F490924

General Info

Members Datasets Scaffolds Average Seq Length
1155 385 2310 171

Family's Representative Sequence

Representative Sequence 3300037853|Ga0436364_0599685|Ga0436364_0599685_295_870
Length 191
Sequence MSRIGRQPIPVPAGVDITVDGGQITVKGPKGTLSRPLRPEVSIRRENGTLYVDRNGDNKTERAMHGLSRTLVNNMVVGVTQGYQKVLEISGVGYRATKQGSDLQLSVGYSHPVLIAPRPGIEFEVGQDVNTRAPIITVRGIDKEVVGQTAAEVRSVRKPEPYKGKGIRYQGEIIRRKAGKSAKAGGKGGKK

Samples

Sample ID Description Type Environment
1 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
2 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
3 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
4 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
62 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
66 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
67 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
68 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
69 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
70 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
71 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
72 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
73 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
74 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
75 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
77 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
78 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
79 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
80 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
85 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
87 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
88 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
90 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
93 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
94 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
95 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
98 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
99 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
100 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
101 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
102 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
103 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
104 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
105 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
106 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
107 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
108 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
109 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
110 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
111 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
112 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
113 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
114 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
115 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
116 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
172 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
175 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
176 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
177 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
178 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
179 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
180 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
181 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
182 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
183 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
184 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
185 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
186 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
187 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
188 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
189 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
190 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
191 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
192 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
193 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
194 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
195 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
196 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
197 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
198 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
199 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
200 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
201 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
202 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
203 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
204 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
205 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
206 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
207 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
208 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
209 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
210 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
211 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
212 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
213 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
214 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
215 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
216 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
217 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
218 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
219 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
220 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
221 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
222 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
223 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
224 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
225 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
226 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
227 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
228 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
229 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
230 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
231 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
232 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
233 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
234 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
235 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
236 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
237 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
238 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
239 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
240 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
241 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
242 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
243 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
244 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
245 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
246 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
247 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
248 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
249 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
250 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
251 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
252 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
253 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
254 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
255 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
256 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
257 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
258 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
259 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
260 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
261 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
262 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
263 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
264 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
265 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
266 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
267 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
268 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
269 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
270 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
271 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
272 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
273 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
274 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
275 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
276 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
277 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
278 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
279 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
280 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
281 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
282 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
283 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
284 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
285 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
286 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
287 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
288 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
289 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
290 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
291 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
292 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
293 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
294 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
295 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
296 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
297 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
298 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
299 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
300 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
301 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
302 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
303 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
304 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
305 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
306 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
307 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
308 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
309 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
310 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
311 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
312 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
313 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
314 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
315 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
316 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
317 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
318 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
319 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
320 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
321 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
322 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
323 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
324 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
325 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
326 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
327 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
328 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
329 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
330 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
331 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
332 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
333 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
334 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
335 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
336 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
337 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
338 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
339 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
340 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
341 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
342 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
343 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
344 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
345 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
346 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
347 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
348 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
349 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
350 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
351 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
352 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
353 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
354 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
355 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
356 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
357 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
358 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
359 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
360 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
361 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
362 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
363 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
364 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
365 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
366 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
367 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
368 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
369 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
370 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
371 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
372 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
373 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
374 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
375 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
376 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
377 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
378 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
379 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
380 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
381 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
382 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
383 2524614857 Deinococcus ficus DSM 19119 Isolate Rhizosphere
384 2739367875 Deinococcus ficus CC-FR2-10 Isolate Unclassified
385 8055588893 Parapedobacter lycopersici KACC 18788 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.13
Metatranscriptomes 0.61
Isolates 0.26

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.69
Nodule 0
Rhizoplane 6.32
Rhizosphere 92.47
Stem 0
Stem Tuber 0
Unclassified 0.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436364_0599685 3300037853 Bacteria 3313
2 ARcpr5yngRDRAFT_c012431 3300000043 Bacteria 718
3 ARSoilOldRDRAFT_c001158 3300000044 Bacteria 2527
4 ARCol0yngRDRAFT_1001005 3300000652 Bacteria 2475
5 JGI24739J22299_10031625 3300001989 Unclassified 1827
6 JGI24735J21928_10171835 3300002067 Unclassified 627
7 JGI25407J50210_10006859 3300003373 Bacteria 2845
8 Ga0070683_100053944 3300005329 Bacteria 3726
9 Ga0070683_100184472 3300005329 Bacteria 1980
10 Ga0070683_100308906 3300005329 Bacteria 1504
11 Ga0070683_101062045 3300005329 Bacteria 778
12 Ga0070670_100002726 3300005331 Bacteria 14597
13 Ga0070670_100091757 3300005331 Bacteria 2611
14 Ga0068869_100022221 3300005334 Bacteria 4369
15 Ga0068869_100491812 3300005334 Bacteria 1023
16 Ga0070680_100098314 3300005336 Bacteria 2427
17 Ga0070680_100123282 3300005336 Bacteria 2164
18 Ga0070682_100189583 3300005337 Bacteria 1443
19 Ga0070682_100226337 3300005337 Bacteria 1334
20 Ga0070682_100727505 3300005337 Bacteria 799
21 Ga0068868_100098882 3300005338 Bacteria 2360
22 Ga0068868_100523321 3300005338 Bacteria 1041
23 Ga0070660_100518276 3300005339 Bacteria 993
24 Ga0070660_100766323 3300005339 Bacteria 811
25 Ga0070691_10030122 3300005341 Bacteria 2541
26 Ga0070687_100073999 3300005343 Bacteria 1838
27 Ga0070661_100040522 3300005344 Bacteria 3398
28 Ga0070661_100370265 3300005344 Bacteria 1128
29 Ga0070661_100633240 3300005344 Bacteria 867
30 Ga0070692_10022707 3300005345 Bacteria 3067
31 Ga0070668_100969449 3300005347 Bacteria 763
32 Ga0070669_100458555 3300005353 Bacteria 1052
33 Ga0070675_100054439 3300005354 Bacteria 3292
34 Ga0070675_100106705 3300005354 Bacteria 2364
35 Ga0070675_100929320 3300005354 Bacteria 798
36 Ga0070671_100068504 3300005355 Bacteria 2960
37 Ga0070671_100107077 3300005355 Bacteria 2347
38 Ga0070671_100894008 3300005355 Bacteria 776
39 Ga0070674_100106394 3300005356 Bacteria 2053
40 Ga0070674_100336072 3300005356 Bacteria 1215
41 Ga0070674_100604946 3300005356 Bacteria 927
42 Ga0070673_100009174 3300005364 Bacteria 6630
43 Ga0070688_100010080 3300005365 Bacteria 5195
44 Ga0070659_100116007 3300005366 Bacteria 2165
45 Ga0070659_100461407 3300005366 Bacteria 1079
46 Ga0070709_10017436 3300005434 Bacteria 4119
47 Ga0070714_100023042 3300005435 Bacteria 5111
48 Ga0070714_100138461 3300005435 Bacteria 2182
49 Ga0070714_100171566 3300005435 Bacteria 1968
50 Ga0070714_100542659 3300005435 Bacteria 1112
51 Ga0070714_101254020 3300005435 Bacteria 723
52 Ga0070713_100001889 3300005436 Bacteria 13509
53 Ga0070713_100035918 3300005436 Bacteria 3994
54 Ga0070713_100163538 3300005436 Bacteria 1988
55 Ga0070710_10010919 3300005437 Bacteria 4473
56 Ga0070710_10055055 3300005437 Bacteria 2246
57 Ga0070711_100175072 3300005439 Bacteria 1638
58 Ga0070711_100258287 3300005439 Bacteria 1369
59 Ga0070711_100961031 3300005439 Bacteria 731
60 Ga0070705_100023560 3300005440 Bacteria 3308
61 Ga0070700_100048730 3300005441 Bacteria 2627
62 Ga0070694_100095994 3300005444 Bacteria 2089
63 Ga0070694_100461334 3300005444 Bacteria 1005
64 Ga0070708_100361595 3300005445 Bacteria 1368
65 Ga0070678_100162368 3300005456 Bacteria 1811
66 Ga0070678_100651518 3300005456 Bacteria 945
67 Ga0070678_100691956 3300005456 Bacteria 918
68 Ga0070678_100943477 3300005456 Bacteria 791
69 Ga0070662_100144820 3300005457 Bacteria 1845
70 Ga0070662_100290847 3300005457 Bacteria 1325
71 Ga0070662_100377263 3300005457 Bacteria 1167
72 Ga0070662_101042223 3300005457 Bacteria 701
73 Ga0070681_10015900 3300005458 Bacteria 7503
74 Ga0070681_10154710 3300005458 Bacteria 2218
75 Ga0068867_100768082 3300005459 Bacteria 857
76 Ga0070685_10005868 3300005466 Bacteria 6247
77 Ga0070707_100001557 3300005468 Bacteria 22299
78 Ga0070699_100149836 3300005518 Bacteria 2062
79 Ga0070679_100029555 3300005530 Bacteria 5407
80 Ga0070679_100337405 3300005530 Bacteria 1455
81 Ga0070684_100022860 3300005535 Bacteria 5220
82 Ga0070684_100089974 3300005535 Bacteria 2728
83 Ga0070684_100156385 3300005535 Bacteria 2067
84 Ga0070684_100240626 3300005535 Bacteria 1653
85 Ga0070684_100402869 3300005535 Bacteria 1261
86 Ga0068853_100214281 3300005539 Bacteria 1756
87 Ga0068853_100284547 3300005539 Bacteria 1525
88 Ga0070672_100064211 3300005543 Bacteria 2900
89 Ga0070672_100132695 3300005543 Bacteria 2048
90 Ga0070686_100434402 3300005544 Bacteria 1006
91 Ga0070695_100001595 3300005545 Bacteria 12688
92 Ga0070696_100198203 3300005546 Bacteria 1498
93 Ga0070693_100107157 3300005547 Bacteria 1712
94 Ga0070704_100191887 3300005549 Bacteria 1643
95 Ga0070704_100340969 3300005549 Bacteria 1262
96 Ga0068855_100939809 3300005563 Bacteria 911
97 Ga0070664_100007134 3300005564 Bacteria 9012
98 Ga0068857_100035784 3300005577 Bacteria 4398
99 Ga0068857_100138893 3300005577 Bacteria 2196
100 Ga0068857_100222749 3300005577 Bacteria 1723
101 Ga0068856_100056684 3300005614 Bacteria 3867
102 Ga0068856_100432985 3300005614 Bacteria 1335
103 Ga0068856_100601606 3300005614 Bacteria 1120
104 Ga0070702_100014750 3300005615 Bacteria 3972
105 Ga0070702_100242311 3300005615 Bacteria 1217
106 Ga0068852_100215349 3300005616 Bacteria 1824
107 Ga0068859_100194972 3300005617 Bacteria 2110
108 Ga0068864_100008046 3300005618 Bacteria 8696
109 Ga0068864_100145545 3300005618 Bacteria 2142
110 Ga0068866_10047907 3300005718 Bacteria 2158
111 Ga0068851_10085219 3300005834 Bacteria 1656
112 Ga0068870_10040559 3300005840 Bacteria 2414
113 Ga0068870_10052187 3300005840 Bacteria 2167
114 Ga0068870_10073954 3300005840 Bacteria 1865
115 Ga0068870_10129624 3300005840 Bacteria 1463
116 Ga0068863_100246016 3300005841 Bacteria 1727
117 Ga0068862_100860677 3300005844 Bacteria 889
118 Ga0081455_10013977 3300005937 Bacteria 7890
119 Ga0081455_10040463 3300005937 Bacteria 4109
120 Ga0081455_10050855 3300005937 Bacteria 3559
121 Ga0081455_10207841 3300005937 Bacteria 1461
122 Ga0081455_10280757 3300005937 Bacteria 1203
123 Ga0081538_10000515 3300005981 Bacteria 43219
124 Ga0081538_10139009 3300005981 Bacteria 1124
125 Ga0081539_10000433 3300005985 Bacteria 89118
126 Ga0070717_10012019 3300006028 Bacteria 6593
127 Ga0070717_10024999 3300006028 Bacteria 4744
128 Ga0070717_10032247 3300006028 Bacteria 4221
129 Ga0070717_10069262 3300006028 Bacteria 2938
130 Ga0070717_10190202 3300006028 Bacteria 1793
131 Ga0070717_10575879 3300006028 Bacteria 1020
132 Ga0075365_10179639 3300006038 Bacteria 1479
133 Ga0075365_10515393 3300006038 Bacteria 845
134 Ga0075365_10618456 3300006038 Bacteria 766
135 Ga0075364_10044999 3300006051 Bacteria 2872
136 Ga0075432_10001059 3300006058 Bacteria 8769
137 Ga0070715_10009632 3300006163 Bacteria 3412
138 Ga0070716_100028679 3300006173 Bacteria 3001
139 Ga0070716_100047618 3300006173 Bacteria 2419
140 Ga0070712_100093717 3300006175 Bacteria 2205
141 Ga0070712_100107998 3300006175 Bacteria 2071
142 Ga0070712_100196031 3300006175 Bacteria 1583
143 Ga0097621_100382488 3300006237 Bacteria 1257
144 Ga0075428_100006916 3300006844 Bacteria 12599
145 Ga0075428_100634603 3300006844 Bacteria 1140
146 Ga0075428_100662417 3300006844 Bacteria 1113
147 Ga0075428_101513565 3300006844 Bacteria 703
148 Ga0075430_100236322 3300006846 Bacteria 1515
149 Ga0075431_100004224 3300006847 Bacteria 14071
150 Ga0075431_100145840 3300006847 Bacteria 2439
151 Ga0075433_10061868 3300006852 Bacteria 3279
152 Ga0075433_10453679 3300006852 Bacteria 1130
153 Ga0075429_100011161 3300006880 Bacteria 7778
154 Ga0075429_100122353 3300006880 Bacteria 2275
155 Ga0075429_100140179 3300006880 Bacteria 2116
156 Ga0068865_100076824 3300006881 Bacteria 2385
157 Ga0075436_100438644 3300006914 Bacteria 950
158 Ga0097620_100194983 3300006931 Bacteria 2110
159 Ga0105240_10134085 3300009093 Bacteria 2967
160 Ga0105240_10689056 3300009093 Bacteria 1116
161 Ga0111539_10008690 3300009094 Bacteria 12890
162 Ga0111539_10065262 3300009094 Bacteria 4302
163 Ga0111539_10074113 3300009094 Bacteria 4011
164 Ga0111539_10665582 3300009094 Bacteria 1212
165 Ga0111539_10998168 3300009094 Bacteria 973
166 Ga0111539_11085749 3300009094 Bacteria 930
167 Ga0105245_10050741 3300009098 Bacteria 3719
168 Ga0105245_10106734 3300009098 Bacteria 2599
169 Ga0105245_10302976 3300009098 Bacteria 1569
170 Ga0105247_10331647 3300009101 Bacteria 1064
171 Ga0114129_10035990 3300009147 Bacteria 6992
172 Ga0114129_10104282 3300009147 Bacteria 3918
173 Ga0114129_10154347 3300009147 Bacteria 3141
174 Ga0114129_10211509 3300009147 Bacteria 2621
175 Ga0114129_10220001 3300009147 Bacteria 2562
176 Ga0114129_10771180 3300009147 Bacteria 1229
177 Ga0105243_10120150 3300009148 Bacteria 2214
178 Ga0105243_10223874 3300009148 Bacteria 1665
179 Ga0105243_10244316 3300009148 Bacteria 1599
180 Ga0105242_10017261 3300009176 Bacteria 5621
181 Ga0105242_10019594 3300009176 Bacteria 5302
182 Ga0105242_10137109 3300009176 Bacteria 2119
183 Ga0105242_10156053 3300009176 Bacteria 1994
184 Ga0105248_10206586 3300009177 Bacteria 2213
185 Ga0105248_10266891 3300009177 Bacteria 1927
186 Ga0105248_10914761 3300009177 Bacteria 991
187 Ga0105237_10429166 3300009545 Bacteria 1327
188 Ga0105238_10270169 3300009551 Bacteria 1681
189 Ga0105249_10198350 3300009553 Bacteria 1963
190 Ga0105030_106641 3300009987 Bacteria 983
191 Ga0105239_10048544 3300010375 Bacteria 4655
192 Ga0105239_10256295 3300010375 Bacteria 1965
193 Ga0105239_10294777 3300010375 Bacteria 1826
194 Ga0105239_10815453 3300010375 Bacteria 1069
195 Ga0105239_11633232 3300010375 Bacteria 746
196 Ga0105246_10260717 3300011119 Bacteria 1381
197 Ga0105246_10349304 3300011119 Bacteria 1211
198 Ga0105246_10353928 3300011119 Bacteria 1204
199 Ga0105246_10984773 3300011119 Bacteria 762
200 Ga0157315_1004064 3300012508 Bacteria 1025
201 Ga0157373_10450061 3300013100 Bacteria 927
202 Ga0157369_10035022 3300013105 Bacteria 5506
203 Ga0157374_10575437 3300013296 Bacteria 1135
204 Ga0157374_10738143 3300013296 Bacteria 999
205 Ga0157374_11753115 3300013296 Bacteria 646
206 Ga0157378_10363416 3300013297 Bacteria 1417
207 Ga0163162_10580982 3300013306 Bacteria 1247
208 Ga0163162_10879949 3300013306 Bacteria 1010
209 Ga0163162_11547895 3300013306 Bacteria 756
210 Ga0157372_10048166 3300013307 Bacteria 4737
211 Ga0157372_10370753 3300013307 Bacteria 1668
212 Ga0157372_10412731 3300013307 Bacteria 1573
213 Ga0157372_10483699 3300013307 Bacteria 1443
214 Ga0157372_11145923 3300013307 Bacteria 899
215 Ga0157375_10047233 3300013308 Bacteria 4203
216 Ga0157375_10485398 3300013308 Bacteria 1400
217 Ga0163163_10356316 3300014325 Bacteria 1519
218 Ga0157380_10094813 3300014326 Bacteria 2471
219 Ga0157380_10433743 3300014326 Bacteria 1257
220 Ga0157380_10462836 3300014326 Bacteria 1221
221 Ga0182008_10247557 3300014497 Bacteria 919
222 Ga0182008_10618451 3300014497 Bacteria 610
223 Ga0157377_10045735 3300014745 Bacteria 2446
224 Ga0157377_10600473 3300014745 Bacteria 785
225 Ga0157377_10692806 3300014745 Bacteria 739
226 Ga0157379_10174406 3300014968 Bacteria 1941
227 Ga0157379_10689001 3300014968 Bacteria 959
228 Ga0157376_10126357 3300014969 Bacteria 2275
229 Ga0157376_10470591 3300014969 Bacteria 1229
230 Ga0157376_10709745 3300014969 Bacteria 1011
231 Ga0163161_10391273 3300017792 Bacteria 1113
232 Ga0206356_10473551 3300020070 Bacteria 1155
233 Ga0213871_10031694 3300021441 Bacteria 1382
234 Ga0224712_10064454 3300022467 Bacteria 1470
235 Ga0224712_10168148 3300022467 Bacteria 982
236 Ga0207692_10034920 3300025898 Bacteria 2438
237 Ga0207692_10420172 3300025898 Bacteria 837
238 Ga0207692_10455059 3300025898 Bacteria 806
239 Ga0207642_10033564 3300025899 Bacteria 2173
240 Ga0207642_10511485 3300025899 Bacteria 737
241 Ga0207710_10269904 3300025900 Bacteria 854
242 Ga0207688_10000094 3300025901 Bacteria 34655
243 Ga0207685_10421115 3300025905 Bacteria 689
244 Ga0207699_10022230 3300025906 Bacteria 3433
245 Ga0207699_10933990 3300025906 Bacteria 640
246 Ga0207645_10124230 3300025907 Bacteria 1677
247 Ga0207643_10012632 3300025908 Bacteria 4561
248 Ga0207643_10018007 3300025908 Bacteria 3868
249 Ga0207643_10019179 3300025908 Bacteria 3747
250 Ga0207643_10052899 3300025908 Bacteria 2307
251 Ga0207684_10061237 3300025910 Bacteria 3196
252 Ga0207707_10108421 3300025912 Bacteria 2428
253 Ga0207707_10214293 3300025912 Bacteria 1677
254 Ga0207695_10443156 3300025913 Bacteria 1182
255 Ga0207695_10608670 3300025913 Bacteria 974
256 Ga0207695_10758460 3300025913 Bacteria 850
257 Ga0207671_10102167 3300025914 Bacteria 2173
258 Ga0207693_10009230 3300025915 Bacteria 8052
259 Ga0207693_10163875 3300025915 Bacteria 1750
260 Ga0207693_10245231 3300025915 Bacteria 1406
261 Ga0207663_10007294 3300025916 Bacteria 5724
262 Ga0207663_10137312 3300025916 Bacteria 1699
263 Ga0207662_10016896 3300025918 Bacteria 4122
264 Ga0207662_10484022 3300025918 Bacteria 850
265 Ga0207657_10009472 3300025919 Bacteria 9785
266 Ga0207657_10032320 3300025919 Bacteria 4730
267 Ga0207649_10324113 3300025920 Bacteria 1133
268 Ga0207649_10737867 3300025920 Bacteria 766
269 Ga0207652_10096320 3300025921 Bacteria 2607
270 Ga0207652_10861220 3300025921 Bacteria 802
271 Ga0207646_10000851 3300025922 Bacteria 39515
272 Ga0207681_10144022 3300025923 Bacteria 1778
273 Ga0207694_10075978 3300025924 Bacteria 2630
274 Ga0207650_10018684 3300025925 Bacteria 4867
275 Ga0207650_10030694 3300025925 Bacteria 3874
276 Ga0207659_10046963 3300025926 Bacteria 3052
277 Ga0207687_10109632 3300025927 Bacteria 2045
278 Ga0207687_10294726 3300025927 Bacteria 1305
279 Ga0207687_10371103 3300025927 Bacteria 1170
280 Ga0207687_10614904 3300025927 Bacteria 917
281 Ga0207700_10000001 3300025928 Bacteria 1122509
282 Ga0207700_10045665 3300025928 Bacteria 3234
283 Ga0207700_10047734 3300025928 Bacteria 3175
284 Ga0207664_10025458 3300025929 Bacteria 4459
285 Ga0207664_10038854 3300025929 Bacteria 3692
286 Ga0207664_10096443 3300025929 Bacteria 2434
287 Ga0207664_10137050 3300025929 Bacteria 2066
288 Ga0207664_10194359 3300025929 Bacteria 1748
289 Ga0207664_10204157 3300025929 Bacteria 1707
290 Ga0207644_10164705 3300025931 Bacteria 1726
291 Ga0207644_10822363 3300025931 Bacteria 777
292 Ga0207690_10163415 3300025932 Bacteria 1662
293 Ga0207690_10697385 3300025932 Bacteria 834
294 Ga0207706_10174250 3300025933 Bacteria 1890
295 Ga0207706_10230165 3300025933 Bacteria 1622
296 Ga0207686_10121872 3300025934 Bacteria 1776
297 Ga0207686_10144148 3300025934 Bacteria 1650
298 Ga0207709_10006045 3300025935 Bacteria 6820
299 Ga0207709_10056512 3300025935 Bacteria 2429
300 Ga0207709_10260242 3300025935 Bacteria 1272
301 Ga0207669_10075819 3300025937 Bacteria 2132
302 Ga0207669_10327646 3300025937 Bacteria 1175
303 Ga0207669_10428016 3300025937 Bacteria 1043
304 Ga0207704_10071929 3300025938 Bacteria 2196
305 Ga0207704_10335079 3300025938 Bacteria 1172
306 Ga0207704_10376060 3300025938 Bacteria 1114
307 Ga0207665_10000058 3300025939 Bacteria 72882
308 Ga0207665_10549878 3300025939 Bacteria 897
309 Ga0207691_10071530 3300025940 Bacteria 3130
310 Ga0207691_10781154 3300025940 Bacteria 803
311 Ga0207711_10110013 3300025941 Bacteria 2449
312 Ga0207711_10254679 3300025941 Bacteria 1613
313 Ga0207711_10342546 3300025941 Bacteria 1384
314 Ga0207689_10032263 3300025942 Bacteria 4358
315 Ga0207689_10663114 3300025942 Bacteria 879
316 Ga0207661_10029243 3300025944 Bacteria 4230
317 Ga0207661_10190988 3300025944 Bacteria 1795
318 Ga0207661_10546301 3300025944 Bacteria 1061
319 Ga0207661_10863333 3300025944 Bacteria 833
320 Ga0207679_10050795 3300025945 Bacteria 3032
321 Ga0207679_10054481 3300025945 Bacteria 2945
322 Ga0207679_10092595 3300025945 Bacteria 2342
323 Ga0207667_10381044 3300025949 Bacteria 1437
324 Ga0207651_10313135 3300025960 Bacteria 1310
325 Ga0207668_10201977 3300025972 Bacteria 1584
326 Ga0207668_10345582 3300025972 Bacteria 1242
327 Ga0207640_10191544 3300025981 Bacteria 1542
328 Ga0207677_10468320 3300026023 Bacteria 1083
329 Ga0207677_10550610 3300026023 Bacteria 1005
330 Ga0207677_11573873 3300026023 Bacteria 608
331 Ga0207639_10084823 3300026041 Bacteria 2517
332 Ga0207639_11048843 3300026041 Bacteria 764
333 Ga0207678_10039202 3300026067 Bacteria 4112
334 Ga0207708_10039177 3300026075 Bacteria 3610
335 Ga0207708_10490920 3300026075 Bacteria 1028
336 Ga0207702_11047895 3300026078 Bacteria 809
337 Ga0207641_10235360 3300026088 Bacteria 1704
338 Ga0207641_11482352 3300026088 Bacteria 680
339 Ga0207648_10042703 3300026089 Bacteria 3980
340 Ga0207648_10780212 3300026089 Bacteria 889
341 Ga0207648_10891679 3300026089 Bacteria 830
342 Ga0207676_10113884 3300026095 Bacteria 2268
343 Ga0207674_10055770 3300026116 Bacteria 4016
344 Ga0207674_10153021 3300026116 Bacteria 2263
345 Ga0207675_100553554 3300026118 Bacteria 1150
346 Ga0207683_10058879 3300026121 Bacteria 3373
347 Ga0207683_10161304 3300026121 Bacteria 2027
348 Ga0207683_10221925 3300026121 Bacteria 1722
349 Ga0207698_10741602 3300026142 Bacteria 980
350 Ga0207698_11902535 3300026142 Bacteria 610
351 Ga0207428_10000181 3300027907 Bacteria 88299
352 Ga0207428_10019256 3300027907 Bacteria 5820
353 Ga0207428_10320405 3300027907 Bacteria 1145
354 Ga0207428_10512868 3300027907 Bacteria 870
355 Ga0268266_10043001 3300028379 Bacteria 3860
356 Ga0268265_10526911 3300028380 Bacteria 1118
357 Ga0265337_1061382 3300028556 Bacteria 1042
358 Ga0265334_10010285 3300028573 Bacteria 3949
359 Ga0265322_10062119 3300028654 Bacteria 1060
360 Ga0265336_10001318 3300028666 Bacteria 11596
361 Ga0265338_10012206 3300028800 Bacteria 9811
362 Ga0265327_10035110 3300031251 Bacteria 2776
363 Ga0265313_10050529 3300031595 Bacteria 1994
364 Ga0307406_10132712 3300031901 Bacteria 1751
365 Ga0316583_10026202 3300032133 Bacteria 2081
366 Ga0316593_10010384 3300032168 Bacteria 2668
367 Ga0316596_1017568 3300033541 Bacteria 1801
368 Ga0373926_0005643 3300035083 Bacteria 4127
369 Ga0373926_0086955 3300035083 Bacteria 1160
370 Ga0373928_0016089 3300035084 Bacteria 1528
371 Ga0373934_0023921 3300035086 Bacteria 2362
372 Ga0373949_0014842 3300035090 Bacteria 1737
373 Ga0373952_0036322 3300035092 Bacteria 1119
374 Ga0373923_0165417 3300035111 Bacteria 1011
375 Ga0373936_0015763 3300035113 Bacteria 2899
376 Ga0373939_0031302 3300035114 Bacteria 1537
377 Ga0373945_0027844 3300035116 Bacteria 1976
378 Ga0373953_0116309 3300035117 Bacteria 1134
379 Ga0373956_0062256 3300035119 Bacteria 1691
380 Ga0373960_0021225 3300035121 Bacteria 1725
381 Ga0373943_0007053 3300035170 Bacteria 5040
382 Ga0373943_0053897 3300035170 Bacteria 1987
383 Ga0373943_0057742 3300035170 Bacteria 1929
384 Ga0373946_0014684 3300035171 Bacteria 2956
385 Ga0373946_0063508 3300035171 Bacteria 1577
386 Ga0373955_0026984 3300035172 Bacteria 2964
387 Ga0373961_0049540 3300035241 Bacteria 1242
388 Ga0373962_0174743 3300035242 Bacteria 715
389 Ga0316574_0171894 3300035398 Bacteria 1395
390 Ga0373924_0081084 3300035410 Bacteria 1380
391 Ga0373931_0017440 3300035691 Bacteria 3552
392 Ga0373935_0042154 3300035692 Bacteria 2869
393 Ga0373935_0079916 3300035692 Bacteria 2123
394 Ga0373935_0319526 3300035692 Bacteria 1101
395 Ga0373935_0591751 3300035692 Bacteria 811
396 Ga0373927_0048850 3300035695 Bacteria 2737
397 Ga0373927_0361397 3300035695 Bacteria 957
398 Ga0373933_0021469 3300035724 Bacteria 3668
399 Ga0373947_0017628 3300035725 Bacteria 4108
400 Ga0373947_0021201 3300035725 Bacteria 3760
401 Ga0373947_0321031 3300035725 Bacteria 1035
402 Ga0373937_0001944 3300036401 Bacteria 17289
403 Ga0373937_0720054 3300036401 Bacteria 945
404 Ga0373925_0002218 3300037068 Bacteria 15763
405 Ga0373925_0062170 3300037068 Bacteria 2807
406 Ga0373925_0177521 3300037068 Bacteria 1684
407 Ga0395899_0153589 3300037312 Bacteria 1630
408 Ga0395899_0190775 3300037312 Bacteria 1434
409 Ga0395899_0207337 3300037312 Bacteria 1364
410 Ga0395900_0011178 3300037418 Bacteria 9178
411 Ga0395900_0167439 3300037418 Bacteria 2239
412 Ga0395900_0284549 3300037418 Bacteria 1644
413 Ga0395900_0752662 3300037418 Bacteria 904
414 Ga0395900_1214729 3300037418 Bacteria 669
415 Ga0395898_0091882 3300037466 Bacteria 2919
416 Ga0395898_0297972 3300037466 Bacteria 1538
417 Ga0395898_1106446 3300037466 Bacteria 725
418 Ga0395905_0055653 3300037471 Bacteria 3702
419 Ga0395905_0342344 3300037471 Bacteria 1386
420 Ga0395905_0700236 3300037471 Bacteria 915
421 Ga0395901_0019091 3300038443 Bacteria 7010
422 Ga0395901_0074476 3300038443 Bacteria 3542
423 Ga0395901_0161249 3300038443 Bacteria 2355
424 Ga0395901_0212831 3300038443 Bacteria 2022
425 Ga0395901_0571535 3300038443 Bacteria 1143
426 Ga0400490_17491 3300038726 Bacteria 28094
427 Ga0400491_12215 3300038727 Bacteria 7556
428 Ga0436365_1358796 3300039437 Bacteria 845
429 Ga0436360_1013902 3300039438 Bacteria 3542
430 Ga0436361_0766437 3300039447 Bacteria 2031
431 Ga0436363_1151979 3300039450 Bacteria 1043
432 Ga0436362_1022308 3300039453 Bacteria 958
433 Ga0439466_0031680 3300041411 Bacteria 1807
434 Ga0451793_1286489 3300041452 Bacteria 990
435 Ga0451795_0086528 3300041456 Bacteria 795
436 Ga0451798_0303405 3300041458 Bacteria 871
437 Ga0451800_0225302 3300041459 Bacteria 1400
438 Ga0450920_002132 3300042122 Bacteria 3348
439 Ga0450920_003850 3300042122 Bacteria 2614
440 Ga0450900_023776 3300042136 Bacteria 867
441 Ga0450902_032249 3300042137 Bacteria 883
442 Ga0450903_024523 3300042138 Bacteria 925
443 Ga0450907_001870 3300042146 Bacteria 4312
444 Ga0450910_013079 3300042147 Bacteria 1205
445 Ga0466969_0003758 3300044656 Bacteria 8068
446 Ga0466969_0064936 3300044656 Bacteria 1766
447 Ga0466969_0198983 3300044656 Bacteria 914
448 Ga0453683_0088991 3300044673 Bacteria 1935
449 Ga0466965_0077701 3300044683 Bacteria 1676
450 Ga0466965_0923505 3300044683 Bacteria 510
451 Ga0466966_0034146 3300044684 Bacteria 3291
452 Ga0466966_0044853 3300044684 Bacteria 2828
453 Ga0466961_0000463 3300044693 Bacteria 25666
454 Ga0466961_0015787 3300044693 Bacteria 4846
455 Ga0466961_0060307 3300044693 Bacteria 2412
456 Ga0466961_0077983 3300044693 Bacteria 2098
457 Ga0466961_0085051 3300044693 Bacteria 2000
458 Ga0466963_0000055 3300044694 Bacteria 37968
459 Ga0466963_0002044 3300044694 Bacteria 11114
460 Ga0466963_0004340 3300044694 Bacteria 8227
461 Ga0466963_0006350 3300044694 Bacteria 6990
462 Ga0466963_0006417 3300044694 Bacteria 6956
463 Ga0466963_0017674 3300044694 Bacteria 4447
464 Ga0466963_0026186 3300044694 Bacteria 3728
465 Ga0466963_0048563 3300044694 Bacteria 2804
466 Ga0466963_0092269 3300044694 Bacteria 2063
467 Ga0466963_0097328 3300044694 Bacteria 2010
468 Ga0466963_0135655 3300044694 Bacteria 1702
469 Ga0466963_0184877 3300044694 Bacteria 1455
470 Ga0466963_0593879 3300044694 Bacteria 782
471 Ga0466963_0638521 3300044694 Bacteria 751
472 Ga0466964_0031729 3300044706 Bacteria 2097
473 Ga0466964_0033993 3300044706 Bacteria 2033
474 Ga0466964_0073886 3300044706 Bacteria 1448
475 Ga0466964_0095241 3300044706 Bacteria 1302
476 Ga0453684_0734803 3300044712 Bacteria 1070
477 Ga0466971_0009943 3300044719 Bacteria 4155
478 Ga0466971_0011670 3300044719 Bacteria 3847
479 Ga0466971_0028795 3300044719 Bacteria 2484
480 Ga0466971_0142487 3300044719 Bacteria 1116
481 Ga0466968_0008743 3300044735 Bacteria 3882
482 Ga0466968_0028416 3300044735 Bacteria 2306
483 Ga0466968_0031656 3300044735 Bacteria 2195
484 Ga0466968_0103594 3300044735 Bacteria 1273
485 Ga0466968_0126664 3300044735 Bacteria 1159
486 Ga0466968_0161488 3300044735 Bacteria 1034
487 Ga0466970_0007299 3300044765 Bacteria 5538
488 Ga0466970_0070016 3300044765 Bacteria 1886
489 Ga0466970_0371652 3300044765 Bacteria 813
490 Ga0466957_0005217 3300044842 Bacteria 7271
491 Ga0466957_0016697 3300044842 Bacteria 4294
492 Ga0466957_0029951 3300044842 Bacteria 3248
493 Ga0466957_0193152 3300044842 Bacteria 1334
494 Ga0466957_0349714 3300044842 Bacteria 1002
495 Ga0466960_0021506 3300044901 Bacteria 2873
496 Ga0466960_0056340 3300044901 Bacteria 1913
497 Ga0466959_0000761 3300045049 Bacteria 18843
498 Ga0466959_0004174 3300045049 Bacteria 9625
499 Ga0466959_0006516 3300045049 Bacteria 8094
500 Ga0466959_0022832 3300045049 Bacteria 4624
501 Ga0466959_0168935 3300045049 Bacteria 1534
502 Ga0466959_0264676 3300045049 Bacteria 1183
503 Ga0466958_0006835 3300045836 Bacteria 6239
504 Ga0466958_0010924 3300045836 Bacteria 5100
505 Ga0466958_0013846 3300045836 Bacteria 4599
506 Ga0466958_0031826 3300045836 Bacteria 3135
507 Ga0466958_0205627 3300045836 Bacteria 1253
508 Ga0466958_0345198 3300045836 Bacteria 958
509 Ga0466958_0375338 3300045836 Bacteria 916
510 Ga0466958_0459671 3300045836 Bacteria 824
511 Ga0466967_0002348 3300045976 Bacteria 11708
512 Ga0466967_0039139 3300045976 Bacteria 4073
513 Ga0466967_0046458 3300045976 Bacteria 3780
514 Ga0466967_0053112 3300045976 Bacteria 3560
515 Ga0466967_0065217 3300045976 Bacteria 3240
516 Ga0466967_0075823 3300045976 Bacteria 3023
517 Ga0466967_0078419 3300045976 Bacteria 2975
518 Ga0466967_0099841 3300045976 Bacteria 2651
519 Ga0466967_0116175 3300045976 Bacteria 2465
520 Ga0466967_0189810 3300045976 Bacteria 1941
521 Ga0466967_0212598 3300045976 Bacteria 1835
522 Ga0466967_0223460 3300045976 Bacteria 1790
523 Ga0466967_0225253 3300045976 Bacteria 1783
524 Ga0466967_0336155 3300045976 Bacteria 1459
525 Ga0466967_0466266 3300045976 Bacteria 1236
526 Ga0466967_0527842 3300045976 Bacteria 1160
527 Ga0466967_0626652 3300045976 Bacteria 1062
528 Ga0466967_0829701 3300045976 Bacteria 918
529 Ga0466967_1157853 3300045976 Bacteria 770
530 Ga0466967_1372260 3300045976 Bacteria 704
531 Ga0466967_1471974 3300045976 Bacteria 678
532 Ga0495592_0000082 3300046454 Bacteria 83312
533 Ga0495592_0005470 3300046454 Bacteria 9382
534 Ga0495592_0074198 3300046454 Bacteria 2471
535 Ga0495592_0475797 3300046454 Bacteria 779
536 Ga0495592_0770835 3300046454 Bacteria 573
537 Ga0495603_0032804 3300046455 Bacteria 3124
538 Ga0495603_0040839 3300046455 Bacteria 2776
539 Ga0495603_0043193 3300046455 Bacteria 2693
540 Ga0495603_0189160 3300046455 Bacteria 1190
541 Ga0495603_0440952 3300046455 Bacteria 746
542 Ga0495629_0001157 3300046459 Bacteria 20835
543 Ga0495629_0107062 3300046459 Bacteria 1950
544 Ga0495629_0458389 3300046459 Bacteria 863
545 Ga0495629_0496358 3300046459 Bacteria 823
546 Ga0495629_0732121 3300046459 Bacteria 655
547 Ga0495641_0002322 3300046461 Bacteria 15128
548 Ga0495641_0003735 3300046461 Bacteria 11202
549 Ga0495641_0013465 3300046461 Bacteria 4492
550 Ga0495641_0016679 3300046461 Bacteria 3859
551 Ga0495641_0168032 3300046461 Bacteria 981
552 Ga0495641_0262499 3300046461 Bacteria 777
553 Ga0495641_0324433 3300046461 Bacteria 695
554 Ga0495651_0000254 3300046462 Bacteria 41379
555 Ga0495651_0222455 3300046462 Bacteria 1305
556 Ga0495651_0285830 3300046462 Bacteria 1112
557 Ga0495653_0023292 3300046463 Bacteria 5006
558 Ga0495653_0110292 3300046463 Bacteria 1978
559 Ga0495653_0168599 3300046463 Bacteria 1513
560 Ga0495653_0206095 3300046463 Bacteria 1331
561 Ga0495580_0009973 3300046472 Bacteria 7427
562 Ga0495582_0000808 3300046473 Bacteria 17389
563 Ga0495582_0001703 3300046473 Bacteria 12403
564 Ga0495582_0265163 3300046473 Bacteria 985
565 Ga0495582_0358266 3300046473 Bacteria 840
566 Ga0495582_0412425 3300046473 Bacteria 779
567 Ga0495582_0484312 3300046473 Bacteria 715
568 Ga0495605_0054527 3300046474 Bacteria 1936
569 Ga0495639_0000659 3300046475 Bacteria 15963
570 Ga0495639_0000828 3300046475 Bacteria 14100
571 Ga0495662_0002737 3300046476 Bacteria 8908
572 Ga0495662_0111106 3300046476 Bacteria 1343
573 Ga0495662_0163504 3300046476 Bacteria 1097
574 Ga0495662_0206358 3300046476 Bacteria 968
575 Ga0495664_0018869 3300046477 Bacteria 3958
576 Ga0495664_0073142 3300046477 Bacteria 2049
577 Ga0495664_0073533 3300046477 Bacteria 2044
578 Ga0495585_0025984 3300046492 Bacteria 3349
579 Ga0495594_0037202 3300046499 Bacteria 2655
580 Ga0495594_0284652 3300046499 Bacteria 942
581 Ga0495594_0378856 3300046499 Bacteria 805
582 Ga0495594_0603824 3300046499 Bacteria 622
583 Ga0495596_0071343 3300046500 Bacteria 1349
584 Ga0495596_0085594 3300046500 Bacteria 1223
585 Ga0495608_0003029 3300046511 Bacteria 11991
586 Ga0495608_0019774 3300046511 Bacteria 4631
587 Ga0495608_0076168 3300046511 Bacteria 2186
588 Ga0495608_0301504 3300046511 Bacteria 992
589 Ga0495618_0010074 3300046514 Bacteria 5714
590 Ga0495618_0011530 3300046514 Bacteria 5362
591 Ga0495618_0079738 3300046514 Bacteria 2088
592 Ga0495618_0130632 3300046514 Bacteria 1607
593 Ga0495618_0224637 3300046514 Bacteria 1184
594 Ga0495618_0285957 3300046514 Bacteria 1027
595 Ga0495618_0604342 3300046514 Bacteria 652
596 Ga0495628_0008466 3300046516 Bacteria 8819
597 Ga0495628_0013181 3300046516 Bacteria 6956
598 Ga0495628_0037042 3300046516 Bacteria 3911
599 Ga0495628_0255320 3300046516 Bacteria 1307
600 Ga0495628_0693428 3300046516 Bacteria 720
601 Ga0495630_0018065 3300046517 Bacteria 5175
602 Ga0495630_0059957 3300046517 Bacteria 2855
603 Ga0495630_0081900 3300046517 Bacteria 2435
604 Ga0495630_0207836 3300046517 Bacteria 1494
605 Ga0495630_0627798 3300046517 Bacteria 823
606 Ga0495630_0742766 3300046517 Bacteria 750
607 Ga0495631_0048561 3300046518 Bacteria 1861
608 Ga0495631_0259748 3300046518 Bacteria 740
609 Ga0495644_0072868 3300046523 Bacteria 1291
610 Ga0495644_0223804 3300046523 Bacteria 728
611 Ga0495663_0025814 3300046525 Bacteria 1716
612 Ga0495666_0000309 3300046526 Bacteria 21203
613 Ga0495666_0008288 3300046526 Bacteria 5208
614 Ga0495642_0037952 3300046528 Bacteria 1950
615 Ga0495642_0354807 3300046528 Bacteria 645
616 Ga0495652_0000144 3300046529 Bacteria 80486
617 Ga0495652_0005095 3300046529 Bacteria 12426
618 Ga0495665_0001383 3300046531 Bacteria 12998
619 Ga0495665_0003045 3300046531 Bacteria 9054
620 Ga0495640_0002828 3300046533 Bacteria 13955
621 Ga0495640_0016017 3300046533 Bacteria 5621
622 Ga0495640_0188659 3300046533 Bacteria 1311
623 Ga0495640_0255781 3300046533 Bacteria 1095
624 Ga0495586_0035224 3300046535 Bacteria 2688
625 Ga0495586_0259235 3300046535 Bacteria 993
626 Ga0495586_0596015 3300046535 Bacteria 638
627 Ga0495587_0000060 3300046536 Bacteria 93780
628 Ga0495587_0042989 3300046536 Bacteria 2692
629 Ga0495587_0267091 3300046536 Bacteria 960
630 Ga0495609_0082219 3300046538 Bacteria 1407
631 Ga0495645_0000038 3300046543 Bacteria 96124
632 Ga0495645_0039870 3300046543 Bacteria 3425
633 Ga0495645_0112646 3300046543 Bacteria 1923
634 Ga0495667_0008738 3300046559 Bacteria 6882
635 Ga0495667_0117024 3300046559 Bacteria 1722
636 Ga0495667_0149217 3300046559 Bacteria 1505
637 Ga0495667_0173797 3300046559 Bacteria 1384
638 Ga0495667_0308668 3300046559 Bacteria 1002
639 Ga0495656_0001194 3300046615 Bacteria 8463
640 Ga0495656_0163686 3300046615 Bacteria 1083
641 Ga0495634_0004455 3300046642 Bacteria 10990
642 Ga0495634_0031559 3300046642 Bacteria 3648
643 Ga0495634_0159950 3300046642 Bacteria 1420
644 Ga0495634_0175161 3300046642 Bacteria 1346
645 Ga0495611_0037229 3300046648 Bacteria 2161
646 Ga0495635_0059021 3300046663 Bacteria 2638
647 Ga0495635_0209839 3300046663 Bacteria 1319
648 Ga0495635_0221470 3300046663 Bacteria 1279
649 Ga0495659_0010631 3300046664 Bacteria 2959
650 Ga0495588_0260965 3300046674 Bacteria 913
651 Ga0495657_0021956 3300046675 Bacteria 4576
652 Ga0495657_0026518 3300046675 Bacteria 4103
653 Ga0495657_0029234 3300046675 Bacteria 3867
654 Ga0495657_0074859 3300046675 Bacteria 2202
655 Ga0495657_0192428 3300046675 Bacteria 1246
656 Ga0495599_0003010 3300046678 Bacteria 9810
657 Ga0495599_0042619 3300046678 Bacteria 2848
658 Ga0495599_0251432 3300046678 Bacteria 1075
659 Ga0495623_0003795 3300046679 Bacteria 9954
660 Ga0495623_0301324 3300046679 Bacteria 885
661 Ga0495646_0016747 3300046680 Bacteria 4654
662 Ga0495646_0027797 3300046680 Bacteria 3546
663 Ga0495646_0075159 3300046680 Bacteria 1981
664 Ga0495646_0167143 3300046680 Bacteria 1214
665 Ga0495647_0010914 3300046681 Bacteria 3103
666 Ga0495647_0013196 3300046681 Bacteria 2859
667 Ga0495647_0112595 3300046681 Bacteria 1137
668 Ga0495647_0274276 3300046681 Bacteria 755
669 Ga0495658_0000498 3300046683 Bacteria 21575
670 Ga0495658_0001453 3300046683 Bacteria 12469
671 Ga0495658_0117774 3300046683 Bacteria 1603
672 Ga0495613_0061335 3300046689 Bacteria 2753
673 Ga0495613_0141595 3300046689 Bacteria 1718
674 Ga0495613_0157507 3300046689 Bacteria 1617
675 Ga0495613_0168864 3300046689 Bacteria 1553
676 Ga0495624_0007698 3300046690 Bacteria 7557
677 Ga0495624_0011808 3300046690 Bacteria 5993
678 Ga0495624_0034041 3300046690 Bacteria 3298
679 Ga0495624_0079393 3300046690 Bacteria 2035
680 Ga0495624_0109404 3300046690 Bacteria 1700
681 Ga0495624_0495574 3300046690 Bacteria 731
682 Ga0495670_0056634 3300046691 Bacteria 1967
683 Ga0495600_0062127 3300046809 Bacteria 2440
684 Ga0495600_0366427 3300046809 Bacteria 901
685 Ga0495581_0001143 3300047315 Bacteria 14507
686 Ga0495581_0017975 3300047315 Bacteria 4108
687 Ga0495581_0230668 3300047315 Bacteria 1083
688 Ga0495604_0000043 3300047317 Bacteria 116335
689 Ga0495604_0148730 3300047317 Bacteria 1666
690 Ga0495604_0220666 3300047317 Bacteria 1305
691 Ga0495604_0254304 3300047317 Bacteria 1196
692 Ga0495674_0007325 3300047319 Bacteria 10549
693 Ga0495674_0019407 3300047319 Bacteria 6310
694 Ga0495674_0138750 3300047319 Bacteria 2044
695 Ga0495674_0227405 3300047319 Bacteria 1540
696 Ga0495674_0493327 3300047319 Bacteria 980
697 Ga0495676_0016334 3300047321 Bacteria 6592
698 Ga0495676_0036425 3300047321 Bacteria 4108
699 Ga0495676_0070005 3300047321 Bacteria 2705
700 Ga0495676_0072781 3300047321 Bacteria 2638
701 Ga0495676_0118846 3300047321 Bacteria 1927
702 Ga0495676_0355612 3300047321 Bacteria 978
703 Ga0495676_0472150 3300047321 Bacteria 826
704 Ga0495680_0005229 3300047322 Bacteria 12252
705 Ga0495680_0009827 3300047322 Bacteria 8578
706 Ga0495680_0010993 3300047322 Bacteria 8042
707 Ga0495680_0286568 3300047322 Bacteria 1159
708 Ga0495675_0000413 3300047444 Bacteria 29216
709 Ga0495685_043204 3300047447 Bacteria 1538
710 Ga0495684_0001111 3300047471 Bacteria 21659
711 Ga0495684_0076140 3300047471 Bacteria 2548
712 Ga0495684_0129709 3300047471 Bacteria 1894
713 Ga0495684_0274597 3300047471 Bacteria 1218
714 Ga0495684_0280426 3300047471 Bacteria 1202
715 Ga0495684_0435114 3300047471 Bacteria 914
716 Ga0495593_0001256 3300047673 Bacteria 14872
717 Ga0495593_0004784 3300047673 Bacteria 8036
718 Ga0495593_0092131 3300047673 Bacteria 1560
719 Ga0495602_0022762 3300048088 Bacteria 6126
720 Ga0495614_0002476 3300048089 Bacteria 8212
721 Ga0495614_0004362 3300048089 Bacteria 6373
722 Ga0495614_0296538 3300048089 Bacteria 746
723 Ga0496100_0001629 3300048903 Bacteria 11110
724 Ga0496100_0053677 3300048903 Bacteria 2625
725 Ga0496100_0272426 3300048903 Bacteria 1259
726 Ga0496100_0276059 3300048903 Bacteria 1251
727 Ga0496100_0444036 3300048903 Bacteria 994
728 Ga0496101_0006702 3300048904 Bacteria 7426
729 Ga0496101_0149061 3300048904 Bacteria 1788
730 Ga0496101_0149940 3300048904 Bacteria 1783
731 Ga0496101_0285472 3300048904 Bacteria 1291
732 Ga0496101_0457958 3300048904 Bacteria 1006
733 Ga0496102_0008253 3300048905 Bacteria 8919
734 Ga0496102_0063343 3300048905 Bacteria 3385
735 Ga0496102_0181949 3300048905 Bacteria 1980
736 Ga0496102_0523215 3300048905 Bacteria 1109
737 Ga0496102_1297569 3300048905 Bacteria 647
738 Ga0496103_0014004 3300048906 Bacteria 4761
739 Ga0496103_0057089 3300048906 Bacteria 2423
740 Ga0496104_0007021 3300048907 Bacteria 9931
741 Ga0496104_0307271 3300048907 Bacteria 1498
742 Ga0496104_0382082 3300048907 Bacteria 1321
743 Ga0496104_0597812 3300048907 Bacteria 1013
744 Ga0496105_0029069 3300048908 Bacteria 4523
745 Ga0496105_0118125 3300048908 Bacteria 2187
746 Ga0496105_0198444 3300048908 Bacteria 1638
747 Ga0496105_0678076 3300048908 Bacteria 793
748 Ga0496106_0031105 3300048909 Bacteria 3977
749 Ga0496106_0232204 3300048909 Bacteria 1473
750 Ga0496106_0530873 3300048909 Bacteria 945
751 Ga0496106_0853683 3300048909 Bacteria 720
752 Ga0496107_0017701 3300048910 Bacteria 5013
753 Ga0496107_0180696 3300048910 Bacteria 1566
754 Ga0496107_0571075 3300048910 Bacteria 837
755 Ga0496107_0727413 3300048910 Bacteria 729
756 Ga0496108_0058486 3300048911 Bacteria 3240
757 Ga0496108_0107249 3300048911 Bacteria 2385
758 Ga0496108_0568902 3300048911 Bacteria 988
759 Ga0496109_0082695 3300048912 Bacteria 2959
760 Ga0496109_0089833 3300048912 Bacteria 2841
761 Ga0496109_0099702 3300048912 Bacteria 2694
762 Ga0496109_0113923 3300048912 Bacteria 2515
763 Ga0496109_0384105 3300048912 Bacteria 1326
764 Ga0496109_0480016 3300048912 Bacteria 1174
765 Ga0496109_0518190 3300048912 Bacteria 1125
766 Ga0496109_1028350 3300048912 Bacteria 761
767 Ga0496109_1393720 3300048912 Bacteria 636
768 Ga0496110_0023971 3300048913 Bacteria 5197
769 Ga0496110_0030835 3300048913 Bacteria 4624
770 Ga0496110_0160468 3300048913 Bacteria 2038
771 Ga0496110_0169073 3300048913 Bacteria 1983
772 Ga0496110_0241280 3300048913 Bacteria 1644
773 Ga0496110_0302419 3300048913 Bacteria 1457
774 Ga0496111_0011827 3300048914 Bacteria 5892
775 Ga0496111_0033779 3300048914 Bacteria 3649
776 Ga0496111_0257450 3300048914 Bacteria 1295
777 Ga0496111_0373134 3300048914 Bacteria 1055
778 Ga0496111_0508613 3300048914 Bacteria 886
779 Ga0496112_0059463 3300048915 Bacteria 3766
780 Ga0496112_0185242 3300048915 Bacteria 2045
781 Ga0496113_0088698 3300048916 Bacteria 2379
782 Ga0496113_0483302 3300048916 Bacteria 995
783 Ga0496114_0005056 3300048917 Bacteria 10281
784 Ga0496114_0006185 3300048917 Bacteria 9424
785 Ga0496114_0151150 3300048917 Bacteria 2014
786 Ga0496114_0172351 3300048917 Bacteria 1886
787 Ga0496114_0194655 3300048917 Bacteria 1774
788 Ga0496114_0361856 3300048917 Bacteria 1283
789 Ga0496114_0386754 3300048917 Bacteria 1239
790 Ga0496115_0033907 3300048918 Bacteria 4033
791 Ga0496115_0123165 3300048918 Bacteria 2134
792 Ga0501031_0001922 3300049568 Bacteria 13097
793 Ga0501031_0002118 3300049568 Bacteria 12520
794 Ga0501031_0005180 3300049568 Bacteria 8498
795 Ga0501031_0068501 3300049568 Bacteria 2312
796 Ga0501031_0091203 3300049568 Bacteria 1987
797 Ga0501031_0114103 3300049568 Bacteria 1764
798 Ga0501031_0209414 3300049568 Bacteria 1271
799 Ga0501031_0340727 3300049568 Bacteria 970
800 Ga0501031_0475227 3300049568 Bacteria 807
801 Ga0501032_0004421 3300049569 Bacteria 10604
802 Ga0501032_0023340 3300049569 Bacteria 4276
803 Ga0501032_0044036 3300049569 Bacteria 3021
804 Ga0501032_0079859 3300049569 Bacteria 2177
805 Ga0501032_0093895 3300049569 Bacteria 1989
806 Ga0501032_0239962 3300049569 Bacteria 1178
807 Ga0501033_0003063 3300049570 Bacteria 13899
808 Ga0501033_0008979 3300049570 Bacteria 7718
809 Ga0501033_0020491 3300049570 Bacteria 4995
810 Ga0501033_0032660 3300049570 Bacteria 3909
811 Ga0501033_0075805 3300049570 Bacteria 2468
812 Ga0501033_0207271 3300049570 Bacteria 1399
813 Ga0501033_0219796 3300049570 Bacteria 1353
814 Ga0501034_0036580 3300049571 Bacteria 4972
815 Ga0501036_0003710 3300049572 Bacteria 12240
816 Ga0501036_0009021 3300049572 Bacteria 8199
817 Ga0501036_0015282 3300049572 Bacteria 6408
818 Ga0501036_0057668 3300049572 Bacteria 3289
819 Ga0501036_0086042 3300049572 Bacteria 2657
820 Ga0501036_0148825 3300049572 Bacteria 1975
821 Ga0501037_0001718 3300049573 Bacteria 15893
822 Ga0501037_0013457 3300049573 Bacteria 6025
823 Ga0501037_0018672 3300049573 Bacteria 5111
824 Ga0501037_0040595 3300049573 Bacteria 3424
825 Ga0501037_0059507 3300049573 Bacteria 2786
826 Ga0501037_0275252 3300049573 Bacteria 1174
827 Ga0501037_0329506 3300049573 Bacteria 1056
828 Ga0501037_0334181 3300049573 Bacteria 1047
829 Ga0501038_0002469 3300049574 Bacteria 17199
830 Ga0501038_0012658 3300049574 Bacteria 7710
831 Ga0501038_0019828 3300049574 Bacteria 6053
832 Ga0501038_0096442 3300049574 Bacteria 2468
833 Ga0501038_0255487 3300049574 Bacteria 1387
834 Ga0501038_0695045 3300049574 Bacteria 762
835 Ga0501038_0733596 3300049574 Bacteria 738
836 Ga0501039_0004772 3300049575 Bacteria 10271
837 Ga0501039_0007709 3300049575 Bacteria 8218
838 Ga0501039_0010859 3300049575 Bacteria 6941
839 Ga0501039_0015250 3300049575 Bacteria 5881
840 Ga0501039_0022477 3300049575 Bacteria 4841
841 Ga0501039_0115948 3300049575 Bacteria 2097
842 Ga0501039_0132026 3300049575 Bacteria 1960
843 Ga0501039_0223910 3300049575 Bacteria 1478
844 Ga0501039_0258374 3300049575 Bacteria 1369
845 Ga0501039_0340275 3300049575 Bacteria 1179
846 Ga0501039_0467126 3300049575 Bacteria 991
847 Ga0501040_0000912 3300049576 Bacteria 18528
848 Ga0501040_0011832 3300049576 Bacteria 5709
849 Ga0501040_0014970 3300049576 Bacteria 5123
850 Ga0501040_0015710 3300049576 Bacteria 5005
851 Ga0501040_0023663 3300049576 Bacteria 4119
852 Ga0501040_0119856 3300049576 Bacteria 1846
853 Ga0501040_0176929 3300049576 Bacteria 1511
854 Ga0501040_0191955 3300049576 Bacteria 1449
855 Ga0501040_0213523 3300049576 Bacteria 1372
856 Ga0501040_0269412 3300049576 Bacteria 1216
857 Ga0501040_0314193 3300049576 Bacteria 1120
858 Ga0501040_0326816 3300049576 Bacteria 1097
859 Ga0501040_0602148 3300049576 Bacteria 794
860 Ga0501041_0001188 3300049577 Bacteria 14191
861 Ga0501041_0001660 3300049577 Bacteria 12450
862 Ga0501041_0001929 3300049577 Bacteria 11642
863 Ga0501041_0002244 3300049577 Bacteria 10922
864 Ga0501041_0004355 3300049577 Bacteria 8192
865 Ga0501041_0012382 3300049577 Bacteria 5052
866 Ga0501041_0036262 3300049577 Bacteria 2988
867 Ga0501041_0401617 3300049577 Bacteria 868
868 Ga0501042_0000667 3300049578 Bacteria 18449
869 Ga0501042_0007635 3300049578 Bacteria 7094
870 Ga0501042_0015136 3300049578 Bacteria 5275
871 Ga0501042_0019313 3300049578 Bacteria 4730
872 Ga0501042_0020347 3300049578 Bacteria 4618
873 Ga0501042_0031825 3300049578 Bacteria 3732
874 Ga0501042_0035028 3300049578 Bacteria 3561
875 Ga0501042_0076737 3300049578 Bacteria 2392
876 Ga0501043_0008410 3300049579 Bacteria 8128
877 Ga0501043_0020037 3300049579 Bacteria 5249
878 Ga0501043_0084192 3300049579 Bacteria 2499
879 Ga0501043_0216269 3300049579 Bacteria 1484
880 Ga0501043_0217764 3300049579 Bacteria 1478
881 Ga0501043_0281015 3300049579 Bacteria 1276
882 Ga0501043_0832755 3300049579 Bacteria 666
883 Ga0501046_0004156 3300049580 Bacteria 13179
884 Ga0501046_0006661 3300049580 Bacteria 10200
885 Ga0501046_0006809 3300049580 Bacteria 10086
886 Ga0501046_0008923 3300049580 Bacteria 8705
887 Ga0501046_0020980 3300049580 Bacteria 5394
888 Ga0501046_0057062 3300049580 Bacteria 3064
889 Ga0501046_0325560 3300049580 Bacteria 1119
890 Ga0501047_0021018 3300049581 Bacteria 6269
891 Ga0501047_0023307 3300049581 Bacteria 5944
892 Ga0501047_0136800 3300049581 Bacteria 2330
893 Ga0501047_0479348 3300049581 Bacteria 1072
894 Ga0501047_1210379 3300049581 Bacteria 569
895 Ga0501048_0004215 3300049582 Bacteria 10958
896 Ga0501048_0006265 3300049582 Bacteria 9047
897 Ga0501048_0015470 3300049582 Bacteria 5636
898 Ga0501048_0023093 3300049582 Bacteria 4546
899 Ga0501048_0026749 3300049582 Bacteria 4198
900 Ga0501048_0034066 3300049582 Bacteria 3677
901 Ga0501048_0039880 3300049582 Bacteria 3366
902 Ga0501048_0052687 3300049582 Bacteria 2896
903 Ga0501048_0092533 3300049582 Bacteria 2132
904 Ga0501048_0367479 3300049582 Bacteria 1027
905 Ga0501048_0675448 3300049582 Bacteria 742
906 Ga0501067_0026731 3300049583 Bacteria 3195
907 Ga0501067_0031044 3300049583 Bacteria 2965
908 Ga0501067_0069254 3300049583 Bacteria 1953
909 Ga0501067_0126627 3300049583 Bacteria 1421
910 Ga0501068_0002839 3300049584 Bacteria 9214
911 Ga0501068_0003273 3300049584 Bacteria 8682
912 Ga0501068_0010460 3300049584 Bacteria 5214
913 Ga0501068_0016129 3300049584 Bacteria 4302
914 Ga0501068_0017184 3300049584 Bacteria 4180
915 Ga0501068_0017701 3300049584 Bacteria 4122
916 Ga0501068_0029609 3300049584 Bacteria 3243
917 Ga0501068_0170713 3300049584 Bacteria 1372
918 Ga0501069_0000281 3300049585 Bacteria 23211
919 Ga0501069_0003229 3300049585 Bacteria 8360
920 Ga0501069_0022228 3300049585 Bacteria 3447
921 Ga0501069_0036892 3300049585 Bacteria 2697
922 Ga0501069_0073093 3300049585 Bacteria 1922
923 Ga0501069_0085775 3300049585 Bacteria 1777
924 Ga0501069_0088552 3300049585 Bacteria 1749
925 Ga0501069_0214449 3300049585 Bacteria 1118
926 Ga0501069_0362565 3300049585 Bacteria 855
927 Ga0501069_0381137 3300049585 Bacteria 833
928 Ga0501070_0007966 3300049586 Bacteria 8974
929 Ga0501070_0010802 3300049586 Bacteria 7714
930 Ga0501070_0035611 3300049586 Bacteria 4159
931 Ga0501070_0094901 3300049586 Bacteria 2468
932 Ga0501070_0181280 3300049586 Bacteria 1733
933 Ga0501070_0234063 3300049586 Bacteria 1505
934 Ga0501071_0001083 3300049587 Bacteria 15121
935 Ga0501071_0004817 3300049587 Bacteria 8596
936 Ga0501071_0006860 3300049587 Bacteria 7420
937 Ga0501071_0010486 3300049587 Bacteria 6211
938 Ga0501071_0057394 3300049587 Bacteria 2813
939 Ga0501071_0064544 3300049587 Bacteria 2656
940 Ga0501071_0074357 3300049587 Bacteria 2479
941 Ga0501071_0157353 3300049587 Bacteria 1697
942 Ga0501071_0172866 3300049587 Bacteria 1617
943 Ga0501071_0250313 3300049587 Bacteria 1337
944 Ga0501071_0513484 3300049587 Bacteria 919
945 Ga0501072_0001268 3300049588 Bacteria 18858
946 Ga0501072_0010632 3300049588 Bacteria 7009
947 Ga0501072_0012923 3300049588 Bacteria 6386
948 Ga0501072_0016036 3300049588 Bacteria 5745
949 Ga0501072_0033633 3300049588 Bacteria 4017
950 Ga0501072_0053837 3300049588 Bacteria 3170
951 Ga0501072_0087000 3300049588 Bacteria 2479
952 Ga0501072_0107030 3300049588 Bacteria 2224
953 Ga0501072_0188856 3300049588 Bacteria 1643
954 Ga0501072_0273938 3300049588 Bacteria 1343
955 Ga0501072_0276702 3300049588 Bacteria 1335
956 Ga0501072_0289965 3300049588 Bacteria 1301
957 Ga0501072_0807292 3300049588 Bacteria 735
958 Ga0501073_0008765 3300049589 Bacteria 7485
959 Ga0501073_0012210 3300049589 Bacteria 6272
960 Ga0501073_0013552 3300049589 Bacteria 5929
961 Ga0501073_0141779 3300049589 Bacteria 1665
962 Ga0501074_0001000 3300049590 Bacteria 18378
963 Ga0501074_0002634 3300049590 Bacteria 12568
964 Ga0501074_0003320 3300049590 Bacteria 11387
965 Ga0501074_0023738 3300049590 Bacteria 4457
966 Ga0501074_0036342 3300049590 Bacteria 3568
967 Ga0501074_0040628 3300049590 Bacteria 3368
968 Ga0501074_0070993 3300049590 Bacteria 2503
969 Ga0501074_0197734 3300049590 Bacteria 1433
970 Ga0501075_0001943 3300049591 Bacteria 13629
971 Ga0501075_0002651 3300049591 Bacteria 11960
972 Ga0501075_0003018 3300049591 Bacteria 11243
973 Ga0501075_0008555 3300049591 Bacteria 7135
974 Ga0501075_0015752 3300049591 Bacteria 5432
975 Ga0501075_0035626 3300049591 Bacteria 3712
976 Ga0501075_0138840 3300049591 Bacteria 1852
977 Ga0501075_0146035 3300049591 Bacteria 1802
978 Ga0501075_0284160 3300049591 Bacteria 1260
979 Ga0501075_0493070 3300049591 Bacteria 935
980 Ga0501075_0583917 3300049591 Bacteria 852
981 Ga0501076_0001626 3300049592 Bacteria 15152
982 Ga0501076_0005603 3300049592 Bacteria 9045
983 Ga0501076_0007318 3300049592 Bacteria 8030
984 Ga0501076_0008207 3300049592 Bacteria 7649
985 Ga0501076_0009171 3300049592 Bacteria 7291
986 Ga0501076_0010290 3300049592 Bacteria 6933
987 Ga0501076_0018971 3300049592 Bacteria 5249
988 Ga0501076_0040146 3300049592 Bacteria 3676
989 Ga0501076_0059670 3300049592 Bacteria 3034
990 Ga0501076_0813538 3300049592 Bacteria 771
991 Ga0501077_0001393 3300049593 Bacteria 14562
992 Ga0501077_0001912 3300049593 Bacteria 12613
993 Ga0501077_0002204 3300049593 Bacteria 11750
994 Ga0501077_0005398 3300049593 Bacteria 7771
995 Ga0501077_0007498 3300049593 Bacteria 6731
996 Ga0501077_0010312 3300049593 Bacteria 5813
997 Ga0501077_0018672 3300049593 Bacteria 4385
998 Ga0501077_0138018 3300049593 Bacteria 1546
999 Ga0501077_0213669 3300049593 Bacteria 1226
1000 Ga0501077_0221186 3300049593 Bacteria 1203
1001 Ga0501077_0307363 3300049593 Bacteria 1010
1002 Ga0501077_0330346 3300049593 Bacteria 972
1003 Ga0501079_0000076 3300049741 Bacteria 46459
1004 Ga0501079_0003409 3300049741 Bacteria 11673
1005 Ga0501079_0006042 3300049741 Bacteria 9074
1006 Ga0501079_0008393 3300049741 Bacteria 7829
1007 Ga0501079_0026369 3300049741 Bacteria 4455
1008 Ga0501079_0027015 3300049741 Bacteria 4400
1009 Ga0501079_0051929 3300049741 Bacteria 3166
1010 Ga0501079_0062704 3300049741 Bacteria 2867
1011 Ga0501079_0079460 3300049741 Bacteria 2536
1012 Ga0501079_0312217 3300049741 Bacteria 1230
1013 Ga0501079_0360704 3300049741 Bacteria 1139
1014 Ga0501079_1230235 3300049741 Bacteria 590
1015 Ga0501080_0012586 3300049742 Bacteria 7757
1016 Ga0501080_0012861 3300049742 Bacteria 7679
1017 Ga0501080_0016472 3300049742 Bacteria 6827
1018 Ga0501080_0029054 3300049742 Bacteria 5146
1019 Ga0501080_0030844 3300049742 Bacteria 4995
1020 Ga0501080_0032304 3300049742 Bacteria 4880
1021 Ga0501080_0048644 3300049742 Bacteria 3946
1022 Ga0501080_0105638 3300049742 Bacteria 2611
1023 Ga0501080_0204327 3300049742 Bacteria 1813
1024 Ga0501080_0320739 3300049742 Bacteria 1403
1025 Ga0501081_0004393 3300049743 Bacteria 9040
1026 Ga0501081_0006383 3300049743 Bacteria 7649
1027 Ga0501081_0017769 3300049743 Bacteria 4713
1028 Ga0501081_0024644 3300049743 Bacteria 4041
1029 Ga0501081_0028999 3300049743 Bacteria 3737
1030 Ga0501081_0084466 3300049743 Bacteria 2227
1031 Ga0501081_0140333 3300049743 Bacteria 1731
1032 Ga0501081_0155437 3300049743 Bacteria 1645
1033 Ga0501081_0243867 3300049743 Bacteria 1310
1034 Ga0501081_0475259 3300049743 Bacteria 930
1035 Ga0501081_0935705 3300049743 Bacteria 654
1036 Ga0501083_0005072 3300049744 Bacteria 9327
1037 Ga0501083_0006583 3300049744 Bacteria 8244
1038 Ga0501083_0011542 3300049744 Bacteria 6196
1039 Ga0501083_0023084 3300049744 Bacteria 4317
1040 Ga0501083_0035316 3300049744 Bacteria 3415
1041 Ga0501083_0251137 3300049744 Bacteria 1151
1042 Ga0501035_0003302 3300049822 Bacteria 15457
1043 Ga0501035_0021361 3300049822 Bacteria 5950
1044 Ga0501035_0034996 3300049822 Bacteria 4562
1045 Ga0501035_0045094 3300049822 Bacteria 3967
1046 Ga0501035_0308733 3300049822 Bacteria 1331
1047 Ga0501035_0773721 3300049822 Bacteria 769
1048 Ga0501044_0018755 3300049823 Bacteria 7410
1049 Ga0501044_0122766 3300049823 Bacteria 2596
1050 Ga0501044_0126002 3300049823 Bacteria 2559
1051 Ga0501044_0153340 3300049823 Bacteria 2285
1052 Ga0501044_0400241 3300049823 Bacteria 1285
1053 Ga0501045_0000077 3300049824 Bacteria 46550
1054 Ga0501045_0001835 3300049824 Bacteria 14347
1055 Ga0501045_0009478 3300049824 Bacteria 6814
1056 Ga0501045_0021888 3300049824 Bacteria 4574
1057 Ga0501045_0028964 3300049824 Bacteria 3997
1058 Ga0501045_0042172 3300049824 Bacteria 3322
1059 Ga0501045_0049099 3300049824 Bacteria 3076
1060 Ga0501045_0070095 3300049824 Bacteria 2578
1061 Ga0501045_0077628 3300049824 Bacteria 2447
1062 nmdc:mga00v17_29338_c1 3300050491 Bacteria 2255
1063 nmdc:mga0yw44_147904_c1 3300050492 Bacteria 1531
1064 nmdc:mga06z11_49760_c1 3300050494 Bacteria 2139
1065 nmdc:mga05p37_10099_c1 3300050507 Bacteria 11207
1066 nmdc:mga05p37_183984_c1 3300050507 Bacteria 2541
1067 nmdc:mga05p37_200451_c1 3300050507 Bacteria 2418
1068 nmdc:mga05p37_47021_c1 3300050507 Bacteria 5307
1069 nmdc:mga05p37_48463_c1 3300050507 Bacteria 5225
1070 nmdc:mga05p37_555413_c1 3300050507 Bacteria 1306
1071 nmdc:mga05p37_63542_c1 3300050507 Bacteria 4543
1072 nmdc:mga05p37_639709_c1 3300050507 Bacteria 1193
1073 nmdc:mga05p37_681750_c1 3300050507 Bacteria 1145
1074 nmdc:mga09592_45593_c1 3300050508 Bacteria 3693
1075 nmdc:mga09592_5692_c1 3300050508 Bacteria 10165
1076 nmdc:mga09592_94219_c1 3300050508 Bacteria 2561
1077 nmdc:mga0qj67_1148600_c1 3300050509 Bacteria 605
1078 nmdc:mga0qj67_27322_c1 3300050509 Bacteria 4422
1079 nmdc:mga06r32_153768_c1 3300050510 Bacteria 2280
1080 nmdc:mga06r32_210913_c1 3300050510 Bacteria 1930
1081 nmdc:mga08y16_1089817_c1 3300050511 Bacteria 774
1082 nmdc:mga08y16_125036_c1 3300050511 Bacteria 2676
1083 nmdc:mga08y16_131091_c1 3300050511 Bacteria 2607
1084 nmdc:mga08y16_398239_c1 3300050511 Bacteria 1409
1085 nmdc:mga08y16_481751_c1 3300050511 Bacteria 1262
1086 nmdc:mga0n895_106199_c1 3300050512 Bacteria 2821
1087 nmdc:mga0rr50_521970_c1 3300050513 Bacteria 1010
1088 nmdc:mga08x19_261282_c1 3300050514 Bacteria 1197
1089 nmdc:mga08x19_691122_c1 3300050514 Bacteria 724
1090 nmdc:mga0a205_62900_c1 3300050515 Bacteria 3585
1091 Ga0495601_0012252 3300053077 Bacteria 5141
1092 Ga0495601_0015676 3300053077 Bacteria 4582
1093 Ga0495601_0167766 3300053077 Bacteria 1434
1094 Ga0495601_0244147 3300053077 Bacteria 1172
1095 Ga0495601_0297604 3300053077 Bacteria 1051
1096 Ga0495612_0030648 3300053078 Bacteria 2166
1097 Ga0495612_0095619 3300053078 Bacteria 1261
1098 Ga0495612_0098364 3300053078 Bacteria 1244
1099 Ga0495612_0110195 3300053078 Bacteria 1177
1100 Ga0495655_0021716 3300053083 Bacteria 1457
1101 Ga0495655_0035009 3300053083 Bacteria 1246
1102 Ga0495595_0026564 3300053084 Bacteria 2573
1103 Ga0495595_0031260 3300053084 Bacteria 2392
1104 Ga0495595_0158127 3300053084 Bacteria 1117
1105 Ga0495619_0003592 3300053085 Bacteria 9996
1106 Ga0495619_0036099 3300053085 Bacteria 3217
1107 Ga0495619_0115933 3300053085 Bacteria 1833
1108 Ga0495619_0216230 3300053085 Bacteria 1327
1109 Ga0500566_0089234 3300053094 Bacteria 1705
1110 Ga0501084_0000125 3300054114 Bacteria 57691
1111 Ga0501084_0003582 3300054114 Bacteria 12609
1112 Ga0501084_0005571 3300054114 Bacteria 10338
1113 Ga0501084_0012078 3300054114 Bacteria 7152
1114 Ga0501084_0040131 3300054114 Bacteria 3915
1115 Ga0501084_0046874 3300054114 Bacteria 3620
1116 Ga0501084_0060248 3300054114 Bacteria 3177
1117 Ga0501084_0067888 3300054114 Bacteria 2985
1118 Ga0501084_0159974 3300054114 Bacteria 1900
1119 Ga0501084_0305995 3300054114 Bacteria 1342
1120 Ga0501084_0308775 3300054114 Bacteria 1336
1121 Ga0501084_0442662 3300054114 Bacteria 1098
1122 Ga0501084_0450992 3300054114 Bacteria 1087
1123 Ga0501084_0600101 3300054114 Bacteria 930
1124 Ga0501084_0798072 3300054114 Bacteria 795
1125 Ga0590075_014407 3300059424 Bacteria 1933
1126 Ga0587091_014186 3300059511 Bacteria 1293
1127 Ga0587115_049326 3300059626 Bacteria 680
1128 Ga0501082_0011395 3300060353 Bacteria 7649
1129 Ga0501082_0016042 3300060353 Bacteria 6444
1130 Ga0501082_0021659 3300060353 Bacteria 5541
1131 Ga0501082_0030512 3300060353 Bacteria 4645
1132 Ga0501082_0031405 3300060353 Bacteria 4579
1133 Ga0501082_0032987 3300060353 Bacteria 4465
1134 Ga0501082_0049398 3300060353 Bacteria 3627
1135 Ga0501082_0070390 3300060353 Bacteria 3012
1136 Ga0501082_0079300 3300060353 Bacteria 2833
1137 Ga0501082_0084830 3300060353 Bacteria 2731
1138 Ga0501082_0282268 3300060353 Bacteria 1445
1139 Ga0501082_0399182 3300060353 Bacteria 1200
1140 Ga0466962_0052638 3300061719 Bacteria 1945
1141 Ga0466962_0061050 3300061719 Bacteria 1799
1142 Ga0466962_0067913 3300061719 Bacteria 1702
1143 Ga0466962_0233146 3300061719 Bacteria 903
1144 Ga0466962_0327486 3300061719 Bacteria 760
1145 Ga0530510_0001850 3300061734 Bacteria 14459
1146 Ga0530510_0001934 3300061734 Bacteria 14165
1147 Ga0530510_0006651 3300061734 Bacteria 8063
1148 Ga0530510_0010209 3300061734 Bacteria 6580
1149 Ga0530510_0032518 3300061734 Bacteria 3754
1150 Ga0530510_0052620 3300061734 Bacteria 2942
1151 Ga0530510_0130624 3300061734 Bacteria 1848
1152 Ga0530510_0874729 3300061734 Bacteria 686
1153 2526062871 2524614857 Bacteria 4146328
1154 2740063893 2739367875 Bacteria 4157290
1155 8055591283 8055588893 Bacteria 3619545
1156 Ga0436364_0599685
1157 ARcpr5yngRDRAFT_c012431
1158 ARSoilOldRDRAFT_c001158
1159 ARCol0yngRDRAFT_1001005
1160 JGI24739J22299_10031625
1161 JGI24735J21928_10171835
1162 JGI25407J50210_10006859
1163 Ga0070683_100053944
1164 Ga0070683_100184472
1165 Ga0070683_100308906
1166 Ga0070683_101062045
1167 Ga0070670_100002726
1168 Ga0070670_100091757
1169 Ga0068869_100022221
1170 Ga0068869_100491812
1171 Ga0070680_100098314
1172 Ga0070680_100123282
1173 Ga0070682_100189583
1174 Ga0070682_100226337
1175 Ga0070682_100727505
1176 Ga0068868_100098882
1177 Ga0068868_100523321
1178 Ga0070660_100518276
1179 Ga0070660_100766323
1180 Ga0070691_10030122
1181 Ga0070687_100073999
1182 Ga0070661_100040522
1183 Ga0070661_100370265
1184 Ga0070661_100633240
1185 Ga0070692_10022707
1186 Ga0070668_100969449
1187 Ga0070669_100458555
1188 Ga0070675_100054439
1189 Ga0070675_100106705
1190 Ga0070675_100929320
1191 Ga0070671_100068504
1192 Ga0070671_100107077
1193 Ga0070671_100894008
1194 Ga0070674_100106394
1195 Ga0070674_100336072
1196 Ga0070674_100604946
1197 Ga0070673_100009174
1198 Ga0070688_100010080
1199 Ga0070659_100116007
1200 Ga0070659_100461407
1201 Ga0070709_10017436
1202 Ga0070714_100023042
1203 Ga0070714_100138461
1204 Ga0070714_100171566
1205 Ga0070714_100542659
1206 Ga0070714_101254020
1207 Ga0070713_100001889
1208 Ga0070713_100035918
1209 Ga0070713_100163538
1210 Ga0070710_10010919
1211 Ga0070710_10055055
1212 Ga0070711_100175072
1213 Ga0070711_100258287
1214 Ga0070711_100961031
1215 Ga0070705_100023560
1216 Ga0070700_100048730
1217 Ga0070694_100095994
1218 Ga0070694_100461334
1219 Ga0070708_100361595
1220 Ga0070678_100162368
1221 Ga0070678_100651518
1222 Ga0070678_100691956
1223 Ga0070678_100943477
1224 Ga0070662_100144820
1225 Ga0070662_100290847
1226 Ga0070662_100377263
1227 Ga0070662_101042223
1228 Ga0070681_10015900
1229 Ga0070681_10154710
1230 Ga0068867_100768082
1231 Ga0070685_10005868
1232 Ga0070707_100001557
1233 Ga0070699_100149836
1234 Ga0070679_100029555
1235 Ga0070679_100337405
1236 Ga0070684_100022860
1237 Ga0070684_100089974
1238 Ga0070684_100156385
1239 Ga0070684_100240626
1240 Ga0070684_100402869
1241 Ga0068853_100214281
1242 Ga0068853_100284547
1243 Ga0070672_100064211
1244 Ga0070672_100132695
1245 Ga0070686_100434402
1246 Ga0070695_100001595
1247 Ga0070696_100198203
1248 Ga0070693_100107157
1249 Ga0070704_100191887
1250 Ga0070704_100340969
1251 Ga0068855_100939809
1252 Ga0070664_100007134
1253 Ga0068857_100035784
1254 Ga0068857_100138893
1255 Ga0068857_100222749
1256 Ga0068856_100056684
1257 Ga0068856_100432985
1258 Ga0068856_100601606
1259 Ga0070702_100014750
1260 Ga0070702_100242311
1261 Ga0068852_100215349
1262 Ga0068859_100194972
1263 Ga0068864_100008046
1264 Ga0068864_100145545
1265 Ga0068866_10047907
1266 Ga0068851_10085219
1267 Ga0068870_10040559
1268 Ga0068870_10052187
1269 Ga0068870_10073954
1270 Ga0068870_10129624
1271 Ga0068863_100246016
1272 Ga0068862_100860677
1273 Ga0081455_10013977
1274 Ga0081455_10040463
1275 Ga0081455_10050855
1276 Ga0081455_10207841
1277 Ga0081455_10280757
1278 Ga0081538_10000515
1279 Ga0081538_10139009
1280 Ga0081539_10000433
1281 Ga0070717_10012019
1282 Ga0070717_10024999
1283 Ga0070717_10032247
1284 Ga0070717_10069262
1285 Ga0070717_10190202
1286 Ga0070717_10575879
1287 Ga0075365_10179639
1288 Ga0075365_10515393
1289 Ga0075365_10618456
1290 Ga0075364_10044999
1291 Ga0075432_10001059
1292 Ga0070715_10009632
1293 Ga0070716_100028679
1294 Ga0070716_100047618
1295 Ga0070712_100093717
1296 Ga0070712_100107998
1297 Ga0070712_100196031
1298 Ga0097621_100382488
1299 Ga0075428_100006916
1300 Ga0075428_100634603
1301 Ga0075428_100662417
1302 Ga0075428_101513565
1303 Ga0075430_100236322
1304 Ga0075431_100004224
1305 Ga0075431_100145840
1306 Ga0075433_10061868
1307 Ga0075433_10453679
1308 Ga0075429_100011161
1309 Ga0075429_100122353
1310 Ga0075429_100140179
1311 Ga0068865_100076824
1312 Ga0075436_100438644
1313 Ga0097620_100194983
1314 Ga0105240_10134085
1315 Ga0105240_10689056
1316 Ga0111539_10008690
1317 Ga0111539_10065262
1318 Ga0111539_10074113
1319 Ga0111539_10665582
1320 Ga0111539_10998168
1321 Ga0111539_11085749
1322 Ga0105245_10050741
1323 Ga0105245_10106734
1324 Ga0105245_10302976
1325 Ga0105247_10331647
1326 Ga0114129_10035990
1327 Ga0114129_10104282
1328 Ga0114129_10154347
1329 Ga0114129_10211509
1330 Ga0114129_10220001
1331 Ga0114129_10771180
1332 Ga0105243_10120150
1333 Ga0105243_10223874
1334 Ga0105243_10244316
1335 Ga0105242_10017261
1336 Ga0105242_10019594
1337 Ga0105242_10137109
1338 Ga0105242_10156053
1339 Ga0105248_10206586
1340 Ga0105248_10266891
1341 Ga0105248_10914761
1342 Ga0105237_10429166
1343 Ga0105238_10270169
1344 Ga0105249_10198350
1345 Ga0105030_106641
1346 Ga0105239_10048544
1347 Ga0105239_10256295
1348 Ga0105239_10294777
1349 Ga0105239_10815453
1350 Ga0105239_11633232
1351 Ga0105246_10260717
1352 Ga0105246_10349304
1353 Ga0105246_10353928
1354 Ga0105246_10984773
1355 Ga0157315_1004064
1356 Ga0157373_10450061
1357 Ga0157369_10035022
1358 Ga0157374_10575437
1359 Ga0157374_10738143
1360 Ga0157374_11753115
1361 Ga0157378_10363416
1362 Ga0163162_10580982
1363 Ga0163162_10879949
1364 Ga0163162_11547895
1365 Ga0157372_10048166
1366 Ga0157372_10370753
1367 Ga0157372_10412731
1368 Ga0157372_10483699
1369 Ga0157372_11145923
1370 Ga0157375_10047233
1371 Ga0157375_10485398
1372 Ga0163163_10356316
1373 Ga0157380_10094813
1374 Ga0157380_10433743
1375 Ga0157380_10462836
1376 Ga0182008_10247557
1377 Ga0182008_10618451
1378 Ga0157377_10045735
1379 Ga0157377_10600473
1380 Ga0157377_10692806
1381 Ga0157379_10174406
1382 Ga0157379_10689001
1383 Ga0157376_10126357
1384 Ga0157376_10470591
1385 Ga0157376_10709745
1386 Ga0163161_10391273
1387 Ga0206356_10473551
1388 Ga0213871_10031694
1389 Ga0224712_10064454
1390 Ga0224712_10168148
1391 Ga0207692_10034920
1392 Ga0207692_10420172
1393 Ga0207692_10455059
1394 Ga0207642_10033564
1395 Ga0207642_10511485
1396 Ga0207710_10269904
1397 Ga0207688_10000094
1398 Ga0207685_10421115
1399 Ga0207699_10022230
1400 Ga0207699_10933990
1401 Ga0207645_10124230
1402 Ga0207643_10012632
1403 Ga0207643_10018007
1404 Ga0207643_10019179
1405 Ga0207643_10052899
1406 Ga0207684_10061237
1407 Ga0207707_10108421
1408 Ga0207707_10214293
1409 Ga0207695_10443156
1410 Ga0207695_10608670
1411 Ga0207695_10758460
1412 Ga0207671_10102167
1413 Ga0207693_10009230
1414 Ga0207693_10163875
1415 Ga0207693_10245231
1416 Ga0207663_10007294
1417 Ga0207663_10137312
1418 Ga0207662_10016896
1419 Ga0207662_10484022
1420 Ga0207657_10009472
1421 Ga0207657_10032320
1422 Ga0207649_10324113
1423 Ga0207649_10737867
1424 Ga0207652_10096320
1425 Ga0207652_10861220
1426 Ga0207646_10000851
1427 Ga0207681_10144022
1428 Ga0207694_10075978
1429 Ga0207650_10018684
1430 Ga0207650_10030694
1431 Ga0207659_10046963
1432 Ga0207687_10109632
1433 Ga0207687_10294726
1434 Ga0207687_10371103
1435 Ga0207687_10614904
1436 Ga0207700_10000001
1437 Ga0207700_10045665
1438 Ga0207700_10047734
1439 Ga0207664_10025458
1440 Ga0207664_10038854
1441 Ga0207664_10096443
1442 Ga0207664_10137050
1443 Ga0207664_10194359
1444 Ga0207664_10204157
1445 Ga0207644_10164705
1446 Ga0207644_10822363
1447 Ga0207690_10163415
1448 Ga0207690_10697385
1449 Ga0207706_10174250
1450 Ga0207706_10230165
1451 Ga0207686_10121872
1452 Ga0207686_10144148
1453 Ga0207709_10006045
1454 Ga0207709_10056512
1455 Ga0207709_10260242
1456 Ga0207669_10075819
1457 Ga0207669_10327646
1458 Ga0207669_10428016
1459 Ga0207704_10071929
1460 Ga0207704_10335079
1461 Ga0207704_10376060
1462 Ga0207665_10000058
1463 Ga0207665_10549878
1464 Ga0207691_10071530
1465 Ga0207691_10781154
1466 Ga0207711_10110013
1467 Ga0207711_10254679
1468 Ga0207711_10342546
1469 Ga0207689_10032263
1470 Ga0207689_10663114
1471 Ga0207661_10029243
1472 Ga0207661_10190988
1473 Ga0207661_10546301
1474 Ga0207661_10863333
1475 Ga0207679_10050795
1476 Ga0207679_10054481
1477 Ga0207679_10092595
1478 Ga0207667_10381044
1479 Ga0207651_10313135
1480 Ga0207668_10201977
1481 Ga0207668_10345582
1482 Ga0207640_10191544
1483 Ga0207677_10468320
1484 Ga0207677_10550610
1485 Ga0207677_11573873
1486 Ga0207639_10084823
1487 Ga0207639_11048843
1488 Ga0207678_10039202
1489 Ga0207708_10039177
1490 Ga0207708_10490920
1491 Ga0207702_11047895
1492 Ga0207641_10235360
1493 Ga0207641_11482352
1494 Ga0207648_10042703
1495 Ga0207648_10780212
1496 Ga0207648_10891679
1497 Ga0207676_10113884
1498 Ga0207674_10055770
1499 Ga0207674_10153021
1500 Ga0207675_100553554
1501 Ga0207683_10058879
1502 Ga0207683_10161304
1503 Ga0207683_10221925
1504 Ga0207698_10741602
1505 Ga0207698_11902535
1506 Ga0207428_10000181
1507 Ga0207428_10019256
1508 Ga0207428_10320405
1509 Ga0207428_10512868
1510 Ga0268266_10043001
1511 Ga0268265_10526911
1512 Ga0265337_1061382
1513 Ga0265334_10010285
1514 Ga0265322_10062119
1515 Ga0265336_10001318
1516 Ga0265338_10012206
1517 Ga0265327_10035110
1518 Ga0265313_10050529
1519 Ga0307406_10132712
1520 Ga0316583_10026202
1521 Ga0316593_10010384
1522 Ga0316596_1017568
1523 Ga0373926_0005643
1524 Ga0373926_0086955
1525 Ga0373928_0016089
1526 Ga0373934_0023921
1527 Ga0373949_0014842
1528 Ga0373952_0036322
1529 Ga0373923_0165417
1530 Ga0373936_0015763
1531 Ga0373939_0031302
1532 Ga0373945_0027844
1533 Ga0373953_0116309
1534 Ga0373956_0062256
1535 Ga0373960_0021225
1536 Ga0373943_0007053
1537 Ga0373943_0053897
1538 Ga0373943_0057742
1539 Ga0373946_0014684
1540 Ga0373946_0063508
1541 Ga0373955_0026984
1542 Ga0373961_0049540
1543 Ga0373962_0174743
1544 Ga0316574_0171894
1545 Ga0373924_0081084
1546 Ga0373931_0017440
1547 Ga0373935_0042154
1548 Ga0373935_0079916
1549 Ga0373935_0319526
1550 Ga0373935_0591751
1551 Ga0373927_0048850
1552 Ga0373927_0361397
1553 Ga0373933_0021469
1554 Ga0373947_0017628
1555 Ga0373947_0021201
1556 Ga0373947_0321031
1557 Ga0373937_0001944
1558 Ga0373937_0720054
1559 Ga0373925_0002218
1560 Ga0373925_0062170
1561 Ga0373925_0177521
1562 Ga0395899_0153589
1563 Ga0395899_0190775
1564 Ga0395899_0207337
1565 Ga0395900_0011178
1566 Ga0395900_0167439
1567 Ga0395900_0284549
1568 Ga0395900_0752662
1569 Ga0395900_1214729
1570 Ga0395898_0091882
1571 Ga0395898_0297972
1572 Ga0395898_1106446
1573 Ga0395905_0055653
1574 Ga0395905_0342344
1575 Ga0395905_0700236
1576 Ga0395901_0019091
1577 Ga0395901_0074476
1578 Ga0395901_0161249
1579 Ga0395901_0212831
1580 Ga0395901_0571535
1581 Ga0400490_17491
1582 Ga0400491_12215
1583 Ga0436365_1358796
1584 Ga0436360_1013902
1585 Ga0436361_0766437
1586 Ga0436363_1151979
1587 Ga0436362_1022308
1588 Ga0439466_0031680
1589 Ga0451793_1286489
1590 Ga0451795_0086528
1591 Ga0451798_0303405
1592 Ga0451800_0225302
1593 Ga0450920_002132
1594 Ga0450920_003850
1595 Ga0450900_023776
1596 Ga0450902_032249
1597 Ga0450903_024523
1598 Ga0450907_001870
1599 Ga0450910_013079
1600 Ga0466969_0003758
1601 Ga0466969_0064936
1602 Ga0466969_0198983
1603 Ga0453683_0088991
1604 Ga0466965_0077701
1605 Ga0466965_0923505
1606 Ga0466966_0034146
1607 Ga0466966_0044853
1608 Ga0466961_0000463
1609 Ga0466961_0015787
1610 Ga0466961_0060307
1611 Ga0466961_0077983
1612 Ga0466961_0085051
1613 Ga0466963_0000055
1614 Ga0466963_0002044
1615 Ga0466963_0004340
1616 Ga0466963_0006350
1617 Ga0466963_0006417
1618 Ga0466963_0017674
1619 Ga0466963_0026186
1620 Ga0466963_0048563
1621 Ga0466963_0092269
1622 Ga0466963_0097328
1623 Ga0466963_0135655
1624 Ga0466963_0184877
1625 Ga0466963_0593879
1626 Ga0466963_0638521
1627 Ga0466964_0031729
1628 Ga0466964_0033993
1629 Ga0466964_0073886
1630 Ga0466964_0095241
1631 Ga0453684_0734803
1632 Ga0466971_0009943
1633 Ga0466971_0011670
1634 Ga0466971_0028795
1635 Ga0466971_0142487
1636 Ga0466968_0008743
1637 Ga0466968_0028416
1638 Ga0466968_0031656
1639 Ga0466968_0103594
1640 Ga0466968_0126664
1641 Ga0466968_0161488
1642 Ga0466970_0007299
1643 Ga0466970_0070016
1644 Ga0466970_0371652
1645 Ga0466957_0005217
1646 Ga0466957_0016697
1647 Ga0466957_0029951
1648 Ga0466957_0193152
1649 Ga0466957_0349714
1650 Ga0466960_0021506
1651 Ga0466960_0056340
1652 Ga0466959_0000761
1653 Ga0466959_0004174
1654 Ga0466959_0006516
1655 Ga0466959_0022832
1656 Ga0466959_0168935
1657 Ga0466959_0264676
1658 Ga0466958_0006835
1659 Ga0466958_0010924
1660 Ga0466958_0013846
1661 Ga0466958_0031826
1662 Ga0466958_0205627
1663 Ga0466958_0345198
1664 Ga0466958_0375338
1665 Ga0466958_0459671
1666 Ga0466967_0002348
1667 Ga0466967_0039139
1668 Ga0466967_0046458
1669 Ga0466967_0053112
1670 Ga0466967_0065217
1671 Ga0466967_0075823
1672 Ga0466967_0078419
1673 Ga0466967_0099841
1674 Ga0466967_0116175
1675 Ga0466967_0189810
1676 Ga0466967_0212598
1677 Ga0466967_0223460
1678 Ga0466967_0225253
1679 Ga0466967_0336155
1680 Ga0466967_0466266
1681 Ga0466967_0527842
1682 Ga0466967_0626652
1683 Ga0466967_0829701
1684 Ga0466967_1157853
1685 Ga0466967_1372260
1686 Ga0466967_1471974
1687 Ga0495592_0000082
1688 Ga0495592_0005470
1689 Ga0495592_0074198
1690 Ga0495592_0475797
1691 Ga0495592_0770835
1692 Ga0495603_0032804
1693 Ga0495603_0040839
1694 Ga0495603_0043193
1695 Ga0495603_0189160
1696 Ga0495603_0440952
1697 Ga0495629_0001157
1698 Ga0495629_0107062
1699 Ga0495629_0458389
1700 Ga0495629_0496358
1701 Ga0495629_0732121
1702 Ga0495641_0002322
1703 Ga0495641_0003735
1704 Ga0495641_0013465
1705 Ga0495641_0016679
1706 Ga0495641_0168032
1707 Ga0495641_0262499
1708 Ga0495641_0324433
1709 Ga0495651_0000254
1710 Ga0495651_0222455
1711 Ga0495651_0285830
1712 Ga0495653_0023292
1713 Ga0495653_0110292
1714 Ga0495653_0168599
1715 Ga0495653_0206095
1716 Ga0495580_0009973
1717 Ga0495582_0000808
1718 Ga0495582_0001703
1719 Ga0495582_0265163
1720 Ga0495582_0358266
1721 Ga0495582_0412425
1722 Ga0495582_0484312
1723 Ga0495605_0054527
1724 Ga0495639_0000659
1725 Ga0495639_0000828
1726 Ga0495662_0002737
1727 Ga0495662_0111106
1728 Ga0495662_0163504
1729 Ga0495662_0206358
1730 Ga0495664_0018869
1731 Ga0495664_0073142
1732 Ga0495664_0073533
1733 Ga0495585_0025984
1734 Ga0495594_0037202
1735 Ga0495594_0284652
1736 Ga0495594_0378856
1737 Ga0495594_0603824
1738 Ga0495596_0071343
1739 Ga0495596_0085594
1740 Ga0495608_0003029
1741 Ga0495608_0019774
1742 Ga0495608_0076168
1743 Ga0495608_0301504
1744 Ga0495618_0010074
1745 Ga0495618_0011530
1746 Ga0495618_0079738
1747 Ga0495618_0130632
1748 Ga0495618_0224637
1749 Ga0495618_0285957
1750 Ga0495618_0604342
1751 Ga0495628_0008466
1752 Ga0495628_0013181
1753 Ga0495628_0037042
1754 Ga0495628_0255320
1755 Ga0495628_0693428
1756 Ga0495630_0018065
1757 Ga0495630_0059957
1758 Ga0495630_0081900
1759 Ga0495630_0207836
1760 Ga0495630_0627798
1761 Ga0495630_0742766
1762 Ga0495631_0048561
1763 Ga0495631_0259748
1764 Ga0495644_0072868
1765 Ga0495644_0223804
1766 Ga0495663_0025814
1767 Ga0495666_0000309
1768 Ga0495666_0008288
1769 Ga0495642_0037952
1770 Ga0495642_0354807
1771 Ga0495652_0000144
1772 Ga0495652_0005095
1773 Ga0495665_0001383
1774 Ga0495665_0003045
1775 Ga0495640_0002828
1776 Ga0495640_0016017
1777 Ga0495640_0188659
1778 Ga0495640_0255781
1779 Ga0495586_0035224
1780 Ga0495586_0259235
1781 Ga0495586_0596015
1782 Ga0495587_0000060
1783 Ga0495587_0042989
1784 Ga0495587_0267091
1785 Ga0495609_0082219
1786 Ga0495645_0000038
1787 Ga0495645_0039870
1788 Ga0495645_0112646
1789 Ga0495667_0008738
1790 Ga0495667_0117024
1791 Ga0495667_0149217
1792 Ga0495667_0173797
1793 Ga0495667_0308668
1794 Ga0495656_0001194
1795 Ga0495656_0163686
1796 Ga0495634_0004455
1797 Ga0495634_0031559
1798 Ga0495634_0159950
1799 Ga0495634_0175161
1800 Ga0495611_0037229
1801 Ga0495635_0059021
1802 Ga0495635_0209839
1803 Ga0495635_0221470
1804 Ga0495659_0010631
1805 Ga0495588_0260965
1806 Ga0495657_0021956
1807 Ga0495657_0026518
1808 Ga0495657_0029234
1809 Ga0495657_0074859
1810 Ga0495657_0192428
1811 Ga0495599_0003010
1812 Ga0495599_0042619
1813 Ga0495599_0251432
1814 Ga0495623_0003795
1815 Ga0495623_0301324
1816 Ga0495646_0016747
1817 Ga0495646_0027797
1818 Ga0495646_0075159
1819 Ga0495646_0167143
1820 Ga0495647_0010914
1821 Ga0495647_0013196
1822 Ga0495647_0112595
1823 Ga0495647_0274276
1824 Ga0495658_0000498
1825 Ga0495658_0001453
1826 Ga0495658_0117774
1827 Ga0495613_0061335
1828 Ga0495613_0141595
1829 Ga0495613_0157507
1830 Ga0495613_0168864
1831 Ga0495624_0007698
1832 Ga0495624_0011808
1833 Ga0495624_0034041
1834 Ga0495624_0079393
1835 Ga0495624_0109404
1836 Ga0495624_0495574
1837 Ga0495670_0056634
1838 Ga0495600_0062127
1839 Ga0495600_0366427
1840 Ga0495581_0001143
1841 Ga0495581_0017975
1842 Ga0495581_0230668
1843 Ga0495604_0000043
1844 Ga0495604_0148730
1845 Ga0495604_0220666
1846 Ga0495604_0254304
1847 Ga0495674_0007325
1848 Ga0495674_0019407
1849 Ga0495674_0138750
1850 Ga0495674_0227405
1851 Ga0495674_0493327
1852 Ga0495676_0016334
1853 Ga0495676_0036425
1854 Ga0495676_0070005
1855 Ga0495676_0072781
1856 Ga0495676_0118846
1857 Ga0495676_0355612
1858 Ga0495676_0472150
1859 Ga0495680_0005229
1860 Ga0495680_0009827
1861 Ga0495680_0010993
1862 Ga0495680_0286568
1863 Ga0495675_0000413
1864 Ga0495685_043204
1865 Ga0495684_0001111
1866 Ga0495684_0076140
1867 Ga0495684_0129709
1868 Ga0495684_0274597
1869 Ga0495684_0280426
1870 Ga0495684_0435114
1871 Ga0495593_0001256
1872 Ga0495593_0004784
1873 Ga0495593_0092131
1874 Ga0495602_0022762
1875 Ga0495614_0002476
1876 Ga0495614_0004362
1877 Ga0495614_0296538
1878 Ga0496100_0001629
1879 Ga0496100_0053677
1880 Ga0496100_0272426
1881 Ga0496100_0276059
1882 Ga0496100_0444036
1883 Ga0496101_0006702
1884 Ga0496101_0149061
1885 Ga0496101_0149940
1886 Ga0496101_0285472
1887 Ga0496101_0457958
1888 Ga0496102_0008253
1889 Ga0496102_0063343
1890 Ga0496102_0181949
1891 Ga0496102_0523215
1892 Ga0496102_1297569
1893 Ga0496103_0014004
1894 Ga0496103_0057089
1895 Ga0496104_0007021
1896 Ga0496104_0307271
1897 Ga0496104_0382082
1898 Ga0496104_0597812
1899 Ga0496105_0029069
1900 Ga0496105_0118125
1901 Ga0496105_0198444
1902 Ga0496105_0678076
1903 Ga0496106_0031105
1904 Ga0496106_0232204
1905 Ga0496106_0530873
1906 Ga0496106_0853683
1907 Ga0496107_0017701
1908 Ga0496107_0180696
1909 Ga0496107_0571075
1910 Ga0496107_0727413
1911 Ga0496108_0058486
1912 Ga0496108_0107249
1913 Ga0496108_0568902
1914 Ga0496109_0082695
1915 Ga0496109_0089833
1916 Ga0496109_0099702
1917 Ga0496109_0113923
1918 Ga0496109_0384105
1919 Ga0496109_0480016
1920 Ga0496109_0518190
1921 Ga0496109_1028350
1922 Ga0496109_1393720
1923 Ga0496110_0023971
1924 Ga0496110_0030835
1925 Ga0496110_0160468
1926 Ga0496110_0169073
1927 Ga0496110_0241280
1928 Ga0496110_0302419
1929 Ga0496111_0011827
1930 Ga0496111_0033779
1931 Ga0496111_0257450
1932 Ga0496111_0373134
1933 Ga0496111_0508613
1934 Ga0496112_0059463
1935 Ga0496112_0185242
1936 Ga0496113_0088698
1937 Ga0496113_0483302
1938 Ga0496114_0005056
1939 Ga0496114_0006185
1940 Ga0496114_0151150
1941 Ga0496114_0172351
1942 Ga0496114_0194655
1943 Ga0496114_0361856
1944 Ga0496114_0386754
1945 Ga0496115_0033907
1946 Ga0496115_0123165
1947 Ga0501031_0001922
1948 Ga0501031_0002118
1949 Ga0501031_0005180
1950 Ga0501031_0068501
1951 Ga0501031_0091203
1952 Ga0501031_0114103
1953 Ga0501031_0209414
1954 Ga0501031_0340727
1955 Ga0501031_0475227
1956 Ga0501032_0004421
1957 Ga0501032_0023340
1958 Ga0501032_0044036
1959 Ga0501032_0079859
1960 Ga0501032_0093895
1961 Ga0501032_0239962
1962 Ga0501033_0003063
1963 Ga0501033_0008979
1964 Ga0501033_0020491
1965 Ga0501033_0032660
1966 Ga0501033_0075805
1967 Ga0501033_0207271
1968 Ga0501033_0219796
1969 Ga0501034_0036580
1970 Ga0501036_0003710
1971 Ga0501036_0009021
1972 Ga0501036_0015282
1973 Ga0501036_0057668
1974 Ga0501036_0086042
1975 Ga0501036_0148825
1976 Ga0501037_0001718
1977 Ga0501037_0013457
1978 Ga0501037_0018672
1979 Ga0501037_0040595
1980 Ga0501037_0059507
1981 Ga0501037_0275252
1982 Ga0501037_0329506
1983 Ga0501037_0334181
1984 Ga0501038_0002469
1985 Ga0501038_0012658
1986 Ga0501038_0019828
1987 Ga0501038_0096442
1988 Ga0501038_0255487
1989 Ga0501038_0695045
1990 Ga0501038_0733596
1991 Ga0501039_0004772
1992 Ga0501039_0007709
1993 Ga0501039_0010859
1994 Ga0501039_0015250
1995 Ga0501039_0022477
1996 Ga0501039_0115948
1997 Ga0501039_0132026
1998 Ga0501039_0223910
1999 Ga0501039_0258374
2000 Ga0501039_0340275
2001 Ga0501039_0467126
2002 Ga0501040_0000912
2003 Ga0501040_0011832
2004 Ga0501040_0014970
2005 Ga0501040_0015710
2006 Ga0501040_0023663
2007 Ga0501040_0119856
2008 Ga0501040_0176929
2009 Ga0501040_0191955
2010 Ga0501040_0213523
2011 Ga0501040_0269412
2012 Ga0501040_0314193
2013 Ga0501040_0326816
2014 Ga0501040_0602148
2015 Ga0501041_0001188
2016 Ga0501041_0001660
2017 Ga0501041_0001929
2018 Ga0501041_0002244
2019 Ga0501041_0004355
2020 Ga0501041_0012382
2021 Ga0501041_0036262
2022 Ga0501041_0401617
2023 Ga0501042_0000667
2024 Ga0501042_0007635
2025 Ga0501042_0015136
2026 Ga0501042_0019313
2027 Ga0501042_0020347
2028 Ga0501042_0031825
2029 Ga0501042_0035028
2030 Ga0501042_0076737
2031 Ga0501043_0008410
2032 Ga0501043_0020037
2033 Ga0501043_0084192
2034 Ga0501043_0216269
2035 Ga0501043_0217764
2036 Ga0501043_0281015
2037 Ga0501043_0832755
2038 Ga0501046_0004156
2039 Ga0501046_0006661
2040 Ga0501046_0006809
2041 Ga0501046_0008923
2042 Ga0501046_0020980
2043 Ga0501046_0057062
2044 Ga0501046_0325560
2045 Ga0501047_0021018
2046 Ga0501047_0023307
2047 Ga0501047_0136800
2048 Ga0501047_0479348
2049 Ga0501047_1210379
2050 Ga0501048_0004215
2051 Ga0501048_0006265
2052 Ga0501048_0015470
2053 Ga0501048_0023093
2054 Ga0501048_0026749
2055 Ga0501048_0034066
2056 Ga0501048_0039880
2057 Ga0501048_0052687
2058 Ga0501048_0092533
2059 Ga0501048_0367479
2060 Ga0501048_0675448
2061 Ga0501067_0026731
2062 Ga0501067_0031044
2063 Ga0501067_0069254
2064 Ga0501067_0126627
2065 Ga0501068_0002839
2066 Ga0501068_0003273
2067 Ga0501068_0010460
2068 Ga0501068_0016129
2069 Ga0501068_0017184
2070 Ga0501068_0017701
2071 Ga0501068_0029609
2072 Ga0501068_0170713
2073 Ga0501069_0000281
2074 Ga0501069_0003229
2075 Ga0501069_0022228
2076 Ga0501069_0036892
2077 Ga0501069_0073093
2078 Ga0501069_0085775
2079 Ga0501069_0088552
2080 Ga0501069_0214449
2081 Ga0501069_0362565
2082 Ga0501069_0381137
2083 Ga0501070_0007966
2084 Ga0501070_0010802
2085 Ga0501070_0035611
2086 Ga0501070_0094901
2087 Ga0501070_0181280
2088 Ga0501070_0234063
2089 Ga0501071_0001083
2090 Ga0501071_0004817
2091 Ga0501071_0006860
2092 Ga0501071_0010486
2093 Ga0501071_0057394
2094 Ga0501071_0064544
2095 Ga0501071_0074357
2096 Ga0501071_0157353
2097 Ga0501071_0172866
2098 Ga0501071_0250313
2099 Ga0501071_0513484
2100 Ga0501072_0001268
2101 Ga0501072_0010632
2102 Ga0501072_0012923
2103 Ga0501072_0016036
2104 Ga0501072_0033633
2105 Ga0501072_0053837
2106 Ga0501072_0087000
2107 Ga0501072_0107030
2108 Ga0501072_0188856
2109 Ga0501072_0273938
2110 Ga0501072_0276702
2111 Ga0501072_0289965
2112 Ga0501072_0807292
2113 Ga0501073_0008765
2114 Ga0501073_0012210
2115 Ga0501073_0013552
2116 Ga0501073_0141779
2117 Ga0501074_0001000
2118 Ga0501074_0002634
2119 Ga0501074_0003320
2120 Ga0501074_0023738
2121 Ga0501074_0036342
2122 Ga0501074_0040628
2123 Ga0501074_0070993
2124 Ga0501074_0197734
2125 Ga0501075_0001943
2126 Ga0501075_0002651
2127 Ga0501075_0003018
2128 Ga0501075_0008555
2129 Ga0501075_0015752
2130 Ga0501075_0035626
2131 Ga0501075_0138840
2132 Ga0501075_0146035
2133 Ga0501075_0284160
2134 Ga0501075_0493070
2135 Ga0501075_0583917
2136 Ga0501076_0001626
2137 Ga0501076_0005603
2138 Ga0501076_0007318
2139 Ga0501076_0008207
2140 Ga0501076_0009171
2141 Ga0501076_0010290
2142 Ga0501076_0018971
2143 Ga0501076_0040146
2144 Ga0501076_0059670
2145 Ga0501076_0813538
2146 Ga0501077_0001393
2147 Ga0501077_0001912
2148 Ga0501077_0002204
2149 Ga0501077_0005398
2150 Ga0501077_0007498
2151 Ga0501077_0010312
2152 Ga0501077_0018672
2153 Ga0501077_0138018
2154 Ga0501077_0213669
2155 Ga0501077_0221186
2156 Ga0501077_0307363
2157 Ga0501077_0330346
2158 Ga0501079_0000076
2159 Ga0501079_0003409
2160 Ga0501079_0006042
2161 Ga0501079_0008393
2162 Ga0501079_0026369
2163 Ga0501079_0027015
2164 Ga0501079_0051929
2165 Ga0501079_0062704
2166 Ga0501079_0079460
2167 Ga0501079_0312217
2168 Ga0501079_0360704
2169 Ga0501079_1230235
2170 Ga0501080_0012586
2171 Ga0501080_0012861
2172 Ga0501080_0016472
2173 Ga0501080_0029054
2174 Ga0501080_0030844
2175 Ga0501080_0032304
2176 Ga0501080_0048644
2177 Ga0501080_0105638
2178 Ga0501080_0204327
2179 Ga0501080_0320739
2180 Ga0501081_0004393
2181 Ga0501081_0006383
2182 Ga0501081_0017769
2183 Ga0501081_0024644
2184 Ga0501081_0028999
2185 Ga0501081_0084466
2186 Ga0501081_0140333
2187 Ga0501081_0155437
2188 Ga0501081_0243867
2189 Ga0501081_0475259
2190 Ga0501081_0935705
2191 Ga0501083_0005072
2192 Ga0501083_0006583
2193 Ga0501083_0011542
2194 Ga0501083_0023084
2195 Ga0501083_0035316
2196 Ga0501083_0251137
2197 Ga0501035_0003302
2198 Ga0501035_0021361
2199 Ga0501035_0034996
2200 Ga0501035_0045094
2201 Ga0501035_0308733
2202 Ga0501035_0773721
2203 Ga0501044_0018755
2204 Ga0501044_0122766
2205 Ga0501044_0126002
2206 Ga0501044_0153340
2207 Ga0501044_0400241
2208 Ga0501045_0000077
2209 Ga0501045_0001835
2210 Ga0501045_0009478
2211 Ga0501045_0021888
2212 Ga0501045_0028964
2213 Ga0501045_0042172
2214 Ga0501045_0049099
2215 Ga0501045_0070095
2216 Ga0501045_0077628
2217 nmdc:mga00v17_29338_c1
2218 nmdc:mga0yw44_147904_c1
2219 nmdc:mga06z11_49760_c1
2220 nmdc:mga05p37_10099_c1
2221 nmdc:mga05p37_183984_c1
2222 nmdc:mga05p37_200451_c1
2223 nmdc:mga05p37_47021_c1
2224 nmdc:mga05p37_48463_c1
2225 nmdc:mga05p37_555413_c1
2226 nmdc:mga05p37_63542_c1
2227 nmdc:mga05p37_639709_c1
2228 nmdc:mga05p37_681750_c1
2229 nmdc:mga09592_45593_c1
2230 nmdc:mga09592_5692_c1
2231 nmdc:mga09592_94219_c1
2232 nmdc:mga0qj67_1148600_c1
2233 nmdc:mga0qj67_27322_c1
2234 nmdc:mga06r32_153768_c1
2235 nmdc:mga06r32_210913_c1
2236 nmdc:mga08y16_1089817_c1
2237 nmdc:mga08y16_125036_c1
2238 nmdc:mga08y16_131091_c1
2239 nmdc:mga08y16_398239_c1
2240 nmdc:mga08y16_481751_c1
2241 nmdc:mga0n895_106199_c1
2242 nmdc:mga0rr50_521970_c1
2243 nmdc:mga08x19_261282_c1
2244 nmdc:mga08x19_691122_c1
2245 nmdc:mga0a205_62900_c1
2246 Ga0495601_0012252
2247 Ga0495601_0015676
2248 Ga0495601_0167766
2249 Ga0495601_0244147
2250 Ga0495601_0297604
2251 Ga0495612_0030648
2252 Ga0495612_0095619
2253 Ga0495612_0098364
2254 Ga0495612_0110195
2255 Ga0495655_0021716
2256 Ga0495655_0035009
2257 Ga0495595_0026564
2258 Ga0495595_0031260
2259 Ga0495595_0158127
2260 Ga0495619_0003592
2261 Ga0495619_0036099
2262 Ga0495619_0115933
2263 Ga0495619_0216230
2264 Ga0500566_0089234
2265 Ga0501084_0000125
2266 Ga0501084_0003582
2267 Ga0501084_0005571
2268 Ga0501084_0012078
2269 Ga0501084_0040131
2270 Ga0501084_0046874
2271 Ga0501084_0060248
2272 Ga0501084_0067888
2273 Ga0501084_0159974
2274 Ga0501084_0305995
2275 Ga0501084_0308775
2276 Ga0501084_0442662
2277 Ga0501084_0450992
2278 Ga0501084_0600101
2279 Ga0501084_0798072
2280 Ga0590075_014407
2281 Ga0587091_014186
2282 Ga0587115_049326
2283 Ga0501082_0011395
2284 Ga0501082_0016042
2285 Ga0501082_0021659
2286 Ga0501082_0030512
2287 Ga0501082_0031405
2288 Ga0501082_0032987
2289 Ga0501082_0049398
2290 Ga0501082_0070390
2291 Ga0501082_0079300
2292 Ga0501082_0084830
2293 Ga0501082_0282268
2294 Ga0501082_0399182
2295 Ga0466962_0052638
2296 Ga0466962_0061050
2297 Ga0466962_0067913
2298 Ga0466962_0233146
2299 Ga0466962_0327486
2300 Ga0530510_0001850
2301 Ga0530510_0001934
2302 Ga0530510_0006651
2303 Ga0530510_0010209
2304 Ga0530510_0032518
2305 Ga0530510_0052620
2306 Ga0530510_0130624
2307 Ga0530510_0874729
2308 2526062871
2309 2740063893
2310 8055591283

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00347

Ribosomal_L6

Ribosomal protein L6

11

82

0.98

PF00347

Ribosomal_L6

Ribosomal protein L6

90

170

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
7nhn-assembly1.cif.gz_K vgal, an antibiotic resistance abcf, in complex with 70s ribosome from listeria monocytogenes 0.9734 9 173
5li0-assembly1.cif.gz_H 70s ribosome from staphylococcus aureus 0.9685 9 172
4v9b-assembly1.cif.gz_BH crystal structure of the 70s ribosome with tigecycline. 0.9639 2 171
6boh-assembly2.cif.gz_NB antibiotic blasticidin s and e. coli release factor 1 (containing deletion 302-304) bound to the 70s ribosome 0.9635 2 176
7nhn-assembly1.cif.gz_K vgal, an antibiotic resistance abcf, in complex with 70s ribosome from listeria monocytogenes 0.9619 9 173
ID Description Score Start End Superfamily
3knmH02 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.9618 84 169 3.90.930.12
af_Q09865_118_210_3.90.930.12 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.9569 84 174 3.90.930.12
1vw4F02 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.9514 84 171 3.90.930.12
3knmH02 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.951 84 169 3.90.930.12
4qcxH01 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.941 2 80 3.90.930.12
ID Description Score Start End GO Terms
AF-A0A358FVP3-F1-model_v4 50S ribosomal protein L6 0.9962 82 162 GO:0002181
GO:0003735
GO:0019843
GO:0022625
AF-A0A357CQG9-F1-model_v4 50S ribosomal protein L6 0.9938 52 162 GO:0002181
GO:0003735
GO:0019843
GO:0022625
AF-X1G5X1-F1-model_v4 Large ribosomal subunit protein uL6 alpha-beta domain-containing protein 0.9916 83 155 GO:0002181
GO:0003735
GO:0019843
GO:0022625
AF-A0A2J1D431-F1-model_v4 deleted 0.9803 74 169
AF-A0A2J6L7U4-F1-model_v4 deleted 0.9802 83 165

Map