F490816

General Info

Members Datasets Scaffolds Average Seq Length
1147 578 1023 149

Family's Representative Sequence

Representative Sequence 3300035119|Ga0373956_0015101|Ga0373956_0015101_1520_1963
Length 147
Sequence MHRRNMLTAALAGIGGLFAATAAPRRAQAAPDKAKVVYHLSDLDKVSFALGNIRNHFDGMGGPDKVAIALVVHGPALKAFGVASANPDLAHRVGEFGKAGLELNACGNTMKAQKLALKDLLPGFVAERGGVVRIAELQSMGYAYLRP

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
5 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
6 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
7 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
8 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
9 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
10 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
11 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
12 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
13 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
14 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
15 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
16 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
17 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
18 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
19 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
20 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
21 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
22 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
23 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
24 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
25 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
26 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
27 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
28 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
29 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
30 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
31 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
32 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
33 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
34 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
35 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
36 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
37 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
38 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
39 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
40 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
41 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
42 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
43 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
44 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
45 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
46 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
47 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
48 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
49 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
50 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
51 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
52 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
53 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
54 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
55 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
56 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
57 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
58 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
59 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
60 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
61 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
62 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
63 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
64 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
65 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
66 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
67 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
68 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
69 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
70 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
71 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
72 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
73 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
74 2904699407
75 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
76 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
77 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
78 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
79 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
80 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
81 2922425934
82 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
83 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
84 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
85 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
86 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
87 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
88 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
89 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
90 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
91 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
92 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
93 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
94 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
95 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
96 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
97 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
98 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
99 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
100 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
101 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
102 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
103 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
104 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
105 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
106 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
107 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
108 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
109 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
110 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
111 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
112 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
113 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
114 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
115 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
116 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
117 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
118 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
119 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
120 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
121 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
122 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
123 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
124 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
125 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
126 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
127 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
128 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
129 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
130 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
131 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
132 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
133 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
134 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
135 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
136 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
137 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
138 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
139 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
140 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
141 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
142 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
143 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
144 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
145 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
146 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
147 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
148 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
149 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
150 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
151 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
152 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
153 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
154 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
155 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
156 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
157 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
158 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
159 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
160 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
161 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
162 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
163 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
164 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
165 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
166 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
167 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
168 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
169 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
170 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
171 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
172 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
173 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
174 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
175 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
176 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
177 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
178 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
179 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
180 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
181 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
182 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
183 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
184 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
185 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
186 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
187 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
188 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
189 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
190 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
191 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
192 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
193 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
194 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
195 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
196 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
197 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
198 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
199 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
200 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
201 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
202 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
203 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
204 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
205 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
206 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
207 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
208 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
209 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
210 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
211 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
212 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
213 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
214 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
215 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
216 3300012495 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 Metagenome Rhizosphere
217 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
218 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
219 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
220 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
221 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
222 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
223 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
224 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
225 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
226 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
227 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
228 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
229 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
230 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
231 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
232 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
233 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
234 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
235 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
236 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
237 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
238 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
239 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
240 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
241 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
242 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
243 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
244 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
245 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
246 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
247 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
248 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
249 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
264 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
265 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
266 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
267 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
268 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
269 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
270 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
271 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
272 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
273 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
274 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
275 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
276 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
277 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
278 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
279 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
280 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
281 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
282 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
283 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
284 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
285 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
286 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
287 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
288 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
289 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
290 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
291 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
292 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
293 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
294 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
295 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
296 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
297 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
298 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
299 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
300 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
301 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
302 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
303 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
304 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
305 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
306 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
307 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
308 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
309 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
310 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
311 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
312 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
313 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
314 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
315 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
316 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
317 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
318 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
319 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
320 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
321 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
322 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
323 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
324 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
325 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
326 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
327 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
328 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
329 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
330 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
331 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
332 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
333 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
334 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
335 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
336 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
337 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
338 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
339 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
340 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
341 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
342 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
343 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
344 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
345 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
346 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
347 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
348 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
349 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
350 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
351 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
352 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
353 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
354 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
355 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
356 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
357 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
358 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
359 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
360 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
361 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
362 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
363 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
364 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
365 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
366 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
367 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
368 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
369 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
370 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
371 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
372 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
373 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
374 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
375 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
376 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
377 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
378 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
379 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
380 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
381 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
382 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
383 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
384 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
385 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
386 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
387 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
388 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
389 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
390 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
391 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
392 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
393 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
394 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
395 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
396 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
397 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
398 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
399 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
400 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
401 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
402 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
403 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
404 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
405 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
406 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
407 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
408 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
409 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
410 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
411 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
412 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
413 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
414 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
415 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
416 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
417 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
418 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
419 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
420 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
421 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
422 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
423 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
424 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
425 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
426 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
427 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
428 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
429 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
430 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
431 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
432 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
433 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
434 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
435 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
436 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
437 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
438 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
439 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
440 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
441 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
442 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
443 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
444 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
445 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
446 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
447 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
448 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
449 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
450 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
451 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
452 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
453 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
454 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
455 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
456 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
457 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
458 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
459 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
460 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
461 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
462 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
463 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
464 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
465 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
466 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
467 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
468 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
469 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
470 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
471 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
472 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
473 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
474 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
475 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
476 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
477 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
478 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
479 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
480 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
481 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
482 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
483 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
484 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
485 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
486 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
487 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
488 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
489 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
490 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
491 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
492 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
493 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
494 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
495 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
496 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
497 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
498 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
499 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
500 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
501 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
502 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
503 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
504 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
505 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
506 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
507 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
508 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
509 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
510 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
511 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
512 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
513 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
514 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
515 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
516 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
517 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
518 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
519 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
520 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
521 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
522 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
523 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
524 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
525 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
526 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
527 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
528 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
529 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
530 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
531 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
532 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
533 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
534 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
535 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
536 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
537 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
538 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
539 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
540 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
541 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
542 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
543 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
544 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
545 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
546 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
547 3300053144 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere Metagenome Endosphere
548 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
549 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
550 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
551 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
552 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
553 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
554 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
555 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
556 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
557 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
558 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
559 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
560 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
561 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
562 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
563 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
564 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
565 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
566 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
567 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
568 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
569 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
570 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
571 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
572 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
573 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
574 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
575 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
576 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
577 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
578 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 89.34
Metatranscriptomes 0
Isolates 10.66

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.99
Nodule 7.93
Rhizoplane 5.93
Rhizosphere 62.95
Stem 0
Stem Tuber 0
Unclassified 10.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1021087 3300001904 Bacteria 1022
2 JGI24739J22299_10146617 3300001989 Bacteria 698
3 JGI25165J46597_1012230 3300003214 Bacteria 1205
4 JGI25165J46597_1026221 3300003214 Bacteria 755
5 JGI25153J46596_10002319 3300003215 Bacteria 11056
6 JGI25153J46596_10009452 3300003215 Bacteria 4528
7 JGI25153J46596_10015838 3300003215 Bacteria 3049
8 JGI25153J46596_10079426 3300003215 Bacteria 823
9 JGI25160J50197_1002079 3300003354 Bacteria 9515
10 JGI25160J50197_1003509 3300003354 Bacteria 7001
11 Ga0055531_10010256 3300003794 Bacteria 4683
12 Ga0055543_1003926 3300004625 Bacteria 4202
13 Ga0065165_1001577 3300005262 Bacteria 23479
14 Ga0065165_1003271 3300005262 Bacteria 11689
15 Ga0065165_1011199 3300005262 Bacteria 3774
16 Ga0065707_10180538 3300005295 Bacteria 1418
17 Ga0070658_10212875 3300005327 Bacteria 1633
18 Ga0070658_10417327 3300005327 Bacteria 1154
19 Ga0070658_10901556 3300005327 Bacteria 769
20 Ga0070676_10364825 3300005328 Bacteria 996
21 Ga0070683_100097917 3300005329 Bacteria 2760
22 Ga0070690_100160818 3300005330 Bacteria 1539
23 Ga0068869_100020962 3300005334 Bacteria 4491
24 Ga0068869_100194276 3300005334 Bacteria 1597
25 Ga0070666_10171222 3300005335 Bacteria 1521
26 Ga0070666_10528762 3300005335 Bacteria 856
27 Ga0070680_100047508 3300005336 Bacteria 3496
28 Ga0070680_101253899 3300005336 Bacteria 641
29 Ga0070682_100048952 3300005337 Bacteria 2634
30 Ga0070682_101275761 3300005337 Bacteria 623
31 Ga0070682_101930484 3300005337 Bacteria 518
32 Ga0068868_100057233 3300005338 Bacteria 3080
33 Ga0068868_100301779 3300005338 Bacteria 1360
34 Ga0068868_100539476 3300005338 Bacteria 1027
35 Ga0070689_100413365 3300005340 Bacteria 1142
36 Ga0070689_101670846 3300005340 Bacteria 579
37 Ga0070687_101535525 3300005343 Bacteria 502
38 Ga0070661_100037493 3300005344 Bacteria 3527
39 Ga0070661_101084222 3300005344 Bacteria 667
40 Ga0070668_100030699 3300005347 Bacteria 4088
41 Ga0070668_100144595 3300005347 Bacteria 1918
42 Ga0070668_100202596 3300005347 Bacteria 1629
43 Ga0070668_100220982 3300005347 Bacteria 1562
44 Ga0070668_100536575 3300005347 Bacteria 1017
45 Ga0070668_100883897 3300005347 Bacteria 798
46 Ga0070669_100084960 3300005353 Bacteria 2363
47 Ga0070669_100571491 3300005353 Bacteria 944
48 Ga0070669_100827498 3300005353 Bacteria 788
49 Ga0070675_100787007 3300005354 Bacteria 869
50 Ga0070671_100016959 3300005355 Bacteria 5890
51 Ga0070671_100173004 3300005355 Bacteria 1827
52 Ga0070671_100375167 3300005355 Bacteria 1215
53 Ga0070671_100400113 3300005355 Bacteria 1175
54 Ga0070674_100054414 3300005356 Bacteria 2768
55 Ga0070659_100309167 3300005366 Bacteria 1319
56 Ga0070659_100368183 3300005366 Bacteria 1208
57 Ga0070667_100198123 3300005367 Bacteria 1781
58 Ga0070667_100323630 3300005367 Bacteria 1392
59 Ga0070667_100566270 3300005367 Bacteria 1045
60 Ga0070667_100755351 3300005367 Bacteria 902
61 Ga0070709_10007376 3300005434 Bacteria 6025
62 Ga0070709_10017852 3300005434 Bacteria 4077
63 Ga0070709_10294047 3300005434 Bacteria 1184
64 Ga0070709_10731884 3300005434 Bacteria 772
65 Ga0070714_100021753 3300005435 Bacteria 5249
66 Ga0070714_100587337 3300005435 Bacteria 1069
67 Ga0070714_100980272 3300005435 Bacteria 822
68 Ga0070713_100020602 3300005436 Bacteria 5058
69 Ga0070713_100025767 3300005436 Bacteria 4604
70 Ga0070713_100027751 3300005436 Bacteria 4462
71 Ga0070713_100040796 3300005436 Bacteria 3776
72 Ga0070710_10000509 3300005437 Bacteria 18274
73 Ga0070710_10037161 3300005437 Bacteria 2667
74 Ga0070701_10490322 3300005438 Bacteria 796
75 Ga0070711_100007654 3300005439 Bacteria 6578
76 Ga0070700_100271444 3300005441 Bacteria 1225
77 Ga0070700_100303333 3300005441 Bacteria 1167
78 Ga0070694_100422542 3300005444 Bacteria 1047
79 Ga0070663_100005879 3300005455 Bacteria 7336
80 Ga0070663_100085339 3300005455 Bacteria 2329
81 Ga0070663_100106479 3300005455 Bacteria 2100
82 Ga0070663_100138533 3300005455 Bacteria 1855
83 Ga0070663_100142887 3300005455 Bacteria 1829
84 Ga0070663_100309624 3300005455 Bacteria 1267
85 Ga0070663_100558360 3300005455 Bacteria 958
86 Ga0070678_100006542 3300005456 Bacteria 6845
87 Ga0070678_100036131 3300005456 Bacteria 3456
88 Ga0070678_100036166 3300005456 Bacteria 3454
89 Ga0070678_100051998 3300005456 Bacteria 2972
90 Ga0070678_100099960 3300005456 Bacteria 2246
91 Ga0070662_100241273 3300005457 Bacteria 1449
92 Ga0070681_10131917 3300005458 Bacteria 2430
93 Ga0070685_10058764 3300005466 Bacteria 2243
94 Ga0070685_10340258 3300005466 Bacteria 1023
95 Ga0070685_10950487 3300005466 Bacteria 642
96 Ga0070706_100820314 3300005467 Bacteria 861
97 Ga0070699_100087190 3300005518 Bacteria 2724
98 Ga0070699_100122767 3300005518 Bacteria 2285
99 Ga0070679_100048075 3300005530 Bacteria 4251
100 Ga0070679_101078241 3300005530 Bacteria 748
101 Ga0070684_101069546 3300005535 Bacteria 758
102 Ga0070684_101409654 3300005535 Bacteria 656
103 Ga0068853_100132768 3300005539 Bacteria 2230
104 Ga0068853_100180909 3300005539 Bacteria 1912
105 Ga0068853_100521118 3300005539 Bacteria 1124
106 Ga0068853_100587591 3300005539 Bacteria 1057
107 Ga0070672_100012466 3300005543 Bacteria 5969
108 Ga0070672_101289933 3300005543 Bacteria 652
109 Ga0070672_102022741 3300005543 Bacteria 519
110 Ga0070695_100088185 3300005545 Bacteria 2065
111 Ga0070695_100476496 3300005545 Bacteria 961
112 Ga0070696_100041134 3300005546 Bacteria 3192
113 Ga0070693_100434639 3300005547 Bacteria 918
114 Ga0070693_100735925 3300005547 Bacteria 725
115 Ga0070693_100818671 3300005547 Bacteria 692
116 Ga0070665_100037937 3300005548 Bacteria 4844
117 Ga0070665_100038593 3300005548 Bacteria 4801
118 Ga0070665_100038996 3300005548 Bacteria 4777
119 Ga0070665_100051102 3300005548 Bacteria 4147
120 Ga0070665_100082922 3300005548 Bacteria 3211
121 Ga0070665_100223303 3300005548 Bacteria 1884
122 Ga0068855_100008246 3300005563 Bacteria 12595
123 Ga0070664_101193111 3300005564 Bacteria 718
124 Ga0068854_100576307 3300005578 Bacteria 958
125 Ga0068854_100635685 3300005578 Bacteria 915
126 Ga0068856_100089112 3300005614 Bacteria 3068
127 Ga0068856_100119368 3300005614 Bacteria 2638
128 Ga0068856_101170178 3300005614 Bacteria 785
129 Ga0068856_102492042 3300005614 Bacteria 524
130 Ga0068852_100128340 3300005616 Bacteria 2332
131 Ga0068852_100393855 3300005616 Bacteria 1361
132 Ga0068852_100606399 3300005616 Bacteria 1099
133 Ga0068852_101187831 3300005616 Bacteria 784
134 Ga0068859_100190639 3300005617 Bacteria 2134
135 Ga0068859_100201434 3300005617 Bacteria 2075
136 Ga0068859_102126299 3300005617 Bacteria 620
137 Ga0068864_100085670 3300005618 Bacteria 2770
138 Ga0068864_100896179 3300005618 Bacteria 876
139 Ga0068864_101566270 3300005618 Bacteria 663
140 Ga0068866_10047267 3300005718 Bacteria 2169
141 Ga0068866_10196323 3300005718 Bacteria 1203
142 Ga0068861_100116638 3300005719 Bacteria 2147
143 Ga0068861_100397802 3300005719 Bacteria 1222
144 Ga0068861_102118750 3300005719 Bacteria 562
145 Ga0068863_100174025 3300005841 Bacteria 2065
146 Ga0068863_100230130 3300005841 Bacteria 1788
147 Ga0068863_100694930 3300005841 Bacteria 1011
148 Ga0068863_101086733 3300005841 Bacteria 804
149 Ga0068858_100032885 3300005842 Bacteria 4816
150 Ga0068858_100204734 3300005842 Bacteria 1867
151 Ga0068858_100354447 3300005842 Bacteria 1406
152 Ga0068858_101355394 3300005842 Bacteria 700
153 Ga0068858_101417153 3300005842 Bacteria 685
154 Ga0068860_100224288 3300005843 Bacteria 1825
155 Ga0068860_100400551 3300005843 Bacteria 1358
156 Ga0068862_100212473 3300005844 Bacteria 1748
157 Ga0068862_100240010 3300005844 Bacteria 1647
158 Ga0068862_100451097 3300005844 Bacteria 1212
159 Ga0068862_100625080 3300005844 Bacteria 1036
160 Ga0081455_10002888 3300005937 Bacteria 20196
161 Ga0081455_10090886 3300005937 Bacteria 2474
162 Ga0081455_10150392 3300005937 Bacteria 1796
163 Ga0081455_10209166 3300005937 Bacteria 1455
164 Ga0081455_10241891 3300005937 Bacteria 1326
165 Ga0081455_10394015 3300005937 Bacteria 963
166 Ga0081540_1012679 3300005983 Bacteria 5530
167 Ga0081540_1030256 3300005983 Bacteria 3002
168 Ga0081540_1039809 3300005983 Bacteria 2460
169 Ga0081539_10000945 3300005985 Bacteria 54444
170 Ga0081539_10043762 3300005985 Bacteria 2592
171 Ga0081539_10083471 3300005985 Bacteria 1672
172 Ga0070717_10269788 3300006028 Bacteria 1507
173 Ga0070717_10817020 3300006028 Bacteria 848
174 Ga0070717_11278861 3300006028 Bacteria 667
175 Ga0075365_10894864 3300006038 Bacteria 626
176 Ga0075368_10015524 3300006042 Bacteria 2828
177 Ga0075368_10117281 3300006042 Bacteria 1101
178 Ga0075363_100006916 3300006048 Bacteria 5187
179 Ga0075363_100035829 3300006048 Bacteria 2599
180 Ga0075363_100238096 3300006048 Bacteria 1046
181 Ga0075363_100244794 3300006048 Bacteria 1032
182 Ga0075364_10019010 3300006051 Bacteria 4309
183 Ga0075364_10091731 3300006051 Bacteria 2016
184 Ga0070715_10043635 3300006163 Bacteria 1892
185 Ga0070715_10135225 3300006163 Bacteria 1191
186 Ga0070716_100049801 3300006173 Bacteria 2375
187 Ga0070716_100072066 3300006173 Unclassified 2033
188 Ga0070716_101764138 3300006173 Bacteria 512
189 Ga0070712_100004995 3300006175 Bacteria 8209
190 Ga0070712_100048327 3300006175 Bacteria 2949
191 Ga0070712_100822714 3300006175 Bacteria 798
192 Ga0075362_10072825 3300006177 Bacteria 1572
193 Ga0075362_10146714 3300006177 Bacteria 1130
194 Ga0075362_10248331 3300006177 Bacteria 875
195 Ga0075367_10005440 3300006178 Bacteria 6323
196 Ga0075367_10018947 3300006178 Bacteria 3807
197 Ga0075367_10056226 3300006178 Bacteria 2337
198 Ga0075367_10293192 3300006178 Bacteria 1024
199 Ga0075367_10510503 3300006178 Bacteria 763
200 Ga0075369_10125152 3300006186 Bacteria 1165
201 Ga0075366_10048174 3300006195 Bacteria 2527
202 Ga0075366_10195698 3300006195 Bacteria 1229
203 Ga0097621_100283128 3300006237 Bacteria 1460
204 Ga0097621_100881220 3300006237 Bacteria 833
205 Ga0097621_101325842 3300006237 Bacteria 680
206 Ga0075370_10062772 3300006353 Bacteria 2117
207 Ga0075370_10079858 3300006353 Bacteria 1879
208 Ga0075370_10372660 3300006353 Bacteria 855
209 Ga0068871_100619219 3300006358 Bacteria 986
210 Ga0068871_101167842 3300006358 Bacteria 721
211 Ga0068871_101427706 3300006358 Bacteria 653
212 Ga0068865_100127424 3300006881 Bacteria 1902
213 Ga0068865_100626176 3300006881 Bacteria 912
214 Ga0097620_100190656 3300006931 Bacteria 2134
215 Ga0097620_100201420 3300006931 Bacteria 2075
216 Ga0097620_102126300 3300006931 Bacteria 620
217 Ga0099824_1009392 3300006942 Bacteria 12057
218 Ga0099822_1000514 3300006943 Bacteria 36429
219 Ga0099823_1022671 3300006944 Bacteria 5798
220 Ga0099794_10009322 3300007265 Bacteria 4121
221 Ga0099794_10262941 3300007265 Bacteria 891
222 Ga0099795_10015351 3300007788 Bacteria 2397
223 Ga0099795_10037493 3300007788 Bacteria 1706
224 Ga0105250_10162509 3300009092 Bacteria 933
225 Ga0105250_10427447 3300009092 Bacteria 591
226 Ga0105240_10022867 3300009093 Bacteria 8282
227 Ga0105240_10060844 3300009093 Bacteria 4707
228 Ga0105240_10201857 3300009093 Bacteria 2329
229 Ga0105240_10233840 3300009093 Bacteria 2134
230 Ga0111539_10718369 3300009094 Bacteria 1163
231 Ga0105245_10009619 3300009098 Bacteria 8432
232 Ga0105245_10030906 3300009098 Bacteria 4737
233 Ga0105245_10188078 3300009098 Bacteria 1976
234 Ga0105245_10415340 3300009098 Bacteria 1347
235 Ga0105245_10593730 3300009098 Bacteria 1133
236 Ga0105247_10012238 3300009101 Bacteria 5155
237 Ga0105247_11189065 3300009101 Bacteria 606
238 Ga0114129_11297391 3300009147 Bacteria 902
239 Ga0105243_10240844 3300009148 Bacteria 1610
240 Ga0105243_10304699 3300009148 Bacteria 1445
241 Ga0105243_10364502 3300009148 Bacteria 1331
242 Ga0105241_10078928 3300009174 Bacteria 2573
243 Ga0105241_10088821 3300009174 Bacteria 2434
244 Ga0105241_10379256 3300009174 Bacteria 1235
245 Ga0105241_10722583 3300009174 Bacteria 911
246 Ga0105241_11310460 3300009174 Bacteria 690
247 Ga0105242_10354340 3300009176 Bacteria 1356
248 Ga0105242_10529692 3300009176 Bacteria 1126
249 Ga0105242_10550984 3300009176 Bacteria 1106
250 Ga0105242_11755633 3300009176 Bacteria 658
251 Ga0105248_10236929 3300009177 Bacteria 2054
252 Ga0105248_10772422 3300009177 Bacteria 1084
253 Ga0105248_11199924 3300009177 Bacteria 858
254 Ga0105237_10009071 3300009545 Bacteria 10687
255 Ga0105237_10047396 3300009545 Bacteria 4320
256 Ga0105237_10205488 3300009545 Bacteria 1970
257 Ga0105237_10217744 3300009545 Bacteria 1909
258 Ga0105237_10283700 3300009545 Bacteria 1659
259 Ga0105237_10353753 3300009545 Bacteria 1473
260 Ga0105237_11114500 3300009545 Bacteria 796
261 Ga0105237_12285899 3300009545 Bacteria 550
262 Ga0105238_10160883 3300009551 Bacteria 2221
263 Ga0105238_10366840 3300009551 Bacteria 1430
264 Ga0105238_10723596 3300009551 Bacteria 1008
265 Ga0105238_11283815 3300009551 Bacteria 758
266 Ga0105249_10371858 3300009553 Bacteria 1453
267 Ga0105249_10910208 3300009553 Bacteria 947
268 Ga0099796_10011316 3300010159 Bacteria 2485
269 Ga0105239_10048157 3300010375 Bacteria 4673
270 Ga0105239_10132157 3300010375 Bacteria 2777
271 Ga0105239_10143828 3300010375 Bacteria 2658
272 Ga0105239_10160763 3300010375 Bacteria 2509
273 Ga0105239_10420828 3300010375 Bacteria 1513
274 Ga0105239_10473650 3300010375 Bacteria 1422
275 Ga0105239_10568477 3300010375 Bacteria 1292
276 Ga0105239_12022104 3300010375 Bacteria 669
277 Ga0105246_10016029 3300011119 Bacteria 4741
278 Ga0105246_10081283 3300011119 Bacteria 2309
279 Ga0105246_10250258 3300011119 Bacteria 1406
280 Ga0105246_10639571 3300011119 Bacteria 924
281 Ga0157323_1032919 3300012495 Bacteria 559
282 Ga0157373_10296683 3300013100 Bacteria 1147
283 Ga0157370_10067944 3300013104 Bacteria 3369
284 Ga0157370_10128852 3300013104 Bacteria 2361
285 Ga0157370_10208636 3300013104 Bacteria 1811
286 Ga0157370_11714495 3300013104 Bacteria 564
287 Ga0157369_10006777 3300013105 Bacteria 13217
288 Ga0157369_10630778 3300013105 Bacteria 1106
289 Ga0157369_10640261 3300013105 Bacteria 1097
290 Ga0157369_11063775 3300013105 Bacteria 827
291 Ga0157374_10640324 3300013296 Bacteria 1074
292 Ga0157378_10052677 3300013297 Bacteria 3621
293 Ga0157378_11792963 3300013297 Bacteria 662
294 Ga0163162_10041842 3300013306 Bacteria 4584
295 Ga0163162_10168343 3300013306 Bacteria 2315
296 Ga0163162_10403251 3300013306 Bacteria 1500
297 Ga0163162_10477785 3300013306 Bacteria 1378
298 Ga0163162_11305588 3300013306 Bacteria 824
299 Ga0163162_11347941 3300013306 Bacteria 811
300 Ga0163162_11688210 3300013306 Bacteria 723
301 Ga0157375_10268156 3300013308 Bacteria 1869
302 Ga0163163_10139629 3300014325 Bacteria 2465
303 Ga0163163_10352379 3300014325 Bacteria 1528
304 Ga0163163_10502220 3300014325 Bacteria 1275
305 Ga0163163_10980453 3300014325 Bacteria 908
306 Ga0163163_11395180 3300014325 Bacteria 762
307 Ga0157380_10222173 3300014326 Bacteria 1691
308 Ga0157380_10288892 3300014326 Bacteria 1505
309 Ga0157380_10439756 3300014326 Bacteria 1249
310 Ga0182008_10744428 3300014497 Bacteria 564
311 Ga0157377_10165116 3300014745 Bacteria 1380
312 Ga0157379_10228819 3300014968 Bacteria 1685
313 Ga0157379_10404762 3300014968 Bacteria 1255
314 Ga0157379_11024733 3300014968 Bacteria 788
315 Ga0157376_10126305 3300014969 Bacteria 2275
316 Ga0157376_10441462 3300014969 Bacteria 1267
317 Ga0182007_10162187 3300015262 Bacteria 765
318 Ga0163161_10127501 3300017792 Bacteria 1917
319 Ga0214544_1000001 3300021320 Bacteria 783667
320 Ga0214542_1000005 3300021321 Bacteria 389646
321 Ga0214542_1027073 3300021321 Bacteria 2684
322 Ga0214545_1000003 3300021324 Bacteria 720274
323 Ga0214545_1019813 3300021324 Bacteria 5618
324 Ga0214543_1000002 3300021327 Bacteria 712733
325 Ga0214543_1039960 3300021327 Bacteria 1271
326 Ga0213873_10031211 3300021358 Bacteria 1324
327 Ga0213871_10018916 3300021441 Bacteria 1690
328 Ga0209563_110124 3300025230 Bacteria 1391
329 Ga0207425_1009648 3300025245 Bacteria 2391
330 Ga0209677_105397 3300025253 Bacteria 3345
331 Ga0209148_1008346 3300025254 Bacteria 2086
332 Ga0209233_1003418 3300025261 Bacteria 5595
333 Ga0209233_1006411 3300025261 Bacteria 3795
334 Ga0209233_1008559 3300025261 Bacteria 3156
335 Ga0209233_1022427 3300025261 Bacteria 1615
336 Ga0209455_1007598 3300025272 Bacteria 3039
337 Ga0209455_1021895 3300025272 Bacteria 1229
338 Ga0209758_1000026 3300025297 Bacteria 582706
339 Ga0209758_1000479 3300025297 Bacteria 65956
340 Ga0209758_1005453 3300025297 Bacteria 9789
341 Ga0209758_1005713 3300025297 Bacteria 9388
342 Ga0209758_1009114 3300025297 Bacteria 6256
343 Ga0209758_1029176 3300025297 Bacteria 2313
344 Ga0209758_1059991 3300025297 Bacteria 1262
345 Ga0209256_1027256 3300025299 Bacteria 1631
346 Ga0207426_1001455 3300025302 Bacteria 19596
347 Ga0207426_1002534 3300025302 Bacteria 11465
348 Ga0207426_1030642 3300025302 Bacteria 1763
349 Ga0207426_1045255 3300025302 Bacteria 1340
350 Ga0209051_1069589 3300025303 Bacteria 1066
351 Ga0209051_1146783 3300025303 Bacteria 559
352 Ga0209257_1005738 3300025304 Bacteria 8496
353 Ga0209257_1009389 3300025304 Bacteria 5259
354 Ga0207697_10017910 3300025315 Bacteria 2908
355 Ga0207697_10095675 3300025315 Bacteria 1262
356 Ga0207656_10303524 3300025321 Bacteria 790
357 Ga0207710_10131988 3300025900 Bacteria 1200
358 Ga0207688_10147599 3300025901 Bacteria 1387
359 Ga0207688_10295931 3300025901 Bacteria 989
360 Ga0207688_10416004 3300025901 Bacteria 835
361 Ga0207688_10557880 3300025901 Bacteria 720
362 Ga0207688_10772746 3300025901 Bacteria 608
363 Ga0207680_10153136 3300025903 Bacteria 1539
364 Ga0207647_10001122 3300025904 Bacteria 20595
365 Ga0207647_10127468 3300025904 Bacteria 1497
366 Ga0207647_10359708 3300025904 Bacteria 824
367 Ga0207699_10042139 3300025906 Bacteria 2642
368 Ga0207699_10047079 3300025906 Bacteria 2526
369 Ga0207699_10448861 3300025906 Bacteria 925
370 Ga0207699_10629452 3300025906 Bacteria 783
371 Ga0207645_10109815 3300025907 Bacteria 1785
372 Ga0207645_10294283 3300025907 Bacteria 1080
373 Ga0207645_10372972 3300025907 Bacteria 957
374 Ga0207705_10063754 3300025909 Bacteria 2663
375 Ga0207705_10350171 3300025909 Bacteria 1138
376 Ga0207684_10264942 3300025910 Bacteria 1483
377 Ga0207684_10466915 3300025910 Bacteria 1083
378 Ga0207654_10031489 3300025911 Bacteria 2922
379 Ga0207654_10057695 3300025911 Bacteria 2257
380 Ga0207654_10514235 3300025911 Bacteria 847
381 Ga0207707_11034968 3300025912 Bacteria 672
382 Ga0207695_10146707 3300025913 Bacteria 2303
383 Ga0207695_10249945 3300025913 Bacteria 1673
384 Ga0207695_10419804 3300025913 Bacteria 1222
385 Ga0207695_10704868 3300025913 Bacteria 890
386 Ga0207671_11054244 3300025914 Bacteria 639
387 Ga0207671_11343030 3300025914 Bacteria 556
388 Ga0207693_10002721 3300025915 Bacteria 15312
389 Ga0207693_10073082 3300025915 Bacteria 2685
390 Ga0207693_10165680 3300025915 Bacteria 1740
391 Ga0207663_10168514 3300025916 Bacteria 1553
392 Ga0207660_10046176 3300025917 Bacteria 3072
393 Ga0207662_10142934 3300025918 Bacteria 1517
394 Ga0207657_10090831 3300025919 Bacteria 2548
395 Ga0207657_10642127 3300025919 Bacteria 827
396 Ga0207657_10944750 3300025919 Bacteria 663
397 Ga0207646_11030532 3300025922 Bacteria 726
398 Ga0207681_10056349 3300025923 Bacteria 2681
399 Ga0207681_10700819 3300025923 Bacteria 842
400 Ga0207694_10249101 3300025924 Bacteria 1453
401 Ga0207694_10459638 3300025924 Bacteria 1063
402 Ga0207650_10157843 3300025925 Bacteria 1795
403 Ga0207650_10656129 3300025925 Bacteria 885
404 Ga0207650_10864118 3300025925 Bacteria 768
405 Ga0207659_10488826 3300025926 Bacteria 1041
406 Ga0207687_10178430 3300025927 Bacteria 1644
407 Ga0207687_10240498 3300025927 Bacteria 1434
408 Ga0207700_10034721 3300025928 Bacteria 3623
409 Ga0207700_10049919 3300025928 Bacteria 3115
410 Ga0207700_10527112 3300025928 Bacteria 1047
411 Ga0207700_11377182 3300025928 Bacteria 627
412 Ga0207664_10005551 3300025929 Bacteria 8637
413 Ga0207664_11449492 3300025929 Bacteria 608
414 Ga0207644_10329070 3300025931 Bacteria 1237
415 Ga0207644_11418262 3300025931 Bacteria 583
416 Ga0207690_10583846 3300025932 Bacteria 911
417 Ga0207690_11231681 3300025932 Bacteria 625
418 Ga0207706_10101453 3300025933 Bacteria 2532
419 Ga0207706_10193204 3300025933 Bacteria 1786
420 Ga0207706_10856691 3300025933 Bacteria 769
421 Ga0207709_10007189 3300025935 Bacteria 6214
422 Ga0207709_10155618 3300025935 Bacteria 1588
423 Ga0207709_10275668 3300025935 Bacteria 1240
424 Ga0207709_11154410 3300025935 Bacteria 637
425 Ga0207665_10044199 3300025939 Bacteria 2981
426 Ga0207665_10158096 3300025939 Unclassified 1628
427 Ga0207691_10068065 3300025940 Bacteria 3217
428 Ga0207711_10551367 3300025941 Bacteria 1075
429 Ga0207711_10797332 3300025941 Bacteria 880
430 Ga0207689_10118666 3300025942 Bacteria 2176
431 Ga0207689_10924399 3300025942 Bacteria 736
432 Ga0207661_10159549 3300025944 Bacteria 1956
433 Ga0207679_10168233 3300025945 Bacteria 1802
434 Ga0207667_10024730 3300025949 Bacteria 6586
435 Ga0207667_10127423 3300025949 Bacteria 2622
436 Ga0207667_11175661 3300025949 Bacteria 748
437 Ga0207651_10051526 3300025960 Bacteria 2801
438 Ga0207651_10514884 3300025960 Bacteria 1036
439 Ga0207651_11837211 3300025960 Bacteria 545
440 Ga0207712_10019100 3300025961 Bacteria 4472
441 Ga0207712_10030112 3300025961 Bacteria 3647
442 Ga0207668_10168921 3300025972 Bacteria 1713
443 Ga0207668_10331912 3300025972 Bacteria 1265
444 Ga0207668_10691884 3300025972 Bacteria 895
445 Ga0207640_10433088 3300025981 Bacteria 1079
446 Ga0207640_10577726 3300025981 Bacteria 948
447 Ga0207640_11435223 3300025981 Bacteria 619
448 Ga0207640_11442622 3300025981 Bacteria 617
449 Ga0207658_10079721 3300025986 Bacteria 2506
450 Ga0207658_10814510 3300025986 Bacteria 848
451 Ga0207658_11557304 3300025986 Bacteria 604
452 Ga0207677_10024382 3300026023 Bacteria 3757
453 Ga0207677_10040965 3300026023 Bacteria 3059
454 Ga0207677_10694527 3300026023 Bacteria 902
455 Ga0207703_10088219 3300026035 Bacteria 2603
456 Ga0207703_10372095 3300026035 Bacteria 1320
457 Ga0207703_11219268 3300026035 Bacteria 723
458 Ga0207703_11398401 3300026035 Bacteria 673
459 Ga0207639_10123255 3300026041 Bacteria 2133
460 Ga0207639_10160965 3300026041 Bacteria 1891
461 Ga0207639_10177963 3300026041 Bacteria 1807
462 Ga0207639_10222140 3300026041 Bacteria 1632
463 Ga0207678_10010858 3300026067 Bacteria 8004
464 Ga0207678_10026500 3300026067 Bacteria 5056
465 Ga0207678_10040964 3300026067 Bacteria 4016
466 Ga0207678_10044407 3300026067 Bacteria 3844
467 Ga0207678_10047043 3300026067 Bacteria 3731
468 Ga0207678_10089203 3300026067 Bacteria 2636
469 Ga0207678_10432481 3300026067 Bacteria 1142
470 Ga0207678_11227649 3300026067 Bacteria 664
471 Ga0207708_10032916 3300026075 Bacteria 3936
472 Ga0207708_10091810 3300026075 Bacteria 2342
473 Ga0207708_10206436 3300026075 Bacteria 1569
474 Ga0207708_10582403 3300026075 Bacteria 946
475 Ga0207702_10075783 3300026078 Bacteria 2906
476 Ga0207702_10997288 3300026078 Bacteria 831
477 Ga0207702_11057578 3300026078 Bacteria 805
478 Ga0207702_11117735 3300026078 Bacteria 782
479 Ga0207641_10169171 3300026088 Bacteria 1993
480 Ga0207641_10222696 3300026088 Bacteria 1750
481 Ga0207641_10255998 3300026088 Bacteria 1637
482 Ga0207648_10232722 3300026089 Bacteria 1639
483 Ga0207648_10305220 3300026089 Bacteria 1428
484 Ga0207676_10416254 3300026095 Bacteria 1259
485 Ga0207676_10522185 3300026095 Bacteria 1130
486 Ga0207676_11251383 3300026095 Bacteria 736
487 Ga0207675_100167936 3300026118 Bacteria 2096
488 Ga0207675_100489012 3300026118 Bacteria 1224
489 Ga0207683_10034874 3300026121 Bacteria 4375
490 Ga0207683_10047287 3300026121 Bacteria 3768
491 Ga0207683_10353514 3300026121 Bacteria 1349
492 Ga0207683_10575045 3300026121 Bacteria 1042
493 Ga0207683_10673488 3300026121 Bacteria 959
494 Ga0207698_10068650 3300026142 Bacteria 2800
495 Ga0207698_10180252 3300026142 Bacteria 1870
496 Ga0207698_10620973 3300026142 Bacteria 1068
497 Ga0209389_1000057 3300027296 Bacteria 107632
498 Ga0209589_1000007 3300027357 Bacteria 425699
499 Ga0209489_100008 3300027361 Bacteria 425699
500 Ga0209489_100226 3300027361 Bacteria 94384
501 Ga0209700_100009 3300027363 Bacteria 425699
502 Ga0209700_100085 3300027363 Bacteria 128517
503 Ga0209179_1011461 3300027512 Bacteria 1571
504 Ga0209813_10035974 3300027866 Bacteria 1485
505 Ga0209813_10127925 3300027866 Bacteria 891
506 Ga0268266_10001410 3300028379 Bacteria 28680
507 Ga0268266_10007006 3300028379 Bacteria 10236
508 Ga0268266_10027864 3300028379 Bacteria 4804
509 Ga0268266_10029572 3300028379 Bacteria 4657
510 Ga0268266_10046226 3300028379 Bacteria 3727
511 Ga0268266_10100933 3300028379 Bacteria 2543
512 Ga0268266_10331734 3300028379 Bacteria 1426
513 Ga0268265_10108662 3300028380 Bacteria 2258
514 Ga0268265_10301740 3300028380 Bacteria 1442
515 Ga0268265_10358339 3300028380 Bacteria 1334
516 Ga0268264_10278652 3300028381 Bacteria 1565
517 Ga0268264_10475490 3300028381 Bacteria 1215
518 Ga0268264_10821987 3300028381 Bacteria 929
519 Ga0307517_10000248 3300028786 Bacteria 92084
520 Ga0307517_10183062 3300028786 Bacteria 1348
521 Ga0307515_10405686 3300028794 Bacteria 987
522 Ga0307515_10616379 3300028794 Bacteria 696
523 Ga0307515_10707915 3300028794 Bacteria 623
524 Ga0265330_10055866 3300031235 Bacteria 1723
525 Ga0265340_10001728 3300031247 Bacteria 12527
526 Ga0265339_10002990 3300031249 Bacteria 11935
527 Ga0265331_10019457 3300031250 Bacteria 3506
528 Ga0265316_10334795 3300031344 Bacteria 1098
529 Ga0307509_11006177 3300031507 Bacteria 501
530 Ga0307408_100524460 3300031548 Bacteria 1041
531 Ga0307408_100660726 3300031548 Bacteria 936
532 Ga0307508_10086597 3300031616 Bacteria 2716
533 Ga0265314_10057154 3300031711 Bacteria 2682
534 Ga0265342_10000444 3300031712 Bacteria 45263
535 Ga0307516_10005798 3300031730 Bacteria 14633
536 Ga0307516_10948613 3300031730 Bacteria 529
537 Ga0307405_10299483 3300031731 Bacteria 1219
538 Ga0307413_10136694 3300031824 Bacteria 1686
539 Ga0307410_10021949 3300031852 Bacteria 3937
540 Ga0307406_10094255 3300031901 Bacteria 2023
541 Ga0307407_10193574 3300031903 Bacteria 1357
542 Ga0307412_10558885 3300031911 Bacteria 962
543 Ga0307409_100249168 3300031995 Bacteria 1623
544 Ga0307409_100377484 3300031995 Bacteria 1346
545 Ga0307416_100041830 3300032002 Bacteria 3572
546 Ga0307416_100117420 3300032002 Bacteria 2362
547 Ga0307416_100230256 3300032002 Bacteria 1786
548 Ga0307416_102330311 3300032002 Bacteria 636
549 Ga0307414_10335122 3300032004 Bacteria 1293
550 Ga0307411_10053188 3300032005 Bacteria 2651
551 Ga0307415_100585659 3300032126 Bacteria 990
552 Ga0307510_10049737 3300033180 Bacteria 4456
553 Ga0307510_10129962 3300033180 Bacteria 2195
554 Ga0307510_10505153 3300033180 Bacteria 652
555 Ga0373944_0084400 3300035089 Bacteria 1054
556 Ga0373936_0017211 3300035113 Bacteria 2782
557 Ga0373936_0093954 3300035113 Bacteria 1260
558 Ga0373936_0098441 3300035113 Bacteria 1232
559 Ga0373954_0037873 3300035118 Bacteria 2241
560 Ga0373956_0015101 3300035119 Bacteria 3230
561 Ga0373956_0075670 3300035119 Bacteria 1540
562 Ga0373943_0024083 3300035170 Bacteria 2837
563 Ga0373943_0322188 3300035170 Bacteria 881
564 Ga0373943_0331101 3300035170 Bacteria 870
565 Ga0373946_0077256 3300035171 Bacteria 1451
566 Ga0373946_0461348 3300035171 Bacteria 648
567 Ga0373955_0001316 3300035172 Bacteria 10524
568 Ga0373924_0311726 3300035410 Bacteria 699
569 Ga0373931_0256809 3300035691 Bacteria 1065
570 Ga0373935_0485782 3300035692 Bacteria 895
571 Ga0373927_0099946 3300035695 Bacteria 1886
572 Ga0373927_0158701 3300035695 Bacteria 1482
573 Ga0373927_0251915 3300035695 Bacteria 1161
574 Ga0373927_1178075 3300035695 Bacteria 505
575 Ga0373933_0140708 3300035724 Bacteria 1523
576 Ga0373947_0012045 3300035725 Bacteria 4953
577 Ga0373947_0671894 3300035725 Bacteria 706
578 Ga0373937_0280743 3300036401 Bacteria 1573
579 Ga0373937_0307671 3300036401 Bacteria 1498
580 Ga0373925_0015018 3300037068 Bacteria 5598
581 Ga0373925_0081538 3300037068 Bacteria 2460
582 Ga0373925_0161231 3300037068 Bacteria 1766
583 Ga0373925_0314730 3300037068 Bacteria 1266
584 Ga0395899_0168635 3300037312 Bacteria 1543
585 Ga0395900_0026521 3300037418 Bacteria 5933
586 Ga0395900_0150164 3300037418 Bacteria 2381
587 Ga0395898_0007695 3300037466 Bacteria 11438
588 Ga0395898_0011882 3300037466 Bacteria 9015
589 Ga0395905_0043972 3300037471 Bacteria 4191
590 Ga0395905_0619250 3300037471 Bacteria 984
591 Ga0436364_0882487 3300037853 Bacteria 2094
592 Ga0395901_0030065 3300038443 Bacteria 5595
593 Ga0395901_0491347 3300038443 Bacteria 1251
594 Ga0395901_0654608 3300038443 Bacteria 1053
595 Ga0436365_1797166 3300039437 Bacteria 4615
596 Ga0436360_0417419 3300039438 Bacteria 3058
597 Ga0436361_1149151 3300039447 Bacteria 4675
598 Ga0436363_0134632 3300039450 Bacteria 1665
599 Ga0436362_1272358 3300039453 Bacteria 4118
600 Ga0451787_372953 3300041441 Bacteria 641
601 Ga0451797_1383401 3300041453 Bacteria 759
602 Ga0451804_0414830 3300041463 Bacteria 1255
603 Ga0451807_1542365 3300041486 Bacteria 1073
604 Ga0451835_0089850 3300041492 Bacteria 734
605 Ga0451849_0907426 3300041505 Bacteria 548
606 Ga0451843_1086481 3300041509 Bacteria 843
607 Ga0439459_0112710 3300042438 Bacteria 677
608 Ga0439464_0092267 3300042439 Bacteria 914
609 Ga0466969_0010526 3300044656 Bacteria 4903
610 Ga0466969_0043185 3300044656 Bacteria 2247
611 Ga0466972_0016778 3300044658 Bacteria 3661
612 Ga0466972_0124109 3300044658 Bacteria 1217
613 Ga0466966_0005947 3300044684 Bacteria 8051
614 Ga0466966_0218088 3300044684 Bacteria 1152
615 Ga0466961_0000863 3300044693 Bacteria 18927
616 Ga0466961_0046672 3300044693 Bacteria 2770
617 Ga0466963_0071599 3300044694 Bacteria 2334
618 Ga0466963_0992467 3300044694 Bacteria 591
619 Ga0466964_0157200 3300044706 Bacteria 1059
620 Ga0466971_0022035 3300044719 Bacteria 2836
621 Ga0466968_0046951 3300044735 Bacteria 1835
622 Ga0466968_0534909 3300044735 Bacteria 587
623 Ga0466970_0405278 3300044765 Bacteria 778
624 Ga0466957_0187308 3300044842 Bacteria 1354
625 Ga0466960_0132092 3300044901 Bacteria 1319
626 Ga0466959_0014195 3300045049 Bacteria 5781
627 Ga0466959_0093008 3300045049 Bacteria 2164
628 Ga0466959_0248511 3300045049 Bacteria 1227
629 Ga0466958_0155703 3300045836 Bacteria 1442
630 Ga0495592_0178672 3300046454 Bacteria 1447
631 Ga0495592_0541897 3300046454 Bacteria 717
632 Ga0495592_0786439 3300046454 Bacteria 566
633 Ga0495603_0036047 3300046455 Bacteria 2969
634 Ga0495603_0118183 3300046455 Bacteria 1545
635 Ga0495603_0205571 3300046455 Bacteria 1138
636 Ga0495603_0240085 3300046455 Bacteria 1044
637 Ga0495603_0249360 3300046455 Bacteria 1022
638 Ga0495590_0335619 3300046457 Bacteria 573
639 Ga0495629_0095010 3300046459 Bacteria 2080
640 Ga0495629_0167408 3300046459 Bacteria 1526
641 Ga0495629_0333446 3300046459 Bacteria 1036
642 Ga0495638_0171184 3300046460 Bacteria 1246
643 Ga0495651_0008654 3300046462 Bacteria 7809
644 Ga0495651_0206179 3300046462 Bacteria 1372
645 Ga0495651_0294311 3300046462 Bacteria 1091
646 Ga0495653_0116906 3300046463 Bacteria 1906
647 Ga0495580_0115240 3300046472 Bacteria 1867
648 Ga0495582_0035455 3300046473 Bacteria 2744
649 Ga0495582_0234013 3300046473 Bacteria 1052
650 Ga0495639_0017275 3300046475 Bacteria 3133
651 Ga0495664_0005611 3300046477 Bacteria 6902
652 Ga0495664_0063668 3300046477 Bacteria 2198
653 Ga0495664_0224520 3300046477 Bacteria 1137
654 Ga0495584_0008011 3300046491 Bacteria 5492
655 Ga0495584_0224376 3300046491 Bacteria 955
656 Ga0495585_0155892 3300046492 Bacteria 1188
657 Ga0495585_0157607 3300046492 Bacteria 1180
658 Ga0495585_0232576 3300046492 Bacteria 926
659 Ga0495594_0353547 3300046499 Bacteria 837
660 Ga0495596_0149803 3300046500 Bacteria 906
661 Ga0495596_0255726 3300046500 Bacteria 680
662 Ga0495606_0364706 3300046507 Bacteria 762
663 Ga0495608_0091559 3300046511 Bacteria 1966
664 Ga0495608_0271971 3300046511 Bacteria 1053
665 Ga0495616_0094138 3300046513 Bacteria 1414
666 Ga0495616_0281096 3300046513 Bacteria 707
667 Ga0495618_0605289 3300046514 Bacteria 652
668 Ga0495620_0028297 3300046515 Bacteria 2609
669 Ga0495620_0103221 3300046515 Bacteria 1135
670 Ga0495628_0016659 3300046516 Bacteria 6129
671 Ga0495628_0145485 3300046516 Bacteria 1807
672 Ga0495628_0839973 3300046516 Bacteria 640
673 Ga0495630_0061491 3300046517 Bacteria 2820
674 Ga0495630_0308180 3300046517 Bacteria 1210
675 Ga0495630_0589230 3300046517 Bacteria 852
676 Ga0495630_0593423 3300046517 Bacteria 849
677 Ga0495631_0051527 3300046518 Bacteria 1799
678 Ga0495631_0240123 3300046518 Bacteria 773
679 Ga0495632_0372245 3300046519 Bacteria 626
680 Ga0495643_0117762 3300046522 Bacteria 1344
681 Ga0495643_0124719 3300046522 Bacteria 1298
682 Ga0495644_0161793 3300046523 Bacteria 858
683 Ga0495648_0002468 3300046524 Bacteria 17007
684 Ga0495652_0584099 3300046529 Bacteria 764
685 Ga0495665_0117142 3300046531 Bacteria 1395
686 Ga0495640_0433394 3300046533 Bacteria 804
687 Ga0495587_0191209 3300046536 Bacteria 1159
688 Ga0495609_0450824 3300046538 Bacteria 511
689 Ga0495597_0147643 3300046542 Bacteria 966
690 Ga0495645_0087057 3300046543 Bacteria 2235
691 Ga0495645_0229171 3300046543 Bacteria 1245
692 Ga0495645_0447610 3300046543 Bacteria 815
693 Ga0495633_0059593 3300046558 Bacteria 1790
694 Ga0495633_0388063 3300046558 Bacteria 632
695 Ga0495667_0156617 3300046559 Bacteria 1466
696 Ga0495667_0179609 3300046559 Bacteria 1359
697 Ga0495667_0219659 3300046559 Bacteria 1213
698 Ga0495656_0189414 3300046615 Bacteria 1015
699 Ga0495656_0204232 3300046615 Unclassified 982
700 Ga0495668_0238234 3300046616 Bacteria 996
701 Ga0495668_0245080 3300046616 Bacteria 981
702 Ga0495668_0267924 3300046616 Bacteria 935
703 Ga0495634_0044257 3300046642 Bacteria 3014
704 Ga0495625_0118150 3300046660 Bacteria 1807
705 Ga0495625_0452441 3300046660 Bacteria 793
706 Ga0495625_0637581 3300046660 Bacteria 636
707 Ga0495635_0023808 3300046663 Bacteria 4267
708 Ga0495635_0062415 3300046663 Bacteria 2559
709 Ga0495635_0080378 3300046663 Bacteria 2231
710 Ga0495635_0313893 3300046663 Bacteria 1050
711 Ga0495659_0016184 3300046664 Bacteria 2458
712 Ga0495588_0012639 3300046674 Bacteria 3996
713 Ga0495588_0351167 3300046674 Bacteria 775
714 Ga0495657_0005091 3300046675 Bacteria 10441
715 Ga0495657_0109153 3300046675 Bacteria 1755
716 Ga0495657_0122415 3300046675 Bacteria 1637
717 Ga0495657_0272849 3300046675 Bacteria 1014
718 Ga0495657_0382005 3300046675 Bacteria 831
719 Ga0495599_0046216 3300046678 Bacteria 2730
720 Ga0495599_0205791 3300046678 Bacteria 1208
721 Ga0495599_0315254 3300046678 Bacteria 942
722 Ga0495623_0019288 3300046679 Bacteria 4408
723 Ga0495646_0027624 3300046680 Bacteria 3559
724 Ga0495646_0034737 3300046680 Bacteria 3130
725 Ga0495669_0006514 3300046684 Bacteria 4881
726 Ga0495669_0087771 3300046684 Bacteria 1433
727 Ga0495624_0023400 3300046690 Bacteria 4074
728 Ga0495670_0014413 3300046691 Bacteria 3886
729 Ga0495671_0056832 3300046692 Bacteria 1937
730 Ga0495671_0151037 3300046692 Bacteria 1131
731 Ga0495649_0577965 3300046694 Bacteria 555
732 Ga0495589_0184747 3300046794 Bacteria 988
733 Ga0495600_0003192 3300046809 Bacteria 9599
734 Ga0495600_0153015 3300046809 Bacteria 1493
735 Ga0495660_0158452 3300046810 Bacteria 1112
736 Ga0495604_0001817 3300047317 Bacteria 17374
737 Ga0495604_0128306 3300047317 Bacteria 1825
738 Ga0495604_0177007 3300047317 Bacteria 1495
739 Ga0495604_0527042 3300047317 Bacteria 764
740 Ga0495636_0466618 3300047318 Bacteria 608
741 Ga0495674_0083125 3300047319 Bacteria 2745
742 Ga0495674_0137802 3300047319 Bacteria 2052
743 Ga0495674_0450322 3300047319 Bacteria 1034
744 Ga0495676_0042637 3300047321 Bacteria 3722
745 Ga0495676_0051596 3300047321 Bacteria 3289
746 Ga0495676_0703042 3300047321 Bacteria 654
747 Ga0495680_0004783 3300047322 Bacteria 12853
748 Ga0495680_0381303 3300047322 Bacteria 976
749 Ga0495683_0142882 3300047323 Bacteria 1120
750 Ga0495683_0209513 3300047323 Bacteria 875
751 Ga0495683_0210923 3300047323 Bacteria 871
752 Ga0495687_019578 3300047443 Bacteria 3317
753 Ga0495687_024634 3300047443 Bacteria 2857
754 Ga0495675_0010677 3300047444 Bacteria 5744
755 Ga0495675_0201168 3300047444 Bacteria 1212
756 Ga0495677_0033517 3300047445 Bacteria 1872
757 Ga0495673_0093296 3300047469 Bacteria 1227
758 Ga0495684_0023628 3300047471 Bacteria 4727
759 Ga0495686_0029502 3300047472 Bacteria 3568
760 Ga0495593_0101512 3300047673 Bacteria 1475
761 Ga0495602_0102240 3300048088 Bacteria 2349
762 Ga0495602_0765575 3300048088 Bacteria 651
763 Ga0495614_0380819 3300048089 Bacteria 661
764 Ga0495615_0164390 3300048090 Bacteria 668
765 Ga0496100_0070326 3300048903 Bacteria 2333
766 Ga0496100_0186968 3300048903 Bacteria 1501
767 Ga0496100_0547128 3300048903 Bacteria 895
768 Ga0496101_0020038 3300048904 Bacteria 4573
769 Ga0496101_0151979 3300048904 Bacteria 1771
770 Ga0496101_0362286 3300048904 Bacteria 1140
771 Ga0496101_0768817 3300048904 Bacteria 760
772 Ga0496101_0815985 3300048904 Bacteria 735
773 Ga0496101_0990750 3300048904 Bacteria 661
774 Ga0496101_1037073 3300048904 Bacteria 645
775 Ga0496102_0003789 3300048905 Bacteria 12786
776 Ga0496102_0027530 3300048905 Bacteria 5076
777 Ga0496102_0256476 3300048905 Bacteria 1649
778 Ga0496102_0392845 3300048905 Bacteria 1305
779 Ga0496102_0396985 3300048905 Bacteria 1297
780 Ga0496102_0802533 3300048905 Bacteria 863
781 Ga0496102_0881232 3300048905 Bacteria 817
782 Ga0496103_0192742 3300048906 Bacteria 1310
783 Ga0496103_0313741 3300048906 Bacteria 1009
784 Ga0496103_0565859 3300048906 Bacteria 725
785 Ga0496104_0002743 3300048907 Bacteria 15154
786 Ga0496104_0114217 3300048907 Bacteria 2589
787 Ga0496104_0182849 3300048907 Bacteria 2007
788 Ga0496104_0183435 3300048907 Bacteria 2003
789 Ga0496105_0056554 3300048908 Bacteria 3238
790 Ga0496105_0059798 3300048908 Bacteria 3144
791 Ga0496105_0077738 3300048908 Bacteria 2740
792 Ga0496105_0671521 3300048908 Bacteria 798
793 Ga0496106_0191605 3300048909 Bacteria 1626
794 Ga0496106_0260204 3300048909 Bacteria 1388
795 Ga0496106_0309568 3300048909 Bacteria 1267
796 Ga0496106_0555808 3300048909 Bacteria 921
797 Ga0496107_0008411 3300048910 Bacteria 7141
798 Ga0496107_0229177 3300048910 Bacteria 1382
799 Ga0496108_0025878 3300048911 Bacteria 4839
800 Ga0496108_0057500 3300048911 Bacteria 3268
801 Ga0496108_0117977 3300048911 Bacteria 2274
802 Ga0496108_1025587 3300048911 Bacteria 704
803 Ga0496109_0055881 3300048912 Bacteria 3601
804 Ga0496109_0162114 3300048912 Bacteria 2095
805 Ga0496109_0193483 3300048912 Bacteria 1911
806 Ga0496110_0023688 3300048913 Bacteria 5223
807 Ga0496110_0040385 3300048913 Bacteria 4067
808 Ga0496110_0269168 3300048913 Bacteria 1551
809 Ga0496110_0353908 3300048913 Bacteria 1338
810 Ga0496110_0456548 3300048913 Bacteria 1164
811 Ga0496110_0545844 3300048913 Bacteria 1053
812 Ga0496111_0046070 3300048914 Bacteria 3139
813 Ga0496112_0043463 3300048915 Bacteria 4399
814 Ga0496112_0205362 3300048915 Bacteria 1928
815 Ga0496112_0419759 3300048915 Bacteria 1277
816 Ga0496113_0086238 3300048916 Bacteria 2412
817 Ga0496113_0146665 3300048916 Bacteria 1860
818 Ga0496113_0203112 3300048916 Bacteria 1575
819 Ga0496113_1033424 3300048916 Bacteria 646
820 Ga0496113_1393184 3300048916 Bacteria 543
821 Ga0496114_0058730 3300048917 Bacteria 3212
822 Ga0496114_0239889 3300048917 Bacteria 1594
823 Ga0496114_0510424 3300048917 Bacteria 1063
824 Ga0496115_0001860 3300048918 Bacteria 15092
825 Ga0496115_0101186 3300048918 Bacteria 2363
826 Ga0496115_0171677 3300048918 Bacteria 1793
827 Ga0496115_0274102 3300048918 Bacteria 1386
828 Ga0496116_0105741 3300048919 Bacteria 1669
829 Ga0496116_0183721 3300048919 Bacteria 1116
830 Ga0496117_0067364 3300048920 Bacteria 2423
831 Ga0496117_0174889 3300048920 Bacteria 1241
832 Ga0496117_0258020 3300048920 Bacteria 947
833 Ga0496117_0386165 3300048920 Bacteria 711
834 Ga0496118_0037271 3300048921 Bacteria 3917
835 Ga0496118_0060898 3300048921 Bacteria 2799
836 Ga0496118_0074666 3300048921 Bacteria 2422
837 Ga0496118_0160053 3300048921 Bacteria 1394
838 Ga0496118_0205111 3300048921 Bacteria 1163
839 Ga0496119_0006768 3300048922 Bacteria 10513
840 Ga0496119_0017432 3300048922 Bacteria 5400
841 Ga0496119_0032207 3300048922 Bacteria 3498
842 Ga0496119_0142601 3300048922 Bacteria 1292
843 Ga0496119_0166289 3300048922 Bacteria 1168
844 Ga0496119_0201214 3300048922 Bacteria 1031
845 Ga0496119_0320368 3300048922 Bacteria 759
846 Ga0496119_0418230 3300048922 Bacteria 637
847 Ga0496120_0010148 3300048923 Bacteria 6597
848 Ga0496120_0211508 3300048923 Bacteria 932
849 Ga0496120_0271990 3300048923 Bacteria 787
850 Ga0496120_0318513 3300048923 Bacteria 707
851 Ga0496121_0002757 3300048924 Bacteria 26099
852 Ga0496121_0023293 3300048924 Bacteria 5969
853 Ga0496121_0058967 3300048924 Bacteria 3168
854 Ga0496121_0059811 3300048924 Bacteria 3139
855 Ga0496121_0084494 3300048924 Bacteria 2502
856 Ga0496121_0095355 3300048924 Bacteria 2312
857 Ga0496121_0123570 3300048924 Bacteria 1950
858 Ga0496121_0128251 3300048924 Bacteria 1903
859 Ga0496121_0147869 3300048924 Bacteria 1733
860 Ga0496121_0157463 3300048924 Bacteria 1665
861 Ga0496121_0180100 3300048924 Bacteria 1526
862 Ga0496121_0183767 3300048924 Bacteria 1506
863 Ga0496122_0129467 3300048925 Bacteria 1607
864 Ga0496122_0212991 3300048925 Bacteria 1117
865 Ga0496124_0094099 3300048927 Bacteria 2438
866 Ga0496124_0193650 3300048927 Bacteria 1553
867 Ga0496125_0060549 3300048928 Bacteria 3042
868 Ga0496125_0156377 3300048928 Bacteria 1557
869 Ga0496125_0184974 3300048928 Bacteria 1383
870 Ga0496126_0003081 3300048929 Bacteria 21560
871 Ga0496126_0061075 3300048929 Bacteria 3387
872 Ga0496126_0137276 3300048929 Bacteria 2108
873 Ga0496126_0177789 3300048929 Bacteria 1809
874 Ga0496126_0191942 3300048929 Bacteria 1729
875 Ga0496126_0387263 3300048929 Bacteria 1137
876 Ga0496126_0406873 3300048929 Bacteria 1102
877 Ga0496126_0423102 3300048929 Bacteria 1076
878 Ga0496126_0576429 3300048929 Bacteria 889
879 Ga0496126_0612840 3300048929 Bacteria 856
880 Ga0501031_0338979 3300049568 Bacteria 973
881 Ga0501032_0004425 3300049569 Bacteria 10596
882 Ga0501033_0000244 3300049570 Bacteria 52231
883 Ga0501033_0334289 3300049570 Bacteria 1063
884 Ga0501034_0000159 3300049571 Bacteria 127397
885 Ga0501036_0000039 3300049572 Bacteria 83065
886 Ga0501037_0000882 3300049573 Bacteria 22410
887 Ga0501038_0000207 3300049574 Bacteria 50307
888 Ga0501038_0396234 3300049574 Bacteria 1069
889 Ga0501039_0000148 3300049575 Bacteria 47789
890 Ga0501039_0378603 3300049575 Bacteria 1112
891 Ga0501040_0641337 3300049576 Bacteria 768
892 Ga0501041_0922063 3300049577 Bacteria 561
893 Ga0501042_0045184 3300049578 Bacteria 3139
894 Ga0501042_0828290 3300049578 Bacteria 674
895 Ga0501043_0001205 3300049579 Bacteria 22758
896 Ga0501046_0000185 3300049580 Bacteria 63459
897 Ga0501046_0615435 3300049580 Bacteria 770
898 Ga0501047_0000385 3300049581 Bacteria 49635
899 Ga0501047_0008133 3300049581 Bacteria 9899
900 Ga0501067_0014764 3300049583 Bacteria 4321
901 Ga0501067_0042385 3300049583 Bacteria 2527
902 Ga0501068_0000371 3300049584 Bacteria 22625
903 Ga0501070_0002140 3300049586 Bacteria 17350
904 Ga0501070_0201587 3300049586 Bacteria 1634
905 Ga0501071_0249897 3300049587 Bacteria 1338
906 Ga0501072_0008681 3300049588 Bacteria 7714
907 Ga0501073_0000702 3300049589 Bacteria 23614
908 Ga0501073_0136093 3300049589 Bacteria 1703
909 Ga0501073_0402537 3300049589 Bacteria 946
910 Ga0501074_0000271 3300049590 Bacteria 29628
911 Ga0501074_0348805 3300049590 Bacteria 1050
912 Ga0501076_0062840 3300049592 Bacteria 2958
913 Ga0501079_0004349 3300049741 Bacteria 10513
914 Ga0501080_0000380 3300049742 Bacteria 34213
915 Ga0501080_0091806 3300049742 Bacteria 2820
916 Ga0501080_0310700 3300049742 Bacteria 1429
917 Ga0501081_0087849 3300049743 Bacteria 2184
918 Ga0501083_0000118 3300049744 Bacteria 54096
919 Ga0501035_0004827 3300049822 Bacteria 12783
920 Ga0501035_1248499 3300049822 Bacteria 575
921 Ga0501044_0000548 3300049823 Bacteria 45787
922 Ga0501044_0228722 3300049823 Bacteria 1808
923 Ga0501045_0003030 3300049824 Bacteria 11490
924 Ga0501045_0385189 3300049824 Bacteria 1044
925 nmdc:mga03683_137063_c1 3300050489 Bacteria 1098
926 nmdc:mga03683_173532_c1 3300050489 Bacteria 980
927 nmdc:mga03683_303422_c1 3300050489 Bacteria 749
928 nmdc:mga03n38_1290_c1 3300050490 Bacteria 7063
929 nmdc:mga03n38_245415_c1 3300050490 Bacteria 944
930 nmdc:mga03n38_886703_c1 3300050490 Bacteria 523
931 nmdc:mga00v17_165893_c1 3300050491 Bacteria 1423
932 nmdc:mga00v17_6086_c1 3300050491 Bacteria 6385
933 nmdc:mga0yw44_23704_c1 3300050492 Bacteria 3462
934 nmdc:mga0k408_110415_c1 3300050493 Bacteria 1625
935 nmdc:mga0k408_155257_c1 3300050493 Bacteria 1363
936 nmdc:mga0k408_71243_c1 3300050493 Bacteria 2029
937 nmdc:mga06z11_1024452_c1 3300050494 Bacteria 503
938 nmdc:mga06z11_23163_c1 3300050494 Bacteria 2913
939 nmdc:mga06z11_2462_c1 3300050494 Bacteria 7073
940 nmdc:mga06z11_374356_c1 3300050494 Bacteria 855
941 nmdc:mga06z11_64701_c1 3300050494 Bacteria 1918
942 nmdc:mga06z11_94254_c1 3300050494 Bacteria 1631
943 nmdc:mga04h51_119879_c1 3300050495 Bacteria 979
944 nmdc:mga04h51_36991_c1 3300050495 Bacteria 1574
945 nmdc:mga07m45_11812_c1 3300050496 Bacteria 3015
946 nmdc:mga07m45_384521_c1 3300050496 Bacteria 815
947 nmdc:mga07m45_92163_c1 3300050496 Bacteria 1737
948 nmdc:mga06r32_654631_c1 3300050510 Bacteria 1018
949 nmdc:mga08y16_675762_c1 3300050511 Bacteria 1034
950 nmdc:mga08y16_831057_c1 3300050511 Bacteria 914
951 nmdc:mga0sz30_28757_c1 3300050516 Bacteria 2288
952 nmdc:mga0sz30_408240_c1 3300050516 Bacteria 609
953 nmdc:mga0sz30_64875_c1 3300050516 Bacteria 1565
954 Ga0495601_0404170 3300053077 Bacteria 885
955 Ga0495612_0013169 3300053078 Bacteria 3331
956 Ga0495612_0046079 3300053078 Bacteria 1785
957 Ga0500635_0076503 3300053080 Bacteria 1196
958 Ga0500635_0150850 3300053080 Bacteria 887
959 Ga0495595_0014623 3300053084 Bacteria 3333
960 Ga0495619_0113450 3300053085 Bacteria 1853
961 Ga0495619_0162170 3300053085 Bacteria 1544
962 Ga0495619_1105612 3300053085 Bacteria 527
963 Ga0500643_000057 3300053087 Bacteria 131401
964 Ga0500647_0016425 3300053091 Bacteria 3401
965 Ga0500647_0096086 3300053091 Bacteria 1417
966 Ga0500651_0264840 3300053093 Bacteria 995
967 Ga0500651_0664090 3300053093 Bacteria 560
968 Ga0500566_0000239 3300053094 Bacteria 29379
969 Ga0500566_0001729 3300053094 Bacteria 12815
970 Ga0500640_032259 3300053095 Bacteria 2299
971 Ga0500640_110454 3300053095 Bacteria 1120
972 Ga0500648_242341 3300053097 Bacteria 858
973 Ga0500554_049782 3300053102 Bacteria 1315
974 Ga0500554_198972 3300053102 Bacteria 671
975 Ga0500555_005133 3300053103 Bacteria 3713
976 Ga0500555_172903 3300053103 Bacteria 524
977 Ga0500569_013364 3300053109 Bacteria 2008
978 Ga0500572_002004 3300053111 Bacteria 5076
979 Ga0500572_012619 3300053111 Bacteria 2074
980 Ga0500594_0108397 3300053118 Bacteria 862
981 Ga0500595_000393 3300053119 Bacteria 28109
982 Ga0500595_142504 3300053119 Bacteria 671
983 Ga0500595_156500 3300053119 Bacteria 635
984 Ga0500608_010552 3300053122 Bacteria 3970
985 Ga0500608_045010 3300053122 Bacteria 2120
986 Ga0500608_105888 3300053122 Bacteria 1296
987 Ga0500614_294736 3300053123 Bacteria 509
988 Ga0500655_125919 3300053133 Bacteria 545
989 Ga0500658_0147378 3300053134 Bacteria 1059
990 Ga0500658_0353272 3300053134 Bacteria 674
991 Ga0500658_0555643 3300053134 Bacteria 516
992 Ga0500559_0003940 3300053136 Bacteria 7167
993 Ga0500568_0046269 3300053139 Bacteria 1728
994 Ga0500577_0000303 3300053142 Bacteria 12770
995 Ga0500577_0117604 3300053142 Bacteria 1103
996 Ga0500585_125611 3300053144 Bacteria 912
997 Ga0500590_042653 3300053148 Bacteria 2329
998 Ga0500603_001096 3300053150 Bacteria 6338
999 Ga0500603_002048 3300053150 Bacteria 4454
1000 Ga0500630_003788 3300053159 Bacteria 7331
1001 Ga0500634_0221373 3300053161 Bacteria 812
1002 Ga0500638_025857 3300053162 Bacteria 2809
1003 Ga0500638_049719 3300053162 Bacteria 2028
1004 Ga0500639_000076 3300053163 Bacteria 45936
1005 Ga0500639_111425 3300053163 Bacteria 1331
1006 Ga0500639_178358 3300053163 Bacteria 943
1007 Ga0500636_0004999 3300053177 Bacteria 7525
1008 Ga0500636_0045048 3300053177 Bacteria 2602
1009 Ga0500636_0227094 3300053177 Bacteria 968
1010 Ga0500636_0385937 3300053177 Bacteria 655
1011 Ga0500636_0489122 3300053177 Bacteria 546
1012 Ga0500637_0222349 3300053178 Bacteria 1066
1013 Ga0500625_007215 3300053729 Bacteria 4810
1014 Ga0500645_073882 3300053730 Bacteria 977
1015 Ga0500596_003456 3300053735 Bacteria 3001
1016 Ga0500601_001060 3300053737 Bacteria 3119
1017 Ga0500601_003860 3300053737 Bacteria 1628
1018 Ga0500601_014325 3300053737 Bacteria 900
1019 Ga0501084_0002995 3300054114 Bacteria 13676
1020 Ga0500661_006131 3300055283 Bacteria 2242
1021 Ga0501082_0000570 3300060353 Bacteria 32833
1022 Ga0466962_0027977 3300061719 Bacteria 2702
1023 Ga0530510_0606541 3300061734 Bacteria 833

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046491 Ga0495584_0008011 Ga0495584_0008011_1727_2179 134
2 3300053134 Ga0500658_0555643 Ga0500658_0555643_37_489 134
3 3300046507 Ga0495606_0364706 Ga0495606_0364706_254_733 136
4 3300009093 Ga0105240_10022867 Ga0105240_100228678 139
5 3300009098 Ga0105245_10188078 Ga0105245_101880783 139
6 3300009174 Ga0105241_10088821 Ga0105241_100888213 139
7 3300009545 Ga0105237_10009071 Ga0105237_100090718 139
8 3300010375 Ga0105239_10132157 Ga0105239_101321574 139
9 3300033180 Ga0307510_10129962 Ga0307510_101299621 142
10 3300006028 Ga0070717_10817020 Ga0070717_108170201 143
11 3300007265 Ga0099794_10009322 Ga0099794_100093221 143
12 3300025923 Ga0207681_10700819 Ga0207681_107008192 143
13 3300035119 Ga0373956_0015101 Ga0373956_0015101_1520_1963 143
14 3300035170 Ga0373943_0331101 Ga0373943_0331101_114_554 143
15 3300035725 Ga0373947_0012045 Ga0373947_0012045_3063_3503 143
16 3300037068 Ga0373925_0161231 Ga0373925_0161231_1307_1747 143
17 3300041453 Ga0451797_1383401 Ga0451797_1383401_44_490 143
18 3300046454 Ga0495592_0541897 Ga0495592_0541897_183_629 143
19 3300046454 Ga0495592_0786439 Ga0495592_0786439_78_518 143
20 3300046459 Ga0495629_0333446 Ga0495629_0333446_358_798 143
21 3300046517 Ga0495630_0308180 Ga0495630_0308180_341_781 143
22 3300046543 Ga0495645_0447610 Ga0495645_0447610_156_596 143
23 3300046559 Ga0495667_0156617 Ga0495667_0156617_478_918 143
24 3300046663 Ga0495635_0313893 Ga0495635_0313893_525_965 143
25 3300046675 Ga0495657_0109153 Ga0495657_0109153_994_1434 143
26 3300046678 Ga0495599_0315254 Ga0495599_0315254_219_659 143
27 3300046680 Ga0495646_0034737 Ga0495646_0034737_1466_1912 143
28 3300047319 Ga0495674_0450322 Ga0495674_0450322_76_516 143
29 3300048088 Ga0495602_0765575 Ga0495602_0765575_144_584 143
30 iso_pu_bacteria 2885383462 2885389723 143
31 3300005435 Ga0070714_100021753 Ga0070714_1000217535 144
32 3300005436 Ga0070713_100040796 Ga0070713_1000407962 144
33 3300009176 Ga0105242_11755633 Ga0105242_117556331 144
34 3300011119 Ga0105246_10639571 Ga0105246_106395712 144
35 3300012495 Ga0157323_1032919 Ga0157323_10329191 144
36 3300013104 Ga0157370_11714495 Ga0157370_117144951 144
37 3300014325 Ga0163163_10352379 Ga0163163_103523791 144
38 3300025928 Ga0207700_10049919 Ga0207700_100499194 144
39 3300035089 Ga0373944_0084400 Ga0373944_0084400_107_553 144
40 3300035118 Ga0373954_0037873 Ga0373954_0037873_1408_1854 144
41 3300035119 Ga0373956_0075670 Ga0373956_0075670_943_1389 144
42 3300035170 Ga0373943_0322188 Ga0373943_0322188_58_504 144
43 3300035172 Ga0373955_0001316 Ga0373955_0001316_10021_10467 144
44 3300035410 Ga0373924_0311726 Ga0373924_0311726_75_521 144
45 3300035691 Ga0373931_0256809 Ga0373931_0256809_458_892 144
46 3300035724 Ga0373933_0140708 Ga0373933_0140708_518_964 144
47 3300035725 Ga0373947_0671894 Ga0373947_0671894_136_582 144
48 3300036401 Ga0373937_0307671 Ga0373937_0307671_410_856 144
49 3300037068 Ga0373925_0015018 Ga0373925_0015018_581_1027 144
50 3300037853 Ga0436364_0882487 Ga0436364_0882487_701_1135 144
51 3300039437 Ga0436365_1797166 Ga0436365_1797166_2304_2738 144
52 3300041463 Ga0451804_0414830 Ga0451804_0414830_804_1238 144
53 3300044735 Ga0466968_0534909 Ga0466968_0534909_142_576 144
54 3300046454 Ga0495592_0178672 Ga0495592_0178672_842_1288 144
55 3300046460 Ga0495638_0171184 Ga0495638_0171184_553_987 144
56 3300046462 Ga0495651_0294311 Ga0495651_0294311_524_970 144
57 3300046473 Ga0495582_0035455 Ga0495582_0035455_1930_2376 144
58 3300046475 Ga0495639_0017275 Ga0495639_0017275_1171_1617 144
59 3300046477 Ga0495664_0005611 Ga0495664_0005611_2918_3364 144
60 3300046500 Ga0495596_0255726 Ga0495596_0255726_199_633 144
61 3300046516 Ga0495628_0145485 Ga0495628_0145485_1351_1797 144
62 3300046517 Ga0495630_0061491 Ga0495630_0061491_711_1157 144
63 3300046524 Ga0495648_0002468 Ga0495648_0002468_7814_8251 144
64 3300046531 Ga0495665_0117142 Ga0495665_0117142_708_1154 144
65 3300046536 Ga0495587_0191209 Ga0495587_0191209_642_1088 144
66 3300046543 Ga0495645_0229171 Ga0495645_0229171_749_1195 144
67 3300046558 Ga0495633_0059593 Ga0495633_0059593_444_878 144
68 3300046559 Ga0495667_0219659 Ga0495667_0219659_158_604 144
69 3300046615 Ga0495656_0204232 Ga0495656_0204232_193_627 144
70 3300046616 Ga0495668_0245080 Ga0495668_0245080_62_496 144
71 3300046663 Ga0495635_0080378 Ga0495635_0080378_399_845 144
72 3300046675 Ga0495657_0122415 Ga0495657_0122415_232_678 144
73 3300046675 Ga0495657_0382005 Ga0495657_0382005_226_672 144
74 3300046678 Ga0495599_0205791 Ga0495599_0205791_300_746 144
75 3300046690 Ga0495624_0023400 Ga0495624_0023400_818_1264 144
76 3300046694 Ga0495649_0577965 Ga0495649_0577965_109_543 144
77 3300046794 Ga0495589_0184747 Ga0495589_0184747_464_898 144
78 3300047319 Ga0495674_0137802 Ga0495674_0137802_463_909 144
79 3300047322 Ga0495680_0381303 Ga0495680_0381303_268_714 144
80 3300047444 Ga0495675_0201168 Ga0495675_0201168_560_1006 144
81 3300047471 Ga0495684_0023628 Ga0495684_0023628_1066_1512 144
82 3300048090 Ga0495615_0164390 Ga0495615_0164390_177_611 144
83 3300048903 Ga0496100_0547128 Ga0496100_0547128_40_474 144
84 3300048904 Ga0496101_0768817 Ga0496101_0768817_59_493 144
85 3300048911 Ga0496108_1025587 Ga0496108_1025587_90_524 144
86 3300048919 Ga0496116_0105741 Ga0496116_0105741_766_1200 144
87 3300048920 Ga0496117_0067364 Ga0496117_0067364_809_1243 144
88 3300048921 Ga0496118_0037271 Ga0496118_0037271_2325_2759 144
89 3300048922 Ga0496119_0166289 Ga0496119_0166289_648_1082 144
90 3300048924 Ga0496121_0023293 Ga0496121_0023293_4090_4524 144
91 3300048929 Ga0496126_0137276 Ga0496126_0137276_274_708 144
92 3300049570 Ga0501033_0334289 Ga0501033_0334289_226_660 144
93 3300049575 Ga0501039_0378603 Ga0501039_0378603_609_1043 144
94 3300049576 Ga0501040_0641337 Ga0501040_0641337_41_475 144
95 3300049580 Ga0501046_0615435 Ga0501046_0615435_54_488 144
96 3300049581 Ga0501047_0008133 Ga0501047_0008133_9166_9600 144
97 3300049586 Ga0501070_0201587 Ga0501070_0201587_205_639 144
98 3300049589 Ga0501073_0136093 Ga0501073_0136093_627_1061 144
99 3300049590 Ga0501074_0348805 Ga0501074_0348805_11_445 144
100 3300049742 Ga0501080_0091806 Ga0501080_0091806_1439_1873 144
101 3300049742 Ga0501080_0310700 Ga0501080_0310700_700_1134 144
102 3300049823 Ga0501044_0228722 Ga0501044_0228722_505_939 144
103 3300053078 Ga0495612_0013169 Ga0495612_0013169_566_1012 144
104 3300053078 Ga0495612_0046079 Ga0495612_0046079_202_648 144
105 3300053084 Ga0495595_0014623 Ga0495595_0014623_2040_2486 144
106 3300053085 Ga0495619_0162170 Ga0495619_0162170_389_835 144
107 3300053087 Ga0500643_000057 Ga0500643_000057_130761_131195 144
108 3300053093 Ga0500651_0264840 Ga0500651_0264840_455_904 144
109 3300053103 Ga0500555_172903 Ga0500555_172903_33_482 144
110 3300053134 Ga0500658_0353272 Ga0500658_0353272_129_578 144
111 iso_pu_bacteria 2513237137 2513861430 144
112 iso_pu_bacteria 2513237145 2513915800 144
113 iso_pu_bacteria 2524023210 2524466585 144
114 iso_pu_bacteria 2667528175 2671123004 144
115 iso_pu_bacteria 2791355197 2793071991 144
116 iso_pu_bacteria 2885374607 2885383105 144
117 iso_pu_bacteria 2903748898 2903756571 144
118 iso_pu_bacteria 2903768456 2903769756 144
119 iso_pu_bacteria 2904699407 2904706150 144
120 iso_pu_bacteria 2906660503 2906660647 144
121 iso_pu_bacteria 2935630451 2935632337 144
122 iso_pu_bacteria 2941507105 2941508284 144
123 iso_pu_bacteria 2941515067 2941515210 144
124 iso_pu_bacteria 2941523033 2941524215 144
125 iso_pu_bacteria 3005474847 3005477431 144
126 iso_pu_bacteria 3005483717 3005487505 144
127 iso_pu_bacteria 8006933436 8006933804 144
128 iso_pu_bacteria 8006973647 8006983476 144
129 3300032002 Ga0307416_100230256 Ga0307416_1002302562 145
130 3300046511 Ga0495608_0271971 Ga0495608_0271971_199_648 145
131 3300050510 nmdc:mga06r32_654631_c1 nmdc:mga06r32_654631_c1_13_474 145
132 3300050511 nmdc:mga08y16_831057_c1 nmdc:mga08y16_831057_c1_219_671 145
133 iso_pu_bacteria 2507262055 2507511169 145
134 iso_pu_bacteria 2508501009 2508544978 145
135 iso_pu_bacteria 2508501042 2508693714 145
136 iso_pu_bacteria 2511231028 2511396510 145
137 iso_pu_bacteria 2513237094 2513637322 145
138 iso_pu_bacteria 2513237095 2513650882 145
139 iso_pu_bacteria 2513237101 2513693388 145
140 iso_pu_bacteria 2513237102 2513700471 145
141 iso_pu_bacteria 2513237139 2513874791 145
142 iso_pu_bacteria 2513237161 2514010491 145
143 iso_pu_bacteria 2515154112 2515625265 145
144 iso_pu_bacteria 2517093001 2517100740 145
145 iso_pu_bacteria 2617270735 2617353565 145
146 iso_pu_bacteria 2617270741 2617373290 145
147 iso_pu_bacteria 2744054633 2745080996 145
148 iso_pu_bacteria 2791355196 2793061893 145
149 iso_pu_bacteria 2802429603 2805916792 145
150 iso_pu_bacteria 2816332527 2818238304 145
151 iso_pu_bacteria 2824600985 2824603983 145
152 iso_pu_bacteria 2824609381 2824611564 145
153 iso_pu_bacteria 2824617872 2824622472 145
154 iso_pu_bacteria 2824626560 2824630348 145
155 iso_pu_bacteria 2824635225 2824638324 145
156 iso_pu_bacteria 2824644064 2824645938 145
157 iso_pu_bacteria 2824653114 2824655412 145
158 iso_pu_bacteria 2824679649 2824680926 145
159 iso_pu_bacteria 2824696289 2824701265 145
160 iso_pu_bacteria 2824714736 2824716059 145
161 iso_pu_bacteria 2824723954 2824725915 145
162 iso_pu_bacteria 2824732956 2824734730 145
163 iso_pu_bacteria 2824746037 2824747697 145
164 iso_pu_bacteria 2824753945 2824754595 145
165 iso_pu_bacteria 2824763712 2824765359 145
166 iso_pu_bacteria 2824773399 2824773458 145
167 iso_pu_bacteria 2838122688 2838128038 145
168 iso_pu_bacteria 2841941048 2841943335 145
169 iso_pu_bacteria 2841949485 2841953936 145
170 iso_pu_bacteria 2841957949 2841962031 145
171 iso_pu_bacteria 2841966195 2841968029 145
172 iso_pu_bacteria 2841974524 2841981283 145
173 iso_pu_bacteria 2841983080 2841988134 145
174 iso_pu_bacteria 2842038055 2842042558 145
175 iso_pu_bacteria 2842045827 2842050601 145
176 iso_pu_bacteria 2844315083 2844316763 145
177 iso_pu_bacteria 2847930680 2847938709 145
178 iso_pu_bacteria 2847939898 2847944093 145
179 iso_pu_bacteria 2857509624 2857512334 145
180 iso_pu_bacteria 2874590934 2874597903 145
181 iso_pu_bacteria 2874604998 2874607485 145
182 iso_pu_bacteria 2874620515 2874626182 145
183 iso_pu_bacteria 2874628541 2874631380 145
184 iso_pu_bacteria 2874645413 2874651431 145
185 iso_pu_bacteria 2876771140 2876776503 145
186 iso_pu_bacteria 2876808645 2876816294 145
187 iso_pu_bacteria 2876818435 2876824907 145
188 iso_pu_bacteria 2879074833 2879081634 145
189 iso_pu_bacteria 2879110137 2879111030 145
190 iso_pu_bacteria 2881364244 2881365940 145
191 iso_pu_bacteria 2885366525 2885366790 145
192 iso_pu_bacteria 2885409591 2885415876 145
193 iso_pu_bacteria 2888378607 2888381372 145
194 iso_pu_bacteria 2888388044 2888389266 145
195 iso_pu_bacteria 2903727486 2903733818 145
196 iso_pu_bacteria 2904666416 2904669200 145
197 iso_pu_bacteria 2904711408 2904719396 145
198 iso_pu_bacteria 2906602504 2906606755 145
199 iso_pu_bacteria 2906626472 2906627481 145
200 iso_pu_bacteria 2908775508 2908781748 145
201 iso_pu_bacteria 2922393267 2922401152 145
202 iso_pu_bacteria 2922425934 2922427716 145
203 iso_pu_bacteria 2935648319 2935653501 145
204 iso_pu_bacteria 2935656913 2935662250 145
205 iso_pu_bacteria 2935777560 2935785269 145
206 iso_pu_bacteria 2935908558 2935912086 145
207 iso_pu_bacteria 2935916978 2935922297 145
208 iso_pu_bacteria 2935926038 2935929115 145
209 iso_pu_bacteria 2935934488 2935935746 145
210 iso_pu_bacteria 2935942939 2935947312 145
211 iso_pu_bacteria 2935951376 2935953594 145
212 iso_pu_bacteria 2935959822 2935961894 145
213 iso_pu_bacteria 2935967501 2935968620 145
214 iso_pu_bacteria 2935975950 2935976802 145
215 iso_pu_bacteria 2935984226 2935992110 145
216 iso_pu_bacteria 2936011229 2936016552 145
217 iso_pu_bacteria 2936019824 2936025134 145
218 iso_pu_bacteria 2936028420 2936034027 145
219 iso_pu_bacteria 2936046547 2936052033 145
220 iso_pu_bacteria 2936055302 2936059806 145
221 iso_pu_bacteria 3005506211 3005511367 145
222 iso_pu_bacteria 3005587118 3005592932 145
223 iso_pu_bacteria 3005594810 3005596372 145
224 iso_pu_bacteria 3005710791 3005712454 145
225 iso_pu_bacteria 3005718088 3005719528 145
226 iso_pu_bacteria 8006926726 8006930132 145
227 iso_pu_bacteria 8016583857 8016588931 145
228 iso_pu_bacteria 8016613128 8016620490 145
229 iso_pu_bacteria 8016630954 8016637904 145
230 iso_pu_bacteria 8019538911 8019538931 145
231 iso_pu_bacteria 8019565922 8019569840 145
232 iso_pu_bacteria 8019619141 8019624972 145
233 iso_pu_bacteria 8019629233 8019637209 145
234 iso_pu_bacteria 8019638758 8019642381 145
235 iso_pu_bacteria 8019648815 8019650198 145
236 iso_pu_bacteria 8019687851 8019694284 145
237 iso_pu_bacteria 8056967851 8056973577 145
238 3300005434 Ga0070709_10017852 Ga0070709_100178524 146
239 3300005434 Ga0070709_10731884 Ga0070709_107318841 146
240 3300005436 Ga0070713_100027751 Ga0070713_1000277511 146
241 3300005437 Ga0070710_10000509 Ga0070710_1000050912 146
242 3300006028 Ga0070717_11278861 Ga0070717_112788611 146
243 3300006163 Ga0070715_10135225 Ga0070715_101352252 146
244 3300006175 Ga0070712_100822714 Ga0070712_1008227141 146
245 3300025906 Ga0207699_10047079 Ga0207699_100470792 146
246 3300025906 Ga0207699_10629452 Ga0207699_106294522 146
247 3300025915 Ga0207693_10073082 Ga0207693_100730822 146
248 3300031247 Ga0265340_10001728 Ga0265340_1000172811 146
249 3300031249 Ga0265339_10002990 Ga0265339_100029904 146
250 3300031250 Ga0265331_10019457 Ga0265331_100194574 146
251 3300031711 Ga0265314_10057154 Ga0265314_100571543 146
252 3300031712 Ga0265342_10000444 Ga0265342_1000044414 146
253 3300025254 Ga0209148_1008346 Ga0209148_10083462 147
254 3300025272 Ga0209455_1007598 Ga0209455_10075982 147
255 3300025900 Ga0207710_10131988 Ga0207710_101319882 147
256 3300031344 Ga0265316_10334795 Ga0265316_103347952 147
257 3300031730 Ga0307516_10005798 Ga0307516_100057984 147
258 3300035695 Ga0373927_1178075 Ga0373927_1178075_33_491 147
259 3300039450 Ga0436363_0134632 Ga0436363_0134632_388_834 147
260 3300046462 Ga0495651_0206179 Ga0495651_0206179_625_1086 147
261 3300046477 Ga0495664_0224520 Ga0495664_0224520_374_835 147
262 3300046559 Ga0495667_0179609 Ga0495667_0179609_706_1167 147
263 3300046675 Ga0495657_0272849 Ga0495657_0272849_346_807 147
264 3300046809 Ga0495600_0153015 Ga0495600_0153015_275_736 147
265 3300048922 Ga0496119_0418230 Ga0496119_0418230_126_569 147
266 3300048923 Ga0496120_0211508 Ga0496120_0211508_48_491 147
267 3300048924 Ga0496121_0123570 Ga0496121_0123570_450_893 147
268 3300048929 Ga0496126_0406873 Ga0496126_0406873_160_603 147
269 3300005327 Ga0070658_10212875 Ga0070658_102128752 148
270 3300005336 Ga0070680_100047508 Ga0070680_1000475082 148
271 3300005344 Ga0070661_101084222 Ga0070661_1010842222 148
272 3300005434 Ga0070709_10007376 Ga0070709_100073763 148
273 3300005434 Ga0070709_10294047 Ga0070709_102940472 148
274 3300005435 Ga0070714_100980272 Ga0070714_1009802722 148
275 3300005436 Ga0070713_100025767 Ga0070713_1000257674 148
276 3300005437 Ga0070710_10037161 Ga0070710_100371613 148
277 3300005439 Ga0070711_100007654 Ga0070711_1000076545 148
278 3300005458 Ga0070681_10131917 Ga0070681_101319171 148
279 3300005518 Ga0070699_100122767 Ga0070699_1001227674 148
280 3300005530 Ga0070679_100048075 Ga0070679_1000480752 148
281 3300005539 Ga0068853_100132768 Ga0068853_1001327682 148
282 3300005543 Ga0070672_102022741 Ga0070672_1020227411 148
283 3300005547 Ga0070693_100735925 Ga0070693_1007359252 148
284 3300005563 Ga0068855_100008246 Ga0068855_1000082469 148
285 3300005937 Ga0081455_10002888 Ga0081455_100028886 148
286 3300006163 Ga0070715_10043635 Ga0070715_100436352 148
287 3300006173 Ga0070716_100049801 Ga0070716_1000498013 148
288 3300006173 Ga0070716_100072066 Ga0070716_1000720662 148
289 3300006175 Ga0070712_100004995 Ga0070712_1000049952 148
290 3300006942 Ga0099824_1009392 Ga0099824_10093928 148
291 3300006943 Ga0099822_1000514 Ga0099822_100051419 148
292 3300009093 Ga0105240_10233840 Ga0105240_102338403 148
293 3300009545 Ga0105237_10205488 Ga0105237_102054882 148
294 3300010375 Ga0105239_10568477 Ga0105239_105684772 148
295 3300013104 Ga0157370_10067944 Ga0157370_100679443 148
296 3300013104 Ga0157370_10208636 Ga0157370_102086363 148
297 3300013105 Ga0157369_10630778 Ga0157369_106307782 148
298 3300013105 Ga0157369_10640261 Ga0157369_106402611 148
299 3300025906 Ga0207699_10042139 Ga0207699_100421391 148
300 3300025906 Ga0207699_10448861 Ga0207699_104488612 148
301 3300025909 Ga0207705_10063754 Ga0207705_100637542 148
302 3300025910 Ga0207684_10264942 Ga0207684_102649422 148
303 3300025912 Ga0207707_11034968 Ga0207707_110349681 148
304 3300025913 Ga0207695_10419804 Ga0207695_104198042 148
305 3300025915 Ga0207693_10002721 Ga0207693_100027213 148
306 3300025917 Ga0207660_10046176 Ga0207660_100461762 148
307 3300025928 Ga0207700_10034721 Ga0207700_100347212 148
308 3300025928 Ga0207700_11377182 Ga0207700_113771821 148
309 3300025929 Ga0207664_10005551 Ga0207664_100055517 148
310 3300025932 Ga0207690_10583846 Ga0207690_105838461 148
311 3300025939 Ga0207665_10044199 Ga0207665_100441993 148
312 3300025939 Ga0207665_10158096 Ga0207665_101580962 148
313 3300025949 Ga0207667_10024730 Ga0207667_100247301 148
314 3300026067 Ga0207678_10432481 Ga0207678_104324811 148
315 3300027357 Ga0209589_1000007 Ga0209589_100000733 148
316 3300027361 Ga0209489_100008 Ga0209489_10000833 148
317 3300027363 Ga0209700_100009 Ga0209700_10000933 148
318 3300031548 Ga0307408_100660726 Ga0307408_1006607262 148
319 3300031731 Ga0307405_10299483 Ga0307405_102994832 148
320 3300031824 Ga0307413_10136694 Ga0307413_101366942 148
321 3300031903 Ga0307407_10193574 Ga0307407_101935742 148
322 3300031911 Ga0307412_10558885 Ga0307412_105588852 148
323 3300031995 Ga0307409_100377484 Ga0307409_1003774842 148
324 3300032002 Ga0307416_100041830 Ga0307416_1000418302 148
325 3300032004 Ga0307414_10335122 Ga0307414_103351222 148
326 3300032005 Ga0307411_10053188 Ga0307411_100531884 148
327 3300035113 Ga0373936_0017211 Ga0373936_0017211_887_1384 148
328 3300035113 Ga0373936_0098441 Ga0373936_0098441_398_847 148
329 3300035171 Ga0373946_0461348 Ga0373946_0461348_85_540 148
330 3300035695 Ga0373927_0158701 Ga0373927_0158701_329_784 148
331 3300041486 Ga0451807_1542365 Ga0451807_1542365_318_764 148
332 3300041509 Ga0451843_1086481 Ga0451843_1086481_232_678 148
333 3300044656 Ga0466969_0043185 Ga0466969_0043185_579_1025 148
334 3300044694 Ga0466963_0992467 Ga0466963_0992467_18_479 148
335 3300044765 Ga0466970_0405278 Ga0466970_0405278_287_733 148
336 3300045049 Ga0466959_0248511 Ga0466959_0248511_600_1046 148
337 3300048905 Ga0496102_0392845 Ga0496102_0392845_766_1212 148
338 3300048909 Ga0496106_0191605 Ga0496106_0191605_700_1146 148
339 3300048922 Ga0496119_0201214 Ga0496119_0201214_28_477 148
340 3300048924 Ga0496121_0128251 Ga0496121_0128251_301_747 148
341 3300048924 Ga0496121_0180100 Ga0496121_0180100_748_1194 148
342 3300048929 Ga0496126_0061075 Ga0496126_0061075_1109_1615 148
343 3300048929 Ga0496126_0387263 Ga0496126_0387263_429_878 148
344 3300048929 Ga0496126_0612840 Ga0496126_0612840_316_762 148
345 3300049568 Ga0501031_0338979 Ga0501031_0338979_20_541 148
346 3300049569 Ga0501032_0004425 Ga0501032_0004425_2505_3026 148
347 3300049570 Ga0501033_0000244 Ga0501033_0000244_30939_31460 148
348 3300049571 Ga0501034_0000159 Ga0501034_0000159_20772_21293 148
349 3300049572 Ga0501036_0000039 Ga0501036_0000039_21805_22326 148
350 3300049573 Ga0501037_0000882 Ga0501037_0000882_13058_13579 148
351 3300049574 Ga0501038_0000207 Ga0501038_0000207_41841_42362 148
352 3300049575 Ga0501039_0000148 Ga0501039_0000148_45119_45640 148
353 3300049578 Ga0501042_0045184 Ga0501042_0045184_991_1512 148
354 3300049579 Ga0501043_0001205 Ga0501043_0001205_16549_17070 148
355 3300049580 Ga0501046_0000185 Ga0501046_0000185_39981_40502 148
356 3300049581 Ga0501047_0000385 Ga0501047_0000385_28343_28864 148
357 3300049583 Ga0501067_0014764 Ga0501067_0014764_2188_2709 148
358 3300049583 Ga0501067_0042385 Ga0501067_0042385_1911_2369 148
359 3300049584 Ga0501068_0000371 Ga0501068_0000371_8915_9436 148
360 3300049586 Ga0501070_0002140 Ga0501070_0002140_11302_11823 148
361 3300049587 Ga0501071_0249897 Ga0501071_0249897_346_867 148
362 3300049588 Ga0501072_0008681 Ga0501072_0008681_1349_1870 148
363 3300049589 Ga0501073_0000702 Ga0501073_0000702_20106_20627 148
364 3300049590 Ga0501074_0000271 Ga0501074_0000271_68_589 148
365 3300049741 Ga0501079_0004349 Ga0501079_0004349_5926_6447 148
366 3300049742 Ga0501080_0000380 Ga0501080_0000380_13459_13980 148
367 3300049743 Ga0501081_0087849 Ga0501081_0087849_310_831 148
368 3300049744 Ga0501083_0000118 Ga0501083_0000118_5048_5569 148
369 3300049822 Ga0501035_0004827 Ga0501035_0004827_11169_11690 148
370 3300049823 Ga0501044_0000548 Ga0501044_0000548_16797_17318 148
371 3300049824 Ga0501045_0003030 Ga0501045_0003030_469_990 148
372 3300053080 Ga0500635_0076503 Ga0500635_0076503_16_465 148
373 3300053091 Ga0500647_0096086 Ga0500647_0096086_491_940 148
374 3300053094 Ga0500566_0000239 Ga0500566_0000239_23311_23760 148
375 3300053095 Ga0500640_032259 Ga0500640_032259_658_1107 148
376 3300053111 Ga0500572_002004 Ga0500572_002004_2208_2657 148
377 3300053122 Ga0500608_010552 Ga0500608_010552_1761_2210 148
378 3300053136 Ga0500559_0003940 Ga0500559_0003940_4767_5216 148
379 3300053144 Ga0500585_125611 Ga0500585_125611_296_745 148
380 3300053148 Ga0500590_042653 Ga0500590_042653_1763_2212 148
381 3300053150 Ga0500603_002048 Ga0500603_002048_1814_2263 148
382 3300053159 Ga0500630_003788 Ga0500630_003788_4745_5194 148
383 3300053162 Ga0500638_049719 Ga0500638_049719_1126_1575 148
384 3300053163 Ga0500639_000076 Ga0500639_000076_33580_34029 148
385 3300053177 Ga0500636_0227094 Ga0500636_0227094_370_819 148
386 3300053735 Ga0500596_003456 Ga0500596_003456_407_856 148
387 3300053737 Ga0500601_003860 Ga0500601_003860_809_1258 148
388 3300054114 Ga0501084_0002995 Ga0501084_0002995_1815_2336 148
389 3300060353 Ga0501082_0000570 Ga0501082_0000570_20775_21296 148
390 3300001904 JGI24736J21556_1021087 JGI24736J21556_10210871 149
391 3300001989 JGI24739J22299_10146617 JGI24739J22299_101466172 149
392 3300003214 JGI25165J46597_1012230 JGI25165J46597_10122302 149
393 3300003214 JGI25165J46597_1026221 JGI25165J46597_10262211 149
394 3300003215 JGI25153J46596_10002319 JGI25153J46596_100023196 149
395 3300003215 JGI25153J46596_10009452 JGI25153J46596_100094526 149
396 3300003215 JGI25153J46596_10015838 JGI25153J46596_100158385 149
397 3300003215 JGI25153J46596_10079426 JGI25153J46596_100794261 149
398 3300003354 JGI25160J50197_1002079 JGI25160J50197_10020797 149
399 3300003354 JGI25160J50197_1003509 JGI25160J50197_10035094 149
400 3300003794 Ga0055531_10010256 Ga0055531_100102564 149
401 3300004625 Ga0055543_1003926 Ga0055543_10039266 149
402 3300005262 Ga0065165_1001577 Ga0065165_100157720 149
403 3300005262 Ga0065165_1003271 Ga0065165_10032717 149
404 3300005262 Ga0065165_1011199 Ga0065165_10111994 149
405 3300005295 Ga0065707_10180538 Ga0065707_101805382 149
406 3300005327 Ga0070658_10417327 Ga0070658_104173272 149
407 3300005327 Ga0070658_10901556 Ga0070658_109015562 149
408 3300005328 Ga0070676_10364825 Ga0070676_103648252 149
409 3300005329 Ga0070683_100097917 Ga0070683_1000979174 149
410 3300005330 Ga0070690_100160818 Ga0070690_1001608181 149
411 3300005334 Ga0068869_100020962 Ga0068869_1000209625 149
412 3300005334 Ga0068869_100194276 Ga0068869_1001942763 149
413 3300005335 Ga0070666_10171222 Ga0070666_101712222 149
414 3300005335 Ga0070666_10528762 Ga0070666_105287622 149
415 3300005336 Ga0070680_101253899 Ga0070680_1012538991 149
416 3300005337 Ga0070682_100048952 Ga0070682_1000489522 149
417 3300005337 Ga0070682_101275761 Ga0070682_1012757612 149
418 3300005337 Ga0070682_101930484 Ga0070682_1019304841 149
419 3300005338 Ga0068868_100057233 Ga0068868_1000572332 149
420 3300005338 Ga0068868_100301779 Ga0068868_1003017793 149
421 3300005338 Ga0068868_100539476 Ga0068868_1005394762 149
422 3300005340 Ga0070689_100413365 Ga0070689_1004133651 149
423 3300005340 Ga0070689_101670846 Ga0070689_1016708461 149
424 3300005343 Ga0070687_101535525 Ga0070687_1015355251 149
425 3300005344 Ga0070661_100037493 Ga0070661_1000374932 149
426 3300005347 Ga0070668_100030699 Ga0070668_1000306993 149
427 3300005347 Ga0070668_100144595 Ga0070668_1001445951 149
428 3300005347 Ga0070668_100202596 Ga0070668_1002025962 149
429 3300005347 Ga0070668_100220982 Ga0070668_1002209821 149
430 3300005347 Ga0070668_100536575 Ga0070668_1005365752 149
431 3300005347 Ga0070668_100883897 Ga0070668_1008838971 149
432 3300005353 Ga0070669_100084960 Ga0070669_1000849602 149
433 3300005353 Ga0070669_100571491 Ga0070669_1005714912 149
434 3300005353 Ga0070669_100827498 Ga0070669_1008274982 149
435 3300005354 Ga0070675_100787007 Ga0070675_1007870071 149
436 3300005355 Ga0070671_100016959 Ga0070671_1000169595 149
437 3300005355 Ga0070671_100173004 Ga0070671_1001730043 149
438 3300005355 Ga0070671_100375167 Ga0070671_1003751672 149
439 3300005355 Ga0070671_100400113 Ga0070671_1004001132 149
440 3300005356 Ga0070674_100054414 Ga0070674_1000544142 149
441 3300005366 Ga0070659_100309167 Ga0070659_1003091672 149
442 3300005366 Ga0070659_100368183 Ga0070659_1003681832 149
443 3300005367 Ga0070667_100198123 Ga0070667_1001981233 149
444 3300005367 Ga0070667_100323630 Ga0070667_1003236301 149
445 3300005367 Ga0070667_100566270 Ga0070667_1005662702 149
446 3300005367 Ga0070667_100755351 Ga0070667_1007553512 149
447 3300005435 Ga0070714_100587337 Ga0070714_1005873372 149
448 3300005436 Ga0070713_100020602 Ga0070713_1000206023 149
449 3300005438 Ga0070701_10490322 Ga0070701_104903222 149
450 3300005441 Ga0070700_100271444 Ga0070700_1002714441 149
451 3300005441 Ga0070700_100303333 Ga0070700_1003033331 149
452 3300005444 Ga0070694_100422542 Ga0070694_1004225422 149
453 3300005455 Ga0070663_100005879 Ga0070663_1000058798 149
454 3300005455 Ga0070663_100085339 Ga0070663_1000853392 149
455 3300005455 Ga0070663_100106479 Ga0070663_1001064791 149
456 3300005455 Ga0070663_100138533 Ga0070663_1001385332 149
457 3300005455 Ga0070663_100142887 Ga0070663_1001428873 149
458 3300005455 Ga0070663_100309624 Ga0070663_1003096242 149
459 3300005455 Ga0070663_100558360 Ga0070663_1005583602 149
460 3300005456 Ga0070678_100006542 Ga0070678_1000065426 149
461 3300005456 Ga0070678_100036131 Ga0070678_1000361312 149
462 3300005456 Ga0070678_100036166 Ga0070678_1000361663 149
463 3300005456 Ga0070678_100051998 Ga0070678_1000519983 149
464 3300005456 Ga0070678_100099960 Ga0070678_1000999602 149
465 3300005457 Ga0070662_100241273 Ga0070662_1002412731 149
466 3300005466 Ga0070685_10058764 Ga0070685_100587643 149
467 3300005466 Ga0070685_10340258 Ga0070685_103402582 149
468 3300005466 Ga0070685_10950487 Ga0070685_109504871 149
469 3300005467 Ga0070706_100820314 Ga0070706_1008203141 149
470 3300005518 Ga0070699_100087190 Ga0070699_1000871903 149
471 3300005530 Ga0070679_101078241 Ga0070679_1010782411 149
472 3300005535 Ga0070684_101069546 Ga0070684_1010695461 149
473 3300005535 Ga0070684_101409654 Ga0070684_1014096541 149
474 3300005539 Ga0068853_100180909 Ga0068853_1001809092 149
475 3300005539 Ga0068853_100521118 Ga0068853_1005211181 149
476 3300005539 Ga0068853_100587591 Ga0068853_1005875912 149
477 3300005543 Ga0070672_100012466 Ga0070672_1000124662 149
478 3300005543 Ga0070672_101289933 Ga0070672_1012899332 149
479 3300005545 Ga0070695_100088185 Ga0070695_1000881852 149
480 3300005545 Ga0070695_100476496 Ga0070695_1004764962 149
481 3300005546 Ga0070696_100041134 Ga0070696_1000411343 149
482 3300005547 Ga0070693_100434639 Ga0070693_1004346391 149
483 3300005547 Ga0070693_100818671 Ga0070693_1008186711 149
484 3300005548 Ga0070665_100037937 Ga0070665_1000379373 149
485 3300005548 Ga0070665_100038593 Ga0070665_1000385935 149
486 3300005548 Ga0070665_100038996 Ga0070665_1000389966 149
487 3300005548 Ga0070665_100051102 Ga0070665_1000511024 149
488 3300005548 Ga0070665_100082922 Ga0070665_1000829223 149
489 3300005548 Ga0070665_100223303 Ga0070665_1002233033 149
490 3300005564 Ga0070664_101193111 Ga0070664_1011931111 149
491 3300005578 Ga0068854_100576307 Ga0068854_1005763071 149
492 3300005578 Ga0068854_100635685 Ga0068854_1006356851 149
493 3300005614 Ga0068856_100089112 Ga0068856_1000891124 149
494 3300005614 Ga0068856_100119368 Ga0068856_1001193682 149
495 3300005614 Ga0068856_101170178 Ga0068856_1011701782 149
496 3300005614 Ga0068856_102492042 Ga0068856_1024920421 149
497 3300005616 Ga0068852_100128340 Ga0068852_1001283401 149
498 3300005616 Ga0068852_100393855 Ga0068852_1003938552 149
499 3300005616 Ga0068852_100606399 Ga0068852_1006063991 149
500 3300005616 Ga0068852_101187831 Ga0068852_1011878311 149
501 3300005617 Ga0068859_100190639 Ga0068859_1001906393 149
502 3300005617 Ga0068859_100201434 Ga0068859_1002014341 149
503 3300005617 Ga0068859_102126299 Ga0068859_1021262991 149
504 3300005618 Ga0068864_100085670 Ga0068864_1000856702 149
505 3300005618 Ga0068864_100896179 Ga0068864_1008961791 149
506 3300005618 Ga0068864_101566270 Ga0068864_1015662701 149
507 3300005718 Ga0068866_10047267 Ga0068866_100472674 149
508 3300005718 Ga0068866_10196323 Ga0068866_101963231 149
509 3300005719 Ga0068861_100116638 Ga0068861_1001166383 149
510 3300005719 Ga0068861_100397802 Ga0068861_1003978022 149
511 3300005719 Ga0068861_102118750 Ga0068861_1021187501 149
512 3300005841 Ga0068863_100174025 Ga0068863_1001740252 149
513 3300005841 Ga0068863_100230130 Ga0068863_1002301301 149
514 3300005841 Ga0068863_100694930 Ga0068863_1006949302 149
515 3300005841 Ga0068863_101086733 Ga0068863_1010867331 149
516 3300005842 Ga0068858_100032885 Ga0068858_1000328852 149
517 3300005842 Ga0068858_100204734 Ga0068858_1002047343 149
518 3300005842 Ga0068858_100354447 Ga0068858_1003544473 149
519 3300005842 Ga0068858_101355394 Ga0068858_1013553941 149
520 3300005842 Ga0068858_101417153 Ga0068858_1014171531 149
521 3300005843 Ga0068860_100224288 Ga0068860_1002242882 149
522 3300005843 Ga0068860_100400551 Ga0068860_1004005512 149
523 3300005844 Ga0068862_100212473 Ga0068862_1002124733 149
524 3300005844 Ga0068862_100240010 Ga0068862_1002400102 149
525 3300005844 Ga0068862_100451097 Ga0068862_1004510972 149
526 3300005844 Ga0068862_100625080 Ga0068862_1006250801 149
527 3300005937 Ga0081455_10090886 Ga0081455_100908862 149
528 3300005937 Ga0081455_10150392 Ga0081455_101503922 149
529 3300005937 Ga0081455_10209166 Ga0081455_102091663 149
530 3300005937 Ga0081455_10241891 Ga0081455_102418912 149
531 3300005937 Ga0081455_10394015 Ga0081455_103940151 149
532 3300005983 Ga0081540_1012679 Ga0081540_10126796 149
533 3300005983 Ga0081540_1030256 Ga0081540_10302563 149
534 3300005983 Ga0081540_1039809 Ga0081540_10398093 149
535 3300005985 Ga0081539_10000945 Ga0081539_1000094542 149
536 3300005985 Ga0081539_10043762 Ga0081539_100437622 149
537 3300005985 Ga0081539_10083471 Ga0081539_100834712 149
538 3300006028 Ga0070717_10269788 Ga0070717_102697882 149
539 3300006038 Ga0075365_10894864 Ga0075365_108948641 149
540 3300006042 Ga0075368_10015524 Ga0075368_100155243 149
541 3300006042 Ga0075368_10117281 Ga0075368_101172812 149
542 3300006048 Ga0075363_100006916 Ga0075363_1000069165 149
543 3300006048 Ga0075363_100035829 Ga0075363_1000358295 149
544 3300006048 Ga0075363_100238096 Ga0075363_1002380962 149
545 3300006048 Ga0075363_100244794 Ga0075363_1002447942 149
546 3300006051 Ga0075364_10019010 Ga0075364_100190105 149
547 3300006051 Ga0075364_10091731 Ga0075364_100917312 149
548 3300006173 Ga0070716_101764138 Ga0070716_1017641381 149
549 3300006175 Ga0070712_100048327 Ga0070712_1000483274 149
550 3300006177 Ga0075362_10072825 Ga0075362_100728253 149
551 3300006177 Ga0075362_10146714 Ga0075362_101467142 149
552 3300006177 Ga0075362_10248331 Ga0075362_102483312 149
553 3300006178 Ga0075367_10005440 Ga0075367_100054403 149
554 3300006178 Ga0075367_10018947 Ga0075367_100189474 149
555 3300006178 Ga0075367_10056226 Ga0075367_100562262 149
556 3300006178 Ga0075367_10293192 Ga0075367_102931922 149
557 3300006178 Ga0075367_10510503 Ga0075367_105105032 149
558 3300006186 Ga0075369_10125152 Ga0075369_101251522 149
559 3300006195 Ga0075366_10048174 Ga0075366_100481746 149
560 3300006195 Ga0075366_10195698 Ga0075366_101956981 149
561 3300006237 Ga0097621_100283128 Ga0097621_1002831282 149
562 3300006237 Ga0097621_100881220 Ga0097621_1008812202 149
563 3300006237 Ga0097621_101325842 Ga0097621_1013258421 149
564 3300006353 Ga0075370_10062772 Ga0075370_100627722 149
565 3300006353 Ga0075370_10079858 Ga0075370_100798582 149
566 3300006353 Ga0075370_10372660 Ga0075370_103726601 149
567 3300006358 Ga0068871_100619219 Ga0068871_1006192192 149
568 3300006358 Ga0068871_101167842 Ga0068871_1011678421 149
569 3300006358 Ga0068871_101427706 Ga0068871_1014277061 149
570 3300006881 Ga0068865_100127424 Ga0068865_1001274242 149
571 3300006881 Ga0068865_100626176 Ga0068865_1006261762 149
572 3300006931 Ga0097620_100190656 Ga0097620_1001906563 149
573 3300006931 Ga0097620_100201420 Ga0097620_1002014201 149
574 3300006931 Ga0097620_102126300 Ga0097620_1021263001 149
575 3300006944 Ga0099823_1022671 Ga0099823_10226716 149
576 3300007265 Ga0099794_10262941 Ga0099794_102629411 149
577 3300007788 Ga0099795_10015351 Ga0099795_100153512 149
578 3300007788 Ga0099795_10037493 Ga0099795_100374932 149
579 3300009092 Ga0105250_10162509 Ga0105250_101625092 149
580 3300009092 Ga0105250_10427447 Ga0105250_104274471 149
581 3300009093 Ga0105240_10060844 Ga0105240_100608446 149
582 3300009093 Ga0105240_10201857 Ga0105240_102018573 149
583 3300009094 Ga0111539_10718369 Ga0111539_107183692 149
584 3300009098 Ga0105245_10009619 Ga0105245_100096196 149
585 3300009098 Ga0105245_10030906 Ga0105245_100309061 149
586 3300009098 Ga0105245_10415340 Ga0105245_104153402 149
587 3300009098 Ga0105245_10593730 Ga0105245_105937301 149
588 3300009101 Ga0105247_10012238 Ga0105247_100122385 149
589 3300009101 Ga0105247_11189065 Ga0105247_111890651 149
590 3300009147 Ga0114129_11297391 Ga0114129_112973911 149
591 3300009148 Ga0105243_10240844 Ga0105243_102408443 149
592 3300009148 Ga0105243_10304699 Ga0105243_103046991 149
593 3300009148 Ga0105243_10364502 Ga0105243_103645022 149
594 3300009174 Ga0105241_10078928 Ga0105241_100789282 149
595 3300009174 Ga0105241_10379256 Ga0105241_103792562 149
596 3300009174 Ga0105241_10722583 Ga0105241_107225832 149
597 3300009174 Ga0105241_11310460 Ga0105241_113104601 149
598 3300009176 Ga0105242_10354340 Ga0105242_103543403 149
599 3300009176 Ga0105242_10529692 Ga0105242_105296922 149
600 3300009176 Ga0105242_10550984 Ga0105242_105509841 149
601 3300009177 Ga0105248_10236929 Ga0105248_102369293 149
602 3300009177 Ga0105248_10772422 Ga0105248_107724221 149
603 3300009177 Ga0105248_11199924 Ga0105248_111999241 149
604 3300009545 Ga0105237_10047396 Ga0105237_100473965 149
605 3300009545 Ga0105237_10217744 Ga0105237_102177442 149
606 3300009545 Ga0105237_10283700 Ga0105237_102837002 149
607 3300009545 Ga0105237_10353753 Ga0105237_103537533 149
608 3300009545 Ga0105237_11114500 Ga0105237_111145001 149
609 3300009545 Ga0105237_12285899 Ga0105237_122858991 149
610 3300009551 Ga0105238_10160883 Ga0105238_101608832 149
611 3300009551 Ga0105238_10366840 Ga0105238_103668401 149
612 3300009551 Ga0105238_10723596 Ga0105238_107235962 149
613 3300009551 Ga0105238_11283815 Ga0105238_112838151 149
614 3300009553 Ga0105249_10371858 Ga0105249_103718582 149
615 3300009553 Ga0105249_10910208 Ga0105249_109102082 149
616 3300010159 Ga0099796_10011316 Ga0099796_100113162 149
617 3300010375 Ga0105239_10048157 Ga0105239_100481575 149
618 3300010375 Ga0105239_10143828 Ga0105239_101438285 149
619 3300010375 Ga0105239_10160763 Ga0105239_101607632 149
620 3300010375 Ga0105239_10420828 Ga0105239_104208282 149
621 3300010375 Ga0105239_10473650 Ga0105239_104736502 149
622 3300010375 Ga0105239_12022104 Ga0105239_120221041 149
623 3300011119 Ga0105246_10016029 Ga0105246_100160291 149
624 3300011119 Ga0105246_10081283 Ga0105246_100812833 149
625 3300011119 Ga0105246_10250258 Ga0105246_102502582 149
626 3300013100 Ga0157373_10296683 Ga0157373_102966831 149
627 3300013104 Ga0157370_10128852 Ga0157370_101288523 149
628 3300013105 Ga0157369_10006777 Ga0157369_100067773 149
629 3300013105 Ga0157369_11063775 Ga0157369_110637752 149
630 3300013296 Ga0157374_10640324 Ga0157374_106403242 149
631 3300013297 Ga0157378_10052677 Ga0157378_100526773 149
632 3300013297 Ga0157378_11792963 Ga0157378_117929632 149
633 3300013306 Ga0163162_10041842 Ga0163162_100418425 149
634 3300013306 Ga0163162_10168343 Ga0163162_101683432 149
635 3300013306 Ga0163162_10403251 Ga0163162_104032511 149
636 3300013306 Ga0163162_10477785 Ga0163162_104777852 149
637 3300013306 Ga0163162_11305588 Ga0163162_113055881 149
638 3300013306 Ga0163162_11347941 Ga0163162_113479411 149
639 3300013306 Ga0163162_11688210 Ga0163162_116882101 149
640 3300013308 Ga0157375_10268156 Ga0157375_102681563 149
641 3300014325 Ga0163163_10139629 Ga0163163_101396292 149
642 3300014325 Ga0163163_10502220 Ga0163163_105022201 149
643 3300014325 Ga0163163_10980453 Ga0163163_109804531 149
644 3300014325 Ga0163163_11395180 Ga0163163_113951801 149
645 3300014326 Ga0157380_10222173 Ga0157380_102221731 149
646 3300014326 Ga0157380_10288892 Ga0157380_102888921 149
647 3300014326 Ga0157380_10439756 Ga0157380_104397562 149
648 3300014497 Ga0182008_10744428 Ga0182008_107444281 149
649 3300014745 Ga0157377_10165116 Ga0157377_101651162 149
650 3300014968 Ga0157379_10228819 Ga0157379_102288192 149
651 3300014968 Ga0157379_10404762 Ga0157379_104047622 149
652 3300014968 Ga0157379_11024733 Ga0157379_110247331 149
653 3300014969 Ga0157376_10126305 Ga0157376_101263052 149
654 3300014969 Ga0157376_10441462 Ga0157376_104414622 149
655 3300015262 Ga0182007_10162187 Ga0182007_101621872 149
656 3300017792 Ga0163161_10127501 Ga0163161_101275012 149
657 3300021320 Ga0214544_1000001 Ga0214544_1000001189 149
658 3300021321 Ga0214542_1000005 Ga0214542_1000005189 149
659 3300021321 Ga0214542_1027073 Ga0214542_10270733 149
660 3300021324 Ga0214545_1000003 Ga0214545_1000003575 149
661 3300021324 Ga0214545_1019813 Ga0214545_10198133 149
662 3300021327 Ga0214543_1000002 Ga0214543_1000002190 149
663 3300021327 Ga0214543_1039960 Ga0214543_10399602 149
664 3300021358 Ga0213873_10031211 Ga0213873_100312111 149
665 3300021441 Ga0213871_10018916 Ga0213871_100189162 149
666 3300025230 Ga0209563_110124 Ga0209563_1101241 149
667 3300025245 Ga0207425_1009648 Ga0207425_10096482 149
668 3300025253 Ga0209677_105397 Ga0209677_1053974 149
669 3300025261 Ga0209233_1003418 Ga0209233_10034184 149
670 3300025261 Ga0209233_1006411 Ga0209233_10064114 149
671 3300025261 Ga0209233_1008559 Ga0209233_10085593 149
672 3300025261 Ga0209233_1022427 Ga0209233_10224271 149
673 3300025272 Ga0209455_1021895 Ga0209455_10218951 149
674 3300025297 Ga0209758_1000026 Ga0209758_1000026131 149
675 3300025297 Ga0209758_1000479 Ga0209758_100047929 149
676 3300025297 Ga0209758_1005453 Ga0209758_10054537 149
677 3300025297 Ga0209758_1005713 Ga0209758_10057131 149
678 3300025297 Ga0209758_1009114 Ga0209758_10091146 149
679 3300025297 Ga0209758_1029176 Ga0209758_10291762 149
680 3300025297 Ga0209758_1059991 Ga0209758_10599912 149
681 3300025299 Ga0209256_1027256 Ga0209256_10272561 149
682 3300025302 Ga0207426_1001455 Ga0207426_100145512 149
683 3300025302 Ga0207426_1002534 Ga0207426_10025347 149
684 3300025302 Ga0207426_1030642 Ga0207426_10306423 149
685 3300025302 Ga0207426_1045255 Ga0207426_10452552 149
686 3300025303 Ga0209051_1069589 Ga0209051_10695891 149
687 3300025303 Ga0209051_1146783 Ga0209051_11467831 149
688 3300025304 Ga0209257_1005738 Ga0209257_10057386 149
689 3300025304 Ga0209257_1009389 Ga0209257_10093894 149
690 3300025315 Ga0207697_10017910 Ga0207697_100179101 149
691 3300025315 Ga0207697_10095675 Ga0207697_100956752 149
692 3300025321 Ga0207656_10303524 Ga0207656_103035241 149
693 3300025901 Ga0207688_10147599 Ga0207688_101475991 149
694 3300025901 Ga0207688_10295931 Ga0207688_102959312 149
695 3300025901 Ga0207688_10416004 Ga0207688_104160041 149
696 3300025901 Ga0207688_10557880 Ga0207688_105578802 149
697 3300025901 Ga0207688_10772746 Ga0207688_107727461 149
698 3300025903 Ga0207680_10153136 Ga0207680_101531363 149
699 3300025904 Ga0207647_10001122 Ga0207647_100011224 149
700 3300025904 Ga0207647_10127468 Ga0207647_101274682 149
701 3300025904 Ga0207647_10359708 Ga0207647_103597081 149
702 3300025907 Ga0207645_10109815 Ga0207645_101098154 149
703 3300025907 Ga0207645_10294283 Ga0207645_102942832 149
704 3300025907 Ga0207645_10372972 Ga0207645_103729722 149
705 3300025909 Ga0207705_10350171 Ga0207705_103501712 149
706 3300025910 Ga0207684_10466915 Ga0207684_104669152 149
707 3300025911 Ga0207654_10031489 Ga0207654_100314895 149
708 3300025911 Ga0207654_10057695 Ga0207654_100576952 149
709 3300025911 Ga0207654_10514235 Ga0207654_105142351 149
710 3300025913 Ga0207695_10146707 Ga0207695_101467071 149
711 3300025913 Ga0207695_10249945 Ga0207695_102499452 149
712 3300025913 Ga0207695_10704868 Ga0207695_107048681 149
713 3300025914 Ga0207671_11054244 Ga0207671_110542441 149
714 3300025914 Ga0207671_11343030 Ga0207671_113430301 149
715 3300025915 Ga0207693_10165680 Ga0207693_101656801 149
716 3300025916 Ga0207663_10168514 Ga0207663_101685142 149
717 3300025918 Ga0207662_10142934 Ga0207662_101429343 149
718 3300025919 Ga0207657_10090831 Ga0207657_100908315 149
719 3300025919 Ga0207657_10642127 Ga0207657_106421272 149
720 3300025919 Ga0207657_10944750 Ga0207657_109447501 149
721 3300025922 Ga0207646_11030532 Ga0207646_110305321 149
722 3300025923 Ga0207681_10056349 Ga0207681_100563494 149
723 3300025924 Ga0207694_10249101 Ga0207694_102491012 149
724 3300025924 Ga0207694_10459638 Ga0207694_104596382 149
725 3300025925 Ga0207650_10157843 Ga0207650_101578431 149
726 3300025925 Ga0207650_10656129 Ga0207650_106561292 149
727 3300025925 Ga0207650_10864118 Ga0207650_108641181 149
728 3300025926 Ga0207659_10488826 Ga0207659_104888262 149
729 3300025927 Ga0207687_10178430 Ga0207687_101784301 149
730 3300025927 Ga0207687_10240498 Ga0207687_102404982 149
731 3300025928 Ga0207700_10527112 Ga0207700_105271122 149
732 3300025929 Ga0207664_11449492 Ga0207664_114494921 149
733 3300025931 Ga0207644_10329070 Ga0207644_103290702 149
734 3300025931 Ga0207644_11418262 Ga0207644_114182621 149
735 3300025932 Ga0207690_11231681 Ga0207690_112316812 149
736 3300025933 Ga0207706_10101453 Ga0207706_101014532 149
737 3300025933 Ga0207706_10193204 Ga0207706_101932042 149
738 3300025933 Ga0207706_10856691 Ga0207706_108566912 149
739 3300025935 Ga0207709_10007189 Ga0207709_100071893 149
740 3300025935 Ga0207709_10155618 Ga0207709_101556182 149
741 3300025935 Ga0207709_10275668 Ga0207709_102756681 149
742 3300025935 Ga0207709_11154410 Ga0207709_111544101 149
743 3300025940 Ga0207691_10068065 Ga0207691_100680653 149
744 3300025941 Ga0207711_10551367 Ga0207711_105513672 149
745 3300025941 Ga0207711_10797332 Ga0207711_107973322 149
746 3300025942 Ga0207689_10118666 Ga0207689_101186663 149
747 3300025942 Ga0207689_10924399 Ga0207689_109243991 149
748 3300025944 Ga0207661_10159549 Ga0207661_101595492 149
749 3300025945 Ga0207679_10168233 Ga0207679_101682333 149
750 3300025949 Ga0207667_10127423 Ga0207667_101274233 149
751 3300025949 Ga0207667_11175661 Ga0207667_111756611 149
752 3300025960 Ga0207651_10051526 Ga0207651_100515263 149
753 3300025960 Ga0207651_10514884 Ga0207651_105148842 149
754 3300025960 Ga0207651_11837211 Ga0207651_118372111 149
755 3300025961 Ga0207712_10019100 Ga0207712_100191004 149
756 3300025961 Ga0207712_10030112 Ga0207712_100301123 149
757 3300025972 Ga0207668_10168921 Ga0207668_101689212 149
758 3300025972 Ga0207668_10331912 Ga0207668_103319122 149
759 3300025972 Ga0207668_10691884 Ga0207668_106918842 149
760 3300025981 Ga0207640_10433088 Ga0207640_104330882 149
761 3300025981 Ga0207640_10577726 Ga0207640_105777262 149
762 3300025981 Ga0207640_11435223 Ga0207640_114352231 149
763 3300025981 Ga0207640_11442622 Ga0207640_114426221 149
764 3300025986 Ga0207658_10079721 Ga0207658_100797215 149
765 3300025986 Ga0207658_10814510 Ga0207658_108145101 149
766 3300025986 Ga0207658_11557304 Ga0207658_115573041 149
767 3300026023 Ga0207677_10024382 Ga0207677_100243822 149
768 3300026023 Ga0207677_10040965 Ga0207677_100409653 149
769 3300026023 Ga0207677_10694527 Ga0207677_106945271 149
770 3300026035 Ga0207703_10088219 Ga0207703_100882193 149
771 3300026035 Ga0207703_10372095 Ga0207703_103720952 149
772 3300026035 Ga0207703_11219268 Ga0207703_112192681 149
773 3300026035 Ga0207703_11398401 Ga0207703_113984011 149
774 3300026041 Ga0207639_10123255 Ga0207639_101232552 149
775 3300026041 Ga0207639_10160965 Ga0207639_101609651 149
776 3300026041 Ga0207639_10177963 Ga0207639_101779632 149
777 3300026041 Ga0207639_10222140 Ga0207639_102221403 149
778 3300026067 Ga0207678_10010858 Ga0207678_100108588 149
779 3300026067 Ga0207678_10026500 Ga0207678_100265005 149
780 3300026067 Ga0207678_10040964 Ga0207678_100409642 149
781 3300026067 Ga0207678_10044407 Ga0207678_100444072 149
782 3300026067 Ga0207678_10047043 Ga0207678_100470432 149
783 3300026067 Ga0207678_10089203 Ga0207678_100892032 149
784 3300026067 Ga0207678_11227649 Ga0207678_112276492 149
785 3300026075 Ga0207708_10032916 Ga0207708_100329163 149
786 3300026075 Ga0207708_10091810 Ga0207708_100918102 149
787 3300026075 Ga0207708_10206436 Ga0207708_102064361 149
788 3300026075 Ga0207708_10582403 Ga0207708_105824032 149
789 3300026078 Ga0207702_10075783 Ga0207702_100757832 149
790 3300026078 Ga0207702_10997288 Ga0207702_109972881 149
791 3300026078 Ga0207702_11057578 Ga0207702_110575781 149
792 3300026078 Ga0207702_11117735 Ga0207702_111177351 149
793 3300026088 Ga0207641_10169171 Ga0207641_101691713 149
794 3300026088 Ga0207641_10222696 Ga0207641_102226962 149
795 3300026088 Ga0207641_10255998 Ga0207641_102559982 149
796 3300026089 Ga0207648_10232722 Ga0207648_102327222 149
797 3300026089 Ga0207648_10305220 Ga0207648_103052202 149
798 3300026095 Ga0207676_10416254 Ga0207676_104162542 149
799 3300026095 Ga0207676_10522185 Ga0207676_105221851 149
800 3300026095 Ga0207676_11251383 Ga0207676_112513832 149
801 3300026118 Ga0207675_100167936 Ga0207675_1001679363 149
802 3300026118 Ga0207675_100489012 Ga0207675_1004890122 149
803 3300026121 Ga0207683_10034874 Ga0207683_100348745 149
804 3300026121 Ga0207683_10047287 Ga0207683_100472873 149
805 3300026121 Ga0207683_10353514 Ga0207683_103535142 149
806 3300026121 Ga0207683_10575045 Ga0207683_105750451 149
807 3300026121 Ga0207683_10673488 Ga0207683_106734882 149
808 3300026142 Ga0207698_10068650 Ga0207698_100686502 149
809 3300026142 Ga0207698_10180252 Ga0207698_101802522 149
810 3300026142 Ga0207698_10620973 Ga0207698_106209732 149
811 3300027296 Ga0209389_1000057 Ga0209389_100005739 149
812 3300027361 Ga0209489_100226 Ga0209489_10022628 149
813 3300027363 Ga0209700_100085 Ga0209700_10008556 149
814 3300027512 Ga0209179_1011461 Ga0209179_10114612 149
815 3300027866 Ga0209813_10035974 Ga0209813_100359742 149
816 3300027866 Ga0209813_10127925 Ga0209813_101279252 149
817 3300028379 Ga0268266_10001410 Ga0268266_100014103 149
818 3300028379 Ga0268266_10007006 Ga0268266_100070068 149
819 3300028379 Ga0268266_10027864 Ga0268266_100278644 149
820 3300028379 Ga0268266_10029572 Ga0268266_100295727 149
821 3300028379 Ga0268266_10046226 Ga0268266_100462262 149
822 3300028379 Ga0268266_10100933 Ga0268266_101009332 149
823 3300028379 Ga0268266_10331734 Ga0268266_103317343 149
824 3300028380 Ga0268265_10108662 Ga0268265_101086622 149
825 3300028380 Ga0268265_10301740 Ga0268265_103017402 149
826 3300028380 Ga0268265_10358339 Ga0268265_103583392 149
827 3300028381 Ga0268264_10278652 Ga0268264_102786522 149
828 3300028381 Ga0268264_10475490 Ga0268264_104754902 149
829 3300028381 Ga0268264_10821987 Ga0268264_108219872 149
830 3300028786 Ga0307517_10000248 Ga0307517_1000024838 149
831 3300028786 Ga0307517_10183062 Ga0307517_101830622 149
832 3300028794 Ga0307515_10405686 Ga0307515_104056861 149
833 3300028794 Ga0307515_10616379 Ga0307515_106163792 149
834 3300028794 Ga0307515_10707915 Ga0307515_107079151 149
835 3300031235 Ga0265330_10055866 Ga0265330_100558662 149
836 3300031507 Ga0307509_11006177 Ga0307509_110061771 149
837 3300031548 Ga0307408_100524460 Ga0307408_1005244602 149
838 3300031616 Ga0307508_10086597 Ga0307508_100865972 149
839 3300031730 Ga0307516_10948613 Ga0307516_109486131 149
840 3300031852 Ga0307410_10021949 Ga0307410_100219492 149
841 3300031901 Ga0307406_10094255 Ga0307406_100942553 149
842 3300031995 Ga0307409_100249168 Ga0307409_1002491681 149
843 3300032002 Ga0307416_100117420 Ga0307416_1001174202 149
844 3300032002 Ga0307416_102330311 Ga0307416_1023303111 149
845 3300032126 Ga0307415_100585659 Ga0307415_1005856592 149
846 3300033180 Ga0307510_10049737 Ga0307510_100497374 149
847 3300033180 Ga0307510_10505153 Ga0307510_105051531 149
848 3300035113 Ga0373936_0093954 Ga0373936_0093954_354_803 149
849 3300035170 Ga0373943_0024083 Ga0373943_0024083_2141_2590 149
850 3300035171 Ga0373946_0077256 Ga0373946_0077256_915_1364 149
851 3300035692 Ga0373935_0485782 Ga0373935_0485782_352_801 149
852 3300035695 Ga0373927_0099946 Ga0373927_0099946_446_895 149
853 3300035695 Ga0373927_0251915 Ga0373927_0251915_429_878 149
854 3300036401 Ga0373937_0280743 Ga0373937_0280743_456_905 149
855 3300037068 Ga0373925_0081538 Ga0373925_0081538_1781_2230 149
856 3300037068 Ga0373925_0314730 Ga0373925_0314730_192_641 149
857 3300037312 Ga0395899_0168635 Ga0395899_0168635_157_606 149
858 3300037418 Ga0395900_0026521 Ga0395900_0026521_2125_2574 149
859 3300037418 Ga0395900_0150164 Ga0395900_0150164_1769_2218 149
860 3300037466 Ga0395898_0007695 Ga0395898_0007695_4869_5318 149
861 3300037466 Ga0395898_0011882 Ga0395898_0011882_2025_2474 149
862 3300037471 Ga0395905_0043972 Ga0395905_0043972_3581_4030 149
863 3300037471 Ga0395905_0619250 Ga0395905_0619250_415_864 149
864 3300038443 Ga0395901_0030065 Ga0395901_0030065_4223_4672 149
865 3300038443 Ga0395901_0491347 Ga0395901_0491347_455_904 149
866 3300038443 Ga0395901_0654608 Ga0395901_0654608_236_685 149
867 3300039438 Ga0436360_0417419 Ga0436360_0417419_938_1387 149
868 3300039447 Ga0436361_1149151 Ga0436361_1149151_1404_1853 149
869 3300039453 Ga0436362_1272358 Ga0436362_1272358_619_1068 149
870 3300041441 Ga0451787_372953 Ga0451787_372953_68_547 149
871 3300041492 Ga0451835_0089850 Ga0451835_0089850_133_612 149
872 3300041505 Ga0451849_0907426 Ga0451849_0907426_60_512 149
873 3300042438 Ga0439459_0112710 Ga0439459_0112710_80_529 149
874 3300042439 Ga0439464_0092267 Ga0439464_0092267_454_903 149
875 3300044656 Ga0466969_0010526 Ga0466969_0010526_717_1166 149
876 3300044658 Ga0466972_0016778 Ga0466972_0016778_1858_2307 149
877 3300044658 Ga0466972_0124109 Ga0466972_0124109_218_667 149
878 3300044684 Ga0466966_0005947 Ga0466966_0005947_4891_5340 149
879 3300044684 Ga0466966_0218088 Ga0466966_0218088_501_950 149
880 3300044693 Ga0466961_0000863 Ga0466961_0000863_15482_15931 149
881 3300044693 Ga0466961_0046672 Ga0466961_0046672_1391_1840 149
882 3300044694 Ga0466963_0071599 Ga0466963_0071599_538_987 149
883 3300044706 Ga0466964_0157200 Ga0466964_0157200_500_949 149
884 3300044719 Ga0466971_0022035 Ga0466971_0022035_637_1086 149
885 3300044735 Ga0466968_0046951 Ga0466968_0046951_124_573 149
886 3300044842 Ga0466957_0187308 Ga0466957_0187308_57_506 149
887 3300044901 Ga0466960_0132092 Ga0466960_0132092_34_483 149
888 3300045049 Ga0466959_0014195 Ga0466959_0014195_401_850 149
889 3300045049 Ga0466959_0093008 Ga0466959_0093008_815_1264 149
890 3300045836 Ga0466958_0155703 Ga0466958_0155703_470_919 149
891 3300046455 Ga0495603_0036047 Ga0495603_0036047_1449_1898 149
892 3300046455 Ga0495603_0118183 Ga0495603_0118183_563_1012 149
893 3300046455 Ga0495603_0205571 Ga0495603_0205571_665_1114 149
894 3300046455 Ga0495603_0240085 Ga0495603_0240085_134_583 149
895 3300046455 Ga0495603_0249360 Ga0495603_0249360_224_727 149
896 3300046457 Ga0495590_0335619 Ga0495590_0335619_75_524 149
897 3300046459 Ga0495629_0095010 Ga0495629_0095010_1514_1963 149
898 3300046459 Ga0495629_0167408 Ga0495629_0167408_645_1097 149
899 3300046462 Ga0495651_0008654 Ga0495651_0008654_2568_3017 149
900 3300046463 Ga0495653_0116906 Ga0495653_0116906_248_697 149
901 3300046472 Ga0495580_0115240 Ga0495580_0115240_609_1058 149
902 3300046473 Ga0495582_0234013 Ga0495582_0234013_579_1028 149
903 3300046477 Ga0495664_0063668 Ga0495664_0063668_509_958 149
904 3300046491 Ga0495584_0224376 Ga0495584_0224376_336_785 149
905 3300046492 Ga0495585_0155892 Ga0495585_0155892_694_1143 149
906 3300046492 Ga0495585_0157607 Ga0495585_0157607_393_842 149
907 3300046492 Ga0495585_0232576 Ga0495585_0232576_68_517 149
908 3300046499 Ga0495594_0353547 Ga0495594_0353547_93_542 149
909 3300046500 Ga0495596_0149803 Ga0495596_0149803_106_555 149
910 3300046511 Ga0495608_0091559 Ga0495608_0091559_41_490 149
911 3300046513 Ga0495616_0094138 Ga0495616_0094138_558_1007 149
912 3300046513 Ga0495616_0281096 Ga0495616_0281096_21_470 149
913 3300046514 Ga0495618_0605289 Ga0495618_0605289_160_624 149
914 3300046515 Ga0495620_0028297 Ga0495620_0028297_1046_1495 149
915 3300046515 Ga0495620_0103221 Ga0495620_0103221_175_624 149
916 3300046516 Ga0495628_0016659 Ga0495628_0016659_5051_5500 149
917 3300046516 Ga0495628_0839973 Ga0495628_0839973_62_511 149
918 3300046517 Ga0495630_0589230 Ga0495630_0589230_329_778 149
919 3300046517 Ga0495630_0593423 Ga0495630_0593423_257_706 149
920 3300046518 Ga0495631_0051527 Ga0495631_0051527_972_1421 149
921 3300046518 Ga0495631_0240123 Ga0495631_0240123_132_581 149
922 3300046519 Ga0495632_0372245 Ga0495632_0372245_113_562 149
923 3300046522 Ga0495643_0117762 Ga0495643_0117762_244_693 149
924 3300046522 Ga0495643_0124719 Ga0495643_0124719_669_1118 149
925 3300046523 Ga0495644_0161793 Ga0495644_0161793_388_837 149
926 3300046529 Ga0495652_0584099 Ga0495652_0584099_256_705 149
927 3300046533 Ga0495640_0433394 Ga0495640_0433394_251_715 149
928 3300046538 Ga0495609_0450824 Ga0495609_0450824_26_475 149
929 3300046542 Ga0495597_0147643 Ga0495597_0147643_92_541 149
930 3300046543 Ga0495645_0087057 Ga0495645_0087057_756_1205 149
931 3300046558 Ga0495633_0388063 Ga0495633_0388063_80_529 149
932 3300046615 Ga0495656_0189414 Ga0495656_0189414_401_850 149
933 3300046616 Ga0495668_0238234 Ga0495668_0238234_520_969 149
934 3300046616 Ga0495668_0267924 Ga0495668_0267924_278_727 149
935 3300046642 Ga0495634_0044257 Ga0495634_0044257_1789_2238 149
936 3300046660 Ga0495625_0118150 Ga0495625_0118150_561_1010 149
937 3300046660 Ga0495625_0452441 Ga0495625_0452441_98_547 149
938 3300046660 Ga0495625_0637581 Ga0495625_0637581_67_516 149
939 3300046663 Ga0495635_0023808 Ga0495635_0023808_2975_3439 149
940 3300046663 Ga0495635_0062415 Ga0495635_0062415_528_977 149
941 3300046664 Ga0495659_0016184 Ga0495659_0016184_961_1410 149
942 3300046674 Ga0495588_0012639 Ga0495588_0012639_2166_2615 149
943 3300046674 Ga0495588_0351167 Ga0495588_0351167_293_742 149
944 3300046675 Ga0495657_0005091 Ga0495657_0005091_5525_5974 149
945 3300046678 Ga0495599_0046216 Ga0495599_0046216_2165_2614 149
946 3300046679 Ga0495623_0019288 Ga0495623_0019288_1439_1888 149
947 3300046680 Ga0495646_0027624 Ga0495646_0027624_2213_2662 149
948 3300046684 Ga0495669_0006514 Ga0495669_0006514_3908_4357 149
949 3300046684 Ga0495669_0087771 Ga0495669_0087771_615_1064 149
950 3300046691 Ga0495670_0014413 Ga0495670_0014413_1967_2416 149
951 3300046692 Ga0495671_0056832 Ga0495671_0056832_542_991 149
952 3300046692 Ga0495671_0151037 Ga0495671_0151037_83_532 149
953 3300046809 Ga0495600_0003192 Ga0495600_0003192_1890_2339 149
954 3300046810 Ga0495660_0158452 Ga0495660_0158452_88_537 149
955 3300047317 Ga0495604_0001817 Ga0495604_0001817_12614_13063 149
956 3300047317 Ga0495604_0128306 Ga0495604_0128306_362_826 149
957 3300047317 Ga0495604_0177007 Ga0495604_0177007_901_1353 149
958 3300047317 Ga0495604_0527042 Ga0495604_0527042_154_603 149
959 3300047318 Ga0495636_0466618 Ga0495636_0466618_26_475 149
960 3300047319 Ga0495674_0083125 Ga0495674_0083125_885_1334 149
961 3300047321 Ga0495676_0042637 Ga0495676_0042637_2162_2626 149
962 3300047321 Ga0495676_0051596 Ga0495676_0051596_1078_1527 149
963 3300047321 Ga0495676_0703042 Ga0495676_0703042_154_603 149
964 3300047322 Ga0495680_0004783 Ga0495680_0004783_12141_12590 149
965 3300047323 Ga0495683_0142882 Ga0495683_0142882_460_909 149
966 3300047323 Ga0495683_0209513 Ga0495683_0209513_112_600 149
967 3300047323 Ga0495683_0210923 Ga0495683_0210923_115_564 149
968 3300047443 Ga0495687_019578 Ga0495687_019578_2282_2731 149
969 3300047443 Ga0495687_024634 Ga0495687_024634_1694_2143 149
970 3300047444 Ga0495675_0010677 Ga0495675_0010677_2945_3394 149
971 3300047445 Ga0495677_0033517 Ga0495677_0033517_758_1207 149
972 3300047469 Ga0495673_0093296 Ga0495673_0093296_326_775 149
973 3300047472 Ga0495686_0029502 Ga0495686_0029502_1302_1754 149
974 3300047673 Ga0495593_0101512 Ga0495593_0101512_960_1424 149
975 3300048088 Ga0495602_0102240 Ga0495602_0102240_1349_1798 149
976 3300048089 Ga0495614_0380819 Ga0495614_0380819_125_574 149
977 3300048903 Ga0496100_0070326 Ga0496100_0070326_1512_1961 149
978 3300048903 Ga0496100_0186968 Ga0496100_0186968_412_861 149
979 3300048904 Ga0496101_0020038 Ga0496101_0020038_2548_2997 149
980 3300048904 Ga0496101_0151979 Ga0496101_0151979_528_977 149
981 3300048904 Ga0496101_0362286 Ga0496101_0362286_142_606 149
982 3300048904 Ga0496101_0815985 Ga0496101_0815985_252_701 149
983 3300048904 Ga0496101_0990750 Ga0496101_0990750_197_646 149
984 3300048904 Ga0496101_1037073 Ga0496101_1037073_100_549 149
985 3300048905 Ga0496102_0003789 Ga0496102_0003789_3107_3556 149
986 3300048905 Ga0496102_0027530 Ga0496102_0027530_2674_3123 149
987 3300048905 Ga0496102_0256476 Ga0496102_0256476_712_1161 149
988 3300048905 Ga0496102_0396985 Ga0496102_0396985_67_516 149
989 3300048905 Ga0496102_0802533 Ga0496102_0802533_399_848 149
990 3300048905 Ga0496102_0881232 Ga0496102_0881232_221_670 149
991 3300048906 Ga0496103_0192742 Ga0496103_0192742_259_708 149
992 3300048906 Ga0496103_0313741 Ga0496103_0313741_534_983 149
993 3300048906 Ga0496103_0565859 Ga0496103_0565859_87_536 149
994 3300048907 Ga0496104_0002743 Ga0496104_0002743_9908_10372 149
995 3300048907 Ga0496104_0114217 Ga0496104_0114217_403_852 149
996 3300048907 Ga0496104_0182849 Ga0496104_0182849_264_713 149
997 3300048907 Ga0496104_0183435 Ga0496104_0183435_1128_1577 149
998 3300048908 Ga0496105_0056554 Ga0496105_0056554_2497_2946 149
999 3300048908 Ga0496105_0059798 Ga0496105_0059798_1730_2179 149
1000 3300048908 Ga0496105_0077738 Ga0496105_0077738_1741_2205 149
1001 3300048908 Ga0496105_0671521 Ga0496105_0671521_201_650 149
1002 3300048909 Ga0496106_0260204 Ga0496106_0260204_576_1025 149
1003 3300048909 Ga0496106_0309568 Ga0496106_0309568_226_675 149
1004 3300048909 Ga0496106_0555808 Ga0496106_0555808_242_691 149
1005 3300048910 Ga0496107_0008411 Ga0496107_0008411_5616_6065 149
1006 3300048910 Ga0496107_0229177 Ga0496107_0229177_722_1171 149
1007 3300048911 Ga0496108_0025878 Ga0496108_0025878_1680_2129 149
1008 3300048911 Ga0496108_0057500 Ga0496108_0057500_1792_2241 149
1009 3300048911 Ga0496108_0117977 Ga0496108_0117977_127_576 149
1010 3300048912 Ga0496109_0055881 Ga0496109_0055881_410_859 149
1011 3300048912 Ga0496109_0162114 Ga0496109_0162114_352_801 149
1012 3300048912 Ga0496109_0193483 Ga0496109_0193483_693_1142 149
1013 3300048913 Ga0496110_0023688 Ga0496110_0023688_74_523 149
1014 3300048913 Ga0496110_0040385 Ga0496110_0040385_876_1325 149
1015 3300048913 Ga0496110_0269168 Ga0496110_0269168_1059_1508 149
1016 3300048913 Ga0496110_0353908 Ga0496110_0353908_877_1326 149
1017 3300048913 Ga0496110_0456548 Ga0496110_0456548_93_542 149
1018 3300048913 Ga0496110_0545844 Ga0496110_0545844_216_665 149
1019 3300048914 Ga0496111_0046070 Ga0496111_0046070_1675_2124 149
1020 3300048915 Ga0496112_0043463 Ga0496112_0043463_1079_1528 149
1021 3300048915 Ga0496112_0205362 Ga0496112_0205362_111_560 149
1022 3300048915 Ga0496112_0419759 Ga0496112_0419759_697_1146 149
1023 3300048916 Ga0496113_0086238 Ga0496113_0086238_126_575 149
1024 3300048916 Ga0496113_0146665 Ga0496113_0146665_171_620 149
1025 3300048916 Ga0496113_0203112 Ga0496113_0203112_37_486 149
1026 3300048916 Ga0496113_1033424 Ga0496113_1033424_157_606 149
1027 3300048916 Ga0496113_1393184 Ga0496113_1393184_15_479 149
1028 3300048917 Ga0496114_0058730 Ga0496114_0058730_857_1306 149
1029 3300048917 Ga0496114_0239889 Ga0496114_0239889_415_864 149
1030 3300048917 Ga0496114_0510424 Ga0496114_0510424_209_658 149
1031 3300048918 Ga0496115_0001860 Ga0496115_0001860_8891_9340 149
1032 3300048918 Ga0496115_0101186 Ga0496115_0101186_1407_1856 149
1033 3300048918 Ga0496115_0171677 Ga0496115_0171677_127_591 149
1034 3300048918 Ga0496115_0274102 Ga0496115_0274102_379_828 149
1035 3300048919 Ga0496116_0183721 Ga0496116_0183721_582_1070 149
1036 3300048920 Ga0496117_0174889 Ga0496117_0174889_232_681 149
1037 3300048920 Ga0496117_0258020 Ga0496117_0258020_201_650 149
1038 3300048920 Ga0496117_0386165 Ga0496117_0386165_133_582 149
1039 3300048921 Ga0496118_0060898 Ga0496118_0060898_149_598 149
1040 3300048921 Ga0496118_0074666 Ga0496118_0074666_542_991 149
1041 3300048921 Ga0496118_0160053 Ga0496118_0160053_412_861 149
1042 3300048921 Ga0496118_0205111 Ga0496118_0205111_58_522 149
1043 3300048922 Ga0496119_0006768 Ga0496119_0006768_10033_10497 149
1044 3300048922 Ga0496119_0017432 Ga0496119_0017432_381_839 149
1045 3300048922 Ga0496119_0032207 Ga0496119_0032207_1122_1571 149
1046 3300048922 Ga0496119_0142601 Ga0496119_0142601_798_1247 149
1047 3300048922 Ga0496119_0320368 Ga0496119_0320368_153_602 149
1048 3300048923 Ga0496120_0010148 Ga0496120_0010148_6022_6486 149
1049 3300048923 Ga0496120_0271990 Ga0496120_0271990_175_624 149
1050 3300048923 Ga0496120_0318513 Ga0496120_0318513_59_508 149
1051 3300048924 Ga0496121_0002757 Ga0496121_0002757_9200_9658 149
1052 3300048924 Ga0496121_0058967 Ga0496121_0058967_1662_2174 149
1053 3300048924 Ga0496121_0059811 Ga0496121_0059811_650_1099 149
1054 3300048924 Ga0496121_0084494 Ga0496121_0084494_1879_2328 149
1055 3300048924 Ga0496121_0095355 Ga0496121_0095355_1484_1933 149
1056 3300048924 Ga0496121_0147869 Ga0496121_0147869_338_787 149
1057 3300048924 Ga0496121_0157463 Ga0496121_0157463_60_524 149
1058 3300048924 Ga0496121_0183767 Ga0496121_0183767_352_801 149
1059 3300048925 Ga0496122_0129467 Ga0496122_0129467_170_622 149
1060 3300048925 Ga0496122_0212991 Ga0496122_0212991_532_981 149
1061 3300048927 Ga0496124_0094099 Ga0496124_0094099_339_803 149
1062 3300048927 Ga0496124_0193650 Ga0496124_0193650_106_555 149
1063 3300048928 Ga0496125_0060549 Ga0496125_0060549_1009_1458 149
1064 3300048928 Ga0496125_0156377 Ga0496125_0156377_593_1042 149
1065 3300048928 Ga0496125_0184974 Ga0496125_0184974_28_477 149
1066 3300048929 Ga0496126_0003081 Ga0496126_0003081_20080_20529 149
1067 3300048929 Ga0496126_0177789 Ga0496126_0177789_788_1237 149
1068 3300048929 Ga0496126_0191942 Ga0496126_0191942_512_964 149
1069 3300048929 Ga0496126_0423102 Ga0496126_0423102_88_537 149
1070 3300048929 Ga0496126_0576429 Ga0496126_0576429_265_729 149
1071 3300049574 Ga0501038_0396234 Ga0501038_0396234_16_468 149
1072 3300049577 Ga0501041_0922063 Ga0501041_0922063_11_463 149
1073 3300049578 Ga0501042_0828290 Ga0501042_0828290_127_579 149
1074 3300049589 Ga0501073_0402537 Ga0501073_0402537_86_538 149
1075 3300049592 Ga0501076_0062840 Ga0501076_0062840_1982_2431 149
1076 3300049822 Ga0501035_1248499 Ga0501035_1248499_46_498 149
1077 3300049824 Ga0501045_0385189 Ga0501045_0385189_33_485 149
1078 3300050489 nmdc:mga03683_137063_c1 nmdc:mga03683_137063_c1_74_535 149
1079 3300050489 nmdc:mga03683_173532_c1 nmdc:mga03683_173532_c1_248_697 149
1080 3300050489 nmdc:mga03683_303422_c1 nmdc:mga03683_303422_c1_236_685 149
1081 3300050490 nmdc:mga03n38_1290_c1 nmdc:mga03n38_1290_c1_2591_3040 149
1082 3300050490 nmdc:mga03n38_245415_c1 nmdc:mga03n38_245415_c1_89_538 149
1083 3300050490 nmdc:mga03n38_886703_c1 nmdc:mga03n38_886703_c1_32_481 149
1084 3300050491 nmdc:mga00v17_165893_c1 nmdc:mga00v17_165893_c1_32_481 149
1085 3300050491 nmdc:mga00v17_6086_c1 nmdc:mga00v17_6086_c1_1047_1496 149
1086 3300050492 nmdc:mga0yw44_23704_c1 nmdc:mga0yw44_23704_c1_1301_1780 149
1087 3300050493 nmdc:mga0k408_110415_c1 nmdc:mga0k408_110415_c1_234_683 149
1088 3300050493 nmdc:mga0k408_155257_c1 nmdc:mga0k408_155257_c1_289_738 149
1089 3300050493 nmdc:mga0k408_71243_c1 nmdc:mga0k408_71243_c1_1394_1843 149
1090 3300050494 nmdc:mga06z11_1024452_c1 nmdc:mga06z11_1024452_c1_44_493 149
1091 3300050494 nmdc:mga06z11_23163_c1 nmdc:mga06z11_23163_c1_1583_2032 149
1092 3300050494 nmdc:mga06z11_2462_c1 nmdc:mga06z11_2462_c1_1004_1453 149
1093 3300050494 nmdc:mga06z11_374356_c1 nmdc:mga06z11_374356_c1_217_666 149
1094 3300050494 nmdc:mga06z11_64701_c1 nmdc:mga06z11_64701_c1_550_999 149
1095 3300050494 nmdc:mga06z11_94254_c1 nmdc:mga06z11_94254_c1_578_1027 149
1096 3300050495 nmdc:mga04h51_119879_c1 nmdc:mga04h51_119879_c1_291_740 149
1097 3300050495 nmdc:mga04h51_36991_c1 nmdc:mga04h51_36991_c1_760_1209 149
1098 3300050496 nmdc:mga07m45_11812_c1 nmdc:mga07m45_11812_c1_938_1387 149
1099 3300050496 nmdc:mga07m45_384521_c1 nmdc:mga07m45_384521_c1_189_638 149
1100 3300050496 nmdc:mga07m45_92163_c1 nmdc:mga07m45_92163_c1_1045_1494 149
1101 3300050511 nmdc:mga08y16_675762_c1 nmdc:mga08y16_675762_c1_532_981 149
1102 3300050516 nmdc:mga0sz30_28757_c1 nmdc:mga0sz30_28757_c1_1569_2018 149
1103 3300050516 nmdc:mga0sz30_408240_c1 nmdc:mga0sz30_408240_c1_17_466 149
1104 3300050516 nmdc:mga0sz30_64875_c1 nmdc:mga0sz30_64875_c1_970_1419 149
1105 3300053077 Ga0495601_0404170 Ga0495601_0404170_94_543 149
1106 3300053080 Ga0500635_0150850 Ga0500635_0150850_119_568 149
1107 3300053085 Ga0495619_0113450 Ga0495619_0113450_1157_1606 149
1108 3300053085 Ga0495619_1105612 Ga0495619_1105612_53_502 149
1109 3300053091 Ga0500647_0016425 Ga0500647_0016425_1991_2440 149
1110 3300053093 Ga0500651_0664090 Ga0500651_0664090_49_498 149
1111 3300053094 Ga0500566_0001729 Ga0500566_0001729_7078_7527 149
1112 3300053095 Ga0500640_110454 Ga0500640_110454_308_757 149
1113 3300053097 Ga0500648_242341 Ga0500648_242341_325_774 149
1114 3300053102 Ga0500554_049782 Ga0500554_049782_310_759 149
1115 3300053102 Ga0500554_198972 Ga0500554_198972_191_640 149
1116 3300053103 Ga0500555_005133 Ga0500555_005133_1995_2480 149
1117 3300053109 Ga0500569_013364 Ga0500569_013364_138_587 149
1118 3300053111 Ga0500572_012619 Ga0500572_012619_951_1400 149
1119 3300053118 Ga0500594_0108397 Ga0500594_0108397_186_671 149
1120 3300053119 Ga0500595_000393 Ga0500595_000393_25183_25641 149
1121 3300053119 Ga0500595_142504 Ga0500595_142504_53_502 149
1122 3300053119 Ga0500595_156500 Ga0500595_156500_42_491 149
1123 3300053122 Ga0500608_045010 Ga0500608_045010_1061_1510 149
1124 3300053122 Ga0500608_105888 Ga0500608_105888_646_1095 149
1125 3300053123 Ga0500614_294736 Ga0500614_294736_20_484 149
1126 3300053133 Ga0500655_125919 Ga0500655_125919_62_511 149
1127 3300053134 Ga0500658_0147378 Ga0500658_0147378_168_617 149
1128 3300053139 Ga0500568_0046269 Ga0500568_0046269_486_944 149
1129 3300053142 Ga0500577_0000303 Ga0500577_0000303_7706_8155 149
1130 3300053142 Ga0500577_0117604 Ga0500577_0117604_474_959 149
1131 3300053150 Ga0500603_001096 Ga0500603_001096_734_1183 149
1132 3300053161 Ga0500634_0221373 Ga0500634_0221373_144_629 149
1133 3300053162 Ga0500638_025857 Ga0500638_025857_133_582 149
1134 3300053163 Ga0500639_111425 Ga0500639_111425_71_535 149
1135 3300053163 Ga0500639_178358 Ga0500639_178358_266_715 149
1136 3300053177 Ga0500636_0004999 Ga0500636_0004999_4457_4906 149
1137 3300053177 Ga0500636_0045048 Ga0500636_0045048_1645_2127 149
1138 3300053177 Ga0500636_0385937 Ga0500636_0385937_136_585 149
1139 3300053177 Ga0500636_0489122 Ga0500636_0489122_77_526 149
1140 3300053178 Ga0500637_0222349 Ga0500637_0222349_564_1013 149
1141 3300053729 Ga0500625_007215 Ga0500625_007215_3905_4354 149
1142 3300053730 Ga0500645_073882 Ga0500645_073882_444_893 149
1143 3300053737 Ga0500601_001060 Ga0500601_001060_2581_3030 149
1144 3300053737 Ga0500601_014325 Ga0500601_014325_12_494 149
1145 3300055283 Ga0500661_006131 Ga0500661_006131_545_994 149
1146 3300061719 Ga0466962_0027977 Ga0466962_0027977_1903_2352 149
1147 3300061734 Ga0530510_0606541 Ga0530510_0606541_178_630 149

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02635

DsrE

DsrE/DsrF-like family

21

147

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
2pd2-assembly1.cif.gz_A crystal structure of (st0148) conserved hypothetical from sulfolobus tokodaii strain7 0.9289 35 149
2pd2-assembly1.cif.gz_A crystal structure of (st0148) conserved hypothetical from sulfolobus tokodaii strain7 0.9209 35 149
1l1s-assembly1.cif.gz_A structure of protein of unknown function mth1491 from methanobacterium thermoautotrophicum 0.8797 34 149
1l1s-assembly1.cif.gz_A structure of protein of unknown function mth1491 from methanobacterium thermoautotrophicum 0.8724 34 149
3pnx-assembly2.cif.gz_E crystal structure of a putative sulfurtransferase dsre (swol_2425) from syntrophomonas wolfei str. goettingen at 1.92 a resolution 0.7837 34 149
ID Description Score Start End Superfamily
2pd2B00 Alpha Beta;3-Layer(aba) Sandwich;Hypothetical Protein Ychn; Chain: A,;DsrEFH-like 0.9231 35 149 3.40.1260.10
2pd2B00 Alpha Beta;3-Layer(aba) Sandwich;Hypothetical Protein Ychn; Chain: A,;DsrEFH-like 0.9151 35 149 3.40.1260.10
af_Q86HR3_48_158_3.40.1260.10 Alpha Beta;3-Layer(aba) Sandwich;Hypothetical Protein Ychn; Chain: A,;DsrEFH-like 0.882 36 147 3.40.1260.10
af_Q86HR3_48_158_3.40.1260.10 Alpha Beta;3-Layer(aba) Sandwich;Hypothetical Protein Ychn; Chain: A,;DsrEFH-like 0.8746 36 147 3.40.1260.10
1l1sA00 Alpha Beta;3-Layer(aba) Sandwich;Hypothetical Protein Ychn; Chain: A,;DsrEFH-like 0.8611 34 149 3.40.1260.10
ID Description Score Start End GO Terms
AF-A0A401U1G0-F1-model_v4 Uncharacterized protein 0.9965 71 149
AF-A0A528TPR5-F1-model_v4 Uncharacterized protein 0.9925 35 149
AF-A0A526YEJ7-F1-model_v4 Uncharacterized protein 0.992 69 149
AF-A0A401U1G0-F1-model_v4 Uncharacterized protein 0.9841 71 149
AF-A0A528TPR5-F1-model_v4 Uncharacterized protein 0.9838 35 149

Feature Viewer

pLDDT pTM Quality
86.66 0.74 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map