bacteria 5936
654 Ga0495646_0115426 3300046680 Bacteria 1525
655 Ga0495646_0156346 3300046680 Bacteria 1265
656 Ga0495647_0006744 3300046681 Bacteria 3822
657 Ga0495647_0068679 3300046681 Bacteria 1414
658 Ga0495658_0003498 3300046683 Bacteria 7772
659 Ga0495658_0036061 3300046683 Bacteria 2726
660 Ga0495658_0046803 3300046683 Bacteria 2433
661 Ga0495658_0069182 3300046683 Bacteria 2046
662 Ga0495658_0082845 3300046683 Bacteria 1885
663 Ga0495658_0165063 3300046683 Unclassified 1368
664 Ga0495669_0090032 3300046684 Bacteria 1416
665 Ga0495613_0000508 3300046689 Bacteria 32835
666 Ga0495613_0026976 3300046689 Bacteria 4276
667 Ga0495613_0049670 3300046689 Bacteria 3095
668 Ga0495613_0597593 3300046689 Bacteria 735
669 Ga0495624_0032723 3300046690 Bacteria 3370
670 Ga0495624_0036798 3300046690 Bacteria 3153
671 Ga0495624_0047972 3300046690 Bacteria 2712
672 Ga0495624_0107846 3300046690 Bacteria 1713
673 Ga0495624_0208057 3300046690 Bacteria 1187
674 Ga0495670_0005031 3300046691 Bacteria 6504
675 Ga0495671_0088284 3300046692 Bacteria 1518
676 Ga0495649_0073715 3300046694 Bacteria 1829
677 Ga0495649_0100214 3300046694 Bacteria 1540
678 Ga0495589_0282080 3300046794 Bacteria 772
679 Ga0495600_0000030 3300046809 Bacteria 89424
680 Ga0495581_0015077 3300047315 Bacteria 4487
681 Ga0495581_0071686 3300047315 Bacteria 2005
682 Ga0495581_0078613 3300047315 Bacteria 1909
683 Ga0495581_0163574 3300047315 Bacteria 1301
684 Ga0495604_0000030 3300047317 Bacteria 138597
685 Ga0495604_0000662 3300047317 Bacteria 29274
686 Ga0495604_0515409 3300047317 Bacteria 774
687 Ga0495674_0000009 3300047319 Bacteria 310479
688 Ga0495674_0002163 3300047319 Bacteria 19301
689 Ga0495674_0013531 3300047319 Bacteria 7669
690 Ga0495674_0479164 3300047319 Bacteria 997
691 Ga0495676_0104282 3300047321 Bacteria 2093
692 Ga0495676_0116718 3300047321 Bacteria 1948
693 Ga0495676_0120623 3300047321 Bacteria 1908
694 Ga0495676_0192362 3300047321 Bacteria 1422
695 Ga0495676_0200553 3300047321 Bacteria 1387
696 Ga0495676_0241159 3300047321 Unclassified 1237
697 Ga0495680_0000359 3300047322 Bacteria 51000
698 Ga0495680_0001209 3300047322 Bacteria 28308
699 Ga0495680_0040382 3300047322 Bacteria 3719
700 Ga0495680_0238091 3300047322 Unclassified 1294
701 Ga0495680_0339882 3300047322 Bacteria 1047
702 Ga0495675_0000056 3300047444 Bacteria 77625
703 Ga0495675_0008977 3300047444 Bacteria 6217
704 Ga0495684_0000056 3300047471 Bacteria 79718
705 Ga0495684_0001278 3300047471 Bacteria 20227
706 Ga0495684_0074981 3300047471 Bacteria 2570
707 Ga0495686_0214595 3300047472 Bacteria 1098
708 Ga0495686_0262390 3300047472 Bacteria 966
709 Ga0495593_0003363 3300047673 Bacteria 9582
710 Ga0495593_0003599 3300047673 Bacteria 9257
711 Ga0495593_0127986 3300047673 Bacteria 1290
712 Ga0495602_0000006 3300048088 Bacteria 322593
713 Ga0495602_0000539 3300048088 Bacteria 35239
714 Ga0495602_0244967 3300048088 Bacteria 1339
715 Ga0495602_0549334 3300048088 Bacteria 801
716 Ga0495614_0137271 3300048089 Bacteria 1085
717 Ga0495614_0299412 3300048089 Bacteria 743
718 Ga0496100_0000926 3300048903 Bacteria 14006
719 Ga0496100_0007931 3300048903 Bacteria 5899
720 Ga0496100_0010730 3300048903 Bacteria 5194
721 Ga0496100_0116252 3300048903 Bacteria 1866
722 Ga0496100_0209142 3300048903 Bacteria 1426
723 Ga0496101_0004497 3300048904 Bacteria 8790
724 Ga0496101_0020299 3300048904 Bacteria 4545
725 Ga0496101_0032008 3300048904 Bacteria 3700
726 Ga0496102_0002933 3300048905 Bacteria 14466
727 Ga0496102_0005716 3300048905 Bacteria 10564
728 Ga0496104_0008179 3300048907 Bacteria 9288
729 Ga0496104_0010922 3300048907 Bacteria 8124
730 Ga0496104_0039756 3300048907 Bacteria 4404
731 Ga0496104_0077661 3300048907 Bacteria 3163
732 Ga0496104_0222826 3300048907 Bacteria 1798
733 Ga0496105_0005555 3300048908 Bacteria 9575
734 Ga0496105_0020686 3300048908 Bacteria 5319
735 Ga0496105_0029456 3300048908 Bacteria 4493
736 Ga0496105_0031349 3300048908 Bacteria 4358
737 Ga0496105_0267976 3300048908 Bacteria 1380
738 Ga0496105_0322327 3300048908 Bacteria 1238
739 Ga0496106_0004750 3300048909 Bacteria 10048
740 Ga0496106_0015351 3300048909 Bacteria 5668
741 Ga0496106_0016428 3300048909 Bacteria 5476
742 Ga0496106_0117374 3300048909 Bacteria 2077
743 Ga0496106_0174483 3300048909 Bacteria 1705
744 Ga0496107_0007435 3300048910 Bacteria 7552
745 Ga0496107_0010058 3300048910 Bacteria 6562
746 Ga0496107_0091732 3300048910 Bacteria 2220
747 Ga0496108_0001187 3300048911 Bacteria 20358
748 Ga0496108_0022989 3300048911 Bacteria 5129
749 Ga0496108_0037474 3300048911 Bacteria 4038
750 Ga0496108_0057975 3300048911 Bacteria 3253
751 Ga0496108_0481587 3300048911 Bacteria 1084
752 Ga0496109_0003628 3300048912 Bacteria 12895
753 Ga0496109_0005207 3300048912 Bacteria 10863
754 Ga0496109_0005449 3300048912 Bacteria 10641
755 Ga0496109_0014804 3300048912 Bacteria 6787
756 Ga0496109_0233656 3300048912 Bacteria 1730
757 Ga0496109_0644463 3300048912 Bacteria 996
758 Ga0496110_0001389 3300048913 Bacteria 17461
759 Ga0496110_0002156 3300048913 Bacteria 14686
760 Ga0496110_0008745 3300048913 Bacteria 8155
761 Ga0496110_0012668 3300048913 Bacteria 6939
762 Ga0496110_0184014 3300048913 Bacteria 1897
763 Ga0496110_0238597 3300048913 Bacteria 1654
764 Ga0496111_0001694 3300048914 Bacteria 12851
765 Ga0496111_0018942 3300048914 Bacteria 4772
766 Ga0496111_0023129 3300048914 Bacteria 4360
767 Ga0496111_0034140 3300048914 Bacteria 3631
768 Ga0496112_0001346 3300048915 Bacteria 18695
769 Ga0496112_0001940 3300048915 Bacteria 16337
770 Ga0496112_0020476 3300048915 Bacteria 6272
771 Ga0496112_0057488 3300048915 Bacteria 3829
772 Ga0496112_0306561 3300048915 Bacteria 1533
773 Ga0496113_0001229 3300048916 Bacteria 14079
774 Ga0496113_0003069 3300048916 Bacteria 9911
775 Ga0496113_0009756 3300048916 Bacteria 6311
776 Ga0496113_0046514 3300048916 Bacteria 3221
777 Ga0496113_0421480 3300048916 Bacteria 1072
778 Ga0496113_0710337 3300048916 Bacteria 802
779 Ga0496114_0017584 3300048917 Bacteria 5774
780 Ga0496114_0067775 3300048917 Bacteria 2994
781 Ga0496114_0093566 3300048917 Bacteria 2555
782 Ga0496114_0393844 3300048917 Bacteria 1227
783 Ga0496115_0003119 3300048918 Bacteria 11913
784 Ga0496115_0010171 3300048918 Bacteria 7020
785 Ga0496115_0030851 3300048918 Bacteria 4220
786 Ga0496115_0037797 3300048918 Bacteria 3827
787 Ga0496115_0061881 3300048918 Bacteria 3019
788 Ga0496116_0001851 3300048919 Bacteria 22897
789 Ga0496117_0121378 3300048920 Bacteria 1604
790 Ga0496120_0300990 3300048923 Bacteria 734
791 Ga0496121_0013940 3300048924 Bacteria 8589
792 Ga0496122_0054736 3300048925 Bacteria 2993
793 Ga0496123_0226992 3300048926 Bacteria 937
794 Ga0496125_0029721 3300048928 Bacteria 4904
795 Ga0496125_0090833 3300048928 Bacteria 2290
796 Ga0496126_0424088 3300048929 Bacteria 1075
797 Ga0501031_0045287 3300049568 Bacteria 2870
798 Ga0501031_0048768 3300049568 Bacteria 2760
799 Ga0501031_0092149 3300049568 Bacteria 1977
800 Ga0501032_0013003 3300049569 Bacteria 5928
801 Ga0501032_0022105 3300049569 Bacteria 4414
802 Ga0501032_0048876 3300049569 Bacteria 2855
803 Ga0501032_0055122 3300049569 Bacteria 2675
804 Ga0501032_0093051 3300049569 Bacteria 1999
805 Ga0501033_0017990 3300049570 Bacteria 5336
806 Ga0501033_0033329 3300049570 Bacteria 3867
807 Ga0501033_0127122 3300049570 Bacteria 1848
808 Ga0501034_0002201 3300049571 Bacteria 24114
809 Ga0501034_0023489 3300049571 Bacteria 6283
810 Ga0501034_0031875 3300049571 Bacteria 5355
811 Ga0501034_0050893 3300049571 Bacteria 4177
812 Ga0501034_0056596 3300049571 Bacteria 3945
813 Ga0501034_0081474 3300049571 Bacteria 3239
814 Ga0501034_0093059 3300049571 Bacteria 3011
815 Ga0501034_0127324 3300049571 Bacteria 2531
816 Ga0501034_0158572 3300049571 Bacteria 2235
817 Ga0501034_0269075 3300049571 Bacteria 1645
818 Ga0501034_0283883 3300049571 Bacteria 1595
819 Ga0501034_0345771 3300049571 Bacteria 1416
820 Ga0501034_0708855 3300049571 Bacteria 904
821 Ga0501036_0007818 3300049572 Bacteria 8746
822 Ga0501036_0016265 3300049572 Bacteria 6213
823 Ga0501036_0058284 3300049572 Bacteria 3271
824 Ga0501036_0062481 3300049572 Bacteria 3154
825 Ga0501036_0069973 3300049572 Bacteria 2967
826 Ga0501036_0124437 3300049572 Bacteria 2177
827 Ga0501036_0136118 3300049572 Bacteria 2073
828 Ga0501037_0005054 3300049573 Bacteria 9600
829 Ga0501037_0009480 3300049573 Bacteria 7146
830 Ga0501037_0126480 3300049573 Bacteria 1834
831 Ga0501037_0417485 3300049573 Bacteria 919
832 Ga0501038_0018363 3300049574 Bacteria 6313
833 Ga0501038_0037433 3300049574 Bacteria 4253
834 Ga0501038_0047640 3300049574 Bacteria 3712
835 Ga0501038_0137111 3300049574 Bacteria 2004
836 Ga0501038_0173305 3300049574 Bacteria 1745
837 Ga0501038_0224760 3300049574 Bacteria 1496
838 Ga0501038_0310331 3300049574 Bacteria 1236
839 Ga0501038_0342794 3300049574 Bacteria 1165
840 Ga0501039_0088736 3300049575 Bacteria 2408
841 Ga0501039_0126551 3300049575 Bacteria 2004
842 Ga0501039_0180494 3300049575 Bacteria 1660
843 Ga0501039_0195945 3300049575 Bacteria 1588
844 Ga0501039_0356505 3300049575 Bacteria 1149
845 Ga0501040_0066629 3300049576 Bacteria 2481
846 Ga0501040_0093026 3300049576 Bacteria 2097
847 Ga0501040_0451038 3300049576 Bacteria 926
848 Ga0501041_0054388 3300049577 Bacteria 2442
849 Ga0501042_0039496 3300049578 Bacteria 3354
850 Ga0501042_0199294 3300049578 Bacteria 1444
851 Ga0501043_0001843 3300049579 Bacteria 18180
852 Ga0501043_0028972 3300049579 Bacteria 4347
853 Ga0501043_0049051 3300049579 Bacteria 3319
854 Ga0501043_0052764 3300049579 Bacteria 3193
855 Ga0501043_0145326 3300049579 Bacteria 1857
856 Ga0501043_0149423 3300049579 Bacteria 1828
857 Ga0501043_0230029 3300049579 Bacteria 1432
858 Ga0501043_0346698 3300049579 Bacteria 1129
859 Ga0501043_0539355 3300049579 Bacteria 868
860 Ga0501043_0832478 3300049579 Unclassified 666
861 Ga0501046_0029021 3300049580 Bacteria 4502
862 Ga0501046_0042972 3300049580 Bacteria 3600
863 Ga0501046_0046372 3300049580 Bacteria 3449
864 Ga0501046_0213269 3300049580 Bacteria 1432
865 Ga0501046_0267391 3300049580 Bacteria 1255
866 Ga0501047_0000010 3300049581 Bacteria 429357
867 Ga0501047_0001775 3300049581 Bacteria 20844
868 Ga0501047_0014495 3300049581 Bacteria 7497
869 Ga0501047_0095778 3300049581 Bacteria 2847
870 Ga0501047_0127392 3300049581 Bacteria 2426
871 Ga0501047_0289149 3300049581 Bacteria 1483
872 Ga0501047_0327509 3300049581 Bacteria 1371
873 Ga0501048_0004920 3300049582 Bacteria 10191
874 Ga0501048_0016921 3300049582 Bacteria 5375
875 Ga0501048_0111287 3300049582 Bacteria 1933
876 Ga0501048_0578936 3300049582 Unclassified 806
877 Ga0501067_0089828 3300049583 Bacteria 1705
878 Ga0501067_0165649 3300049583 Bacteria 1231
879 Ga0501067_0325256 3300049583 Bacteria 856
880 Ga0501068_0005782 3300049584 Bacteria 6783
881 Ga0501068_0103009 3300049584 Bacteria 1770
882 Ga0501068_0111004 3300049584 Bacteria 1705
883 Ga0501068_0154246 3300049584 Bacteria 1445
884 Ga0501068_0191423 3300049584 Bacteria 1295
885 Ga0501068_0325772 3300049584 Bacteria 985
886 Ga0501068_0327630 3300049584 Unclassified 982
887 Ga0501069_0035200 3300049585 Bacteria 2758
888 Ga0501069_0051069 3300049585 Bacteria 2301
889 Ga0501069_0102789 3300049585 Bacteria 1623
890 Ga0501069_0108775 3300049585 Bacteria 1577
891 Ga0501069_0124177 3300049585 Bacteria 1475
892 Ga0501069_0246239 3300049585 Unclassified 1042
893 Ga0501070_0044484 3300049586 Bacteria 3694
894 Ga0501070_0056695 3300049586 Bacteria 3247
895 Ga0501070_0102058 3300049586 Bacteria 2372
896 Ga0501070_0123635 3300049586 Bacteria 2138
897 Ga0501070_0132694 3300049586 Bacteria 2057
898 Ga0501070_0154409 3300049586 Bacteria 1893
899 Ga0501070_0191252 3300049586 Bacteria 1682
900 Ga0501070_0202789 3300049586 Bacteria 1628
901 Ga0501070_0242180 3300049586 Bacteria 1476
902 Ga0501070_0245748 3300049586 Bacteria 1464
903 Ga0501070_0256771 3300049586 Bacteria 1429
904 Ga0501071_0083235 3300049587 Bacteria 2344
905 Ga0501071_0155413 3300049587 Bacteria 1708
906 Ga0501072_0033081 3300049588 Bacteria 4051
907 Ga0501072_0062220 3300049588 Bacteria 2944
908 Ga0501072_0086538 3300049588 Bacteria 2487
909 Ga0501072_0258493 3300049588 Bacteria 1386
910 Ga0501072_0327898 3300049588 Bacteria 1216
911 Ga0501072_0461682 3300049588 Bacteria 1005
912 Ga0501073_0004541 3300049589 Bacteria 10438
913 Ga0501073_0016110 3300049589 Bacteria 5419
914 Ga0501073_0033338 3300049589 Bacteria 3667
915 Ga0501073_0072315 3300049589 Bacteria 2402
916 Ga0501073_0124554 3300049589 Bacteria 1786
917 Ga0501073_0183423 3300049589 Bacteria 1448
918 Ga0501073_0334461 3300049589 Unclassified 1045
919 Ga0501073_0377293 3300049589 Bacteria 979
920 Ga0501073_0382846 3300049589 Unclassified 972
921 Ga0501074_0009189 3300049590 Bacteria 7181
922 Ga0501074_0010349 3300049590 Bacteria 6768
923 Ga0501074_0046562 3300049590 Bacteria 3136
924 Ga0501074_0180689 3300049590 Unclassified 1505
925 Ga0501074_0192647 3300049590 Bacteria 1453
926 Ga0501075_0010200 3300049591 Bacteria 6596
927 Ga0501075_0040287 3300049591 Bacteria 3498
928 Ga0501075_0600613 3300049591 Bacteria 839
929 Ga0501076_0009793 3300049592 Bacteria 7079
930 Ga0501076_0078679 3300049592 Bacteria 2646
931 Ga0501076_0247431 3300049592 Bacteria 1459
932 Ga0501076_0337393 3300049592 Bacteria 1237
933 Ga0501076_0400388 3300049592 Bacteria 1129
934 Ga0501077_0118183 3300049593 Bacteria 1680
935 Ga0501079_0020198 3300049741 Bacteria 5091
936 Ga0501079_0042950 3300049741 Bacteria 3490
937 Ga0501079_0066627 3300049741 Bacteria 2779
938 Ga0501079_0291895 3300049741 Bacteria 1275
939 Ga0501079_0312730 3300049741 Bacteria 1229
940 Ga0501080_0000314 3300049742 Bacteria 37074
941 Ga0501080_0006102 3300049742 Bacteria 10802
942 Ga0501080_0008717 3300049742 Bacteria 9209
943 Ga0501080_0009753 3300049742 Bacteria 8771
944 Ga0501080_0011995 3300049742 Bacteria 7937
945 Ga0501080_0022269 3300049742 Bacteria 5871
946 Ga0501080_0023180 3300049742 Bacteria 5756
947 Ga0501080_0035262 3300049742 Bacteria 4670
948 Ga0501080_0045183 3300049742 Bacteria 4100
949 Ga0501080_0081340 3300049742 Bacteria 3010
950 Ga0501080_0177989 3300049742 Bacteria 1958
951 Ga0501080_0236493 3300049742 Bacteria 1669
952 Ga0501080_0254933 3300049742 Bacteria 1599
953 Ga0501080_0504689 3300049742 Bacteria 1081
954 Ga0501080_0540662 3300049742 Bacteria 1038
955 Ga0501081_0018902 3300049743 Bacteria 4580
956 Ga0501081_0027216 3300049743 Bacteria 3858
957 Ga0501081_0148981 3300049743 Bacteria 1680
958 Ga0501081_0533896 3300049743 Bacteria 876
959 Ga0501083_0005058 3300049744 Bacteria 9342
960 Ga0501083_0030007 3300049744 Bacteria 3737
961 Ga0501083_0144139 3300049744 Bacteria 1559
962 Ga0501083_0181223 3300049744 Bacteria 1375
963 Ga0501083_0418990 3300049744 Bacteria 871
964 Ga0501035_0004729 3300049822 Bacteria 12925
965 Ga0501035_0011561 3300049822 Bacteria 8181
966 Ga0501035_0030708 3300049822 Bacteria 4898
967 Ga0501035_0036440 3300049822 Bacteria 4458
968 Ga0501035_0330562 3300049822 Unclassified 1279
969 Ga0501035_0620731 3300049822 Bacteria 879
970 Ga0501044_0000116 3300049823 Bacteria 96626
971 Ga0501044_0002291 3300049823 Bacteria 21805
972 Ga0501044_0003610 3300049823 Bacteria 17403
973 Ga0501044_0078352 3300049823 Bacteria 3349
974 Ga0501044_0093602 3300049823 Bacteria 3030
975 Ga0501044_0125313 3300049823 Bacteria 2566
976 Ga0501044_0262961 3300049823 Bacteria 1663
977 Ga0501044_0404528 3300049823 Bacteria 1277
978 Ga0501045_0038834 3300049824 Bacteria 3463
979 Ga0501045_0361097 3300049824 Bacteria 1081
980 Ga0501045_0520249 3300049824 Bacteria 883
981 nmdc:mga03683_1213_c2 3300050489 Bacteria 5469
982 nmdc:mga03683_44154_c1 3300050489 Bacteria 1841
983 nmdc:mga03n38_331637_c1 3300050490 Bacteria 824
984 nmdc:mga03n38_59258_c1 3300050490 Bacteria 1737
985 nmdc:mga03n38_9563_c1 3300050490 Bacteria 3533
986 nmdc:mga00v17_149620_c1 3300050491 Bacteria 1500
987 nmdc:mga00v17_24709_c1 3300050491 Bacteria 2178
988 nmdc:mga00v17_28997_c1 3300050491 Bacteria 3245
989 nmdc:mga00v17_4955_c1 3300050491 Bacteria 6983
990 nmdc:mga00v17_79322_c1 3300050491 Bacteria 2047
991 nmdc:mga0yw44_11062_c1 3300050492 Bacteria 4638
992 nmdc:mga0yw44_116513_c1 3300050492 Bacteria 1717
993 nmdc:mga0yw44_4079_c1 3300050492 Bacteria 6620
994 nmdc:mga0yw44_54507_c1 3300050492 Bacteria 2430
995 nmdc:mga0yw44_580_c1 3300050492 Bacteria 13256
996 nmdc:mga0yw44_63973_c1 3300050492 Bacteria 2263
997 nmdc:mga0yw44_69664_c1 3300050492 Bacteria 2179
998 nmdc:mga0yw44_98989_c1 3300050492 Bacteria 1855
999 nmdc:mga0k408_142046_c1 3300050493 Bacteria 1428
1000 nmdc:mga0k408_47462_c1 3300050493 Bacteria 2482
1001 nmdc:mga06z11_15735_c2 3300050494 Bacteria 2987
1002 nmdc:mga06z11_169845_c1 3300050494 Bacteria 1251
1003 nmdc:mga06z11_33677_c1 3300050494 Bacteria 2508
1004 nmdc:mga06z11_44729_c1 3300050494 Bacteria 2234
1005 nmdc:mga04h51_121630_c1 3300050495 Bacteria 973
1006 nmdc:mga04h51_148960_c1 3300050495 Bacteria 893
1007 nmdc:mga04h51_19183_c1 3300050495 Bacteria 1474
1008 nmdc:mga04h51_6680_c1 3300050495 Bacteria 3005
1009 nmdc:mga07m45_12481_c1 3300050496 Bacteria 4491
1010 nmdc:mga07m45_46338_c1 3300050496 Bacteria 2442
1011 nmdc:mga05p37_11744_c1 3300050507 Bacteria 10440
1012 nmdc:mga05p37_374_c1 3300050507 Bacteria 48074
1013 nmdc:mga05p37_47092_c1 3300050507 Bacteria 5303
1014 nmdc:mga05p37_512131_c1 3300050507 Bacteria 1374
1015 nmdc:mga09592_20752_c1 3300050508 Bacteria 5407
1016 nmdc:mga09592_2601_c1 3300050508 Bacteria 14611
1017 nmdc:mga0qj67_134130_c1 3300050509 Bacteria 2006
1018 nmdc:mga0qj67_50765_c1 3300050509 Bacteria 3280
1019 nmdc:mga0qj67_551023_c1 3300050509 Bacteria 925
1020 nmdc:mga0qj67_65941_c1 3300050509 Bacteria 2883
1021 nmdc:mga06r32_250622_c2 3300050510 Bacteria 1011
1022 nmdc:mga06r32_307479_c1 3300050510 Bacteria 1571
1023 nmdc:mga06r32_349126_c1 3300050510 Bacteria 1464
1024 nmdc:mga06r32_397_c1 3300050510 Bacteria 36835
1025 nmdc:mga08y16_122069_c1 3300050511 Bacteria 2711
1026 nmdc:mga08y16_124566_c1 3300050511 Bacteria 2681
1027 nmdc:mga08y16_155771_c1 3300050511 Bacteria 2374
1028 nmdc:mga08y16_184_c1 3300050511 Bacteria 55479
1029 nmdc:mga08y16_270713_c1 3300050511 Bacteria 1753
1030 nmdc:mga08y16_321525_c1 3300050511 Bacteria 1593
1031 nmdc:mga08y16_90408_c1 3300050511 Bacteria 3191
1032 nmdc:mga0n895_381227_c1 3300050512 Bacteria 1427
1033 nmdc:mga0n895_445606_c1 3300050512 Bacteria 1307
1034 nmdc:mga0n895_834709_c1 3300050512 Bacteria 910
1035 nmdc:mga0n895_96376_c1 3300050512 Bacteria 2963
1036 nmdc:mga0rr50_282808_c1 3300050513 Bacteria 1384
1037 nmdc:mga0rr50_64490_c1 3300050513 Bacteria 2771
1038 nmdc:mga0rr50_70704_c1 3300050513 Bacteria 2660
1039 nmdc:mga08x19_103158_c1 3300050514 Bacteria 1894
1040 nmdc:mga08x19_138367_c1 3300050514 Bacteria 1643
1041 nmdc:mga08x19_14_c1 3300050514 Bacteria 365567
1042 nmdc:mga0a205_203406_c1 3300050515 Bacteria 1870
1043 nmdc:mga0sz30_19112_c1 3300050516 Bacteria 842
1044 nmdc:mga0sz30_38510_c1 3300050516 Bacteria 1162
1045 nmdc:mga0sz30_56787_c1 3300050516 Bacteria 1668
1046 Ga0495601_0000007 3300053077 Bacteria 365972
1047 Ga0495601_0005541 3300053077 Bacteria 7365
1048 Ga0495601_0012397 3300053077 Bacteria 5114
1049 Ga0495601_0301767 3300053077 Bacteria 1043
1050 Ga0495612_0000053 3300053078 Bacteria 52880
1051 Ga0495612_0001301 3300053078 Bacteria 10300
1052 Ga0495612_0002727 3300053078 Bacteria 7308
1053 Ga0495612_0271565 3300053078 Bacteria 757
1054 Ga0495655_0034961 3300053083 Bacteria 1247
1055 Ga0495595_0000031 3300053084 Bacteria 89199
1056 Ga0495595_0005529 3300053084 Bacteria 5117
1057 Ga0495595_0010781 3300053084 Bacteria 3808
1058 Ga0495595_0030894 3300053084 Bacteria 2405
1059 Ga0495595_0088479 3300053084 Bacteria 1483
1060 Ga0495595_0274711 3300053084 Bacteria 845
1061 Ga0495619_0000023 3300053085 Bacteria 182266
1062 Ga0495619_0003219 3300053085 Bacteria 10571
1063 Ga0495619_0013374 3300053085 Bacteria 5170
1064 Ga0495619_0024881 3300053085 Bacteria 3841
1065 Ga0495619_0058559 3300053085 Bacteria 2557
1066 Ga0495619_0230447 3300053085 Bacteria 1283
1067 Ga0495619_0643639 3300053085 Bacteria 723
1068 Ga0500644_0072537 3300053088 Bacteria 1244
1069 Ga0500646_0081659 3300053090 Bacteria 987
1070 Ga0500583_0162939 3300053092 Bacteria 1111
1071 Ga0500651_0039858 3300053093 Bacteria 2958
1072 Ga0500651_0121043 3300053093 Bacteria 1589
1073 Ga0500651_0139892 3300053093 Unclassified 1460
1074 Ga0500651_0144194 3300053093 Bacteria 1433
1075 Ga0500566_0000499 3300053094 Bacteria 21864
1076 Ga0500641_0018535 3300053096 Bacteria 2619
1077 Ga0500650_0002506 3300053098 Bacteria 6075
1078 Ga0500555_003654 3300053103 Bacteria 4379
1079 Ga0500556_0000004 3300053104 Bacteria 666287
1080 Ga0500562_067349 3300053108 Bacteria 965
1081 Ga0500569_033050 3300053109 Bacteria 1467
1082 Ga0500593_069737 3300053117 Bacteria 1527
1083 Ga0500594_0123260 3300053118 Bacteria 815
1084 Ga0500595_000731 3300053119 Bacteria 19548
1085 Ga0500595_022769 3300053119 Bacteria 2211
1086 Ga0500614_022675 3300053123 Bacteria 1468
1087 Ga0500618_001267 3300053125 Bacteria 11733
1088 Ga0500642_0000010 3300053130 Bacteria 272552
1089 Ga0500642_0000887 3300053130 Bacteria 8708
1090 Ga0500642_0009847 3300053130 Bacteria 3341
1091 Ga0500642_0124487 3300053130 Bacteria 1207
1092 Ga0500652_000063 3300053131 Bacteria 46678
1093 Ga0500658_0073848 3300053134 Bacteria 1445
1094 Ga0500568_0000388 3300053139 Bacteria 33489
1095 Ga0500568_0013508 3300053139 Bacteria 3720
1096 Ga0500577_0031982 3300053142 Bacteria 1846
1097 Ga0500577_0036118 3300053142 Bacteria 1767
1098 Ga0500577_0079257 3300053142 Bacteria 1306
1099 Ga0500588_0000561 3300053146 Bacteria 6037
1100 Ga0500588_0012298 3300053146 Bacteria 2119
1101 Ga0500588_0016324 3300053146 Bacteria 1919
1102 Ga0500588_0037346 3300053146 Bacteria 1442
1103 Ga0500604_0002284 3300053151 Bacteria 5248
1104 Ga0500604_0012185 3300053151 Bacteria 2318
1105 Ga0500604_0049761 3300053151 Bacteria 1289
1106 Ga0500616_0000014 3300053153 Bacteria 637918
1107 Ga0500616_0000888 3300053153 Bacteria 32969
1108 Ga0500616_0011431 3300053153 Bacteria 5242
1109 Ga0500619_020780 3300053154 Bacteria 1882
1110 Ga0500622_0000266 3300053156 Bacteria 53524
1111 Ga0500627_0033807 3300053158 Bacteria 2163
1112 Ga0500633_0038306 3300053160 Bacteria 1596
1113 Ga0500634_0249411 3300053161 Bacteria 739
1114 Ga0500636_0001741 3300053177 Bacteria 11927
1115 Ga0500570_069807 3300053724 Bacteria 1646
1116 Ga0500645_021692 3300053730 Bacteria 1981
1117 Ga0500609_002904 3300053731 Bacteria 2439
1118 Ga0500601_000022 3300053737 Bacteria 34845
1119 Ga0501084_0034090 3300054114 Bacteria 4257
1120 Ga0501084_0083270 3300054114 Bacteria 2685
1121 Ga0501084_0083298 3300054114 Bacteria 2684
1122 Ga0501084_0336590 3300054114 Bacteria 1275
1123 Ga0501084_0337175 3300054114 Bacteria 1274
1124 Ga0501084_0384489 3300054114 Bacteria 1186
1125 Ga0500661_021571 3300055283 Bacteria 1143
1126 Ga0501082_0001543 3300060353 Bacteria 20276
1127 Ga0501082_0007592 3300060353 Bacteria 9353
1128 Ga0501082_0021973 3300060353 Bacteria 5501
1129 Ga0501082_0051744 3300060353 Bacteria 3540
1130 Ga0501082_0299310 3300060353 Bacteria 1401
1131 Ga0501082_0323962 3300060353 Bacteria 1343
1132 Ga0501082_0694267 3300060353 Bacteria 891
1133 Ga0466962_0155906 3300061719 Bacteria 1109
1134 Ga0530510_0117097 3300061734 Bacteria 1954
1135 Ga0530510_0172919 3300061734 Unclassified 1600
1136 Ga0530510_0222121 3300061734 Bacteria 1404
1137 Ga0530510_0540371 3300061734 Bacteria 885
1138 Ga0530510_0570628 3300061734 Bacteria 860

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049581 Ga0501047_0001775 Ga0501047_0001775_5779_6414 189
2 3300049742 Ga0501080_0009753 Ga0501080_0009753_3131_3766 189
3 3300039438 Ga0436360_0320708 Ga0436360_0320708_2930_3580 194
4 3300044765 Ga0466970_0243946 Ga0466970_0243946_214_876 199
5 3300003322 rootL2_10291390 rootL2_102913902 203
6 3300005985 Ga0081539_10015587 Ga0081539_100155874 203
7 3300031456 Ga0307513_10451469 Ga0307513_104514692 203
8 3300045976 Ga0466967_0069388 Ga0466967_0069388_389_1015 203
9 3300047472 Ga0495686_0214595 Ga0495686_0214595_227_847 203
10 3300049571 Ga0501034_0708855 Ga0501034_0708855_123_743 203
11 3300049579 Ga0501043_0145326 Ga0501043_0145326_168_788 203
12 3300049579 Ga0501043_0832478 Ga0501043_0832478_16_636 203
13 3300049581 Ga0501047_0327509 Ga0501047_0327509_595_1215 203
14 3300049586 Ga0501070_0256771 Ga0501070_0256771_221_841 203
15 3300049589 Ga0501073_0377293 Ga0501073_0377293_320_940 203
16 3300049742 Ga0501080_0035262 Ga0501080_0035262_1546_2166 203
17 3300049742 Ga0501080_0540662 Ga0501080_0540662_399_1019 203
18 3300049822 Ga0501035_0036440 Ga0501035_0036440_593_1213 203
19 3300049823 Ga0501044_0262961 Ga0501044_0262961_465_1085 203
20 3300053146 Ga0500588_0000561 Ga0500588_0000561_3369_3989 203
21 3300053153 Ga0500616_0000888 Ga0500616_0000888_26303_26923 203
22 3300003316 rootH1_10021619 rootH1_100216192 205
23 3300003320 rootH2_10032559 rootH2_1003255912 205
24 3300005262 Ga0065165_1028635 Ga0065165_10286352 205
25 3300005844 Ga0068862_100029912 Ga0068862_1000299123 205
26 3300025297 Ga0209758_1000059 Ga0209758_1000059231 205
27 3300025297 Ga0209758_1046740 Ga0209758_10467402 205
28 3300025298 Ga0209050_1002314 Ga0209050_10023142 205
29 3300025299 Ga0209256_1068092 Ga0209256_10680921 205
30 3300025304 Ga0209257_1000114 Ga0209257_1000114224 205
31 3300025304 Ga0209257_1019160 Ga0209257_10191602 205
32 3300029957 Ga0265324_10060633 Ga0265324_100606332 205
33 3300030522 Ga0307512_10186941 Ga0307512_101869411 205
34 3300031239 Ga0265328_10012454 Ga0265328_100124543 205
35 3300031250 Ga0265331_10000333 Ga0265331_100003335 205
36 3300041459 Ga0451800_0784539 Ga0451800_0784539_394_1032 205
37 3300041505 Ga0451849_0087101 Ga0451849_0087101_23_661 205
38 3300044673 Ga0453683_0473469 Ga0453683_0473469_158_781 205
39 3300044712 Ga0453684_0000006 Ga0453684_0000006_586943_587572 205
40 3300044712 Ga0453684_0000031 Ga0453684_0000031_387711_388337 205
41 3300044712 Ga0453684_0008102 Ga0453684_0008102_17995_18618 205
42 3300044712 Ga0453684_0313101 Ga0453684_0313101_1086_1709 205
43 3300046660 Ga0495625_0325743 Ga0495625_0325743_32_670 205
44 3300049571 Ga0501034_0093059 Ga0501034_0093059_571_1206 205
45 3300049574 Ga0501038_0224760 Ga0501038_0224760_84_713 205
46 3300049575 Ga0501039_0195945 Ga0501039_0195945_23_658 205
47 3300049579 Ga0501043_0028972 Ga0501043_0028972_1812_2447 205
48 3300049579 Ga0501043_0539355 Ga0501043_0539355_63_692 205
49 3300049580 Ga0501046_0267391 Ga0501046_0267391_386_1021 205
50 3300049583 Ga0501067_0089828 Ga0501067_0089828_614_1243 205
51 3300049584 Ga0501068_0005782 Ga0501068_0005782_813_1448 205
52 3300049585 Ga0501069_0051069 Ga0501069_0051069_1136_1771 205
53 3300049586 Ga0501070_0245748 Ga0501070_0245748_559_1188 205
54 3300049588 Ga0501072_0327898 Ga0501072_0327898_80_715 205
55 3300049589 Ga0501073_0016110 Ga0501073_0016110_1866_2495 205
56 3300049590 Ga0501074_0046562 Ga0501074_0046562_2360_2989 205
57 3300049741 Ga0501079_0312730 Ga0501079_0312730_223_858 205
58 3300049742 Ga0501080_0045183 Ga0501080_0045183_279_908 205
59 3300049742 Ga0501080_0504689 Ga0501080_0504689_101_730 205
60 3300049744 Ga0501083_0144139 Ga0501083_0144139_394_1023 205
61 3300049822 Ga0501035_0620731 Ga0501035_0620731_230_859 205
62 3300049823 Ga0501044_0002291 Ga0501044_0002291_12817_13452 205
63 3300049823 Ga0501044_0404528 Ga0501044_0404528_417_1046 205
64 3300053092 Ga0500583_0162939 Ga0500583_0162939_115_753 205
65 3300053093 Ga0500651_0039858 Ga0500651_0039858_2045_2683 205
66 3300053093 Ga0500651_0121043 Ga0500651_0121043_397_1035 205
67 3300053103 Ga0500555_003654 Ga0500555_003654_3501_4139 205
68 3300053119 Ga0500595_000731 Ga0500595_000731_9309_9947 205
69 3300053123 Ga0500614_022675 Ga0500614_022675_139_777 205
70 3300053130 Ga0500642_0000887 Ga0500642_0000887_7278_7916 205
71 3300053139 Ga0500568_0013508 Ga0500568_0013508_2050_2688 205
72 3300053142 Ga0500577_0031982 Ga0500577_0031982_1046_1684 205
73 3300053142 Ga0500577_0036118 Ga0500577_0036118_1091_1720 205
74 3300053146 Ga0500588_0012298 Ga0500588_0012298_1058_1696 205
75 3300053146 Ga0500588_0016324 Ga0500588_0016324_424_1062 205
76 3300053151 Ga0500604_0002284 Ga0500604_0002284_462_1097 205
77 3300053151 Ga0500604_0049761 Ga0500604_0049761_124_762 205
78 3300053161 Ga0500634_0249411 Ga0500634_0249411_72_710 205
79 3300053731 Ga0500609_002904 Ga0500609_002904_675_1307 205
80 3300060353 Ga0501082_0001543 Ga0501082_0001543_17949_18584 205
81 3300031251 Ga0265327_10000775 Ga0265327_1000077541 206
82 iso_pu_bacteria 2643221576 2643892612 206
83 iso_pu_bacteria 2643221590 2643962061 206
84 iso_pu_bacteria 2643221617 2644098735 206
85 iso_pu_bacteria 2643221620 2644116096 206
86 3300005563 Ga0068855_100136130 Ga0068855_1001361302 207
87 3300005618 Ga0068864_100418600 Ga0068864_1004186001 207
88 3300005843 Ga0068860_100216486 Ga0068860_1002164862 207
89 3300009093 Ga0105240_10026738 Ga0105240_100267384 207
90 3300025913 Ga0207695_10050992 Ga0207695_100509922 207
91 3300025949 Ga0207667_10354994 Ga0207667_103549942 207
92 3300026095 Ga0207676_10308045 Ga0207676_103080451 207
93 3300031251 Ga0265327_10091170 Ga0265327_100911702 207
94 3300035083 Ga0373926_0162366 Ga0373926_0162366_63_695 207
95 3300035116 Ga0373945_0017489 Ga0373945_0017489_1140_1772 207
96 3300035170 Ga0373943_0002159 Ga0373943_0002159_1794_2426 207
97 3300035692 Ga0373935_0034107 Ga0373935_0034107_49_681 207
98 3300035725 Ga0373947_0016255 Ga0373947_0016255_879_1511 207
99 3300037068 Ga0373925_0004278 Ga0373925_0004278_4167_4799 207
100 3300047319 Ga0495674_0479164 Ga0495674_0479164_324_956 207
101 3300053093 Ga0500651_0139892 Ga0500651_0139892_513_1181 207
102 3300009545 Ga0105237_10047128 Ga0105237_100471284 208
103 3300025914 Ga0207671_10087282 Ga0207671_100872822 208
104 3300037418 Ga0395900_0534211 Ga0395900_0534211_119_778 208
105 3300037466 Ga0395898_0179458 Ga0395898_0179458_973_1638 208
106 3300038443 Ga0395901_0266328 Ga0395901_0266328_138_803 208
107 3300044683 Ga0466965_0102315 Ga0466965_0102315_393_1067 208
108 3300044712 Ga0453684_0112756 Ga0453684_0112756_1840_2514 208
109 iso_pu_bacteria 2643221604 2644034770 208
110 iso_pu_bacteria 2738541305 2738872000 208
111 iso_pu_bacteria 2811994874 2812329952 208
112 3300005336 Ga0070680_100698473 Ga0070680_1006984731 210
113 3300035113 Ga0373936_0165075 Ga0373936_0165075_87_737 210
114 3300035695 Ga0373927_0029730 Ga0373927_0029730_2770_3420 210
115 3300035725 Ga0373947_0001498 Ga0373947_0001498_9437_10087 210
116 3300037068 Ga0373925_0006000 Ga0373925_0006000_4558_5208 210
117 3300046455 Ga0495603_0001017 Ga0495603_0001017_6160_6810 210
118 3300046459 Ga0495629_0001626 Ga0495629_0001626_15_665 210
119 3300046461 Ga0495641_0114372 Ga0495641_0114372_168_818 210
120 3300046472 Ga0495580_0000806 Ga0495580_0000806_21922_22572 210
121 3300046473 Ga0495582_0001348 Ga0495582_0001348_6086_6736 210
122 3300046475 Ga0495639_0001292 Ga0495639_0001292_8533_9183 210
123 3300046499 Ga0495594_0000401 Ga0495594_0000401_5762_6412 210
124 3300046557 Ga0495622_0046788 Ga0495622_0046788_970_1620 210
125 3300046642 Ga0495634_0297489 Ga0495634_0297489_30_680 210
126 3300046663 Ga0495635_0135616 Ga0495635_0135616_540_1190 210
127 3300046674 Ga0495588_0005816 Ga0495588_0005816_2978_3628 210
128 3300046681 Ga0495647_0006744 Ga0495647_0006744_1503_2153 210
129 3300046683 Ga0495658_0003498 Ga0495658_0003498_3954_4604 210
130 3300046689 Ga0495613_0000508 Ga0495613_0000508_24613_25263 210
131 3300046690 Ga0495624_0032723 Ga0495624_0032723_181_831 210
132 3300047322 Ga0495680_0040382 Ga0495680_0040382_2778_3428 210
133 3300047673 Ga0495593_0003599 Ga0495593_0003599_6284_6934 210
134 3300048089 Ga0495614_0299412 Ga0495614_0299412_82_732 210
135 3300049568 Ga0501031_0045287 Ga0501031_0045287_1862_2518 210
136 3300049569 Ga0501032_0055122 Ga0501032_0055122_1228_1884 210
137 3300049570 Ga0501033_0127122 Ga0501033_0127122_82_738 210
138 3300049572 Ga0501036_0069973 Ga0501036_0069973_192_848 210
139 3300049574 Ga0501038_0137111 Ga0501038_0137111_1267_1923 210
140 3300049575 Ga0501039_0180494 Ga0501039_0180494_183_839 210
141 3300049576 Ga0501040_0066629 Ga0501040_0066629_1307_1963 210
142 3300049577 Ga0501041_0054388 Ga0501041_0054388_1387_2043 210
143 3300049578 Ga0501042_0039496 Ga0501042_0039496_336_992 210
144 3300049579 Ga0501043_0049051 Ga0501043_0049051_2352_3008 210
145 3300049580 Ga0501046_0029021 Ga0501046_0029021_2239_2895 210
146 3300049584 Ga0501068_0327630 Ga0501068_0327630_24_680 210
147 3300049585 Ga0501069_0246239 Ga0501069_0246239_119_775 210
148 3300049589 Ga0501073_0382846 Ga0501073_0382846_50_706 210
149 3300049590 Ga0501074_0180689 Ga0501074_0180689_405_1061 210
150 3300049591 Ga0501075_0010200 Ga0501075_0010200_2892_3548 210
151 3300049592 Ga0501076_0009793 Ga0501076_0009793_1760_2416 210
152 3300049741 Ga0501079_0042950 Ga0501079_0042950_1752_2408 210
153 3300049742 Ga0501080_0011995 Ga0501080_0011995_5052_5708 210
154 3300049743 Ga0501081_0018902 Ga0501081_0018902_1134_1790 210
155 3300049744 Ga0501083_0030007 Ga0501083_0030007_241_897 210
156 3300049822 Ga0501035_0330562 Ga0501035_0330562_486_1142 210
157 3300049824 Ga0501045_0038834 Ga0501045_0038834_2758_3414 210
158 3300053084 Ga0495595_0010781 Ga0495595_0010781_1367_2017 210
159 3300053085 Ga0495619_0013374 Ga0495619_0013374_3733_4383 210
160 3300054114 Ga0501084_0083298 Ga0501084_0083298_901_1557 210
161 3300060353 Ga0501082_0051744 Ga0501082_0051744_2100_2756 210
162 3300061734 Ga0530510_0172919 Ga0530510_0172919_828_1484 210
163 3300025254 Ga0209148_1001585 Ga0209148_10015853 211
164 3300048929 Ga0496126_0424088 Ga0496126_0424088_300_995 212
165 3300037068 Ga0373925_0594639 Ga0373925_0594639_196_846 213
166 3300005336 Ga0070680_100022351 Ga0070680_1000223513 217
167 3300005337 Ga0070682_100008050 Ga0070682_1000080506 217
168 3300005341 Ga0070691_10120209 Ga0070691_101202092 217
169 3300005366 Ga0070659_100043352 Ga0070659_1000433524 217
170 3300005455 Ga0070663_100099777 Ga0070663_1000997773 217
171 3300005458 Ga0070681_10030828 Ga0070681_100308286 217
172 3300005530 Ga0070679_100016290 Ga0070679_1000162907 217
173 3300005539 Ga0068853_100011139 Ga0068853_1000111393 217
174 3300005547 Ga0070693_100012903 Ga0070693_1000129033 217
175 3300005549 Ga0070704_100334507 Ga0070704_1003345071 217
176 3300005563 Ga0068855_100074040 Ga0068855_1000740402 217
177 3300013307 Ga0157372_10016504 Ga0157372_100165045 217
178 3300025912 Ga0207707_10045123 Ga0207707_100451232 217
179 3300025921 Ga0207652_10413202 Ga0207652_104132022 217
180 3300025949 Ga0207667_10358477 Ga0207667_103584772 217
181 3300026041 Ga0207639_10012134 Ga0207639_100121343 217
182 3300026067 Ga0207678_10121665 Ga0207678_101216653 217
183 3300039447 Ga0436361_0622258 Ga0436361_0622258_1006_1677 217
184 3300050495 nmdc:mga04h51_19183_c1 nmdc:mga04h51_19183_c1_150_818 217
185 3300050513 nmdc:mga0rr50_64490_c1 nmdc:mga0rr50_64490_c1_407_1075 217
186 3300050514 nmdc:mga08x19_14_c1 nmdc:mga08x19_14_c1_309279_309947 217
187 3300054114 Ga0501084_0337175 Ga0501084_0337175_14_685 217
188 3300003354 JGI25160J50197_1001950 JGI25160J50197_10019508 218
189 3300005355 Ga0070671_100390424 Ga0070671_1003904242 218
190 3300005435 Ga0070714_100000556 Ga0070714_1000005564 218
191 3300005437 Ga0070710_10002571 Ga0070710_100025714 218
192 3300005439 Ga0070711_100017293 Ga0070711_1000172932 218
193 3300005539 Ga0068853_100037050 Ga0068853_1000370502 218
194 3300005614 Ga0068856_100246984 Ga0068856_1002469842 218
195 3300006028 Ga0070717_10059609 Ga0070717_100596092 218
196 3300006038 Ga0075365_10078435 Ga0075365_100784353 218
197 3300006173 Ga0070716_100022930 Ga0070716_1000229303 218
198 3300006175 Ga0070712_100033476 Ga0070712_1000334762 218
199 3300006178 Ga0075367_10140312 Ga0075367_101403121 218
200 3300006178 Ga0075367_10172944 Ga0075367_101729442 218
201 3300006186 Ga0075369_10005025 Ga0075369_100050254 218
202 3300009174 Ga0105241_10116553 Ga0105241_101165532 218
203 3300009545 Ga0105237_10092024 Ga0105237_100920242 218
204 3300009545 Ga0105237_10640661 Ga0105237_106406612 218
205 3300009551 Ga0105238_10277946 Ga0105238_102779462 218
206 3300010375 Ga0105239_10007779 Ga0105239_1000777915 218
207 3300013100 Ga0157373_10242012 Ga0157373_102420122 218
208 3300013297 Ga0157378_11203288 Ga0157378_112032881 218
209 3300025254 Ga0209148_1000274 Ga0209148_100027433 218
210 3300025297 Ga0209758_1001908 Ga0209758_10019089 218
211 3300025297 Ga0209758_1036239 Ga0209758_10362392 218
212 3300025302 Ga0207426_1000143 Ga0207426_1000143162 218
213 3300025304 Ga0209257_1030530 Ga0209257_10305302 218
214 3300025898 Ga0207692_10009902 Ga0207692_100099022 218
215 3300025906 Ga0207699_10001003 Ga0207699_1000100310 218
216 3300025911 Ga0207654_10063597 Ga0207654_100635972 218
217 3300025915 Ga0207693_10045948 Ga0207693_100459482 218
218 3300025916 Ga0207663_10012503 Ga0207663_100125032 218
219 3300025924 Ga0207694_10175041 Ga0207694_101750412 218
220 3300025929 Ga0207664_10030708 Ga0207664_100307082 218
221 3300025939 Ga0207665_10029125 Ga0207665_100291253 218
222 3300026041 Ga0207639_10143515 Ga0207639_101435152 218
223 3300026078 Ga0207702_10543101 Ga0207702_105431012 218
224 3300031344 Ga0265316_10374520 Ga0265316_103745202 218
225 3300044694 Ga0466963_0017811 Ga0466963_0017811_1388_2074 218
226 3300044706 Ga0466964_0163810 Ga0466964_0163810_147_833 218
227 3300045976 Ga0466967_0024864 Ga0466967_0024864_1644_2330 218
228 3300048928 Ga0496125_0090833 Ga0496125_0090833_320_1006 218
229 3300049584 Ga0501068_0325772 Ga0501068_0325772_180_854 218
230 3300049587 Ga0501071_0083235 Ga0501071_0083235_335_1009 218
231 3300049588 Ga0501072_0086538 Ga0501072_0086538_145_819 218
232 3300049591 Ga0501075_0040287 Ga0501075_0040287_225_899 218
233 3300049593 Ga0501077_0118183 Ga0501077_0118183_592_1266 218
234 3300049741 Ga0501079_0020198 Ga0501079_0020198_2145_2819 218
235 3300049743 Ga0501081_0027216 Ga0501081_0027216_1308_1982 218
236 3300050491 nmdc:mga00v17_79322_c1 nmdc:mga00v17_79322_c1_1332_2018 218
237 3300050492 nmdc:mga0yw44_54507_c1 nmdc:mga0yw44_54507_c1_1066_1752 218
238 3300053119 Ga0500595_022769 Ga0500595_022769_570_1256 218
239 3300053125 Ga0500618_001267 Ga0500618_001267_1370_2059 218
240 3300053130 Ga0500642_0009847 Ga0500642_0009847_2524_3210 218
241 3300053737 Ga0500601_000022 Ga0500601_000022_937_1623 218
242 3300054114 Ga0501084_0034090 Ga0501084_0034090_2927_3601 218
243 3300055283 Ga0500661_021571 Ga0500661_021571_192_878 218
244 3300060353 Ga0501082_0021973 Ga0501082_0021973_3216_3890 218
245 3300061719 Ga0466962_0155906 Ga0466962_0155906_412_1098 218
246 3300061734 Ga0530510_0117097 Ga0530510_0117097_114_788 218
247 iso_pu_bacteria 2791355197 2793068239 218
248 iso_pu_bacteria 2824653114 2824656246 218
249 iso_pu_bacteria 2824661429 2824665657 218
250 iso_pu_bacteria 2844315083 2844318741 218
251 iso_pu_bacteria 2906602504 2906604430 218
252 iso_pu_bacteria 8056967851 8056973131 218
253 3300005536 Ga0070697_100039437 Ga0070697_1000394373 219
254 3300005545 Ga0070695_100008588 Ga0070695_1000085883 219
255 3300005546 Ga0070696_100007312 Ga0070696_1000073124 219
256 3300005549 Ga0070704_100002394 Ga0070704_1000023947 219
257 3300005577 Ga0068857_100156103 Ga0068857_1001561032 219
258 3300006038 Ga0075365_10047027 Ga0075365_100470272 219
259 3300006051 Ga0075364_10083572 Ga0075364_100835722 219
260 3300006163 Ga0070715_10174973 Ga0070715_101749732 219
261 3300006186 Ga0075369_10189107 Ga0075369_101891071 219
262 3300006195 Ga0075366_10404603 Ga0075366_104046032 219
263 3300006914 Ga0075436_100000477 Ga0075436_1000004773 219
264 3300007076 Ga0075435_100076627 Ga0075435_1000766273 219
265 3300009174 Ga0105241_10024393 Ga0105241_100243934 219
266 3300010375 Ga0105239_10307471 Ga0105239_103074712 219
267 3300013100 Ga0157373_10015435 Ga0157373_100154352 219
268 3300025905 Ga0207685_10061678 Ga0207685_100616782 219
269 3300026067 Ga0207678_10038702 Ga0207678_100387022 219
270 3300026116 Ga0207674_10184805 Ga0207674_101848052 219
271 3300027866 Ga0209813_10039324 Ga0209813_100393242 219
272 3300028379 Ga0268266_10319538 Ga0268266_103195382 219
273 3300028794 Ga0307515_10091636 Ga0307515_100916363 219
274 3300035724 Ga0373933_0000007 Ga0373933_0000007_88028_88717 219
275 3300042005 Ga0439448_0084842 Ga0439448_0084842_236_910 219
276 3300046460 Ga0495638_0011195 Ga0495638_0011195_4181_4867 219
277 3300046501 Ga0495607_0103777 Ga0495607_0103777_159_845 219
278 3300046507 Ga0495606_0110584 Ga0495606_0110584_589_1275 219
279 3300046512 Ga0495610_0021653 Ga0495610_0021653_888_1574 219
280 3300046515 Ga0495620_0064800 Ga0495620_0064800_106_792 219
281 3300046518 Ga0495631_0020740 Ga0495631_0020740_228_914 219
282 3300046524 Ga0495648_0082144 Ga0495648_0082144_200_886 219
283 3300046648 Ga0495611_0251504 Ga0495611_0251504_80_766 219
284 3300046660 Ga0495625_0034767 Ga0495625_0034767_816_1502 219
285 3300046660 Ga0495625_0346003 Ga0495625_0346003_228_890 219
286 3300046665 Ga0495661_0016354 Ga0495661_0016354_59_745 219
287 3300046691 Ga0495670_0005031 Ga0495670_0005031_1054_1740 219
288 3300046692 Ga0495671_0088284 Ga0495671_0088284_702_1388 219
289 3300047472 Ga0495686_0262390 Ga0495686_0262390_175_861 219
290 3300048919 Ga0496116_0001851 Ga0496116_0001851_15434_16120 219
291 3300048920 Ga0496117_0121378 Ga0496117_0121378_460_1146 219
292 3300048923 Ga0496120_0300990 Ga0496120_0300990_32_718 219
293 3300048924 Ga0496121_0013940 Ga0496121_0013940_6624_7310 219
294 3300048925 Ga0496122_0054736 Ga0496122_0054736_170_856 219
295 3300048926 Ga0496123_0226992 Ga0496123_0226992_186_872 219
296 3300048928 Ga0496125_0029721 Ga0496125_0029721_4060_4746 219
297 3300049571 Ga0501034_0269075 Ga0501034_0269075_596_1285 219
298 3300049572 Ga0501036_0124437 Ga0501036_0124437_595_1284 219
299 3300049574 Ga0501038_0047640 Ga0501038_0047640_2003_2692 219
300 3300049574 Ga0501038_0310331 Ga0501038_0310331_196_885 219
301 3300049581 Ga0501047_0127392 Ga0501047_0127392_1257_1946 219
302 3300049583 Ga0501067_0165649 Ga0501067_0165649_196_885 219
303 3300049584 Ga0501068_0154246 Ga0501068_0154246_441_1130 219
304 3300049589 Ga0501073_0004541 Ga0501073_0004541_8032_8721 219
305 3300049742 Ga0501080_0023180 Ga0501080_0023180_590_1279 219
306 3300050491 nmdc:mga00v17_4955_c1 nmdc:mga00v17_4955_c1_128_814 219
307 3300050496 nmdc:mga07m45_12481_c1 nmdc:mga07m45_12481_c1_3395_4081 219
308 3300050516 nmdc:mga0sz30_19112_c1 nmdc:mga0sz30_19112_c1_49_735 219
309 3300053088 Ga0500644_0072537 Ga0500644_0072537_210_896 219
310 3300053090 Ga0500646_0081659 Ga0500646_0081659_49_735 219
311 3300053093 Ga0500651_0144194 Ga0500651_0144194_626_1312 219
312 3300053094 Ga0500566_0000499 Ga0500566_0000499_13630_14316 219
313 3300053096 Ga0500641_0018535 Ga0500641_0018535_1826_2512 219
314 3300053098 Ga0500650_0002506 Ga0500650_0002506_4540_5226 219
315 3300053104 Ga0500556_0000004 Ga0500556_0000004_46297_46983 219
316 3300053108 Ga0500562_067349 Ga0500562_067349_33_695 219
317 3300053109 Ga0500569_033050 Ga0500569_033050_596_1282 219
318 3300053118 Ga0500594_0123260 Ga0500594_0123260_99_785 219
319 3300053130 Ga0500642_0000010 Ga0500642_0000010_139252_139938 219
320 3300053131 Ga0500652_000063 Ga0500652_000063_17115_17801 219
321 3300053139 Ga0500568_0000388 Ga0500568_0000388_11228_11914 219
322 3300053146 Ga0500588_0037346 Ga0500588_0037346_148_834 219
323 3300053151 Ga0500604_0012185 Ga0500604_0012185_596_1282 219
324 3300053153 Ga0500616_0000014 Ga0500616_0000014_63488_64174 219
325 3300053154 Ga0500619_020780 Ga0500619_020780_613_1299 219
326 3300053156 Ga0500622_0000266 Ga0500622_0000266_50353_51039 219
327 3300053158 Ga0500627_0033807 Ga0500627_0033807_59_745 219
328 3300053160 Ga0500633_0038306 Ga0500633_0038306_507_1193 219
329 3300053177 Ga0500636_0001741 Ga0500636_0001741_8511_9200 219
330 3300053724 Ga0500570_069807 Ga0500570_069807_271_957 219
331 3300053730 Ga0500645_021692 Ga0500645_021692_474_1160 219
332 3300054114 Ga0501084_0336590 Ga0501084_0336590_531_1220 219
333 3300060353 Ga0501082_0299310 Ga0501082_0299310_247_936 219
334 iso_pu_bacteria 2602042107 2603859168 219
335 iso_pu_bacteria 2857524615 2857527779 219
336 iso_pu_bacteria 2893066018 2893066499 219
337 iso_pu_bacteria 2919073203 2919079445 219
338 3300006048 Ga0075363_100288731 Ga0075363_1002887311 220
339 3300009094 Ga0111539_10083183 Ga0111539_100831835 220
340 3300013297 Ga0157378_10142728 Ga0157378_101427282 220
341 3300031247 Ga0265340_10034405 Ga0265340_100344053 220
342 3300031616 Ga0307508_10047520 Ga0307508_100475203 220
343 3300033544 Ga0316215_1000920 Ga0316215_10009203 220
344 3300035724 Ga0373933_0056949 Ga0373933_0056949_193_861 220
345 3300036401 Ga0373937_0047656 Ga0373937_0047656_1804_2472 220
346 3300036459 Ga0372808_000937 Ga0372808_000937_391_1083 220
347 3300039437 Ga0436365_0368397 Ga0436365_0368397_2010_2672 220
348 3300048908 Ga0496105_0031349 Ga0496105_0031349_3300_4016 220
349 3300048909 Ga0496106_0174483 Ga0496106_0174483_206_868 220
350 3300048912 Ga0496109_0233656 Ga0496109_0233656_364_1026 220
351 3300048913 Ga0496110_0238597 Ga0496110_0238597_713_1375 220
352 3300048916 Ga0496113_0421480 Ga0496113_0421480_352_1014 220
353 3300048918 Ga0496115_0030851 Ga0496115_0030851_2704_3366 220
354 3300049571 Ga0501034_0056596 Ga0501034_0056596_1128_1820 220
355 3300050507 nmdc:mga05p37_512131_c1 nmdc:mga05p37_512131_c1_298_960 220
356 3300050511 nmdc:mga08y16_124566_c1 nmdc:mga08y16_124566_c1_20_682 220
357 3300005353 Ga0070669_100324818 Ga0070669_1003248182 221
358 3300005355 Ga0070671_100178959 Ga0070671_1001789592 221
359 3300005356 Ga0070674_100116254 Ga0070674_1001162542 221
360 3300005983 Ga0081540_1017139 Ga0081540_10171392 221
361 3300006038 Ga0075365_10333070 Ga0075365_103330702 221
362 3300006038 Ga0075365_10386415 Ga0075365_103864152 221
363 3300006042 Ga0075368_10065813 Ga0075368_100658132 221
364 3300006042 Ga0075368_10194856 Ga0075368_101948562 221
365 3300006048 Ga0075363_100076097 Ga0075363_1000760972 221
366 3300006048 Ga0075363_100137181 Ga0075363_1001371812 221
367 3300006178 Ga0075367_10218491 Ga0075367_102184911 221
368 3300006186 Ga0075369_10047996 Ga0075369_100479962 221
369 3300006195 Ga0075366_10193129 Ga0075366_101931291 221
370 3300006847 Ga0075431_100064062 Ga0075431_1000640624 221
371 3300006852 Ga0075433_10298209 Ga0075433_102982092 221
372 3300009094 Ga0111539_10106273 Ga0111539_101062732 221
373 3300011119 Ga0105246_10557154 Ga0105246_105571542 221
374 3300013307 Ga0157372_11029520 Ga0157372_110295201 221
375 3300025921 Ga0207652_10043743 Ga0207652_100437432 221
376 3300025923 Ga0207681_10364887 Ga0207681_103648872 221
377 3300027866 Ga0209813_10074582 Ga0209813_100745822 221
378 3300031241 Ga0265325_10014052 Ga0265325_100140522 221
379 3300031595 Ga0265313_10073434 Ga0265313_100734342 221
380 3300035114 Ga0373939_0001290 Ga0373939_0001290_1350_2015 221
381 3300046491 Ga0495584_0008719 Ga0495584_0008719_1875_2540 221
382 3300048903 Ga0496100_0010730 Ga0496100_0010730_3254_3922 221
383 3300048904 Ga0496101_0020299 Ga0496101_0020299_1358_2026 221
384 3300048905 Ga0496102_0002933 Ga0496102_0002933_7541_8209 221
385 3300048907 Ga0496104_0010922 Ga0496104_0010922_4888_5556 221
386 3300048909 Ga0496106_0016428 Ga0496106_0016428_4284_4952 221
387 3300048910 Ga0496107_0007435 Ga0496107_0007435_2840_3508 221
388 3300048911 Ga0496108_0057975 Ga0496108_0057975_613_1281 221
389 3300048912 Ga0496109_0014804 Ga0496109_0014804_3412_4080 221
390 3300048913 Ga0496110_0002156 Ga0496110_0002156_2633_3301 221
391 3300048914 Ga0496111_0034140 Ga0496111_0034140_742_1410 221
392 3300048915 Ga0496112_0020476 Ga0496112_0020476_3684_4352 221
393 3300048916 Ga0496113_0009756 Ga0496113_0009756_3462_4130 221
394 3300048918 Ga0496115_0037797 Ga0496115_0037797_406_1074 221
395 3300049571 Ga0501034_0023489 Ga0501034_0023489_4207_4872 221
396 3300049581 Ga0501047_0095778 Ga0501047_0095778_655_1320 221
397 3300049582 Ga0501048_0578936 Ga0501048_0578936_102_767 221
398 3300049585 Ga0501069_0035200 Ga0501069_0035200_44_709 221
399 3300049585 Ga0501069_0108775 Ga0501069_0108775_172_837 221
400 3300049586 Ga0501070_0044484 Ga0501070_0044484_511_1176 221
401 3300049586 Ga0501070_0123635 Ga0501070_0123635_419_1084 221
402 3300049586 Ga0501070_0132694 Ga0501070_0132694_516_1181 221
403 3300049586 Ga0501070_0154409 Ga0501070_0154409_973_1638 221
404 3300049586 Ga0501070_0191252 Ga0501070_0191252_864_1529 221
405 3300049589 Ga0501073_0183423 Ga0501073_0183423_555_1226 221
406 3300049589 Ga0501073_0334461 Ga0501073_0334461_344_1009 221
407 3300049590 Ga0501074_0010349 Ga0501074_0010349_494_1159 221
408 3300049742 Ga0501080_0008717 Ga0501080_0008717_8006_8671 221
409 3300049742 Ga0501080_0022269 Ga0501080_0022269_1048_1713 221
410 3300049742 Ga0501080_0236493 Ga0501080_0236493_591_1262 221
411 3300049744 Ga0501083_0181223 Ga0501083_0181223_270_950 221
412 3300049744 Ga0501083_0418990 Ga0501083_0418990_82_747 221
413 3300049822 Ga0501035_0004729 Ga0501035_0004729_11082_11747 221
414 3300049823 Ga0501044_0093602 Ga0501044_0093602_691_1356 221
415 3300050490 nmdc:mga03n38_59258_c1 nmdc:mga03n38_59258_c1_873_1538 221
416 3300050491 nmdc:mga00v17_149620_c1 nmdc:mga00v17_149620_c1_551_1216 221
417 3300050492 nmdc:mga0yw44_98989_c1 nmdc:mga0yw44_98989_c1_615_1280 221
418 3300050495 nmdc:mga04h51_121630_c1 nmdc:mga04h51_121630_c1_49_714 221
419 3300050495 nmdc:mga04h51_148960_c1 nmdc:mga04h51_148960_c1_169_834 221
420 3300050510 nmdc:mga06r32_349126_c1 nmdc:mga06r32_349126_c1_199_864 221
421 3300050511 nmdc:mga08y16_90408_c1 nmdc:mga08y16_90408_c1_2360_3025 221
422 3300050516 nmdc:mga0sz30_38510_c1 nmdc:mga0sz30_38510_c1_345_1013 221
423 3300050516 nmdc:mga0sz30_56787_c1 nmdc:mga0sz30_56787_c1_565_1230 221
424 3300060353 Ga0501082_0323962 Ga0501082_0323962_500_1165 221
425 3300001976 JGI24752J21851_1007459 JGI24752J21851_10074592 222
426 3300001990 JGI24737J22298_10012530 JGI24737J22298_100125302 222
427 3300001991 JGI24743J22301_10000134 JGI24743J22301_100001346 222
428 3300002070 JGI24750J21931_1000851 JGI24750J21931_10008512 222
429 3300002073 JGI24745J21846_1001252 JGI24745J21846_10012522 222
430 3300002074 JGI24748J21848_1001597 JGI24748J21848_10015972 222
431 3300002076 JGI24749J21850_1000509 JGI24749J21850_10005095 222
432 3300002077 JGI24744J21845_10002294 JGI24744J21845_100022942 222
433 3300002239 JGI24034J26672_10002367 JGI24034J26672_100023672 222
434 3300002459 JGI24751J29686_10001980 JGI24751J29686_100019802 222
435 3300003215 JGI25153J46596_10006534 JGI25153J46596_100065343 222
436 3300005329 Ga0070683_100269295 Ga0070683_1002692952 222
437 3300005330 Ga0070690_100028892 Ga0070690_1000288923 222
438 3300005331 Ga0070670_100013394 Ga0070670_1000133945 222
439 3300005331 Ga0070670_100020400 Ga0070670_1000204002 222
440 3300005334 Ga0068869_100028205 Ga0068869_1000282052 222
441 3300005336 Ga0070680_100002406 Ga0070680_1000024064 222
442 3300005336 Ga0070680_100343800 Ga0070680_1003438002 222
443 3300005338 Ga0068868_100007445 Ga0068868_1000074455 222
444 3300005339 Ga0070660_100222309 Ga0070660_1002223092 222
445 3300005340 Ga0070689_100075714 Ga0070689_1000757143 222
446 3300005343 Ga0070687_100001322 Ga0070687_1000013228 222
447 3300005343 Ga0070687_100079089 Ga0070687_1000790892 222
448 3300005344 Ga0070661_100077062 Ga0070661_1000770623 222
449 3300005347 Ga0070668_100012197 Ga0070668_1000121972 222
450 3300005353 Ga0070669_100065344 Ga0070669_1000653443 222
451 3300005353 Ga0070669_100086295 Ga0070669_1000862952 222
452 3300005353 Ga0070669_100331888 Ga0070669_1003318882 222
453 3300005354 Ga0070675_100035184 Ga0070675_1000351843 222
454 3300005355 Ga0070671_100013663 Ga0070671_1000136633 222
455 3300005355 Ga0070671_100162171 Ga0070671_1001621712 222
456 3300005355 Ga0070671_100497137 Ga0070671_1004971372 222
457 3300005356 Ga0070674_100002023 Ga0070674_1000020232 222
458 3300005356 Ga0070674_100413441 Ga0070674_1004134412 222
459 3300005364 Ga0070673_100012244 Ga0070673_1000122443 222
460 3300005364 Ga0070673_100078176 Ga0070673_1000781762 222
461 3300005364 Ga0070673_100081066 Ga0070673_1000810662 222
462 3300005365 Ga0070688_100006730 Ga0070688_1000067305 222
463 3300005365 Ga0070688_100020200 Ga0070688_1000202003 222
464 3300005365 Ga0070688_100044398 Ga0070688_1000443982 222
465 3300005366 Ga0070659_100311580 Ga0070659_1003115802 222
466 3300005367 Ga0070667_100006086 Ga0070667_1000060865 222
467 3300005367 Ga0070667_100084771 Ga0070667_1000847712 222
468 3300005436 Ga0070713_101169477 Ga0070713_1011694771 222
469 3300005437 Ga0070710_10018625 Ga0070710_100186253 222
470 3300005438 Ga0070701_10000544 Ga0070701_100005448 222
471 3300005439 Ga0070711_100179886 Ga0070711_1001798862 222
472 3300005439 Ga0070711_100477130 Ga0070711_1004771301 222
473 3300005441 Ga0070700_100014905 Ga0070700_1000149053 222
474 3300005455 Ga0070663_100522804 Ga0070663_1005228041 222
475 3300005456 Ga0070678_100033394 Ga0070678_1000333942 222
476 3300005456 Ga0070678_100042057 Ga0070678_1000420572 222
477 3300005456 Ga0070678_100065144 Ga0070678_1000651441 222
478 3300005458 Ga0070681_10036642 Ga0070681_100366423 222
479 3300005459 Ga0068867_100006600 Ga0068867_1000066005 222
480 3300005459 Ga0068867_100112569 Ga0068867_1001125692 222
481 3300005466 Ga0070685_10001171 Ga0070685_1000117110 222
482 3300005471 Ga0070698_100407018 Ga0070698_1004070181 222
483 3300005530 Ga0070679_100010449 Ga0070679_1000104495 222
484 3300005535 Ga0070684_100111632 Ga0070684_1001116321 222
485 3300005539 Ga0068853_100028508 Ga0068853_1000285084 222
486 3300005543 Ga0070672_100007959 Ga0070672_1000079592 222
487 3300005544 Ga0070686_100242105 Ga0070686_1002421052 222
488 3300005544 Ga0070686_100615599 Ga0070686_1006155991 222
489 3300005548 Ga0070665_100031361 Ga0070665_1000313615 222
490 3300005549 Ga0070704_100081333 Ga0070704_1000813332 222
491 3300005549 Ga0070704_100103455 Ga0070704_1001034553 222
492 3300005563 Ga0068855_100144161 Ga0068855_1001441613 222
493 3300005564 Ga0070664_100051607 Ga0070664_1000516074 222
494 3300005578 Ga0068854_100103200 Ga0068854_1001032002 222
495 3300005614 Ga0068856_100110413 Ga0068856_1001104132 222
496 3300005615 Ga0070702_100036072 Ga0070702_1000360722 222
497 3300005615 Ga0070702_100218091 Ga0070702_1002180912 222
498 3300005615 Ga0070702_100259079 Ga0070702_1002590792 222
499 3300005615 Ga0070702_100346934 Ga0070702_1003469342 222
500 3300005617 Ga0068859_100149112 Ga0068859_1001491122 222
501 3300005617 Ga0068859_100193521 Ga0068859_1001935212 222
502 3300005618 Ga0068864_100397581 Ga0068864_1003975812 222
503 3300005840 Ga0068870_10005222 Ga0068870_100052225 222
504 3300005841 Ga0068863_100007012 Ga0068863_10000701210 222
505 3300005841 Ga0068863_100155966 Ga0068863_1001559662 222
506 3300005841 Ga0068863_100500957 Ga0068863_1005009571 222
507 3300005842 Ga0068858_100016071 Ga0068858_1000160714 222
508 3300005842 Ga0068858_100383926 Ga0068858_1003839262 222
509 3300005843 Ga0068860_100040442 Ga0068860_1000404424 222
510 3300005844 Ga0068862_100011484 Ga0068862_1000114845 222
511 3300005844 Ga0068862_100840405 Ga0068862_1008404052 222
512 3300005844 Ga0068862_101167701 Ga0068862_1011677011 222
513 3300005937 Ga0081455_10010899 Ga0081455_100108999 222
514 3300005937 Ga0081455_10033604 Ga0081455_100336044 222
515 3300005937 Ga0081455_10469817 Ga0081455_104698171 222
516 3300005981 Ga0081538_10029065 Ga0081538_100290653 222
517 3300005981 Ga0081538_10034984 Ga0081538_100349843 222
518 3300005981 Ga0081538_10078950 Ga0081538_100789502 222
519 3300006028 Ga0070717_10022811 Ga0070717_100228114 222
520 3300006028 Ga0070717_10057188 Ga0070717_100571883 222
521 3300006028 Ga0070717_10167415 Ga0070717_101674152 222
522 3300006028 Ga0070717_10310901 Ga0070717_103109012 222
523 3300006038 Ga0075365_10001017 Ga0075365_100010173 222
524 3300006038 Ga0075365_10007361 Ga0075365_100073612 222
525 3300006038 Ga0075365_10026251 Ga0075365_100262512 222
526 3300006038 Ga0075365_10041020 Ga0075365_100410202 222
527 3300006038 Ga0075365_10141855 Ga0075365_101418552 222
528 3300006048 Ga0075363_100151318 Ga0075363_1001513182 222
529 3300006051 Ga0075364_10033452 Ga0075364_100334522 222
530 3300006163 Ga0070715_10127066 Ga0070715_101270661 222
531 3300006175 Ga0070712_100004847 Ga0070712_10000484710 222
532 3300006175 Ga0070712_100088621 Ga0070712_1000886212 222
533 3300006177 Ga0075362_10013531 Ga0075362_100135312 222
534 3300006177 Ga0075362_10051552 Ga0075362_100515522 222
535 3300006178 Ga0075367_10047397 Ga0075367_100473972 222
536 3300006178 Ga0075367_10305587 Ga0075367_103055872 222
537 3300006195 Ga0075366_10008616 Ga0075366_100086163 222
538 3300006195 Ga0075366_10013786 Ga0075366_100137865 222
539 3300006195 Ga0075366_10036925 Ga0075366_100369253 222
540 3300006353 Ga0075370_10027696 Ga0075370_100276962 222
541 3300006353 Ga0075370_10099290 Ga0075370_100992902 222
542 3300006358 Ga0068871_100067335 Ga0068871_1000673352 222
543 3300006358 Ga0068871_100113778 Ga0068871_1001137782 222
544 3300006844 Ga0075428_100001218 Ga0075428_10000121811 222
545 3300006844 Ga0075428_100022676 Ga0075428_1000226766 222
546 3300006844 Ga0075428_100573027 Ga0075428_1005730272 222
547 3300006844 Ga0075428_100624086 Ga0075428_1006240862 222
548 3300006846 Ga0075430_100000152 Ga0075430_10000015238 222
549 3300006846 Ga0075430_100025527 Ga0075430_1000255275 222
550 3300006846 Ga0075430_100045037 Ga0075430_1000450372 222
551 3300006846 Ga0075430_100198426 Ga0075430_1001984262 222
552 3300006847 Ga0075431_100000613 Ga0075431_10000061314 222
553 3300006847 Ga0075431_100010947 Ga0075431_1000109474 222
554 3300006847 Ga0075431_100062491 Ga0075431_1000624911 222
555 3300006847 Ga0075431_100582744 Ga0075431_1005827442 222
556 3300006847 Ga0075431_101208336 Ga0075431_1012083361 222
557 3300006852 Ga0075433_10059850 Ga0075433_100598503 222
558 3300006871 Ga0075434_100017361 Ga0075434_1000173614 222
559 3300006871 Ga0075434_100056047 Ga0075434_1000560474 222
560 3300006871 Ga0075434_100269646 Ga0075434_1002696461 222
561 3300006880 Ga0075429_100004424 Ga0075429_1000044244 222
562 3300006880 Ga0075429_100274586 Ga0075429_1002745862 222
563 3300006880 Ga0075429_100429975 Ga0075429_1004299752 222
564 3300006881 Ga0068865_100098503 Ga0068865_1000985033 222
565 3300006881 Ga0068865_100403720 Ga0068865_1004037202 222
566 3300006914 Ga0075436_100028761 Ga0075436_1000287611 222
567 3300006914 Ga0075436_100520032 Ga0075436_1005200321 222
568 3300006931 Ga0097620_100149123 Ga0097620_1001491232 222
569 3300006931 Ga0097620_100193536 Ga0097620_1001935362 222
570 3300007076 Ga0075435_100079110 Ga0075435_1000791102 222
571 3300007265 Ga0099794_10089867 Ga0099794_100898672 222
572 3300007788 Ga0099795_10001007 Ga0099795_100010074 222
573 3300007788 Ga0099795_10025722 Ga0099795_100257221 222
574 3300009011 Ga0105251_10054542 Ga0105251_100545421 222
575 3300009094 Ga0111539_10000840 Ga0111539_1000084013 222
576 3300009094 Ga0111539_10044534 Ga0111539_100445342 222
577 3300009094 Ga0111539_10089489 Ga0111539_100894893 222
578 3300009094 Ga0111539_10168821 Ga0111539_101688212 222
579 3300009094 Ga0111539_10241880 Ga0111539_102418802 222
580 3300009098 Ga0105245_10028096 Ga0105245_100280963 222
581 3300009098 Ga0105245_10201889 Ga0105245_102018892 222
582 3300009101 Ga0105247_10110832 Ga0105247_101108322 222
583 3300009101 Ga0105247_10228451 Ga0105247_102284512 222
584 3300009147 Ga0114129_10000320 Ga0114129_1000032046 222
585 3300009147 Ga0114129_10002097 Ga0114129_100020978 222
586 3300009147 Ga0114129_10051669 Ga0114129_100516696 222
587 3300009147 Ga0114129_10061592 Ga0114129_100615922 222
588 3300009147 Ga0114129_11430534 Ga0114129_114305341 222
589 3300009148 Ga0105243_10023744 Ga0105243_100237444 222
590 3300009148 Ga0105243_10221733 Ga0105243_102217332 222
591 3300009174 Ga0105241_10075452 Ga0105241_100754522 222
592 3300009174 Ga0105241_10639123 Ga0105241_106391232 222
593 3300009176 Ga0105242_10102353 Ga0105242_101023532 222
594 3300009176 Ga0105242_10390973 Ga0105242_103909732 222
595 3300009177 Ga0105248_10039516 Ga0105248_100395165 222
596 3300009177 Ga0105248_10629824 Ga0105248_106298241 222
597 3300009551 Ga0105238_10080512 Ga0105238_100805122 222
598 3300009551 Ga0105238_10855019 Ga0105238_108550192 222
599 3300010159 Ga0099796_10006006 Ga0099796_100060062 222
600 3300010159 Ga0099796_10043499 Ga0099796_100434992 222
601 3300010159 Ga0099796_10048748 Ga0099796_100487481 222
602 3300011119 Ga0105246_10076930 Ga0105246_100769302 222
603 3300011119 Ga0105246_10103701 Ga0105246_101037012 222
604 3300011119 Ga0105246_10241714 Ga0105246_102417142 222
605 3300013296 Ga0157374_10144995 Ga0157374_101449952 222
606 3300013297 Ga0157378_10430782 Ga0157378_104307822 222
607 3300013306 Ga0163162_10090461 Ga0163162_100904612 222
608 3300013306 Ga0163162_10736081 Ga0163162_107360811 222
609 3300013308 Ga0157375_10369079 Ga0157375_103690792 222
610 3300014325 Ga0163163_10039625 Ga0163163_100396254 222
611 3300014325 Ga0163163_10623628 Ga0163163_106236282 222
612 3300014326 Ga0157380_10084701 Ga0157380_100847012 222
613 3300014326 Ga0157380_10137661 Ga0157380_101376612 222
614 3300014745 Ga0157377_10005862 Ga0157377_100058625 222
615 3300014968 Ga0157379_10056034 Ga0157379_100560342 222
616 3300014968 Ga0157379_10144281 Ga0157379_101442812 222
617 3300014969 Ga0157376_10111300 Ga0157376_101113003 222
618 3300014969 Ga0157376_10571090 Ga0157376_105710902 222
619 3300017792 Ga0163161_10009501 Ga0163161_100095014 222
620 3300024225 Ga0224572_1001576 Ga0224572_10015762 222
621 3300025297 Ga0209758_1001730 Ga0209758_10017303 222
622 3300025898 Ga0207692_10029373 Ga0207692_100293732 222
623 3300025899 Ga0207642_10000663 Ga0207642_100006634 222
624 3300025899 Ga0207642_10138146 Ga0207642_101381462 222
625 3300025900 Ga0207710_10023256 Ga0207710_100232562 222
626 3300025901 Ga0207688_10000130 Ga0207688_1000013023 222
627 3300025901 Ga0207688_10068808 Ga0207688_100688083 222
628 3300025901 Ga0207688_10273334 Ga0207688_102733342 222
629 3300025904 Ga0207647_10002385 Ga0207647_1000238515 222
630 3300025907 Ga0207645_10049854 Ga0207645_100498543 222
631 3300025908 Ga0207643_10001981 Ga0207643_100019812 222
632 3300025909 Ga0207705_10315453 Ga0207705_103154532 222
633 3300025912 Ga0207707_10121547 Ga0207707_101215472 222
634 3300025915 Ga0207693_10004368 Ga0207693_100043688 222
635 3300025915 Ga0207693_10062706 Ga0207693_100627063 222
636 3300025915 Ga0207693_10080870 Ga0207693_100808702 222
637 3300025915 Ga0207693_10253175 Ga0207693_102531752 222
638 3300025916 Ga0207663_10046371 Ga0207663_100463711 222
639 3300025917 Ga0207660_10174649 Ga0207660_101746492 222
640 3300025917 Ga0207660_10294967 Ga0207660_102949672 222
641 3300025918 Ga0207662_10147737 Ga0207662_101477372 222
642 3300025919 Ga0207657_10032651 Ga0207657_100326513 222
643 3300025921 Ga0207652_10102515 Ga0207652_101025152 222
644 3300025923 Ga0207681_10054305 Ga0207681_100543052 222
645 3300025924 Ga0207694_10127645 Ga0207694_101276452 222
646 3300025925 Ga0207650_10004418 Ga0207650_100044181 222
647 3300025925 Ga0207650_10014049 Ga0207650_100140493 222
648 3300025925 Ga0207650_10025768 Ga0207650_100257682 222
649 3300025926 Ga0207659_10012143 Ga0207659_100121436 222
650 3300025926 Ga0207659_10066708 Ga0207659_100667081 222
651 3300025926 Ga0207659_10099922 Ga0207659_100999222 222
652 3300025927 Ga0207687_10005289 Ga0207687_100052898 222
653 3300025927 Ga0207687_10061597 Ga0207687_100615973 222
654 3300025928 Ga0207700_10058615 Ga0207700_100586152 222
655 3300025928 Ga0207700_10084407 Ga0207700_100844072 222
656 3300025928 Ga0207700_10452787 Ga0207700_104527872 222
657 3300025928 Ga0207700_10977642 Ga0207700_109776421 222
658 3300025929 Ga0207664_10156957 Ga0207664_101569572 222
659 3300025929 Ga0207664_10182416 Ga0207664_101824162 222
660 3300025931 Ga0207644_10006827 Ga0207644_100068272 222
661 3300025931 Ga0207644_10025164 Ga0207644_100251643 222
662 3300025931 Ga0207644_10102456 Ga0207644_101024561 222
663 3300025933 Ga0207706_10002801 Ga0207706_100028013 222
664 3300025934 Ga0207686_10054100 Ga0207686_100541002 222
665 3300025935 Ga0207709_10015455 Ga0207709_100154554 222
666 3300025935 Ga0207709_10177333 Ga0207709_101773332 222
667 3300025936 Ga0207670_10021754 Ga0207670_100217544 222
668 3300025936 Ga0207670_10052934 Ga0207670_100529342 222
669 3300025936 Ga0207670_10076670 Ga0207670_100766702 222
670 3300025936 Ga0207670_10305155 Ga0207670_103051552 222
671 3300025937 Ga0207669_10007567 Ga0207669_100075672 222
672 3300025938 Ga0207704_10196064 Ga0207704_101960642 222
673 3300025939 Ga0207665_10281471 Ga0207665_102814712 222
674 3300025940 Ga0207691_10011407 Ga0207691_100114075 222
675 3300025940 Ga0207691_10540575 Ga0207691_105405752 222
676 3300025941 Ga0207711_10016266 Ga0207711_100162663 222
677 3300025941 Ga0207711_10090712 Ga0207711_100907122 222
678 3300025942 Ga0207689_10000756 Ga0207689_1000075622 222
679 3300025945 Ga0207679_10024806 Ga0207679_100248063 222
680 3300025960 Ga0207651_10003263 Ga0207651_100032633 222
681 3300025960 Ga0207651_10007290 Ga0207651_100072902 222
682 3300025960 Ga0207651_10072681 Ga0207651_100726813 222
683 3300025960 Ga0207651_10799889 Ga0207651_107998891 222
684 3300025961 Ga0207712_10017551 Ga0207712_100175514 222
685 3300025972 Ga0207668_10028885 Ga0207668_100288852 222
686 3300025972 Ga0207668_10485434 Ga0207668_104854342 222
687 3300025972 Ga0207668_10767144 Ga0207668_107671441 222
688 3300025981 Ga0207640_10015569 Ga0207640_100155694 222
689 3300026023 Ga0207677_10006114 Ga0207677_100061144 222
690 3300026035 Ga0207703_10011569 Ga0207703_100115696 222
691 3300026035 Ga0207703_10783315 Ga0207703_107833152 222
692 3300026067 Ga0207678_10042400 Ga0207678_100424002 222
693 3300026075 Ga0207708_10004345 Ga0207708_100043452 222
694 3300026088 Ga0207641_10058535 Ga0207641_100585354 222
695 3300026088 Ga0207641_10162421 Ga0207641_101624212 222
696 3300026088 Ga0207641_10991663 Ga0207641_109916631 222
697 3300026089 Ga0207648_10009209 Ga0207648_100092094 222
698 3300026089 Ga0207648_10060490 Ga0207648_100604903 222
699 3300026095 Ga0207676_10007771 Ga0207676_100077716 222
700 3300026095 Ga0207676_10132024 Ga0207676_101320242 222
701 3300026118 Ga0207675_100004438 Ga0207675_1000044383 222
702 3300026121 Ga0207683_10015749 Ga0207683_100157492 222
703 3300026121 Ga0207683_10049872 Ga0207683_100498723 222
704 3300026121 Ga0207683_10090523 Ga0207683_100905232 222
705 3300026121 Ga0207683_10572721 Ga0207683_105727212 222
706 3300026142 Ga0207698_10115378 Ga0207698_101153782 222
707 3300027866 Ga0209813_10005872 Ga0209813_100058722 222
708 3300027907 Ga0207428_10017604 Ga0207428_100176044 222
709 3300027907 Ga0207428_10066313 Ga0207428_100663133 222
710 3300027907 Ga0207428_10123330 Ga0207428_101233301 222
711 3300028379 Ga0268266_10209882 Ga0268266_102098822 222
712 3300028380 Ga0268265_10015994 Ga0268265_100159942 222
713 3300028381 Ga0268264_10244109 Ga0268264_102441092 222
714 3300028381 Ga0268264_10733889 Ga0268264_107338892 222
715 3300030760 Ga0265762_1004526 Ga0265762_10045262 222
716 3300030763 Ga0265763_1001918 Ga0265763_10019182 222
717 3300031548 Ga0307408_100242164 Ga0307408_1002421642 222
718 3300035083 Ga0373926_0006659 Ga0373926_0006659_1798_2472 222
719 3300035085 Ga0373929_0010236 Ga0373929_0010236_495_1163 222
720 3300035088 Ga0373940_0007997 Ga0373940_0007997_455_1123 222
721 3300035089 Ga0373944_0001173 Ga0373944_0001173_3262_3936 222
722 3300035111 Ga0373923_0002035 Ga0373923_0002035_2252_2920 222
723 3300035113 Ga0373936_0001796 Ga0373936_0001796_639_1307 222
724 3300035113 Ga0373936_0047960 Ga0373936_0047960_560_1228 222
725 3300035116 Ga0373945_0005121 Ga0373945_0005121_2709_3377 222
726 3300035116 Ga0373945_0007492 Ga0373945_0007492_889_1563 222
727 3300035116 Ga0373945_0007797 Ga0373945_0007797_1040_1714 222
728 3300035117 Ga0373953_0032305 Ga0373953_0032305_523_1191 222
729 3300035119 Ga0373956_0012955 Ga0373956_0012955_490_1158 222
730 3300035119 Ga0373956_0037590 Ga0373956_0037590_516_1184 222
731 3300035170 Ga0373943_0000381 Ga0373943_0000381_14208_14882 222
732 3300035170 Ga0373943_0015098 Ga0373943_0015098_736_1404 222
733 3300035170 Ga0373943_0031493 Ga0373943_0031493_1084_1752 222
734 3300035170 Ga0373943_0077253 Ga0373943_0077253_646_1314 222
735 3300035170 Ga0373943_0224374 Ga0373943_0224374_262_936 222
736 3300035171 Ga0373946_0002070 Ga0373946_0002070_1240_1908 222
737 3300035171 Ga0373946_0036439 Ga0373946_0036439_365_1099 222
738 3300035171 Ga0373946_0052451 Ga0373946_0052451_875_1549 222
739 3300035172 Ga0373955_0002179 Ga0373955_0002179_2000_2668 222
740 3300035172 Ga0373955_0007537 Ga0373955_0007537_191_859 222
741 3300035242 Ga0373962_0041982 Ga0373962_0041982_604_1272 222
742 3300035410 Ga0373924_0015268 Ga0373924_0015268_1678_2346 222
743 3300035410 Ga0373924_0031708 Ga0373924_0031708_781_1515 222
744 3300035410 Ga0373924_0102603 Ga0373924_0102603_496_1164 222
745 3300035691 Ga0373931_0086002 Ga0373931_0086002_348_1016 222
746 3300035692 Ga0373935_0000006 Ga0373935_0000006_27358_28026 222
747 3300035692 Ga0373935_0049660 Ga0373935_0049660_1458_2132 222
748 3300035692 Ga0373935_0053179 Ga0373935_0053179_454_1122 222
749 3300035692 Ga0373935_0105630 Ga0373935_0105630_566_1234 222
750 3300035692 Ga0373935_0170453 Ga0373935_0170453_630_1298 222
751 3300035695 Ga0373927_0003706 Ga0373927_0003706_7560_8234 222
752 3300035695 Ga0373927_0013209 Ga0373927_0013209_4664_5338 222
753 3300035695 Ga0373927_0015339 Ga0373927_0015339_1992_2660 222
754 3300035695 Ga0373927_0015712 Ga0373927_0015712_3137_3805 222
755 3300035695 Ga0373927_0018500 Ga0373927_0018500_216_884 222
756 3300035695 Ga0373927_0171463 Ga0373927_0171463_595_1263 222
757 3300035695 Ga0373927_0238671 Ga0373927_0238671_385_1053 222
758 3300035695 Ga0373927_0547269 Ga0373927_0547269_25_693 222
759 3300035724 Ga0373933_0004171 Ga0373933_0004171_1176_1844 222
760 3300035725 Ga0373947_0000419 Ga0373947_0000419_20650_21324 222
761 3300035725 Ga0373947_0003146 Ga0373947_0003146_5657_6331 222
762 3300035725 Ga0373947_0006728 Ga0373947_0006728_3021_3689 222
763 3300035725 Ga0373947_0019872 Ga0373947_0019872_2071_2739 222
764 3300035725 Ga0373947_0033265 Ga0373947_0033265_1175_1843 222
765 3300035725 Ga0373947_0105033 Ga0373947_0105033_285_953 222
766 3300035725 Ga0373947_0139717 Ga0373947_0139717_689_1357 222
767 3300036401 Ga0373937_0000124 Ga0373937_0000124_5856_6524 222
768 3300036401 Ga0373937_0018439 Ga0373937_0018439_617_1285 222
769 3300036401 Ga0373937_0025281 Ga0373937_0025281_1736_2470 222
770 3300037068 Ga0373925_0000210 Ga0373925_0000210_39554_40222 222
771 3300037068 Ga0373925_0006086 Ga0373925_0006086_5603_6277 222
772 3300037068 Ga0373925_0026431 Ga0373925_0026431_1053_1721 222
773 3300037068 Ga0373925_0032271 Ga0373925_0032271_1362_2036 222
774 3300037068 Ga0373925_0083949 Ga0373925_0083949_1571_2239 222
775 3300037068 Ga0373925_0284217 Ga0373925_0284217_72_740 222
776 3300039437 Ga0436365_1370429 Ga0436365_1370429_93_761 222
777 3300041486 Ga0451807_2166610 Ga0451807_2166610_182_850 222
778 3300042013 Ga0439456_078854 Ga0439456_078854_56_724 222
779 3300044712 Ga0453684_1220544 Ga0453684_1220544_57_725 222
780 3300046452 Ga0495617_078930 Ga0495617_078930_337_1005 222
781 3300046454 Ga0495592_0000020 Ga0495592_0000020_72533_73201 222
782 3300046454 Ga0495592_0026318 Ga0495592_0026318_814_1482 222
783 3300046454 Ga0495592_0034109 Ga0495592_0034109_2871_3605 222
784 3300046454 Ga0495592_0095454 Ga0495592_0095454_445_1119 222
785 3300046459 Ga0495629_0006124 Ga0495629_0006124_1159_1827 222
786 3300046459 Ga0495629_0008249 Ga0495629_0008249_5456_6124 222
787 3300046459 Ga0495629_0044612 Ga0495629_0044612_1412_2086 222
788 3300046459 Ga0495629_0258401 Ga0495629_0258401_137_871 222
789 3300046459 Ga0495629_0444729 Ga0495629_0444729_62_730 222
790 3300046462 Ga0495651_0000282 Ga0495651_0000282_35427_36095 222
791 3300046462 Ga0495651_0001410 Ga0495651_0001410_6618_7286 222
792 3300046463 Ga0495653_0000046 Ga0495653_0000046_67597_68265 222
793 3300046463 Ga0495653_0001155 Ga0495653_0001155_5516_6184 222
794 3300046463 Ga0495653_0092433 Ga0495653_0092433_607_1281 222
795 3300046472 Ga0495580_0147371 Ga0495580_0147371_422_1096 222
796 3300046473 Ga0495582_0059585 Ga0495582_0059585_38_772 222
797 3300046473 Ga0495582_0096554 Ga0495582_0096554_461_1129 222
798 3300046475 Ga0495639_0133006 Ga0495639_0133006_370_1038 222
799 3300046475 Ga0495639_0146341 Ga0495639_0146341_309_977 222
800 3300046475 Ga0495639_0307503 Ga0495639_0307503_32_700 222
801 3300046476 Ga0495662_0001018 Ga0495662_0001018_8900_9574 222
802 3300046476 Ga0495662_0130074 Ga0495662_0130074_405_1073 222
803 3300046476 Ga0495662_0139554 Ga0495662_0139554_423_1091 222
804 3300046477 Ga0495664_0000017 Ga0495664_0000017_67538_68206 222
805 3300046477 Ga0495664_0000670 Ga0495664_0000670_13427_14101 222
806 3300046477 Ga0495664_0064886 Ga0495664_0064886_739_1407 222
807 3300046491 Ga0495584_0032467 Ga0495584_0032467_553_1344 222
808 3300046491 Ga0495584_0187068 Ga0495584_0187068_188_856 222
809 3300046501 Ga0495607_0104439 Ga0495607_0104439_521_1312 222
810 3300046501 Ga0495607_0233215 Ga0495607_0233215_39_707 222
811 3300046511 Ga0495608_0000250 Ga0495608_0000250_26806_27474 222
812 3300046511 Ga0495608_0010843 Ga0495608_0010843_858_1526 222
813 3300046511 Ga0495608_0081432 Ga0495608_0081432_839_1573 222
814 3300046513 Ga0495616_0071391 Ga0495616_0071391_340_1131 222
815 3300046513 Ga0495616_0191170 Ga0495616_0191170_197_865 222
816 3300046514 Ga0495618_0000059 Ga0495618_0000059_67519_68187 222
817 3300046514 Ga0495618_0002157 Ga0495618_0002157_5592_6266 222
818 3300046514 Ga0495618_0002703 Ga0495618_0002703_6193_6861 222
819 3300046514 Ga0495618_0237435 Ga0495618_0237435_46_720 222
820 3300046516 Ga0495628_0000022 Ga0495628_0000022_40684_41352 222
821 3300046516 Ga0495628_0015475 Ga0495628_0015475_4167_4835 222
822 3300046516 Ga0495628_0056961 Ga0495628_0056961_33_701 222
823 3300046516 Ga0495628_0245684 Ga0495628_0245684_506_1240 222
824 3300046517 Ga0495630_0000758 Ga0495630_0000758_11617_12285 222
825 3300046517 Ga0495630_0011807 Ga0495630_0011807_750_1424 222
826 3300046517 Ga0495630_0104242 Ga0495630_0104242_44_712 222
827 3300046517 Ga0495630_0310229 Ga0495630_0310229_143_811 222
828 3300046517 Ga0495630_0347433 Ga0495630_0347433_194_862 222
829 3300046520 Ga0495637_0135961 Ga0495637_0135961_165_833 222
830 3300046522 Ga0495643_0215295 Ga0495643_0215295_138_806 222
831 3300046523 Ga0495644_0095070 Ga0495644_0095070_144_935 222
832 3300046525 Ga0495663_0063692 Ga0495663_0063692_449_1117 222
833 3300046526 Ga0495666_0114782 Ga0495666_0114782_420_1094 222
834 3300046526 Ga0495666_0204169 Ga0495666_0204169_164_832 222
835 3300046529 Ga0495652_0000008 Ga0495652_0000008_302286_302954 222
836 3300046529 Ga0495652_0001912 Ga0495652_0001912_5470_6138 222
837 3300046529 Ga0495652_0026195 Ga0495652_0026195_596_1270 222
838 3300046529 Ga0495652_0153943 Ga0495652_0153943_379_1113 222
839 3300046529 Ga0495652_0365284 Ga0495652_0365284_329_997 222
840 3300046531 Ga0495665_0123950 Ga0495665_0123950_643_1311 222
841 3300046531 Ga0495665_0137291 Ga0495665_0137291_264_932 222
842 3300046531 Ga0495665_0269460 Ga0495665_0269460_89_823 222
843 3300046533 Ga0495640_0000029 Ga0495640_0000029_11508_12176 222
844 3300046533 Ga0495640_0008277 Ga0495640_0008277_6996_7670 222
845 3300046533 Ga0495640_0012288 Ga0495640_0012288_3869_4543 222
846 3300046533 Ga0495640_0033432 Ga0495640_0033432_789_1457 222
847 3300046533 Ga0495640_0092337 Ga0495640_0092337_904_1572 222
848 3300046535 Ga0495586_0010651 Ga0495586_0010651_3550_4224 222
849 3300046536 Ga0495587_0000019 Ga0495587_0000019_93929_94597 222
850 3300046536 Ga0495587_0006011 Ga0495587_0006011_1143_1811 222
851 3300046537 Ga0495598_0010537 Ga0495598_0010537_186_854 222
852 3300046543 Ga0495645_0000006 Ga0495645_0000006_112426_113094 222
853 3300046543 Ga0495645_0008317 Ga0495645_0008317_6283_6957 222
854 3300046543 Ga0495645_0175214 Ga0495645_0175214_17_751 222
855 3300046543 Ga0495645_0204885 Ga0495645_0204885_306_974 222
856 3300046557 Ga0495622_0118276 Ga0495622_0118276_141_809 222
857 3300046558 Ga0495633_0061264 Ga0495633_0061264_685_1353 222
858 3300046559 Ga0495667_0000061 Ga0495667_0000061_26627_27295 222
859 3300046559 Ga0495667_0000879 Ga0495667_0000879_4141_4809 222
860 3300046615 Ga0495656_0001123 Ga0495656_0001123_3443_4111 222
861 3300046615 Ga0495656_0034826 Ga0495656_0034826_1092_1760 222
862 3300046616 Ga0495668_0053325 Ga0495668_0053325_71_739 222
863 3300046642 Ga0495634_0001212 Ga0495634_0001212_19221_19889 222
864 3300046642 Ga0495634_0001468 Ga0495634_0001468_12699_13367 222
865 3300046642 Ga0495634_0007204 Ga0495634_0007204_137_811 222
866 3300046642 Ga0495634_0007643 Ga0495634_0007643_4161_4835 222
867 3300046642 Ga0495634_0189376 Ga0495634_0189376_111_845 222
868 3300046663 Ga0495635_0000023 Ga0495635_0000023_94161_94829 222
869 3300046663 Ga0495635_0009308 Ga0495635_0009308_1134_1808 222
870 3300046663 Ga0495635_0050714 Ga0495635_0050714_1395_2063 222
871 3300046663 Ga0495635_0169013 Ga0495635_0169013_374_1048 222
872 3300046665 Ga0495661_0018986 Ga0495661_0018986_908_1576 222
873 3300046675 Ga0495657_0000099 Ga0495657_0000099_74293_74961 222
874 3300046675 Ga0495657_0031948 Ga0495657_0031948_336_1004 222
875 3300046678 Ga0495599_0000039 Ga0495599_0000039_3100_3768 222
876 3300046678 Ga0495599_0068733 Ga0495599_0068733_745_1413 222
877 3300046678 Ga0495599_0183154 Ga0495599_0183154_187_861 222
878 3300046679 Ga0495623_0000253 Ga0495623_0000253_30703_31371 222
879 3300046679 Ga0495623_0002814 Ga0495623_0002814_8987_9655 222
880 3300046679 Ga0495623_0163132 Ga0495623_0163132_402_1136 222
881 3300046680 Ga0495646_0000017 Ga0495646_0000017_26604_27272 222
882 3300046680 Ga0495646_0010331 Ga0495646_0010331_661_1329 222
883 3300046680 Ga0495646_0115426 Ga0495646_0115426_216_1007 222
884 3300046680 Ga0495646_0156346 Ga0495646_0156346_161_895 222
885 3300046681 Ga0495647_0068679 Ga0495647_0068679_478_1146 222
886 3300046683 Ga0495658_0036061 Ga0495658_0036061_164_832 222
887 3300046683 Ga0495658_0046803 Ga0495658_0046803_1049_1717 222
888 3300046683 Ga0495658_0069182 Ga0495658_0069182_551_1285 222
889 3300046683 Ga0495658_0082845 Ga0495658_0082845_711_1379 222
890 3300046683 Ga0495658_0165063 Ga0495658_0165063_197_871 222
891 3300046684 Ga0495669_0090032 Ga0495669_0090032_140_808 222
892 3300046689 Ga0495613_0026976 Ga0495613_0026976_1129_1797 222
893 3300046689 Ga0495613_0049670 Ga0495613_0049670_198_866 222
894 3300046689 Ga0495613_0597593 Ga0495613_0597593_14_682 222
895 3300046690 Ga0495624_0036798 Ga0495624_0036798_294_962 222
896 3300046690 Ga0495624_0047972 Ga0495624_0047972_1819_2493 222
897 3300046690 Ga0495624_0107846 Ga0495624_0107846_685_1353 222
898 3300046690 Ga0495624_0208057 Ga0495624_0208057_138_806 222
899 3300046694 Ga0495649_0073715 Ga0495649_0073715_558_1226 222
900 3300046694 Ga0495649_0100214 Ga0495649_0100214_675_1466 222
901 3300046794 Ga0495589_0282080 Ga0495589_0282080_19_687 222
902 3300046809 Ga0495600_0000030 Ga0495600_0000030_21470_22138 222
903 3300047315 Ga0495581_0015077 Ga0495581_0015077_3079_3747 222
904 3300047315 Ga0495581_0071686 Ga0495581_0071686_394_1068 222
905 3300047315 Ga0495581_0078613 Ga0495581_0078613_972_1640 222
906 3300047315 Ga0495581_0163574 Ga0495581_0163574_464_1138 222
907 3300047317 Ga0495604_0000030 Ga0495604_0000030_97118_97786 222
908 3300047317 Ga0495604_0000662 Ga0495604_0000662_24246_24914 222
909 3300047317 Ga0495604_0515409 Ga0495604_0515409_66_740 222
910 3300047319 Ga0495674_0000009 Ga0495674_0000009_269000_269668 222
911 3300047319 Ga0495674_0002163 Ga0495674_0002163_6489_7163 222
912 3300047319 Ga0495674_0013531 Ga0495674_0013531_4929_5597 222
913 3300047321 Ga0495676_0104282 Ga0495676_0104282_526_1200 222
914 3300047321 Ga0495676_0116718 Ga0495676_0116718_1017_1685 222
915 3300047321 Ga0495676_0120623 Ga0495676_0120623_848_1516 222
916 3300047321 Ga0495676_0192362 Ga0495676_0192362_491_1159 222
917 3300047321 Ga0495676_0200553 Ga0495676_0200553_86_754 222
918 3300047321 Ga0495676_0241159 Ga0495676_0241159_54_728 222
919 3300047322 Ga0495680_0000359 Ga0495680_0000359_11515_12183 222
920 3300047322 Ga0495680_0001209 Ga0495680_0001209_23289_23957 222
921 3300047322 Ga0495680_0238091 Ga0495680_0238091_160_834 222
922 3300047322 Ga0495680_0339882 Ga0495680_0339882_255_989 222
923 3300047444 Ga0495675_0000056 Ga0495675_0000056_27638_28306 222
924 3300047444 Ga0495675_0008977 Ga0495675_0008977_1072_1740 222
925 3300047471 Ga0495684_0000056 Ga0495684_0000056_11537_12205 222
926 3300047471 Ga0495684_0001278 Ga0495684_0001278_7415_8089 222
927 3300047471 Ga0495684_0074981 Ga0495684_0074981_1038_1712 222
928 3300047673 Ga0495593_0003363 Ga0495593_0003363_6790_7458 222
929 3300047673 Ga0495593_0127986 Ga0495593_0127986_44_712 222
930 3300048088 Ga0495602_0000006 Ga0495602_0000006_67488_68156 222
931 3300048088 Ga0495602_0000539 Ga0495602_0000539_7058_7726 222
932 3300048088 Ga0495602_0244967 Ga0495602_0244967_633_1301 222
933 3300048088 Ga0495602_0549334 Ga0495602_0549334_35_703 222
934 3300048089 Ga0495614_0137271 Ga0495614_0137271_73_741 222
935 3300048903 Ga0496100_0000926 Ga0496100_0000926_4314_5105 222
936 3300048903 Ga0496100_0007931 Ga0496100_0007931_4428_5096 222
937 3300048903 Ga0496100_0116252 Ga0496100_0116252_1113_1781 222
938 3300048903 Ga0496100_0209142 Ga0496100_0209142_224_892 222
939 3300048904 Ga0496101_0004497 Ga0496101_0004497_1007_1798 222
940 3300048904 Ga0496101_0032008 Ga0496101_0032008_164_832 222
941 3300048905 Ga0496102_0005716 Ga0496102_0005716_3264_4055 222
942 3300048907 Ga0496104_0008179 Ga0496104_0008179_1266_2057 222
943 3300048907 Ga0496104_0039756 Ga0496104_0039756_3418_4086 222
944 3300048907 Ga0496104_0077661 Ga0496104_0077661_69_737 222
945 3300048907 Ga0496104_0222826 Ga0496104_0222826_968_1639 222
946 3300048908 Ga0496105_0005555 Ga0496105_0005555_5926_6594 222
947 3300048908 Ga0496105_0020686 Ga0496105_0020686_3633_4424 222
948 3300048908 Ga0496105_0029456 Ga0496105_0029456_2367_3035 222
949 3300048908 Ga0496105_0267976 Ga0496105_0267976_454_1188 222
950 3300048908 Ga0496105_0322327 Ga0496105_0322327_555_1226 222
951 3300048909 Ga0496106_0004750 Ga0496106_0004750_7443_8234 222
952 3300048909 Ga0496106_0015351 Ga0496106_0015351_2897_3565 222
953 3300048909 Ga0496106_0117374 Ga0496106_0117374_973_1641 222
954 3300048910 Ga0496107_0010058 Ga0496107_0010058_1113_1781 222
955 3300048910 Ga0496107_0091732 Ga0496107_0091732_1266_2057 222
956 3300048911 Ga0496108_0001187 Ga0496108_0001187_18112_18903 222
957 3300048911 Ga0496108_0022989 Ga0496108_0022989_344_1015 222
958 3300048911 Ga0496108_0037474 Ga0496108_0037474_600_1268 222
959 3300048911 Ga0496108_0481587 Ga0496108_0481587_144_812 222
960 3300048912 Ga0496109_0003628 Ga0496109_0003628_439_1107 222
961 3300048912 Ga0496109_0005207 Ga0496109_0005207_3892_4683 222
962 3300048912 Ga0496109_0005449 Ga0496109_0005449_3064_3735 222
963 3300048912 Ga0496109_0644463 Ga0496109_0644463_255_923 222
964 3300048913 Ga0496110_0001389 Ga0496110_0001389_10161_10952 222
965 3300048913 Ga0496110_0008745 Ga0496110_0008745_6676_7347 222
966 3300048913 Ga0496110_0012668 Ga0496110_0012668_6024_6692 222
967 3300048913 Ga0496110_0184014 Ga0496110_0184014_565_1344 222
968 3300048914 Ga0496111_0001694 Ga0496111_0001694_3765_4433 222
969 3300048914 Ga0496111_0018942 Ga0496111_0018942_2110_2901 222
970 3300048914 Ga0496111_0023129 Ga0496111_0023129_2146_2817 222
971 3300048915 Ga0496112_0001346 Ga0496112_0001346_2409_3200 222
972 3300048915 Ga0496112_0001940 Ga0496112_0001940_14349_15083 222
973 3300048915 Ga0496112_0057488 Ga0496112_0057488_2682_3353 222
974 3300048915 Ga0496112_0306561 Ga0496112_0306561_647_1315 222
975 3300048916 Ga0496113_0001229 Ga0496113_0001229_2660_3451 222
976 3300048916 Ga0496113_0003069 Ga0496113_0003069_3290_3958 222
977 3300048916 Ga0496113_0046514 Ga0496113_0046514_672_1343 222
978 3300048916 Ga0496113_0710337 Ga0496113_0710337_81_749 222
979 3300048917 Ga0496114_0017584 Ga0496114_0017584_1241_1909 222
980 3300048917 Ga0496114_0067775 Ga0496114_0067775_1479_2147 222
981 3300048917 Ga0496114_0093566 Ga0496114_0093566_997_1788 222
982 3300048917 Ga0496114_0393844 Ga0496114_0393844_403_1074 222
983 3300048918 Ga0496115_0003119 Ga0496115_0003119_8347_9138 222
984 3300048918 Ga0496115_0010171 Ga0496115_0010171_3574_4242 222
985 3300048918 Ga0496115_0061881 Ga0496115_0061881_1116_1895 222
986 3300049568 Ga0501031_0048768 Ga0501031_0048768_1951_2619 222
987 3300049568 Ga0501031_0092149 Ga0501031_0092149_568_1257 222
988 3300049569 Ga0501032_0013003 Ga0501032_0013003_2988_3665 222
989 3300049569 Ga0501032_0022105 Ga0501032_0022105_1849_2526 222
990 3300049569 Ga0501032_0048876 Ga0501032_0048876_619_1296 222
991 3300049569 Ga0501032_0093051 Ga0501032_0093051_248_916 222
992 3300049570 Ga0501033_0017990 Ga0501033_0017990_2167_2844 222
993 3300049570 Ga0501033_0033329 Ga0501033_0033329_1226_1894 222
994 3300049571 Ga0501034_0002201 Ga0501034_0002201_7858_8535 222
995 3300049571 Ga0501034_0031875 Ga0501034_0031875_268_936 222
996 3300049571 Ga0501034_0050893 Ga0501034_0050893_1113_1790 222
997 3300049571 Ga0501034_0081474 Ga0501034_0081474_2211_2879 222
998 3300049571 Ga0501034_0127324 Ga0501034_0127324_1197_1886 222
999 3300049571 Ga0501034_0158572 Ga0501034_0158572_1038_1715 222
1000 3300049571 Ga0501034_0283883 Ga0501034_0283883_738_1406 222
1001 3300049571 Ga0501034_0345771 Ga0501034_0345771_186_863 222
1002 3300049572 Ga0501036_0007818 Ga0501036_0007818_6653_7321 222
1003 3300049572 Ga0501036_0016265 Ga0501036_0016265_5229_5906 222
1004 3300049572 Ga0501036_0058284 Ga0501036_0058284_2409_3086 222
1005 3300049572 Ga0501036_0062481 Ga0501036_0062481_1717_2394 222
1006 3300049572 Ga0501036_0136118 Ga0501036_0136118_851_1540 222
1007 3300049573 Ga0501037_0005054 Ga0501037_0005054_174_851 222
1008 3300049573 Ga0501037_0009480 Ga0501037_0009480_5614_6291 222
1009 3300049573 Ga0501037_0126480 Ga0501037_0126480_362_1039 222
1010 3300049573 Ga0501037_0417485 Ga0501037_0417485_197_868 222
1011 3300049574 Ga0501038_0018363 Ga0501038_0018363_4505_5173 222
1012 3300049574 Ga0501038_0037433 Ga0501038_0037433_2421_3098 222
1013 3300049574 Ga0501038_0173305 Ga0501038_0173305_154_831 222
1014 3300049574 Ga0501038_0342794 Ga0501038_0342794_139_807 222
1015 3300049575 Ga0501039_0088736 Ga0501039_0088736_1683_2360 222
1016 3300049575 Ga0501039_0126551 Ga0501039_0126551_1006_1683 222
1017 3300049575 Ga0501039_0356505 Ga0501039_0356505_157_825 222
1018 3300049576 Ga0501040_0093026 Ga0501040_0093026_1023_1712 222
1019 3300049576 Ga0501040_0451038 Ga0501040_0451038_220_891 222
1020 3300049578 Ga0501042_0199294 Ga0501042_0199294_463_1140 222
1021 3300049579 Ga0501043_0001843 Ga0501043_0001843_12268_12945 222
1022 3300049579 Ga0501043_0052764 Ga0501043_0052764_1547_2224 222
1023 3300049579 Ga0501043_0149423 Ga0501043_0149423_1141_1809 222
1024 3300049579 Ga0501043_0230029 Ga0501043_0230029_175_852 222
1025 3300049579 Ga0501043_0346698 Ga0501043_0346698_309_995 222
1026 3300049580 Ga0501046_0042972 Ga0501046_0042972_263_931 222
1027 3300049580 Ga0501046_0046372 Ga0501046_0046372_1790_2479 222
1028 3300049580 Ga0501046_0213269 Ga0501046_0213269_471_1148 222
1029 3300049581 Ga0501047_0000010 Ga0501047_0000010_61977_62654 222
1030 3300049581 Ga0501047_0014495 Ga0501047_0014495_4332_5000 222
1031 3300049581 Ga0501047_0289149 Ga0501047_0289149_36_704 222
1032 3300049582 Ga0501048_0004920 Ga0501048_0004920_6481_7158 222
1033 3300049582 Ga0501048_0016921 Ga0501048_0016921_144_812 222
1034 3300049582 Ga0501048_0111287 Ga0501048_0111287_21_698 222
1035 3300049583 Ga0501067_0325256 Ga0501067_0325256_110_778 222
1036 3300049584 Ga0501068_0103009 Ga0501068_0103009_1080_1757 222
1037 3300049584 Ga0501068_0111004 Ga0501068_0111004_992_1660 222
1038 3300049584 Ga0501068_0191423 Ga0501068_0191423_57_746 222
1039 3300049585 Ga0501069_0102789 Ga0501069_0102789_393_1070 222
1040 3300049585 Ga0501069_0124177 Ga0501069_0124177_664_1332 222
1041 3300049586 Ga0501070_0056695 Ga0501070_0056695_1261_1950 222
1042 3300049586 Ga0501070_0102058 Ga0501070_0102058_1029_1706 222
1043 3300049586 Ga0501070_0202789 Ga0501070_0202789_565_1254 222
1044 3300049586 Ga0501070_0242180 Ga0501070_0242180_394_1071 222
1045 3300049587 Ga0501071_0155413 Ga0501071_0155413_154_822 222
1046 3300049588 Ga0501072_0033081 Ga0501072_0033081_2890_3579 222
1047 3300049588 Ga0501072_0062220 Ga0501072_0062220_1938_2615 222
1048 3300049588 Ga0501072_0258493 Ga0501072_0258493_409_1077 222
1049 3300049588 Ga0501072_0461682 Ga0501072_0461682_24_695 222
1050 3300049589 Ga0501073_0033338 Ga0501073_0033338_622_1299 222
1051 3300049589 Ga0501073_0072315 Ga0501073_0072315_1146_1814 222
1052 3300049589 Ga0501073_0124554 Ga0501073_0124554_244_933 222
1053 3300049590 Ga0501074_0009189 Ga0501074_0009189_3048_3725 222
1054 3300049590 Ga0501074_0192647 Ga0501074_0192647_121_789 222
1055 3300049591 Ga0501075_0600613 Ga0501075_0600613_114_803 222
1056 3300049592 Ga0501076_0078679 Ga0501076_0078679_27_704 222
1057 3300049592 Ga0501076_0247431 Ga0501076_0247431_761_1429 222
1058 3300049592 Ga0501076_0337393 Ga0501076_0337393_236_904 222
1059 3300049592 Ga0501076_0400388 Ga0501076_0400388_101_772 222
1060 3300049741 Ga0501079_0066627 Ga0501079_0066627_1567_2235 222
1061 3300049741 Ga0501079_0291895 Ga0501079_0291895_477_1166 222
1062 3300049742 Ga0501080_0000314 Ga0501080_0000314_5336_6013 222
1063 3300049742 Ga0501080_0006102 Ga0501080_0006102_9594_10262 222
1064 3300049742 Ga0501080_0081340 Ga0501080_0081340_1134_1802 222
1065 3300049742 Ga0501080_0177989 Ga0501080_0177989_1230_1919 222
1066 3300049742 Ga0501080_0254933 Ga0501080_0254933_635_1312 222
1067 3300049743 Ga0501081_0148981 Ga0501081_0148981_679_1347 222
1068 3300049743 Ga0501081_0533896 Ga0501081_0533896_120_854 222
1069 3300049744 Ga0501083_0005058 Ga0501083_0005058_5225_5902 222
1070 3300049822 Ga0501035_0011561 Ga0501035_0011561_7078_7746 222
1071 3300049822 Ga0501035_0030708 Ga0501035_0030708_2386_3063 222
1072 3300049823 Ga0501044_0000116 Ga0501044_0000116_63971_64639 222
1073 3300049823 Ga0501044_0003610 Ga0501044_0003610_12601_13278 222
1074 3300049823 Ga0501044_0078352 Ga0501044_0078352_2568_3236 222
1075 3300049823 Ga0501044_0125313 Ga0501044_0125313_568_1257 222
1076 3300049824 Ga0501045_0361097 Ga0501045_0361097_375_1052 222
1077 3300049824 Ga0501045_0520249 Ga0501045_0520249_38_706 222
1078 3300050489 nmdc:mga03683_1213_c2 nmdc:mga03683_1213_c2_2583_3269 222
1079 3300050489 nmdc:mga03683_44154_c1 nmdc:mga03683_44154_c1_1079_1747 222
1080 3300050490 nmdc:mga03n38_331637_c1 nmdc:mga03n38_331637_c1_34_720 222
1081 3300050490 nmdc:mga03n38_9563_c1 nmdc:mga03n38_9563_c1_2658_3344 222
1082 3300050491 nmdc:mga00v17_24709_c1 nmdc:mga00v17_24709_c1_878_1546 222
1083 3300050491 nmdc:mga00v17_28997_c1 nmdc:mga00v17_28997_c1_778_1464 222
1084 3300050492 nmdc:mga0yw44_11062_c1 nmdc:mga0yw44_11062_c1_2070_2738 222
1085 3300050492 nmdc:mga0yw44_116513_c1 nmdc:mga0yw44_116513_c1_327_1118 222
1086 3300050492 nmdc:mga0yw44_4079_c1 nmdc:mga0yw44_4079_c1_1403_2071 222
1087 3300050492 nmdc:mga0yw44_580_c1 nmdc:mga0yw44_580_c1_11361_12029 222
1088 3300050492 nmdc:mga0yw44_63973_c1 nmdc:mga0yw44_63973_c1_1363_2031 222
1089 3300050492 nmdc:mga0yw44_69664_c1 nmdc:mga0yw44_69664_c1_81_767 222
1090 3300050493 nmdc:mga0k408_142046_c1 nmdc:mga0k408_142046_c1_664_1332 222
1091 3300050493 nmdc:mga0k408_47462_c1 nmdc:mga0k408_47462_c1_492_1160 222
1092 3300050494 nmdc:mga06z11_15735_c2 nmdc:mga06z11_15735_c2_549_1235 222
1093 3300050494 nmdc:mga06z11_169845_c1 nmdc:mga06z11_169845_c1_245_913 222
1094 3300050494 nmdc:mga06z11_33677_c1 nmdc:mga06z11_33677_c1_1213_1881 222
1095 3300050494 nmdc:mga06z11_44729_c1 nmdc:mga06z11_44729_c1_1217_2041 222
1096 3300050495 nmdc:mga04h51_6680_c1 nmdc:mga04h51_6680_c1_2034_2720 222
1097 3300050496 nmdc:mga07m45_46338_c1 nmdc:mga07m45_46338_c1_1659_2345 222
1098 3300050507 nmdc:mga05p37_11744_c1 nmdc:mga05p37_11744_c1_8378_9046 222
1099 3300050507 nmdc:mga05p37_374_c1 nmdc:mga05p37_374_c1_42071_42739 222
1100 3300050507 nmdc:mga05p37_47092_c1 nmdc:mga05p37_47092_c1_1115_1783 222
1101 3300050508 nmdc:mga09592_20752_c1 nmdc:mga09592_20752_c1_3629_4297 222
1102 3300050508 nmdc:mga09592_2601_c1 nmdc:mga09592_2601_c1_7548_8216 222
1103 3300050509 nmdc:mga0qj67_134130_c1 nmdc:mga0qj67_134130_c1_133_801 222
1104 3300050509 nmdc:mga0qj67_50765_c1 nmdc:mga0qj67_50765_c1_1996_2664 222
1105 3300050509 nmdc:mga0qj67_551023_c1 nmdc:mga0qj67_551023_c1_239_907 222
1106 3300050509 nmdc:mga0qj67_65941_c1 nmdc:mga0qj67_65941_c1_462_1130 222
1107 3300050510 nmdc:mga06r32_250622_c2 nmdc:mga06r32_250622_c2_208_879 222
1108 3300050510 nmdc:mga06r32_307479_c1 nmdc:mga06r32_307479_c1_276_944 222
1109 3300050510 nmdc:mga06r32_397_c1 nmdc:mga06r32_397_c1_7146_7814 222
1110 3300050511 nmdc:mga08y16_122069_c1 nmdc:mga08y16_122069_c1_160_951 222
1111 3300050511 nmdc:mga08y16_155771_c1 nmdc:mga08y16_155771_c1_576_1244 222
1112 3300050511 nmdc:mga08y16_184_c1 nmdc:mga08y16_184_c1_30518_31186 222
1113 3300050511 nmdc:mga08y16_270713_c1 nmdc:mga08y16_270713_c1_692_1360 222
1114 3300050511 nmdc:mga08y16_321525_c1 nmdc:mga08y16_321525_c1_318_986 222
1115 3300050512 nmdc:mga0n895_381227_c1 nmdc:mga0n895_381227_c1_110_778 222
1116 3300050512 nmdc:mga0n895_445606_c1 nmdc:mga0n895_445606_c1_491_1159 222
1117 3300050512 nmdc:mga0n895_834709_c1 nmdc:mga0n895_834709_c1_44_835 222
1118 3300050512 nmdc:mga0n895_96376_c1 nmdc:mga0n895_96376_c1_1190_1858 222
1119 3300050513 nmdc:mga0rr50_282808_c1 nmdc:mga0rr50_282808_c1_381_1049 222
1120 3300050513 nmdc:mga0rr50_70704_c1 nmdc:mga0rr50_70704_c1_1172_1840 222
1121 3300050514 nmdc:mga08x19_103158_c1 nmdc:mga08x19_103158_c1_1190_1858 222
1122 3300050514 nmdc:mga08x19_138367_c1 nmdc:mga08x19_138367_c1_215_889 222
1123 3300050515 nmdc:mga0a205_203406_c1 nmdc:mga0a205_203406_c1_217_885 222
1124 3300053077 Ga0495601_0000007 Ga0495601_0000007_297902_298570 222
1125 3300053077 Ga0495601_0005541 Ga0495601_0005541_2531_3199 222
1126 3300053077 Ga0495601_0012397 Ga0495601_0012397_2582_3256 222
1127 3300053077 Ga0495601_0301767 Ga0495601_0301767_105_773 222
1128 3300053078 Ga0495612_0000053 Ga0495612_0000053_40684_41352 222
1129 3300053078 Ga0495612_0001301 Ga0495612_0001301_3321_3995 222
1130 3300053078 Ga0495612_0002727 Ga0495612_0002727_4808_5476 222
1131 3300053078 Ga0495612_0271565 Ga0495612_0271565_74_742 222
1132 3300053083 Ga0495655_0034961 Ga0495655_0034961_246_914 222
1133 3300053084 Ga0495595_0000031 Ga0495595_0000031_55169_55837 222
1134 3300053084 Ga0495595_0005529 Ga0495595_0005529_3290_3958 222
1135 3300053084 Ga0495595_0030894 Ga0495595_0030894_709_1377 222
1136 3300053084 Ga0495595_0088479 Ga0495595_0088479_45_779 222
1137 3300053084 Ga0495595_0274711 Ga0495595_0274711_102_770 222
1138 3300053085 Ga0495619_0000023 Ga0495619_0000023_98031_98699 222
1139 3300053085 Ga0495619_0003219 Ga0495619_0003219_5116_5790 222
1140 3300053085 Ga0495619_0024881 Ga0495619_0024881_1475_2143 222
1141 3300053085 Ga0495619_0058559 Ga0495619_0058559_1788_2456 222
1142 3300053085 Ga0495619_0230447 Ga0495619_0230447_506_1240 222
1143 3300053085 Ga0495619_0643639 Ga0495619_0643639_13_681 222
1144 3300053117 Ga0500593_069737 Ga0500593_069737_67_813 222
1145 3300053130 Ga0500642_0124487 Ga0500642_0124487_166_834 222
1146 3300053134 Ga0500658_0073848 Ga0500658_0073848_540_1208 222
1147 3300053142 Ga0500577_0079257 Ga0500577_0079257_35_703 222
1148 3300053153 Ga0500616_0011431 Ga0500616_0011431_3115_3783 222
1149 3300054114 Ga0501084_0083270 Ga0501084_0083270_1526_2194 222
1150 3300054114 Ga0501084_0384489 Ga0501084_0384489_319_987 222
1151 3300060353 Ga0501082_0007592 Ga0501082_0007592_445_1113 222
1152 3300060353 Ga0501082_0694267 Ga0501082_0694267_200_877 222
1153 3300061734 Ga0530510_0222121 Ga0530510_0222121_243_911 222
1154 3300061734 Ga0530510_0540371 Ga0530510_0540371_160_828 222
1155 3300061734 Ga0530510_0570628 Ga0530510_0570628_20_688 222

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02223

Thymidylate_kin

Thymidylate kinase

20

218

0.97

PF13521

AAA_28

AAA domain

17

189

0.7

Structural Annotation

Top 5 Hits

ID Description Score Start End
5x98-assembly1.cif.gz_A y162f mutant of thermus thermophilus hb8 thymidylate kinase 0.9583 3 206
5xal-assembly1.cif.gz_B y99f mutant of thermus thermophilus hb8 thymidylate kinase 0.9581 3 206
5x8a-assembly1.cif.gz_B crystal structure of atp bound thymidylate kinase from thermus thermophilus hb8 0.9578 3 206
5x8d-assembly1.cif.gz_B d90l mutant of thermus thermophilus hb8 thymidylate kinase 0.9577 3 206
3hjn-assembly1.cif.gz_B crystal structure of thymidylate kinase in complex with dtdp and adp from thermotoga maritima 0.9559 5 202
ID Description Score Start End Superfamily
5x7jB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9463 3 208 3.40.50.300
2pbrA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9408 5 206 3.40.50.300
3uwoB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9389 3 208 3.40.50.300
5x7jB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9325 3 208 3.40.50.300
2z0hB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9306 5 202 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A537P924-F1-model_v4 Thymidylate kinase (EC 2.7.4.9) (dTMP kinase) 0.9974 1 186 GO:0004798
GO:0005524
GO:0005829
GO:0006227
GO:0006233
GO:0006235
AF-A0A537T9L3-F1-model_v4 Thymidylate kinase (EC 2.7.4.9) (dTMP kinase) 0.9969 1 210 GO:0004798
GO:0005524
GO:0005829
GO:0006227
GO:0006233
GO:0006235
AF-A0A2P8NJ21-F1-model_v4 Thymidylate kinase (EC 2.7.4.9) (dTMP kinase) 0.9918 1 209 GO:0004798
GO:0005524
GO:0005829
GO:0006227
GO:0006233
GO:0006235
AF-A0A3D2CX13-F1-model_v4 deleted 0.9906 1 173
AF-A0A0A8K505-F1-model_v4 Thymidylate kinase (EC 2.7.4.9) (dTMP kinase) 0.9896 2 209 GO:0004798
GO:0005524
GO:0005829
GO:0006227
GO:0006233
GO:0006235

Feature Viewer

pLDDT pTM Quality
94.28 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map