F490816
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1147 | 578 | 1023 | 149 |
Family's Representative Sequence
| Representative Sequence | 3300035119|Ga0373956_0015101|Ga0373956_0015101_1520_1963 |
| Length | 147 |
| Sequence | MHRRNMLTAALAGIGGLFAATAAPRRAQAAPDKAKVVYHLSDLDKVSFALGNIRNHFDGMGGPDKVAIALVVHGPALKAFGVASANPDLAHRVGEFGKAGLELNACGNTMKAQKLALKDLLPGFVAERGGVVRIAELQSMGYAYLRP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 2 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 3 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 4 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 5 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 6 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 7 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 8 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 9 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 10 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 11 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 12 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 13 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 14 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 15 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 16 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 17 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 18 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 19 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 20 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 21 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 22 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 23 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 24 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 25 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 26 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 27 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 28 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 29 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 30 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 31 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 32 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 33 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 34 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 35 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 36 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 37 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 38 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 39 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 40 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 41 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 42 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 43 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 44 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 45 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 46 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 47 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 48 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 49 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 50 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 51 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 52 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 53 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 54 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 55 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 56 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 57 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 58 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 59 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 60 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 61 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 62 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 63 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 64 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 65 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 66 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 67 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 68 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 69 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 70 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 71 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 72 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 73 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 74 | 2904699407 | |||
| 75 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 76 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 77 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 78 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 79 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 80 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 81 | 2922425934 | |||
| 82 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 83 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 84 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 85 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 86 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 87 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 88 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 89 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 90 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 91 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 92 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 93 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 94 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 95 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 96 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 97 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 98 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 99 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 100 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 101 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 102 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 103 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 104 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 105 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 106 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 107 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 108 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 109 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 110 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 111 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 112 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 113 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 114 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 115 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 116 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 117 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 118 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 119 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 120 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 121 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 122 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 123 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 124 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 125 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 126 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 127 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 128 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 129 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 130 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 131 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 132 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 133 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 134 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 135 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 136 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 137 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 138 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 139 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 140 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 141 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 142 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 143 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 144 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 145 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 146 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 147 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 148 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 149 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 150 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 151 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 152 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 153 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 154 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 155 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 156 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 157 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 158 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 159 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 160 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 161 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 162 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 163 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 164 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 165 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 166 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 167 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 168 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 169 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 170 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 171 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 172 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 173 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 174 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 175 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 176 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 177 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 178 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 179 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 180 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 181 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 182 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 183 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 184 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 185 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 186 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 187 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 188 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 189 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 190 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 192 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 193 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 194 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 196 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 197 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 198 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 199 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 200 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 201 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 202 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 204 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 205 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 207 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 208 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 209 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 210 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 211 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 212 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 213 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 214 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 215 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 216 | 3300012495 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 | Metagenome | Rhizosphere |
| 217 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 218 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 219 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 220 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 221 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 222 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 223 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 224 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 225 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 226 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 227 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 228 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 229 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 230 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 231 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 232 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 233 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 234 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 235 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 236 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 237 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 238 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 239 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 240 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 241 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 242 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 243 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 244 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 245 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 246 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 247 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 248 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 249 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 268 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 270 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 271 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 272 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 273 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 274 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 275 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 276 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 277 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 278 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 279 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 280 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 281 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 282 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 283 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 284 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 285 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 286 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 287 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 288 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 289 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 290 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 291 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 292 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 293 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 294 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 295 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 296 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 297 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 298 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 299 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 300 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 301 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 302 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 303 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 304 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 305 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 306 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 307 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 308 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 309 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 310 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 311 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 312 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 313 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 314 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 315 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 316 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 317 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 318 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 319 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 320 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 321 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 322 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 323 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 324 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 325 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 326 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 327 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 328 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 329 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 330 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 331 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 332 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 333 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 334 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 335 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 336 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 337 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 338 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 339 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 340 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 341 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 342 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 343 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 344 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 345 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 346 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 347 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 348 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 349 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 350 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 351 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 352 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 353 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 354 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 355 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 356 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 357 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 358 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 359 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 360 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 361 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 362 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 363 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 364 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 365 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 366 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 367 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 368 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 369 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 370 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 371 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 372 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 373 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 374 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 375 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 376 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 377 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 378 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 379 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 380 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 381 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 382 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 383 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 384 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 385 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 386 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 440 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 441 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 442 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 443 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 444 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 445 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 446 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 447 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 448 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 449 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 450 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 451 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 452 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 453 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 454 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 455 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 456 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 457 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 458 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 459 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 460 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 461 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 462 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 463 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 464 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 465 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 466 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 467 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 468 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 469 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 470 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 471 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 472 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 473 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 474 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 475 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 476 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 477 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 478 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 479 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 480 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 481 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 482 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 483 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 484 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 485 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 486 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 487 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 488 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 489 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 490 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 491 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 492 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 493 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 494 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 495 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 496 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 497 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 498 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 499 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 500 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 501 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 502 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 503 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 504 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 505 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 506 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 507 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 508 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 509 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 510 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 511 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 512 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 513 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 514 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 515 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 516 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 517 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 518 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 519 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 520 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 521 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 522 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 523 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 524 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 525 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 526 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 527 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 528 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 529 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 530 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 531 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 532 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 533 | 3300053097 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere | Metagenome | Endosphere |
| 534 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 535 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 536 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 537 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 538 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 539 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 540 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 541 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 542 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 543 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 544 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 545 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 546 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 547 | 3300053144 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere | Metagenome | Endosphere |
| 548 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 549 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 550 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 551 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 552 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 553 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 554 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 555 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 556 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 557 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 558 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 559 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 560 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 561 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 562 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 563 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 564 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 565 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 566 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 567 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 568 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 569 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 570 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 571 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 572 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 573 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 574 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 575 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 576 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 577 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 578 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 89.34 |
| Metatranscriptomes | 0 |
| Isolates | 10.66 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 12.99 |
| Nodule | 7.93 |
| Rhizoplane | 5.93 |
| Rhizosphere | 62.95 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.2 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1021087 | 3300001904 | Bacteria | 1022 |
| 2 | JGI24739J22299_10146617 | 3300001989 | Bacteria | 698 |
| 3 | JGI25165J46597_1012230 | 3300003214 | Bacteria | 1205 |
| 4 | JGI25165J46597_1026221 | 3300003214 | Bacteria | 755 |
| 5 | JGI25153J46596_10002319 | 3300003215 | Bacteria | 11056 |
| 6 | JGI25153J46596_10009452 | 3300003215 | Bacteria | 4528 |
| 7 | JGI25153J46596_10015838 | 3300003215 | Bacteria | 3049 |
| 8 | JGI25153J46596_10079426 | 3300003215 | Bacteria | 823 |
| 9 | JGI25160J50197_1002079 | 3300003354 | Bacteria | 9515 |
| 10 | JGI25160J50197_1003509 | 3300003354 | Bacteria | 7001 |
| 11 | Ga0055531_10010256 | 3300003794 | Bacteria | 4683 |
| 12 | Ga0055543_1003926 | 3300004625 | Bacteria | 4202 |
| 13 | Ga0065165_1001577 | 3300005262 | Bacteria | 23479 |
| 14 | Ga0065165_1003271 | 3300005262 | Bacteria | 11689 |
| 15 | Ga0065165_1011199 | 3300005262 | Bacteria | 3774 |
| 16 | Ga0065707_10180538 | 3300005295 | Bacteria | 1418 |
| 17 | Ga0070658_10212875 | 3300005327 | Bacteria | 1633 |
| 18 | Ga0070658_10417327 | 3300005327 | Bacteria | 1154 |
| 19 | Ga0070658_10901556 | 3300005327 | Bacteria | 769 |
| 20 | Ga0070676_10364825 | 3300005328 | Bacteria | 996 |
| 21 | Ga0070683_100097917 | 3300005329 | Bacteria | 2760 |
| 22 | Ga0070690_100160818 | 3300005330 | Bacteria | 1539 |
| 23 | Ga0068869_100020962 | 3300005334 | Bacteria | 4491 |
| 24 | Ga0068869_100194276 | 3300005334 | Bacteria | 1597 |
| 25 | Ga0070666_10171222 | 3300005335 | Bacteria | 1521 |
| 26 | Ga0070666_10528762 | 3300005335 | Bacteria | 856 |
| 27 | Ga0070680_100047508 | 3300005336 | Bacteria | 3496 |
| 28 | Ga0070680_101253899 | 3300005336 | Bacteria | 641 |
| 29 | Ga0070682_100048952 | 3300005337 | Bacteria | 2634 |
| 30 | Ga0070682_101275761 | 3300005337 | Bacteria | 623 |
| 31 | Ga0070682_101930484 | 3300005337 | Bacteria | 518 |
| 32 | Ga0068868_100057233 | 3300005338 | Bacteria | 3080 |
| 33 | Ga0068868_100301779 | 3300005338 | Bacteria | 1360 |
| 34 | Ga0068868_100539476 | 3300005338 | Bacteria | 1027 |
| 35 | Ga0070689_100413365 | 3300005340 | Bacteria | 1142 |
| 36 | Ga0070689_101670846 | 3300005340 | Bacteria | 579 |
| 37 | Ga0070687_101535525 | 3300005343 | Bacteria | 502 |
| 38 | Ga0070661_100037493 | 3300005344 | Bacteria | 3527 |
| 39 | Ga0070661_101084222 | 3300005344 | Bacteria | 667 |
| 40 | Ga0070668_100030699 | 3300005347 | Bacteria | 4088 |
| 41 | Ga0070668_100144595 | 3300005347 | Bacteria | 1918 |
| 42 | Ga0070668_100202596 | 3300005347 | Bacteria | 1629 |
| 43 | Ga0070668_100220982 | 3300005347 | Bacteria | 1562 |
| 44 | Ga0070668_100536575 | 3300005347 | Bacteria | 1017 |
| 45 | Ga0070668_100883897 | 3300005347 | Bacteria | 798 |
| 46 | Ga0070669_100084960 | 3300005353 | Bacteria | 2363 |
| 47 | Ga0070669_100571491 | 3300005353 | Bacteria | 944 |
| 48 | Ga0070669_100827498 | 3300005353 | Bacteria | 788 |
| 49 | Ga0070675_100787007 | 3300005354 | Bacteria | 869 |
| 50 | Ga0070671_100016959 | 3300005355 | Bacteria | 5890 |
| 51 | Ga0070671_100173004 | 3300005355 | Bacteria | 1827 |
| 52 | Ga0070671_100375167 | 3300005355 | Bacteria | 1215 |
| 53 | Ga0070671_100400113 | 3300005355 | Bacteria | 1175 |
| 54 | Ga0070674_100054414 | 3300005356 | Bacteria | 2768 |
| 55 | Ga0070659_100309167 | 3300005366 | Bacteria | 1319 |
| 56 | Ga0070659_100368183 | 3300005366 | Bacteria | 1208 |
| 57 | Ga0070667_100198123 | 3300005367 | Bacteria | 1781 |
| 58 | Ga0070667_100323630 | 3300005367 | Bacteria | 1392 |
| 59 | Ga0070667_100566270 | 3300005367 | Bacteria | 1045 |
| 60 | Ga0070667_100755351 | 3300005367 | Bacteria | 902 |
| 61 | Ga0070709_10007376 | 3300005434 | Bacteria | 6025 |
| 62 | Ga0070709_10017852 | 3300005434 | Bacteria | 4077 |
| 63 | Ga0070709_10294047 | 3300005434 | Bacteria | 1184 |
| 64 | Ga0070709_10731884 | 3300005434 | Bacteria | 772 |
| 65 | Ga0070714_100021753 | 3300005435 | Bacteria | 5249 |
| 66 | Ga0070714_100587337 | 3300005435 | Bacteria | 1069 |
| 67 | Ga0070714_100980272 | 3300005435 | Bacteria | 822 |
| 68 | Ga0070713_100020602 | 3300005436 | Bacteria | 5058 |
| 69 | Ga0070713_100025767 | 3300005436 | Bacteria | 4604 |
| 70 | Ga0070713_100027751 | 3300005436 | Bacteria | 4462 |
| 71 | Ga0070713_100040796 | 3300005436 | Bacteria | 3776 |
| 72 | Ga0070710_10000509 | 3300005437 | Bacteria | 18274 |
| 73 | Ga0070710_10037161 | 3300005437 | Bacteria | 2667 |
| 74 | Ga0070701_10490322 | 3300005438 | Bacteria | 796 |
| 75 | Ga0070711_100007654 | 3300005439 | Bacteria | 6578 |
| 76 | Ga0070700_100271444 | 3300005441 | Bacteria | 1225 |
| 77 | Ga0070700_100303333 | 3300005441 | Bacteria | 1167 |
| 78 | Ga0070694_100422542 | 3300005444 | Bacteria | 1047 |
| 79 | Ga0070663_100005879 | 3300005455 | Bacteria | 7336 |
| 80 | Ga0070663_100085339 | 3300005455 | Bacteria | 2329 |
| 81 | Ga0070663_100106479 | 3300005455 | Bacteria | 2100 |
| 82 | Ga0070663_100138533 | 3300005455 | Bacteria | 1855 |
| 83 | Ga0070663_100142887 | 3300005455 | Bacteria | 1829 |
| 84 | Ga0070663_100309624 | 3300005455 | Bacteria | 1267 |
| 85 | Ga0070663_100558360 | 3300005455 | Bacteria | 958 |
| 86 | Ga0070678_100006542 | 3300005456 | Bacteria | 6845 |
| 87 | Ga0070678_100036131 | 3300005456 | Bacteria | 3456 |
| 88 | Ga0070678_100036166 | 3300005456 | Bacteria | 3454 |
| 89 | Ga0070678_100051998 | 3300005456 | Bacteria | 2972 |
| 90 | Ga0070678_100099960 | 3300005456 | Bacteria | 2246 |
| 91 | Ga0070662_100241273 | 3300005457 | Bacteria | 1449 |
| 92 | Ga0070681_10131917 | 3300005458 | Bacteria | 2430 |
| 93 | Ga0070685_10058764 | 3300005466 | Bacteria | 2243 |
| 94 | Ga0070685_10340258 | 3300005466 | Bacteria | 1023 |
| 95 | Ga0070685_10950487 | 3300005466 | Bacteria | 642 |
| 96 | Ga0070706_100820314 | 3300005467 | Bacteria | 861 |
| 97 | Ga0070699_100087190 | 3300005518 | Bacteria | 2724 |
| 98 | Ga0070699_100122767 | 3300005518 | Bacteria | 2285 |
| 99 | Ga0070679_100048075 | 3300005530 | Bacteria | 4251 |
| 100 | Ga0070679_101078241 | 3300005530 | Bacteria | 748 |
| 101 | Ga0070684_101069546 | 3300005535 | Bacteria | 758 |
| 102 | Ga0070684_101409654 | 3300005535 | Bacteria | 656 |
| 103 | Ga0068853_100132768 | 3300005539 | Bacteria | 2230 |
| 104 | Ga0068853_100180909 | 3300005539 | Bacteria | 1912 |
| 105 | Ga0068853_100521118 | 3300005539 | Bacteria | 1124 |
| 106 | Ga0068853_100587591 | 3300005539 | Bacteria | 1057 |
| 107 | Ga0070672_100012466 | 3300005543 | Bacteria | 5969 |
| 108 | Ga0070672_101289933 | 3300005543 | Bacteria | 652 |
| 109 | Ga0070672_102022741 | 3300005543 | Bacteria | 519 |
| 110 | Ga0070695_100088185 | 3300005545 | Bacteria | 2065 |
| 111 | Ga0070695_100476496 | 3300005545 | Bacteria | 961 |
| 112 | Ga0070696_100041134 | 3300005546 | Bacteria | 3192 |
| 113 | Ga0070693_100434639 | 3300005547 | Bacteria | 918 |
| 114 | Ga0070693_100735925 | 3300005547 | Bacteria | 725 |
| 115 | Ga0070693_100818671 | 3300005547 | Bacteria | 692 |
| 116 | Ga0070665_100037937 | 3300005548 | Bacteria | 4844 |
| 117 | Ga0070665_100038593 | 3300005548 | Bacteria | 4801 |
| 118 | Ga0070665_100038996 | 3300005548 | Bacteria | 4777 |
| 119 | Ga0070665_100051102 | 3300005548 | Bacteria | 4147 |
| 120 | Ga0070665_100082922 | 3300005548 | Bacteria | 3211 |
| 121 | Ga0070665_100223303 | 3300005548 | Bacteria | 1884 |
| 122 | Ga0068855_100008246 | 3300005563 | Bacteria | 12595 |
| 123 | Ga0070664_101193111 | 3300005564 | Bacteria | 718 |
| 124 | Ga0068854_100576307 | 3300005578 | Bacteria | 958 |
| 125 | Ga0068854_100635685 | 3300005578 | Bacteria | 915 |
| 126 | Ga0068856_100089112 | 3300005614 | Bacteria | 3068 |
| 127 | Ga0068856_100119368 | 3300005614 | Bacteria | 2638 |
| 128 | Ga0068856_101170178 | 3300005614 | Bacteria | 785 |
| 129 | Ga0068856_102492042 | 3300005614 | Bacteria | 524 |
| 130 | Ga0068852_100128340 | 3300005616 | Bacteria | 2332 |
| 131 | Ga0068852_100393855 | 3300005616 | Bacteria | 1361 |
| 132 | Ga0068852_100606399 | 3300005616 | Bacteria | 1099 |
| 133 | Ga0068852_101187831 | 3300005616 | Bacteria | 784 |
| 134 | Ga0068859_100190639 | 3300005617 | Bacteria | 2134 |
| 135 | Ga0068859_100201434 | 3300005617 | Bacteria | 2075 |
| 136 | Ga0068859_102126299 | 3300005617 | Bacteria | 620 |
| 137 | Ga0068864_100085670 | 3300005618 | Bacteria | 2770 |
| 138 | Ga0068864_100896179 | 3300005618 | Bacteria | 876 |
| 139 | Ga0068864_101566270 | 3300005618 | Bacteria | 663 |
| 140 | Ga0068866_10047267 | 3300005718 | Bacteria | 2169 |
| 141 | Ga0068866_10196323 | 3300005718 | Bacteria | 1203 |
| 142 | Ga0068861_100116638 | 3300005719 | Bacteria | 2147 |
| 143 | Ga0068861_100397802 | 3300005719 | Bacteria | 1222 |
| 144 | Ga0068861_102118750 | 3300005719 | Bacteria | 562 |
| 145 | Ga0068863_100174025 | 3300005841 | Bacteria | 2065 |
| 146 | Ga0068863_100230130 | 3300005841 | Bacteria | 1788 |
| 147 | Ga0068863_100694930 | 3300005841 | Bacteria | 1011 |
| 148 | Ga0068863_101086733 | 3300005841 | Bacteria | 804 |
| 149 | Ga0068858_100032885 | 3300005842 | Bacteria | 4816 |
| 150 | Ga0068858_100204734 | 3300005842 | Bacteria | 1867 |
| 151 | Ga0068858_100354447 | 3300005842 | Bacteria | 1406 |
| 152 | Ga0068858_101355394 | 3300005842 | Bacteria | 700 |
| 153 | Ga0068858_101417153 | 3300005842 | Bacteria | 685 |
| 154 | Ga0068860_100224288 | 3300005843 | Bacteria | 1825 |
| 155 | Ga0068860_100400551 | 3300005843 | Bacteria | 1358 |
| 156 | Ga0068862_100212473 | 3300005844 | Bacteria | 1748 |
| 157 | Ga0068862_100240010 | 3300005844 | Bacteria | 1647 |
| 158 | Ga0068862_100451097 | 3300005844 | Bacteria | 1212 |
| 159 | Ga0068862_100625080 | 3300005844 | Bacteria | 1036 |
| 160 | Ga0081455_10002888 | 3300005937 | Bacteria | 20196 |
| 161 | Ga0081455_10090886 | 3300005937 | Bacteria | 2474 |
| 162 | Ga0081455_10150392 | 3300005937 | Bacteria | 1796 |
| 163 | Ga0081455_10209166 | 3300005937 | Bacteria | 1455 |
| 164 | Ga0081455_10241891 | 3300005937 | Bacteria | 1326 |
| 165 | Ga0081455_10394015 | 3300005937 | Bacteria | 963 |
| 166 | Ga0081540_1012679 | 3300005983 | Bacteria | 5530 |
| 167 | Ga0081540_1030256 | 3300005983 | Bacteria | 3002 |
| 168 | Ga0081540_1039809 | 3300005983 | Bacteria | 2460 |
| 169 | Ga0081539_10000945 | 3300005985 | Bacteria | 54444 |
| 170 | Ga0081539_10043762 | 3300005985 | Bacteria | 2592 |
| 171 | Ga0081539_10083471 | 3300005985 | Bacteria | 1672 |
| 172 | Ga0070717_10269788 | 3300006028 | Bacteria | 1507 |
| 173 | Ga0070717_10817020 | 3300006028 | Bacteria | 848 |
| 174 | Ga0070717_11278861 | 3300006028 | Bacteria | 667 |
| 175 | Ga0075365_10894864 | 3300006038 | Bacteria | 626 |
| 176 | Ga0075368_10015524 | 3300006042 | Bacteria | 2828 |
| 177 | Ga0075368_10117281 | 3300006042 | Bacteria | 1101 |
| 178 | Ga0075363_100006916 | 3300006048 | Bacteria | 5187 |
| 179 | Ga0075363_100035829 | 3300006048 | Bacteria | 2599 |
| 180 | Ga0075363_100238096 | 3300006048 | Bacteria | 1046 |
| 181 | Ga0075363_100244794 | 3300006048 | Bacteria | 1032 |
| 182 | Ga0075364_10019010 | 3300006051 | Bacteria | 4309 |
| 183 | Ga0075364_10091731 | 3300006051 | Bacteria | 2016 |
| 184 | Ga0070715_10043635 | 3300006163 | Bacteria | 1892 |
| 185 | Ga0070715_10135225 | 3300006163 | Bacteria | 1191 |
| 186 | Ga0070716_100049801 | 3300006173 | Bacteria | 2375 |
| 187 | Ga0070716_100072066 | 3300006173 | Unclassified | 2033 |
| 188 | Ga0070716_101764138 | 3300006173 | Bacteria | 512 |
| 189 | Ga0070712_100004995 | 3300006175 | Bacteria | 8209 |
| 190 | Ga0070712_100048327 | 3300006175 | Bacteria | 2949 |
| 191 | Ga0070712_100822714 | 3300006175 | Bacteria | 798 |
| 192 | Ga0075362_10072825 | 3300006177 | Bacteria | 1572 |
| 193 | Ga0075362_10146714 | 3300006177 | Bacteria | 1130 |
| 194 | Ga0075362_10248331 | 3300006177 | Bacteria | 875 |
| 195 | Ga0075367_10005440 | 3300006178 | Bacteria | 6323 |
| 196 | Ga0075367_10018947 | 3300006178 | Bacteria | 3807 |
| 197 | Ga0075367_10056226 | 3300006178 | Bacteria | 2337 |
| 198 | Ga0075367_10293192 | 3300006178 | Bacteria | 1024 |
| 199 | Ga0075367_10510503 | 3300006178 | Bacteria | 763 |
| 200 | Ga0075369_10125152 | 3300006186 | Bacteria | 1165 |
| 201 | Ga0075366_10048174 | 3300006195 | Bacteria | 2527 |
| 202 | Ga0075366_10195698 | 3300006195 | Bacteria | 1229 |
| 203 | Ga0097621_100283128 | 3300006237 | Bacteria | 1460 |
| 204 | Ga0097621_100881220 | 3300006237 | Bacteria | 833 |
| 205 | Ga0097621_101325842 | 3300006237 | Bacteria | 680 |
| 206 | Ga0075370_10062772 | 3300006353 | Bacteria | 2117 |
| 207 | Ga0075370_10079858 | 3300006353 | Bacteria | 1879 |
| 208 | Ga0075370_10372660 | 3300006353 | Bacteria | 855 |
| 209 | Ga0068871_100619219 | 3300006358 | Bacteria | 986 |
| 210 | Ga0068871_101167842 | 3300006358 | Bacteria | 721 |
| 211 | Ga0068871_101427706 | 3300006358 | Bacteria | 653 |
| 212 | Ga0068865_100127424 | 3300006881 | Bacteria | 1902 |
| 213 | Ga0068865_100626176 | 3300006881 | Bacteria | 912 |
| 214 | Ga0097620_100190656 | 3300006931 | Bacteria | 2134 |
| 215 | Ga0097620_100201420 | 3300006931 | Bacteria | 2075 |
| 216 | Ga0097620_102126300 | 3300006931 | Bacteria | 620 |
| 217 | Ga0099824_1009392 | 3300006942 | Bacteria | 12057 |
| 218 | Ga0099822_1000514 | 3300006943 | Bacteria | 36429 |
| 219 | Ga0099823_1022671 | 3300006944 | Bacteria | 5798 |
| 220 | Ga0099794_10009322 | 3300007265 | Bacteria | 4121 |
| 221 | Ga0099794_10262941 | 3300007265 | Bacteria | 891 |
| 222 | Ga0099795_10015351 | 3300007788 | Bacteria | 2397 |
| 223 | Ga0099795_10037493 | 3300007788 | Bacteria | 1706 |
| 224 | Ga0105250_10162509 | 3300009092 | Bacteria | 933 |
| 225 | Ga0105250_10427447 | 3300009092 | Bacteria | 591 |
| 226 | Ga0105240_10022867 | 3300009093 | Bacteria | 8282 |
| 227 | Ga0105240_10060844 | 3300009093 | Bacteria | 4707 |
| 228 | Ga0105240_10201857 | 3300009093 | Bacteria | 2329 |
| 229 | Ga0105240_10233840 | 3300009093 | Bacteria | 2134 |
| 230 | Ga0111539_10718369 | 3300009094 | Bacteria | 1163 |
| 231 | Ga0105245_10009619 | 3300009098 | Bacteria | 8432 |
| 232 | Ga0105245_10030906 | 3300009098 | Bacteria | 4737 |
| 233 | Ga0105245_10188078 | 3300009098 | Bacteria | 1976 |
| 234 | Ga0105245_10415340 | 3300009098 | Bacteria | 1347 |
| 235 | Ga0105245_10593730 | 3300009098 | Bacteria | 1133 |
| 236 | Ga0105247_10012238 | 3300009101 | Bacteria | 5155 |
| 237 | Ga0105247_11189065 | 3300009101 | Bacteria | 606 |
| 238 | Ga0114129_11297391 | 3300009147 | Bacteria | 902 |
| 239 | Ga0105243_10240844 | 3300009148 | Bacteria | 1610 |
| 240 | Ga0105243_10304699 | 3300009148 | Bacteria | 1445 |
| 241 | Ga0105243_10364502 | 3300009148 | Bacteria | 1331 |
| 242 | Ga0105241_10078928 | 3300009174 | Bacteria | 2573 |
| 243 | Ga0105241_10088821 | 3300009174 | Bacteria | 2434 |
| 244 | Ga0105241_10379256 | 3300009174 | Bacteria | 1235 |
| 245 | Ga0105241_10722583 | 3300009174 | Bacteria | 911 |
| 246 | Ga0105241_11310460 | 3300009174 | Bacteria | 690 |
| 247 | Ga0105242_10354340 | 3300009176 | Bacteria | 1356 |
| 248 | Ga0105242_10529692 | 3300009176 | Bacteria | 1126 |
| 249 | Ga0105242_10550984 | 3300009176 | Bacteria | 1106 |
| 250 | Ga0105242_11755633 | 3300009176 | Bacteria | 658 |
| 251 | Ga0105248_10236929 | 3300009177 | Bacteria | 2054 |
| 252 | Ga0105248_10772422 | 3300009177 | Bacteria | 1084 |
| 253 | Ga0105248_11199924 | 3300009177 | Bacteria | 858 |
| 254 | Ga0105237_10009071 | 3300009545 | Bacteria | 10687 |
| 255 | Ga0105237_10047396 | 3300009545 | Bacteria | 4320 |
| 256 | Ga0105237_10205488 | 3300009545 | Bacteria | 1970 |
| 257 | Ga0105237_10217744 | 3300009545 | Bacteria | 1909 |
| 258 | Ga0105237_10283700 | 3300009545 | Bacteria | 1659 |
| 259 | Ga0105237_10353753 | 3300009545 | Bacteria | 1473 |
| 260 | Ga0105237_11114500 | 3300009545 | Bacteria | 796 |
| 261 | Ga0105237_12285899 | 3300009545 | Bacteria | 550 |
| 262 | Ga0105238_10160883 | 3300009551 | Bacteria | 2221 |
| 263 | Ga0105238_10366840 | 3300009551 | Bacteria | 1430 |
| 264 | Ga0105238_10723596 | 3300009551 | Bacteria | 1008 |
| 265 | Ga0105238_11283815 | 3300009551 | Bacteria | 758 |
| 266 | Ga0105249_10371858 | 3300009553 | Bacteria | 1453 |
| 267 | Ga0105249_10910208 | 3300009553 | Bacteria | 947 |
| 268 | Ga0099796_10011316 | 3300010159 | Bacteria | 2485 |
| 269 | Ga0105239_10048157 | 3300010375 | Bacteria | 4673 |
| 270 | Ga0105239_10132157 | 3300010375 | Bacteria | 2777 |
| 271 | Ga0105239_10143828 | 3300010375 | Bacteria | 2658 |
| 272 | Ga0105239_10160763 | 3300010375 | Bacteria | 2509 |
| 273 | Ga0105239_10420828 | 3300010375 | Bacteria | 1513 |
| 274 | Ga0105239_10473650 | 3300010375 | Bacteria | 1422 |
| 275 | Ga0105239_10568477 | 3300010375 | Bacteria | 1292 |
| 276 | Ga0105239_12022104 | 3300010375 | Bacteria | 669 |
| 277 | Ga0105246_10016029 | 3300011119 | Bacteria | 4741 |
| 278 | Ga0105246_10081283 | 3300011119 | Bacteria | 2309 |
| 279 | Ga0105246_10250258 | 3300011119 | Bacteria | 1406 |
| 280 | Ga0105246_10639571 | 3300011119 | Bacteria | 924 |
| 281 | Ga0157323_1032919 | 3300012495 | Bacteria | 559 |
| 282 | Ga0157373_10296683 | 3300013100 | Bacteria | 1147 |
| 283 | Ga0157370_10067944 | 3300013104 | Bacteria | 3369 |
| 284 | Ga0157370_10128852 | 3300013104 | Bacteria | 2361 |
| 285 | Ga0157370_10208636 | 3300013104 | Bacteria | 1811 |
| 286 | Ga0157370_11714495 | 3300013104 | Bacteria | 564 |
| 287 | Ga0157369_10006777 | 3300013105 | Bacteria | 13217 |
| 288 | Ga0157369_10630778 | 3300013105 | Bacteria | 1106 |
| 289 | Ga0157369_10640261 | 3300013105 | Bacteria | 1097 |
| 290 | Ga0157369_11063775 | 3300013105 | Bacteria | 827 |
| 291 | Ga0157374_10640324 | 3300013296 | Bacteria | 1074 |
| 292 | Ga0157378_10052677 | 3300013297 | Bacteria | 3621 |
| 293 | Ga0157378_11792963 | 3300013297 | Bacteria | 662 |
| 294 | Ga0163162_10041842 | 3300013306 | Bacteria | 4584 |
| 295 | Ga0163162_10168343 | 3300013306 | Bacteria | 2315 |
| 296 | Ga0163162_10403251 | 3300013306 | Bacteria | 1500 |
| 297 | Ga0163162_10477785 | 3300013306 | Bacteria | 1378 |
| 298 | Ga0163162_11305588 | 3300013306 | Bacteria | 824 |
| 299 | Ga0163162_11347941 | 3300013306 | Bacteria | 811 |
| 300 | Ga0163162_11688210 | 3300013306 | Bacteria | 723 |
| 301 | Ga0157375_10268156 | 3300013308 | Bacteria | 1869 |
| 302 | Ga0163163_10139629 | 3300014325 | Bacteria | 2465 |
| 303 | Ga0163163_10352379 | 3300014325 | Bacteria | 1528 |
| 304 | Ga0163163_10502220 | 3300014325 | Bacteria | 1275 |
| 305 | Ga0163163_10980453 | 3300014325 | Bacteria | 908 |
| 306 | Ga0163163_11395180 | 3300014325 | Bacteria | 762 |
| 307 | Ga0157380_10222173 | 3300014326 | Bacteria | 1691 |
| 308 | Ga0157380_10288892 | 3300014326 | Bacteria | 1505 |
| 309 | Ga0157380_10439756 | 3300014326 | Bacteria | 1249 |
| 310 | Ga0182008_10744428 | 3300014497 | Bacteria | 564 |
| 311 | Ga0157377_10165116 | 3300014745 | Bacteria | 1380 |
| 312 | Ga0157379_10228819 | 3300014968 | Bacteria | 1685 |
| 313 | Ga0157379_10404762 | 3300014968 | Bacteria | 1255 |
| 314 | Ga0157379_11024733 | 3300014968 | Bacteria | 788 |
| 315 | Ga0157376_10126305 | 3300014969 | Bacteria | 2275 |
| 316 | Ga0157376_10441462 | 3300014969 | Bacteria | 1267 |
| 317 | Ga0182007_10162187 | 3300015262 | Bacteria | 765 |
| 318 | Ga0163161_10127501 | 3300017792 | Bacteria | 1917 |
| 319 | Ga0214544_1000001 | 3300021320 | Bacteria | 783667 |
| 320 | Ga0214542_1000005 | 3300021321 | Bacteria | 389646 |
| 321 | Ga0214542_1027073 | 3300021321 | Bacteria | 2684 |
| 322 | Ga0214545_1000003 | 3300021324 | Bacteria | 720274 |
| 323 | Ga0214545_1019813 | 3300021324 | Bacteria | 5618 |
| 324 | Ga0214543_1000002 | 3300021327 | Bacteria | 712733 |
| 325 | Ga0214543_1039960 | 3300021327 | Bacteria | 1271 |
| 326 | Ga0213873_10031211 | 3300021358 | Bacteria | 1324 |
| 327 | Ga0213871_10018916 | 3300021441 | Bacteria | 1690 |
| 328 | Ga0209563_110124 | 3300025230 | Bacteria | 1391 |
| 329 | Ga0207425_1009648 | 3300025245 | Bacteria | 2391 |
| 330 | Ga0209677_105397 | 3300025253 | Bacteria | 3345 |
| 331 | Ga0209148_1008346 | 3300025254 | Bacteria | 2086 |
| 332 | Ga0209233_1003418 | 3300025261 | Bacteria | 5595 |
| 333 | Ga0209233_1006411 | 3300025261 | Bacteria | 3795 |
| 334 | Ga0209233_1008559 | 3300025261 | Bacteria | 3156 |
| 335 | Ga0209233_1022427 | 3300025261 | Bacteria | 1615 |
| 336 | Ga0209455_1007598 | 3300025272 | Bacteria | 3039 |
| 337 | Ga0209455_1021895 | 3300025272 | Bacteria | 1229 |
| 338 | Ga0209758_1000026 | 3300025297 | Bacteria | 582706 |
| 339 | Ga0209758_1000479 | 3300025297 | Bacteria | 65956 |
| 340 | Ga0209758_1005453 | 3300025297 | Bacteria | 9789 |
| 341 | Ga0209758_1005713 | 3300025297 | Bacteria | 9388 |
| 342 | Ga0209758_1009114 | 3300025297 | Bacteria | 6256 |
| 343 | Ga0209758_1029176 | 3300025297 | Bacteria | 2313 |
| 344 | Ga0209758_1059991 | 3300025297 | Bacteria | 1262 |
| 345 | Ga0209256_1027256 | 3300025299 | Bacteria | 1631 |
| 346 | Ga0207426_1001455 | 3300025302 | Bacteria | 19596 |
| 347 | Ga0207426_1002534 | 3300025302 | Bacteria | 11465 |
| 348 | Ga0207426_1030642 | 3300025302 | Bacteria | 1763 |
| 349 | Ga0207426_1045255 | 3300025302 | Bacteria | 1340 |
| 350 | Ga0209051_1069589 | 3300025303 | Bacteria | 1066 |
| 351 | Ga0209051_1146783 | 3300025303 | Bacteria | 559 |
| 352 | Ga0209257_1005738 | 3300025304 | Bacteria | 8496 |
| 353 | Ga0209257_1009389 | 3300025304 | Bacteria | 5259 |
| 354 | Ga0207697_10017910 | 3300025315 | Bacteria | 2908 |
| 355 | Ga0207697_10095675 | 3300025315 | Bacteria | 1262 |
| 356 | Ga0207656_10303524 | 3300025321 | Bacteria | 790 |
| 357 | Ga0207710_10131988 | 3300025900 | Bacteria | 1200 |
| 358 | Ga0207688_10147599 | 3300025901 | Bacteria | 1387 |
| 359 | Ga0207688_10295931 | 3300025901 | Bacteria | 989 |
| 360 | Ga0207688_10416004 | 3300025901 | Bacteria | 835 |
| 361 | Ga0207688_10557880 | 3300025901 | Bacteria | 720 |
| 362 | Ga0207688_10772746 | 3300025901 | Bacteria | 608 |
| 363 | Ga0207680_10153136 | 3300025903 | Bacteria | 1539 |
| 364 | Ga0207647_10001122 | 3300025904 | Bacteria | 20595 |
| 365 | Ga0207647_10127468 | 3300025904 | Bacteria | 1497 |
| 366 | Ga0207647_10359708 | 3300025904 | Bacteria | 824 |
| 367 | Ga0207699_10042139 | 3300025906 | Bacteria | 2642 |
| 368 | Ga0207699_10047079 | 3300025906 | Bacteria | 2526 |
| 369 | Ga0207699_10448861 | 3300025906 | Bacteria | 925 |
| 370 | Ga0207699_10629452 | 3300025906 | Bacteria | 783 |
| 371 | Ga0207645_10109815 | 3300025907 | Bacteria | 1785 |
| 372 | Ga0207645_10294283 | 3300025907 | Bacteria | 1080 |
| 373 | Ga0207645_10372972 | 3300025907 | Bacteria | 957 |
| 374 | Ga0207705_10063754 | 3300025909 | Bacteria | 2663 |
| 375 | Ga0207705_10350171 | 3300025909 | Bacteria | 1138 |
| 376 | Ga0207684_10264942 | 3300025910 | Bacteria | 1483 |
| 377 | Ga0207684_10466915 | 3300025910 | Bacteria | 1083 |
| 378 | Ga0207654_10031489 | 3300025911 | Bacteria | 2922 |
| 379 | Ga0207654_10057695 | 3300025911 | Bacteria | 2257 |
| 380 | Ga0207654_10514235 | 3300025911 | Bacteria | 847 |
| 381 | Ga0207707_11034968 | 3300025912 | Bacteria | 672 |
| 382 | Ga0207695_10146707 | 3300025913 | Bacteria | 2303 |
| 383 | Ga0207695_10249945 | 3300025913 | Bacteria | 1673 |
| 384 | Ga0207695_10419804 | 3300025913 | Bacteria | 1222 |
| 385 | Ga0207695_10704868 | 3300025913 | Bacteria | 890 |
| 386 | Ga0207671_11054244 | 3300025914 | Bacteria | 639 |
| 387 | Ga0207671_11343030 | 3300025914 | Bacteria | 556 |
| 388 | Ga0207693_10002721 | 3300025915 | Bacteria | 15312 |
| 389 | Ga0207693_10073082 | 3300025915 | Bacteria | 2685 |
| 390 | Ga0207693_10165680 | 3300025915 | Bacteria | 1740 |
| 391 | Ga0207663_10168514 | 3300025916 | Bacteria | 1553 |
| 392 | Ga0207660_10046176 | 3300025917 | Bacteria | 3072 |
| 393 | Ga0207662_10142934 | 3300025918 | Bacteria | 1517 |
| 394 | Ga0207657_10090831 | 3300025919 | Bacteria | 2548 |
| 395 | Ga0207657_10642127 | 3300025919 | Bacteria | 827 |
| 396 | Ga0207657_10944750 | 3300025919 | Bacteria | 663 |
| 397 | Ga0207646_11030532 | 3300025922 | Bacteria | 726 |
| 398 | Ga0207681_10056349 | 3300025923 | Bacteria | 2681 |
| 399 | Ga0207681_10700819 | 3300025923 | Bacteria | 842 |
| 400 | Ga0207694_10249101 | 3300025924 | Bacteria | 1453 |
| 401 | Ga0207694_10459638 | 3300025924 | Bacteria | 1063 |
| 402 | Ga0207650_10157843 | 3300025925 | Bacteria | 1795 |
| 403 | Ga0207650_10656129 | 3300025925 | Bacteria | 885 |
| 404 | Ga0207650_10864118 | 3300025925 | Bacteria | 768 |
| 405 | Ga0207659_10488826 | 3300025926 | Bacteria | 1041 |
| 406 | Ga0207687_10178430 | 3300025927 | Bacteria | 1644 |
| 407 | Ga0207687_10240498 | 3300025927 | Bacteria | 1434 |
| 408 | Ga0207700_10034721 | 3300025928 | Bacteria | 3623 |
| 409 | Ga0207700_10049919 | 3300025928 | Bacteria | 3115 |
| 410 | Ga0207700_10527112 | 3300025928 | Bacteria | 1047 |
| 411 | Ga0207700_11377182 | 3300025928 | Bacteria | 627 |
| 412 | Ga0207664_10005551 | 3300025929 | Bacteria | 8637 |
| 413 | Ga0207664_11449492 | 3300025929 | Bacteria | 608 |
| 414 | Ga0207644_10329070 | 3300025931 | Bacteria | 1237 |
| 415 | Ga0207644_11418262 | 3300025931 | Bacteria | 583 |
| 416 | Ga0207690_10583846 | 3300025932 | Bacteria | 911 |
| 417 | Ga0207690_11231681 | 3300025932 | Bacteria | 625 |
| 418 | Ga0207706_10101453 | 3300025933 | Bacteria | 2532 |
| 419 | Ga0207706_10193204 | 3300025933 | Bacteria | 1786 |
| 420 | Ga0207706_10856691 | 3300025933 | Bacteria | 769 |
| 421 | Ga0207709_10007189 | 3300025935 | Bacteria | 6214 |
| 422 | Ga0207709_10155618 | 3300025935 | Bacteria | 1588 |
| 423 | Ga0207709_10275668 | 3300025935 | Bacteria | 1240 |
| 424 | Ga0207709_11154410 | 3300025935 | Bacteria | 637 |
| 425 | Ga0207665_10044199 | 3300025939 | Bacteria | 2981 |
| 426 | Ga0207665_10158096 | 3300025939 | Unclassified | 1628 |
| 427 | Ga0207691_10068065 | 3300025940 | Bacteria | 3217 |
| 428 | Ga0207711_10551367 | 3300025941 | Bacteria | 1075 |
| 429 | Ga0207711_10797332 | 3300025941 | Bacteria | 880 |
| 430 | Ga0207689_10118666 | 3300025942 | Bacteria | 2176 |
| 431 | Ga0207689_10924399 | 3300025942 | Bacteria | 736 |
| 432 | Ga0207661_10159549 | 3300025944 | Bacteria | 1956 |
| 433 | Ga0207679_10168233 | 3300025945 | Bacteria | 1802 |
| 434 | Ga0207667_10024730 | 3300025949 | Bacteria | 6586 |
| 435 | Ga0207667_10127423 | 3300025949 | Bacteria | 2622 |
| 436 | Ga0207667_11175661 | 3300025949 | Bacteria | 748 |
| 437 | Ga0207651_10051526 | 3300025960 | Bacteria | 2801 |
| 438 | Ga0207651_10514884 | 3300025960 | Bacteria | 1036 |
| 439 | Ga0207651_11837211 | 3300025960 | Bacteria | 545 |
| 440 | Ga0207712_10019100 | 3300025961 | Bacteria | 4472 |
| 441 | Ga0207712_10030112 | 3300025961 | Bacteria | 3647 |
| 442 | Ga0207668_10168921 | 3300025972 | Bacteria | 1713 |
| 443 | Ga0207668_10331912 | 3300025972 | Bacteria | 1265 |
| 444 | Ga0207668_10691884 | 3300025972 | Bacteria | 895 |
| 445 | Ga0207640_10433088 | 3300025981 | Bacteria | 1079 |
| 446 | Ga0207640_10577726 | 3300025981 | Bacteria | 948 |
| 447 | Ga0207640_11435223 | 3300025981 | Bacteria | 619 |
| 448 | Ga0207640_11442622 | 3300025981 | Bacteria | 617 |
| 449 | Ga0207658_10079721 | 3300025986 | Bacteria | 2506 |
| 450 | Ga0207658_10814510 | 3300025986 | Bacteria | 848 |
| 451 | Ga0207658_11557304 | 3300025986 | Bacteria | 604 |
| 452 | Ga0207677_10024382 | 3300026023 | Bacteria | 3757 |
| 453 | Ga0207677_10040965 | 3300026023 | Bacteria | 3059 |
| 454 | Ga0207677_10694527 | 3300026023 | Bacteria | 902 |
| 455 | Ga0207703_10088219 | 3300026035 | Bacteria | 2603 |
| 456 | Ga0207703_10372095 | 3300026035 | Bacteria | 1320 |
| 457 | Ga0207703_11219268 | 3300026035 | Bacteria | 723 |
| 458 | Ga0207703_11398401 | 3300026035 | Bacteria | 673 |
| 459 | Ga0207639_10123255 | 3300026041 | Bacteria | 2133 |
| 460 | Ga0207639_10160965 | 3300026041 | Bacteria | 1891 |
| 461 | Ga0207639_10177963 | 3300026041 | Bacteria | 1807 |
| 462 | Ga0207639_10222140 | 3300026041 | Bacteria | 1632 |
| 463 | Ga0207678_10010858 | 3300026067 | Bacteria | 8004 |
| 464 | Ga0207678_10026500 | 3300026067 | Bacteria | 5056 |
| 465 | Ga0207678_10040964 | 3300026067 | Bacteria | 4016 |
| 466 | Ga0207678_10044407 | 3300026067 | Bacteria | 3844 |
| 467 | Ga0207678_10047043 | 3300026067 | Bacteria | 3731 |
| 468 | Ga0207678_10089203 | 3300026067 | Bacteria | 2636 |
| 469 | Ga0207678_10432481 | 3300026067 | Bacteria | 1142 |
| 470 | Ga0207678_11227649 | 3300026067 | Bacteria | 664 |
| 471 | Ga0207708_10032916 | 3300026075 | Bacteria | 3936 |
| 472 | Ga0207708_10091810 | 3300026075 | Bacteria | 2342 |
| 473 | Ga0207708_10206436 | 3300026075 | Bacteria | 1569 |
| 474 | Ga0207708_10582403 | 3300026075 | Bacteria | 946 |
| 475 | Ga0207702_10075783 | 3300026078 | Bacteria | 2906 |
| 476 | Ga0207702_10997288 | 3300026078 | Bacteria | 831 |
| 477 | Ga0207702_11057578 | 3300026078 | Bacteria | 805 |
| 478 | Ga0207702_11117735 | 3300026078 | Bacteria | 782 |
| 479 | Ga0207641_10169171 | 3300026088 | Bacteria | 1993 |
| 480 | Ga0207641_10222696 | 3300026088 | Bacteria | 1750 |
| 481 | Ga0207641_10255998 | 3300026088 | Bacteria | 1637 |
| 482 | Ga0207648_10232722 | 3300026089 | Bacteria | 1639 |
| 483 | Ga0207648_10305220 | 3300026089 | Bacteria | 1428 |
| 484 | Ga0207676_10416254 | 3300026095 | Bacteria | 1259 |
| 485 | Ga0207676_10522185 | 3300026095 | Bacteria | 1130 |
| 486 | Ga0207676_11251383 | 3300026095 | Bacteria | 736 |
| 487 | Ga0207675_100167936 | 3300026118 | Bacteria | 2096 |
| 488 | Ga0207675_100489012 | 3300026118 | Bacteria | 1224 |
| 489 | Ga0207683_10034874 | 3300026121 | Bacteria | 4375 |
| 490 | Ga0207683_10047287 | 3300026121 | Bacteria | 3768 |
| 491 | Ga0207683_10353514 | 3300026121 | Bacteria | 1349 |
| 492 | Ga0207683_10575045 | 3300026121 | Bacteria | 1042 |
| 493 | Ga0207683_10673488 | 3300026121 | Bacteria | 959 |
| 494 | Ga0207698_10068650 | 3300026142 | Bacteria | 2800 |
| 495 | Ga0207698_10180252 | 3300026142 | Bacteria | 1870 |
| 496 | Ga0207698_10620973 | 3300026142 | Bacteria | 1068 |
| 497 | Ga0209389_1000057 | 3300027296 | Bacteria | 107632 |
| 498 | Ga0209589_1000007 | 3300027357 | Bacteria | 425699 |
| 499 | Ga0209489_100008 | 3300027361 | Bacteria | 425699 |
| 500 | Ga0209489_100226 | 3300027361 | Bacteria | 94384 |
| 501 | Ga0209700_100009 | 3300027363 | Bacteria | 425699 |
| 502 | Ga0209700_100085 | 3300027363 | Bacteria | 128517 |
| 503 | Ga0209179_1011461 | 3300027512 | Bacteria | 1571 |
| 504 | Ga0209813_10035974 | 3300027866 | Bacteria | 1485 |
| 505 | Ga0209813_10127925 | 3300027866 | Bacteria | 891 |
| 506 | Ga0268266_10001410 | 3300028379 | Bacteria | 28680 |
| 507 | Ga0268266_10007006 | 3300028379 | Bacteria | 10236 |
| 508 | Ga0268266_10027864 | 3300028379 | Bacteria | 4804 |
| 509 | Ga0268266_10029572 | 3300028379 | Bacteria | 4657 |
| 510 | Ga0268266_10046226 | 3300028379 | Bacteria | 3727 |
| 511 | Ga0268266_10100933 | 3300028379 | Bacteria | 2543 |
| 512 | Ga0268266_10331734 | 3300028379 | Bacteria | 1426 |
| 513 | Ga0268265_10108662 | 3300028380 | Bacteria | 2258 |
| 514 | Ga0268265_10301740 | 3300028380 | Bacteria | 1442 |
| 515 | Ga0268265_10358339 | 3300028380 | Bacteria | 1334 |
| 516 | Ga0268264_10278652 | 3300028381 | Bacteria | 1565 |
| 517 | Ga0268264_10475490 | 3300028381 | Bacteria | 1215 |
| 518 | Ga0268264_10821987 | 3300028381 | Bacteria | 929 |
| 519 | Ga0307517_10000248 | 3300028786 | Bacteria | 92084 |
| 520 | Ga0307517_10183062 | 3300028786 | Bacteria | 1348 |
| 521 | Ga0307515_10405686 | 3300028794 | Bacteria | 987 |
| 522 | Ga0307515_10616379 | 3300028794 | Bacteria | 696 |
| 523 | Ga0307515_10707915 | 3300028794 | Bacteria | 623 |
| 524 | Ga0265330_10055866 | 3300031235 | Bacteria | 1723 |
| 525 | Ga0265340_10001728 | 3300031247 | Bacteria | 12527 |
| 526 | Ga0265339_10002990 | 3300031249 | Bacteria | 11935 |
| 527 | Ga0265331_10019457 | 3300031250 | Bacteria | 3506 |
| 528 | Ga0265316_10334795 | 3300031344 | Bacteria | 1098 |
| 529 | Ga0307509_11006177 | 3300031507 | Bacteria | 501 |
| 530 | Ga0307408_100524460 | 3300031548 | Bacteria | 1041 |
| 531 | Ga0307408_100660726 | 3300031548 | Bacteria | 936 |
| 532 | Ga0307508_10086597 | 3300031616 | Bacteria | 2716 |
| 533 | Ga0265314_10057154 | 3300031711 | Bacteria | 2682 |
| 534 | Ga0265342_10000444 | 3300031712 | Bacteria | 45263 |
| 535 | Ga0307516_10005798 | 3300031730 | Bacteria | 14633 |
| 536 | Ga0307516_10948613 | 3300031730 | Bacteria | 529 |
| 537 | Ga0307405_10299483 | 3300031731 | Bacteria | 1219 |
| 538 | Ga0307413_10136694 | 3300031824 | Bacteria | 1686 |
| 539 | Ga0307410_10021949 | 3300031852 | Bacteria | 3937 |
| 540 | Ga0307406_10094255 | 3300031901 | Bacteria | 2023 |
| 541 | Ga0307407_10193574 | 3300031903 | Bacteria | 1357 |
| 542 | Ga0307412_10558885 | 3300031911 | Bacteria | 962 |
| 543 | Ga0307409_100249168 | 3300031995 | Bacteria | 1623 |
| 544 | Ga0307409_100377484 | 3300031995 | Bacteria | 1346 |
| 545 | Ga0307416_100041830 | 3300032002 | Bacteria | 3572 |
| 546 | Ga0307416_100117420 | 3300032002 | Bacteria | 2362 |
| 547 | Ga0307416_100230256 | 3300032002 | Bacteria | 1786 |
| 548 | Ga0307416_102330311 | 3300032002 | Bacteria | 636 |
| 549 | Ga0307414_10335122 | 3300032004 | Bacteria | 1293 |
| 550 | Ga0307411_10053188 | 3300032005 | Bacteria | 2651 |
| 551 | Ga0307415_100585659 | 3300032126 | Bacteria | 990 |
| 552 | Ga0307510_10049737 | 3300033180 | Bacteria | 4456 |
| 553 | Ga0307510_10129962 | 3300033180 | Bacteria | 2195 |
| 554 | Ga0307510_10505153 | 3300033180 | Bacteria | 652 |
| 555 | Ga0373944_0084400 | 3300035089 | Bacteria | 1054 |
| 556 | Ga0373936_0017211 | 3300035113 | Bacteria | 2782 |
| 557 | Ga0373936_0093954 | 3300035113 | Bacteria | 1260 |
| 558 | Ga0373936_0098441 | 3300035113 | Bacteria | 1232 |
| 559 | Ga0373954_0037873 | 3300035118 | Bacteria | 2241 |
| 560 | Ga0373956_0015101 | 3300035119 | Bacteria | 3230 |
| 561 | Ga0373956_0075670 | 3300035119 | Bacteria | 1540 |
| 562 | Ga0373943_0024083 | 3300035170 | Bacteria | 2837 |
| 563 | Ga0373943_0322188 | 3300035170 | Bacteria | 881 |
| 564 | Ga0373943_0331101 | 3300035170 | Bacteria | 870 |
| 565 | Ga0373946_0077256 | 3300035171 | Bacteria | 1451 |
| 566 | Ga0373946_0461348 | 3300035171 | Bacteria | 648 |
| 567 | Ga0373955_0001316 | 3300035172 | Bacteria | 10524 |
| 568 | Ga0373924_0311726 | 3300035410 | Bacteria | 699 |
| 569 | Ga0373931_0256809 | 3300035691 | Bacteria | 1065 |
| 570 | Ga0373935_0485782 | 3300035692 | Bacteria | 895 |
| 571 | Ga0373927_0099946 | 3300035695 | Bacteria | 1886 |
| 572 | Ga0373927_0158701 | 3300035695 | Bacteria | 1482 |
| 573 | Ga0373927_0251915 | 3300035695 | Bacteria | 1161 |
| 574 | Ga0373927_1178075 | 3300035695 | Bacteria | 505 |
| 575 | Ga0373933_0140708 | 3300035724 | Bacteria | 1523 |
| 576 | Ga0373947_0012045 | 3300035725 | Bacteria | 4953 |
| 577 | Ga0373947_0671894 | 3300035725 | Bacteria | 706 |
| 578 | Ga0373937_0280743 | 3300036401 | Bacteria | 1573 |
| 579 | Ga0373937_0307671 | 3300036401 | Bacteria | 1498 |
| 580 | Ga0373925_0015018 | 3300037068 | Bacteria | 5598 |
| 581 | Ga0373925_0081538 | 3300037068 | Bacteria | 2460 |
| 582 | Ga0373925_0161231 | 3300037068 | Bacteria | 1766 |
| 583 | Ga0373925_0314730 | 3300037068 | Bacteria | 1266 |
| 584 | Ga0395899_0168635 | 3300037312 | Bacteria | 1543 |
| 585 | Ga0395900_0026521 | 3300037418 | Bacteria | 5933 |
| 586 | Ga0395900_0150164 | 3300037418 | Bacteria | 2381 |
| 587 | Ga0395898_0007695 | 3300037466 | Bacteria | 11438 |
| 588 | Ga0395898_0011882 | 3300037466 | Bacteria | 9015 |
| 589 | Ga0395905_0043972 | 3300037471 | Bacteria | 4191 |
| 590 | Ga0395905_0619250 | 3300037471 | Bacteria | 984 |
| 591 | Ga0436364_0882487 | 3300037853 | Bacteria | 2094 |
| 592 | Ga0395901_0030065 | 3300038443 | Bacteria | 5595 |
| 593 | Ga0395901_0491347 | 3300038443 | Bacteria | 1251 |
| 594 | Ga0395901_0654608 | 3300038443 | Bacteria | 1053 |
| 595 | Ga0436365_1797166 | 3300039437 | Bacteria | 4615 |
| 596 | Ga0436360_0417419 | 3300039438 | Bacteria | 3058 |
| 597 | Ga0436361_1149151 | 3300039447 | Bacteria | 4675 |
| 598 | Ga0436363_0134632 | 3300039450 | Bacteria | 1665 |
| 599 | Ga0436362_1272358 | 3300039453 | Bacteria | 4118 |
| 600 | Ga0451787_372953 | 3300041441 | Bacteria | 641 |
| 601 | Ga0451797_1383401 | 3300041453 | Bacteria | 759 |
| 602 | Ga0451804_0414830 | 3300041463 | Bacteria | 1255 |
| 603 | Ga0451807_1542365 | 3300041486 | Bacteria | 1073 |
| 604 | Ga0451835_0089850 | 3300041492 | Bacteria | 734 |
| 605 | Ga0451849_0907426 | 3300041505 | Bacteria | 548 |
| 606 | Ga0451843_1086481 | 3300041509 | Bacteria | 843 |
| 607 | Ga0439459_0112710 | 3300042438 | Bacteria | 677 |
| 608 | Ga0439464_0092267 | 3300042439 | Bacteria | 914 |
| 609 | Ga0466969_0010526 | 3300044656 | Bacteria | 4903 |
| 610 | Ga0466969_0043185 | 3300044656 | Bacteria | 2247 |
| 611 | Ga0466972_0016778 | 3300044658 | Bacteria | 3661 |
| 612 | Ga0466972_0124109 | 3300044658 | Bacteria | 1217 |
| 613 | Ga0466966_0005947 | 3300044684 | Bacteria | 8051 |
| 614 | Ga0466966_0218088 | 3300044684 | Bacteria | 1152 |
| 615 | Ga0466961_0000863 | 3300044693 | Bacteria | 18927 |
| 616 | Ga0466961_0046672 | 3300044693 | Bacteria | 2770 |
| 617 | Ga0466963_0071599 | 3300044694 | Bacteria | 2334 |
| 618 | Ga0466963_0992467 | 3300044694 | Bacteria | 591 |
| 619 | Ga0466964_0157200 | 3300044706 | Bacteria | 1059 |
| 620 | Ga0466971_0022035 | 3300044719 | Bacteria | 2836 |
| 621 | Ga0466968_0046951 | 3300044735 | Bacteria | 1835 |
| 622 | Ga0466968_0534909 | 3300044735 | Bacteria | 587 |
| 623 | Ga0466970_0405278 | 3300044765 | Bacteria | 778 |
| 624 | Ga0466957_0187308 | 3300044842 | Bacteria | 1354 |
| 625 | Ga0466960_0132092 | 3300044901 | Bacteria | 1319 |
| 626 | Ga0466959_0014195 | 3300045049 | Bacteria | 5781 |
| 627 | Ga0466959_0093008 | 3300045049 | Bacteria | 2164 |
| 628 | Ga0466959_0248511 | 3300045049 | Bacteria | 1227 |
| 629 | Ga0466958_0155703 | 3300045836 | Bacteria | 1442 |
| 630 | Ga0495592_0178672 | 3300046454 | Bacteria | 1447 |
| 631 | Ga0495592_0541897 | 3300046454 | Bacteria | 717 |
| 632 | Ga0495592_0786439 | 3300046454 | Bacteria | 566 |
| 633 | Ga0495603_0036047 | 3300046455 | Bacteria | 2969 |
| 634 | Ga0495603_0118183 | 3300046455 | Bacteria | 1545 |
| 635 | Ga0495603_0205571 | 3300046455 | Bacteria | 1138 |
| 636 | Ga0495603_0240085 | 3300046455 | Bacteria | 1044 |
| 637 | Ga0495603_0249360 | 3300046455 | Bacteria | 1022 |
| 638 | Ga0495590_0335619 | 3300046457 | Bacteria | 573 |
| 639 | Ga0495629_0095010 | 3300046459 | Bacteria | 2080 |
| 640 | Ga0495629_0167408 | 3300046459 | Bacteria | 1526 |
| 641 | Ga0495629_0333446 | 3300046459 | Bacteria | 1036 |
| 642 | Ga0495638_0171184 | 3300046460 | Bacteria | 1246 |
| 643 | Ga0495651_0008654 | 3300046462 | Bacteria | 7809 |
| 644 | Ga0495651_0206179 | 3300046462 | Bacteria | 1372 |
| 645 | Ga0495651_0294311 | 3300046462 | Bacteria | 1091 |
| 646 | Ga0495653_0116906 | 3300046463 | Bacteria | 1906 |
| 647 | Ga0495580_0115240 | 3300046472 | Bacteria | 1867 |
| 648 | Ga0495582_0035455 | 3300046473 | Bacteria | 2744 |
| 649 | Ga0495582_0234013 | 3300046473 | Bacteria | 1052 |
| 650 | Ga0495639_0017275 | 3300046475 | Bacteria | 3133 |
| 651 | Ga0495664_0005611 | 3300046477 | Bacteria | 6902 |
| 652 | Ga0495664_0063668 | 3300046477 | Bacteria | 2198 |
| 653 | Ga0495664_0224520 | 3300046477 | Bacteria | 1137 |
| 654 | Ga0495584_0008011 | 3300046491 | Bacteria | 5492 |
| 655 | Ga0495584_0224376 | 3300046491 | Bacteria | 955 |
| 656 | Ga0495585_0155892 | 3300046492 | Bacteria | 1188 |
| 657 | Ga0495585_0157607 | 3300046492 | Bacteria | 1180 |
| 658 | Ga0495585_0232576 | 3300046492 | Bacteria | 926 |
| 659 | Ga0495594_0353547 | 3300046499 | Bacteria | 837 |
| 660 | Ga0495596_0149803 | 3300046500 | Bacteria | 906 |
| 661 | Ga0495596_0255726 | 3300046500 | Bacteria | 680 |
| 662 | Ga0495606_0364706 | 3300046507 | Bacteria | 762 |
| 663 | Ga0495608_0091559 | 3300046511 | Bacteria | 1966 |
| 664 | Ga0495608_0271971 | 3300046511 | Bacteria | 1053 |
| 665 | Ga0495616_0094138 | 3300046513 | Bacteria | 1414 |
| 666 | Ga0495616_0281096 | 3300046513 | Bacteria | 707 |
| 667 | Ga0495618_0605289 | 3300046514 | Bacteria | 652 |
| 668 | Ga0495620_0028297 | 3300046515 | Bacteria | 2609 |
| 669 | Ga0495620_0103221 | 3300046515 | Bacteria | 1135 |
| 670 | Ga0495628_0016659 | 3300046516 | Bacteria | 6129 |
| 671 | Ga0495628_0145485 | 3300046516 | Bacteria | 1807 |
| 672 | Ga0495628_0839973 | 3300046516 | Bacteria | 640 |
| 673 | Ga0495630_0061491 | 3300046517 | Bacteria | 2820 |
| 674 | Ga0495630_0308180 | 3300046517 | Bacteria | 1210 |
| 675 | Ga0495630_0589230 | 3300046517 | Bacteria | 852 |
| 676 | Ga0495630_0593423 | 3300046517 | Bacteria | 849 |
| 677 | Ga0495631_0051527 | 3300046518 | Bacteria | 1799 |
| 678 | Ga0495631_0240123 | 3300046518 | Bacteria | 773 |
| 679 | Ga0495632_0372245 | 3300046519 | Bacteria | 626 |
| 680 | Ga0495643_0117762 | 3300046522 | Bacteria | 1344 |
| 681 | Ga0495643_0124719 | 3300046522 | Bacteria | 1298 |
| 682 | Ga0495644_0161793 | 3300046523 | Bacteria | 858 |
| 683 | Ga0495648_0002468 | 3300046524 | Bacteria | 17007 |
| 684 | Ga0495652_0584099 | 3300046529 | Bacteria | 764 |
| 685 | Ga0495665_0117142 | 3300046531 | Bacteria | 1395 |
| 686 | Ga0495640_0433394 | 3300046533 | Bacteria | 804 |
| 687 | Ga0495587_0191209 | 3300046536 | Bacteria | 1159 |
| 688 | Ga0495609_0450824 | 3300046538 | Bacteria | 511 |
| 689 | Ga0495597_0147643 | 3300046542 | Bacteria | 966 |
| 690 | Ga0495645_0087057 | 3300046543 | Bacteria | 2235 |
| 691 | Ga0495645_0229171 | 3300046543 | Bacteria | 1245 |
| 692 | Ga0495645_0447610 | 3300046543 | Bacteria | 815 |
| 693 | Ga0495633_0059593 | 3300046558 | Bacteria | 1790 |
| 694 | Ga0495633_0388063 | 3300046558 | Bacteria | 632 |
| 695 | Ga0495667_0156617 | 3300046559 | Bacteria | 1466 |
| 696 | Ga0495667_0179609 | 3300046559 | Bacteria | 1359 |
| 697 | Ga0495667_0219659 | 3300046559 | Bacteria | 1213 |
| 698 | Ga0495656_0189414 | 3300046615 | Bacteria | 1015 |
| 699 | Ga0495656_0204232 | 3300046615 | Unclassified | 982 |
| 700 | Ga0495668_0238234 | 3300046616 | Bacteria | 996 |
| 701 | Ga0495668_0245080 | 3300046616 | Bacteria | 981 |
| 702 | Ga0495668_0267924 | 3300046616 | Bacteria | 935 |
| 703 | Ga0495634_0044257 | 3300046642 | Bacteria | 3014 |
| 704 | Ga0495625_0118150 | 3300046660 | Bacteria | 1807 |
| 705 | Ga0495625_0452441 | 3300046660 | Bacteria | 793 |
| 706 | Ga0495625_0637581 | 3300046660 | Bacteria | 636 |
| 707 | Ga0495635_0023808 | 3300046663 | Bacteria | 4267 |
| 708 | Ga0495635_0062415 | 3300046663 | Bacteria | 2559 |
| 709 | Ga0495635_0080378 | 3300046663 | Bacteria | 2231 |
| 710 | Ga0495635_0313893 | 3300046663 | Bacteria | 1050 |
| 711 | Ga0495659_0016184 | 3300046664 | Bacteria | 2458 |
| 712 | Ga0495588_0012639 | 3300046674 | Bacteria | 3996 |
| 713 | Ga0495588_0351167 | 3300046674 | Bacteria | 775 |
| 714 | Ga0495657_0005091 | 3300046675 | Bacteria | 10441 |
| 715 | Ga0495657_0109153 | 3300046675 | Bacteria | 1755 |
| 716 | Ga0495657_0122415 | 3300046675 | Bacteria | 1637 |
| 717 | Ga0495657_0272849 | 3300046675 | Bacteria | 1014 |
| 718 | Ga0495657_0382005 | 3300046675 | Bacteria | 831 |
| 719 | Ga0495599_0046216 | 3300046678 | Bacteria | 2730 |
| 720 | Ga0495599_0205791 | 3300046678 | Bacteria | 1208 |
| 721 | Ga0495599_0315254 | 3300046678 | Bacteria | 942 |
| 722 | Ga0495623_0019288 | 3300046679 | Bacteria | 4408 |
| 723 | Ga0495646_0027624 | 3300046680 | Bacteria | 3559 |
| 724 | Ga0495646_0034737 | 3300046680 | Bacteria | 3130 |
| 725 | Ga0495669_0006514 | 3300046684 | Bacteria | 4881 |
| 726 | Ga0495669_0087771 | 3300046684 | Bacteria | 1433 |
| 727 | Ga0495624_0023400 | 3300046690 | Bacteria | 4074 |
| 728 | Ga0495670_0014413 | 3300046691 | Bacteria | 3886 |
| 729 | Ga0495671_0056832 | 3300046692 | Bacteria | 1937 |
| 730 | Ga0495671_0151037 | 3300046692 | Bacteria | 1131 |
| 731 | Ga0495649_0577965 | 3300046694 | Bacteria | 555 |
| 732 | Ga0495589_0184747 | 3300046794 | Bacteria | 988 |
| 733 | Ga0495600_0003192 | 3300046809 | Bacteria | 9599 |
| 734 | Ga0495600_0153015 | 3300046809 | Bacteria | 1493 |
| 735 | Ga0495660_0158452 | 3300046810 | Bacteria | 1112 |
| 736 | Ga0495604_0001817 | 3300047317 | Bacteria | 17374 |
| 737 | Ga0495604_0128306 | 3300047317 | Bacteria | 1825 |
| 738 | Ga0495604_0177007 | 3300047317 | Bacteria | 1495 |
| 739 | Ga0495604_0527042 | 3300047317 | Bacteria | 764 |
| 740 | Ga0495636_0466618 | 3300047318 | Bacteria | 608 |
| 741 | Ga0495674_0083125 | 3300047319 | Bacteria | 2745 |
| 742 | Ga0495674_0137802 | 3300047319 | Bacteria | 2052 |
| 743 | Ga0495674_0450322 | 3300047319 | Bacteria | 1034 |
| 744 | Ga0495676_0042637 | 3300047321 | Bacteria | 3722 |
| 745 | Ga0495676_0051596 | 3300047321 | Bacteria | 3289 |
| 746 | Ga0495676_0703042 | 3300047321 | Bacteria | 654 |
| 747 | Ga0495680_0004783 | 3300047322 | Bacteria | 12853 |
| 748 | Ga0495680_0381303 | 3300047322 | Bacteria | 976 |
| 749 | Ga0495683_0142882 | 3300047323 | Bacteria | 1120 |
| 750 | Ga0495683_0209513 | 3300047323 | Bacteria | 875 |
| 751 | Ga0495683_0210923 | 3300047323 | Bacteria | 871 |
| 752 | Ga0495687_019578 | 3300047443 | Bacteria | 3317 |
| 753 | Ga0495687_024634 | 3300047443 | Bacteria | 2857 |
| 754 | Ga0495675_0010677 | 3300047444 | Bacteria | 5744 |
| 755 | Ga0495675_0201168 | 3300047444 | Bacteria | 1212 |
| 756 | Ga0495677_0033517 | 3300047445 | Bacteria | 1872 |
| 757 | Ga0495673_0093296 | 3300047469 | Bacteria | 1227 |
| 758 | Ga0495684_0023628 | 3300047471 | Bacteria | 4727 |
| 759 | Ga0495686_0029502 | 3300047472 | Bacteria | 3568 |
| 760 | Ga0495593_0101512 | 3300047673 | Bacteria | 1475 |
| 761 | Ga0495602_0102240 | 3300048088 | Bacteria | 2349 |
| 762 | Ga0495602_0765575 | 3300048088 | Bacteria | 651 |
| 763 | Ga0495614_0380819 | 3300048089 | Bacteria | 661 |
| 764 | Ga0495615_0164390 | 3300048090 | Bacteria | 668 |
| 765 | Ga0496100_0070326 | 3300048903 | Bacteria | 2333 |
| 766 | Ga0496100_0186968 | 3300048903 | Bacteria | 1501 |
| 767 | Ga0496100_0547128 | 3300048903 | Bacteria | 895 |
| 768 | Ga0496101_0020038 | 3300048904 | Bacteria | 4573 |
| 769 | Ga0496101_0151979 | 3300048904 | Bacteria | 1771 |
| 770 | Ga0496101_0362286 | 3300048904 | Bacteria | 1140 |
| 771 | Ga0496101_0768817 | 3300048904 | Bacteria | 760 |
| 772 | Ga0496101_0815985 | 3300048904 | Bacteria | 735 |
| 773 | Ga0496101_0990750 | 3300048904 | Bacteria | 661 |
| 774 | Ga0496101_1037073 | 3300048904 | Bacteria | 645 |
| 775 | Ga0496102_0003789 | 3300048905 | Bacteria | 12786 |
| 776 | Ga0496102_0027530 | 3300048905 | Bacteria | 5076 |
| 777 | Ga0496102_0256476 | 3300048905 | Bacteria | 1649 |
| 778 | Ga0496102_0392845 | 3300048905 | Bacteria | 1305 |
| 779 | Ga0496102_0396985 | 3300048905 | Bacteria | 1297 |
| 780 | Ga0496102_0802533 | 3300048905 | Bacteria | 863 |
| 781 | Ga0496102_0881232 | 3300048905 | Bacteria | 817 |
| 782 | Ga0496103_0192742 | 3300048906 | Bacteria | 1310 |
| 783 | Ga0496103_0313741 | 3300048906 | Bacteria | 1009 |
| 784 | Ga0496103_0565859 | 3300048906 | Bacteria | 725 |
| 785 | Ga0496104_0002743 | 3300048907 | Bacteria | 15154 |
| 786 | Ga0496104_0114217 | 3300048907 | Bacteria | 2589 |
| 787 | Ga0496104_0182849 | 3300048907 | Bacteria | 2007 |
| 788 | Ga0496104_0183435 | 3300048907 | Bacteria | 2003 |
| 789 | Ga0496105_0056554 | 3300048908 | Bacteria | 3238 |
| 790 | Ga0496105_0059798 | 3300048908 | Bacteria | 3144 |
| 791 | Ga0496105_0077738 | 3300048908 | Bacteria | 2740 |
| 792 | Ga0496105_0671521 | 3300048908 | Bacteria | 798 |
| 793 | Ga0496106_0191605 | 3300048909 | Bacteria | 1626 |
| 794 | Ga0496106_0260204 | 3300048909 | Bacteria | 1388 |
| 795 | Ga0496106_0309568 | 3300048909 | Bacteria | 1267 |
| 796 | Ga0496106_0555808 | 3300048909 | Bacteria | 921 |
| 797 | Ga0496107_0008411 | 3300048910 | Bacteria | 7141 |
| 798 | Ga0496107_0229177 | 3300048910 | Bacteria | 1382 |
| 799 | Ga0496108_0025878 | 3300048911 | Bacteria | 4839 |
| 800 | Ga0496108_0057500 | 3300048911 | Bacteria | 3268 |
| 801 | Ga0496108_0117977 | 3300048911 | Bacteria | 2274 |
| 802 | Ga0496108_1025587 | 3300048911 | Bacteria | 704 |
| 803 | Ga0496109_0055881 | 3300048912 | Bacteria | 3601 |
| 804 | Ga0496109_0162114 | 3300048912 | Bacteria | 2095 |
| 805 | Ga0496109_0193483 | 3300048912 | Bacteria | 1911 |
| 806 | Ga0496110_0023688 | 3300048913 | Bacteria | 5223 |
| 807 | Ga0496110_0040385 | 3300048913 | Bacteria | 4067 |
| 808 | Ga0496110_0269168 | 3300048913 | Bacteria | 1551 |
| 809 | Ga0496110_0353908 | 3300048913 | Bacteria | 1338 |
| 810 | Ga0496110_0456548 | 3300048913 | Bacteria | 1164 |
| 811 | Ga0496110_0545844 | 3300048913 | Bacteria | 1053 |
| 812 | Ga0496111_0046070 | 3300048914 | Bacteria | 3139 |
| 813 | Ga0496112_0043463 | 3300048915 | Bacteria | 4399 |
| 814 | Ga0496112_0205362 | 3300048915 | Bacteria | 1928 |
| 815 | Ga0496112_0419759 | 3300048915 | Bacteria | 1277 |
| 816 | Ga0496113_0086238 | 3300048916 | Bacteria | 2412 |
| 817 | Ga0496113_0146665 | 3300048916 | Bacteria | 1860 |
| 818 | Ga0496113_0203112 | 3300048916 | Bacteria | 1575 |
| 819 | Ga0496113_1033424 | 3300048916 | Bacteria | 646 |
| 820 | Ga0496113_1393184 | 3300048916 | Bacteria | 543 |
| 821 | Ga0496114_0058730 | 3300048917 | Bacteria | 3212 |
| 822 | Ga0496114_0239889 | 3300048917 | Bacteria | 1594 |
| 823 | Ga0496114_0510424 | 3300048917 | Bacteria | 1063 |
| 824 | Ga0496115_0001860 | 3300048918 | Bacteria | 15092 |
| 825 | Ga0496115_0101186 | 3300048918 | Bacteria | 2363 |
| 826 | Ga0496115_0171677 | 3300048918 | Bacteria | 1793 |
| 827 | Ga0496115_0274102 | 3300048918 | Bacteria | 1386 |
| 828 | Ga0496116_0105741 | 3300048919 | Bacteria | 1669 |
| 829 | Ga0496116_0183721 | 3300048919 | Bacteria | 1116 |
| 830 | Ga0496117_0067364 | 3300048920 | Bacteria | 2423 |
| 831 | Ga0496117_0174889 | 3300048920 | Bacteria | 1241 |
| 832 | Ga0496117_0258020 | 3300048920 | Bacteria | 947 |
| 833 | Ga0496117_0386165 | 3300048920 | Bacteria | 711 |
| 834 | Ga0496118_0037271 | 3300048921 | Bacteria | 3917 |
| 835 | Ga0496118_0060898 | 3300048921 | Bacteria | 2799 |
| 836 | Ga0496118_0074666 | 3300048921 | Bacteria | 2422 |
| 837 | Ga0496118_0160053 | 3300048921 | Bacteria | 1394 |
| 838 | Ga0496118_0205111 | 3300048921 | Bacteria | 1163 |
| 839 | Ga0496119_0006768 | 3300048922 | Bacteria | 10513 |
| 840 | Ga0496119_0017432 | 3300048922 | Bacteria | 5400 |
| 841 | Ga0496119_0032207 | 3300048922 | Bacteria | 3498 |
| 842 | Ga0496119_0142601 | 3300048922 | Bacteria | 1292 |
| 843 | Ga0496119_0166289 | 3300048922 | Bacteria | 1168 |
| 844 | Ga0496119_0201214 | 3300048922 | Bacteria | 1031 |
| 845 | Ga0496119_0320368 | 3300048922 | Bacteria | 759 |
| 846 | Ga0496119_0418230 | 3300048922 | Bacteria | 637 |
| 847 | Ga0496120_0010148 | 3300048923 | Bacteria | 6597 |
| 848 | Ga0496120_0211508 | 3300048923 | Bacteria | 932 |
| 849 | Ga0496120_0271990 | 3300048923 | Bacteria | 787 |
| 850 | Ga0496120_0318513 | 3300048923 | Bacteria | 707 |
| 851 | Ga0496121_0002757 | 3300048924 | Bacteria | 26099 |
| 852 | Ga0496121_0023293 | 3300048924 | Bacteria | 5969 |
| 853 | Ga0496121_0058967 | 3300048924 | Bacteria | 3168 |
| 854 | Ga0496121_0059811 | 3300048924 | Bacteria | 3139 |
| 855 | Ga0496121_0084494 | 3300048924 | Bacteria | 2502 |
| 856 | Ga0496121_0095355 | 3300048924 | Bacteria | 2312 |
| 857 | Ga0496121_0123570 | 3300048924 | Bacteria | 1950 |
| 858 | Ga0496121_0128251 | 3300048924 | Bacteria | 1903 |
| 859 | Ga0496121_0147869 | 3300048924 | Bacteria | 1733 |
| 860 | Ga0496121_0157463 | 3300048924 | Bacteria | 1665 |
| 861 | Ga0496121_0180100 | 3300048924 | Bacteria | 1526 |
| 862 | Ga0496121_0183767 | 3300048924 | Bacteria | 1506 |
| 863 | Ga0496122_0129467 | 3300048925 | Bacteria | 1607 |
| 864 | Ga0496122_0212991 | 3300048925 | Bacteria | 1117 |
| 865 | Ga0496124_0094099 | 3300048927 | Bacteria | 2438 |
| 866 | Ga0496124_0193650 | 3300048927 | Bacteria | 1553 |
| 867 | Ga0496125_0060549 | 3300048928 | Bacteria | 3042 |
| 868 | Ga0496125_0156377 | 3300048928 | Bacteria | 1557 |
| 869 | Ga0496125_0184974 | 3300048928 | Bacteria | 1383 |
| 870 | Ga0496126_0003081 | 3300048929 | Bacteria | 21560 |
| 871 | Ga0496126_0061075 | 3300048929 | Bacteria | 3387 |
| 872 | Ga0496126_0137276 | 3300048929 | Bacteria | 2108 |
| 873 | Ga0496126_0177789 | 3300048929 | Bacteria | 1809 |
| 874 | Ga0496126_0191942 | 3300048929 | Bacteria | 1729 |
| 875 | Ga0496126_0387263 | 3300048929 | Bacteria | 1137 |
| 876 | Ga0496126_0406873 | 3300048929 | Bacteria | 1102 |
| 877 | Ga0496126_0423102 | 3300048929 | Bacteria | 1076 |
| 878 | Ga0496126_0576429 | 3300048929 | Bacteria | 889 |
| 879 | Ga0496126_0612840 | 3300048929 | Bacteria | 856 |
| 880 | Ga0501031_0338979 | 3300049568 | Bacteria | 973 |
| 881 | Ga0501032_0004425 | 3300049569 | Bacteria | 10596 |
| 882 | Ga0501033_0000244 | 3300049570 | Bacteria | 52231 |
| 883 | Ga0501033_0334289 | 3300049570 | Bacteria | 1063 |
| 884 | Ga0501034_0000159 | 3300049571 | Bacteria | 127397 |
| 885 | Ga0501036_0000039 | 3300049572 | Bacteria | 83065 |
| 886 | Ga0501037_0000882 | 3300049573 | Bacteria | 22410 |
| 887 | Ga0501038_0000207 | 3300049574 | Bacteria | 50307 |
| 888 | Ga0501038_0396234 | 3300049574 | Bacteria | 1069 |
| 889 | Ga0501039_0000148 | 3300049575 | Bacteria | 47789 |
| 890 | Ga0501039_0378603 | 3300049575 | Bacteria | 1112 |
| 891 | Ga0501040_0641337 | 3300049576 | Bacteria | 768 |
| 892 | Ga0501041_0922063 | 3300049577 | Bacteria | 561 |
| 893 | Ga0501042_0045184 | 3300049578 | Bacteria | 3139 |
| 894 | Ga0501042_0828290 | 3300049578 | Bacteria | 674 |
| 895 | Ga0501043_0001205 | 3300049579 | Bacteria | 22758 |
| 896 | Ga0501046_0000185 | 3300049580 | Bacteria | 63459 |
| 897 | Ga0501046_0615435 | 3300049580 | Bacteria | 770 |
| 898 | Ga0501047_0000385 | 3300049581 | Bacteria | 49635 |
| 899 | Ga0501047_0008133 | 3300049581 | Bacteria | 9899 |
| 900 | Ga0501067_0014764 | 3300049583 | Bacteria | 4321 |
| 901 | Ga0501067_0042385 | 3300049583 | Bacteria | 2527 |
| 902 | Ga0501068_0000371 | 3300049584 | Bacteria | 22625 |
| 903 | Ga0501070_0002140 | 3300049586 | Bacteria | 17350 |
| 904 | Ga0501070_0201587 | 3300049586 | Bacteria | 1634 |
| 905 | Ga0501071_0249897 | 3300049587 | Bacteria | 1338 |
| 906 | Ga0501072_0008681 | 3300049588 | Bacteria | 7714 |
| 907 | Ga0501073_0000702 | 3300049589 | Bacteria | 23614 |
| 908 | Ga0501073_0136093 | 3300049589 | Bacteria | 1703 |
| 909 | Ga0501073_0402537 | 3300049589 | Bacteria | 946 |
| 910 | Ga0501074_0000271 | 3300049590 | Bacteria | 29628 |
| 911 | Ga0501074_0348805 | 3300049590 | Bacteria | 1050 |
| 912 | Ga0501076_0062840 | 3300049592 | Bacteria | 2958 |
| 913 | Ga0501079_0004349 | 3300049741 | Bacteria | 10513 |
| 914 | Ga0501080_0000380 | 3300049742 | Bacteria | 34213 |
| 915 | Ga0501080_0091806 | 3300049742 | Bacteria | 2820 |
| 916 | Ga0501080_0310700 | 3300049742 | Bacteria | 1429 |
| 917 | Ga0501081_0087849 | 3300049743 | Bacteria | 2184 |
| 918 | Ga0501083_0000118 | 3300049744 | Bacteria | 54096 |
| 919 | Ga0501035_0004827 | 3300049822 | Bacteria | 12783 |
| 920 | Ga0501035_1248499 | 3300049822 | Bacteria | 575 |
| 921 | Ga0501044_0000548 | 3300049823 | Bacteria | 45787 |
| 922 | Ga0501044_0228722 | 3300049823 | Bacteria | 1808 |
| 923 | Ga0501045_0003030 | 3300049824 | Bacteria | 11490 |
| 924 | Ga0501045_0385189 | 3300049824 | Bacteria | 1044 |
| 925 | nmdc:mga03683_137063_c1 | 3300050489 | Bacteria | 1098 |
| 926 | nmdc:mga03683_173532_c1 | 3300050489 | Bacteria | 980 |
| 927 | nmdc:mga03683_303422_c1 | 3300050489 | Bacteria | 749 |
| 928 | nmdc:mga03n38_1290_c1 | 3300050490 | Bacteria | 7063 |
| 929 | nmdc:mga03n38_245415_c1 | 3300050490 | Bacteria | 944 |
| 930 | nmdc:mga03n38_886703_c1 | 3300050490 | Bacteria | 523 |
| 931 | nmdc:mga00v17_165893_c1 | 3300050491 | Bacteria | 1423 |
| 932 | nmdc:mga00v17_6086_c1 | 3300050491 | Bacteria | 6385 |
| 933 | nmdc:mga0yw44_23704_c1 | 3300050492 | Bacteria | 3462 |
| 934 | nmdc:mga0k408_110415_c1 | 3300050493 | Bacteria | 1625 |
| 935 | nmdc:mga0k408_155257_c1 | 3300050493 | Bacteria | 1363 |
| 936 | nmdc:mga0k408_71243_c1 | 3300050493 | Bacteria | 2029 |
| 937 | nmdc:mga06z11_1024452_c1 | 3300050494 | Bacteria | 503 |
| 938 | nmdc:mga06z11_23163_c1 | 3300050494 | Bacteria | 2913 |
| 939 | nmdc:mga06z11_2462_c1 | 3300050494 | Bacteria | 7073 |
| 940 | nmdc:mga06z11_374356_c1 | 3300050494 | Bacteria | 855 |
| 941 | nmdc:mga06z11_64701_c1 | 3300050494 | Bacteria | 1918 |
| 942 | nmdc:mga06z11_94254_c1 | 3300050494 | Bacteria | 1631 |
| 943 | nmdc:mga04h51_119879_c1 | 3300050495 | Bacteria | 979 |
| 944 | nmdc:mga04h51_36991_c1 | 3300050495 | Bacteria | 1574 |
| 945 | nmdc:mga07m45_11812_c1 | 3300050496 | Bacteria | 3015 |
| 946 | nmdc:mga07m45_384521_c1 | 3300050496 | Bacteria | 815 |
| 947 | nmdc:mga07m45_92163_c1 | 3300050496 | Bacteria | 1737 |
| 948 | nmdc:mga06r32_654631_c1 | 3300050510 | Bacteria | 1018 |
| 949 | nmdc:mga08y16_675762_c1 | 3300050511 | Bacteria | 1034 |
| 950 | nmdc:mga08y16_831057_c1 | 3300050511 | Bacteria | 914 |
| 951 | nmdc:mga0sz30_28757_c1 | 3300050516 | Bacteria | 2288 |
| 952 | nmdc:mga0sz30_408240_c1 | 3300050516 | Bacteria | 609 |
| 953 | nmdc:mga0sz30_64875_c1 | 3300050516 | Bacteria | 1565 |
| 954 | Ga0495601_0404170 | 3300053077 | Bacteria | 885 |
| 955 | Ga0495612_0013169 | 3300053078 | Bacteria | 3331 |
| 956 | Ga0495612_0046079 | 3300053078 | Bacteria | 1785 |
| 957 | Ga0500635_0076503 | 3300053080 | Bacteria | 1196 |
| 958 | Ga0500635_0150850 | 3300053080 | Bacteria | 887 |
| 959 | Ga0495595_0014623 | 3300053084 | Bacteria | 3333 |
| 960 | Ga0495619_0113450 | 3300053085 | Bacteria | 1853 |
| 961 | Ga0495619_0162170 | 3300053085 | Bacteria | 1544 |
| 962 | Ga0495619_1105612 | 3300053085 | Bacteria | 527 |
| 963 | Ga0500643_000057 | 3300053087 | Bacteria | 131401 |
| 964 | Ga0500647_0016425 | 3300053091 | Bacteria | 3401 |
| 965 | Ga0500647_0096086 | 3300053091 | Bacteria | 1417 |
| 966 | Ga0500651_0264840 | 3300053093 | Bacteria | 995 |
| 967 | Ga0500651_0664090 | 3300053093 | Bacteria | 560 |
| 968 | Ga0500566_0000239 | 3300053094 | Bacteria | 29379 |
| 969 | Ga0500566_0001729 | 3300053094 | Bacteria | 12815 |
| 970 | Ga0500640_032259 | 3300053095 | Bacteria | 2299 |
| 971 | Ga0500640_110454 | 3300053095 | Bacteria | 1120 |
| 972 | Ga0500648_242341 | 3300053097 | Bacteria | 858 |
| 973 | Ga0500554_049782 | 3300053102 | Bacteria | 1315 |
| 974 | Ga0500554_198972 | 3300053102 | Bacteria | 671 |
| 975 | Ga0500555_005133 | 3300053103 | Bacteria | 3713 |
| 976 | Ga0500555_172903 | 3300053103 | Bacteria | 524 |
| 977 | Ga0500569_013364 | 3300053109 | Bacteria | 2008 |
| 978 | Ga0500572_002004 | 3300053111 | Bacteria | 5076 |
| 979 | Ga0500572_012619 | 3300053111 | Bacteria | 2074 |
| 980 | Ga0500594_0108397 | 3300053118 | Bacteria | 862 |
| 981 | Ga0500595_000393 | 3300053119 | Bacteria | 28109 |
| 982 | Ga0500595_142504 | 3300053119 | Bacteria | 671 |
| 983 | Ga0500595_156500 | 3300053119 | Bacteria | 635 |
| 984 | Ga0500608_010552 | 3300053122 | Bacteria | 3970 |
| 985 | Ga0500608_045010 | 3300053122 | Bacteria | 2120 |
| 986 | Ga0500608_105888 | 3300053122 | Bacteria | 1296 |
| 987 | Ga0500614_294736 | 3300053123 | Bacteria | 509 |
| 988 | Ga0500655_125919 | 3300053133 | Bacteria | 545 |
| 989 | Ga0500658_0147378 | 3300053134 | Bacteria | 1059 |
| 990 | Ga0500658_0353272 | 3300053134 | Bacteria | 674 |
| 991 | Ga0500658_0555643 | 3300053134 | Bacteria | 516 |
| 992 | Ga0500559_0003940 | 3300053136 | Bacteria | 7167 |
| 993 | Ga0500568_0046269 | 3300053139 | Bacteria | 1728 |
| 994 | Ga0500577_0000303 | 3300053142 | Bacteria | 12770 |
| 995 | Ga0500577_0117604 | 3300053142 | Bacteria | 1103 |
| 996 | Ga0500585_125611 | 3300053144 | Bacteria | 912 |
| 997 | Ga0500590_042653 | 3300053148 | Bacteria | 2329 |
| 998 | Ga0500603_001096 | 3300053150 | Bacteria | 6338 |
| 999 | Ga0500603_002048 | 3300053150 | Bacteria | 4454 |
| 1000 | Ga0500630_003788 | 3300053159 | Bacteria | 7331 |
| 1001 | Ga0500634_0221373 | 3300053161 | Bacteria | 812 |
| 1002 | Ga0500638_025857 | 3300053162 | Bacteria | 2809 |
| 1003 | Ga0500638_049719 | 3300053162 | Bacteria | 2028 |
| 1004 | Ga0500639_000076 | 3300053163 | Bacteria | 45936 |
| 1005 | Ga0500639_111425 | 3300053163 | Bacteria | 1331 |
| 1006 | Ga0500639_178358 | 3300053163 | Bacteria | 943 |
| 1007 | Ga0500636_0004999 | 3300053177 | Bacteria | 7525 |
| 1008 | Ga0500636_0045048 | 3300053177 | Bacteria | 2602 |
| 1009 | Ga0500636_0227094 | 3300053177 | Bacteria | 968 |
| 1010 | Ga0500636_0385937 | 3300053177 | Bacteria | 655 |
| 1011 | Ga0500636_0489122 | 3300053177 | Bacteria | 546 |
| 1012 | Ga0500637_0222349 | 3300053178 | Bacteria | 1066 |
| 1013 | Ga0500625_007215 | 3300053729 | Bacteria | 4810 |
| 1014 | Ga0500645_073882 | 3300053730 | Bacteria | 977 |
| 1015 | Ga0500596_003456 | 3300053735 | Bacteria | 3001 |
| 1016 | Ga0500601_001060 | 3300053737 | Bacteria | 3119 |
| 1017 | Ga0500601_003860 | 3300053737 | Bacteria | 1628 |
| 1018 | Ga0500601_014325 | 3300053737 | Bacteria | 900 |
| 1019 | Ga0501084_0002995 | 3300054114 | Bacteria | 13676 |
| 1020 | Ga0500661_006131 | 3300055283 | Bacteria | 2242 |
| 1021 | Ga0501082_0000570 | 3300060353 | Bacteria | 32833 |
| 1022 | Ga0466962_0027977 | 3300061719 | Bacteria | 2702 |
| 1023 | Ga0530510_0606541 | 3300061734 | Bacteria | 833 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046491 | Ga0495584_0008011 | Ga0495584_0008011_1727_2179 | 134 |
| 2 | 3300053134 | Ga0500658_0555643 | Ga0500658_0555643_37_489 | 134 |
| 3 | 3300046507 | Ga0495606_0364706 | Ga0495606_0364706_254_733 | 136 |
| 4 | 3300009093 | Ga0105240_10022867 | Ga0105240_100228678 | 139 |
| 5 | 3300009098 | Ga0105245_10188078 | Ga0105245_101880783 | 139 |
| 6 | 3300009174 | Ga0105241_10088821 | Ga0105241_100888213 | 139 |
| 7 | 3300009545 | Ga0105237_10009071 | Ga0105237_100090718 | 139 |
| 8 | 3300010375 | Ga0105239_10132157 | Ga0105239_101321574 | 139 |
| 9 | 3300033180 | Ga0307510_10129962 | Ga0307510_101299621 | 142 |
| 10 | 3300006028 | Ga0070717_10817020 | Ga0070717_108170201 | 143 |
| 11 | 3300007265 | Ga0099794_10009322 | Ga0099794_100093221 | 143 |
| 12 | 3300025923 | Ga0207681_10700819 | Ga0207681_107008192 | 143 |
| 13 | 3300035119 | Ga0373956_0015101 | Ga0373956_0015101_1520_1963 | 143 |
| 14 | 3300035170 | Ga0373943_0331101 | Ga0373943_0331101_114_554 | 143 |
| 15 | 3300035725 | Ga0373947_0012045 | Ga0373947_0012045_3063_3503 | 143 |
| 16 | 3300037068 | Ga0373925_0161231 | Ga0373925_0161231_1307_1747 | 143 |
| 17 | 3300041453 | Ga0451797_1383401 | Ga0451797_1383401_44_490 | 143 |
| 18 | 3300046454 | Ga0495592_0541897 | Ga0495592_0541897_183_629 | 143 |
| 19 | 3300046454 | Ga0495592_0786439 | Ga0495592_0786439_78_518 | 143 |
| 20 | 3300046459 | Ga0495629_0333446 | Ga0495629_0333446_358_798 | 143 |
| 21 | 3300046517 | Ga0495630_0308180 | Ga0495630_0308180_341_781 | 143 |
| 22 | 3300046543 | Ga0495645_0447610 | Ga0495645_0447610_156_596 | 143 |
| 23 | 3300046559 | Ga0495667_0156617 | Ga0495667_0156617_478_918 | 143 |
| 24 | 3300046663 | Ga0495635_0313893 | Ga0495635_0313893_525_965 | 143 |
| 25 | 3300046675 | Ga0495657_0109153 | Ga0495657_0109153_994_1434 | 143 |
| 26 | 3300046678 | Ga0495599_0315254 | Ga0495599_0315254_219_659 | 143 |
| 27 | 3300046680 | Ga0495646_0034737 | Ga0495646_0034737_1466_1912 | 143 |
| 28 | 3300047319 | Ga0495674_0450322 | Ga0495674_0450322_76_516 | 143 |
| 29 | 3300048088 | Ga0495602_0765575 | Ga0495602_0765575_144_584 | 143 |
| 30 | iso_pu_bacteria | 2885383462 | 2885389723 | 143 |
| 31 | 3300005435 | Ga0070714_100021753 | Ga0070714_1000217535 | 144 |
| 32 | 3300005436 | Ga0070713_100040796 | Ga0070713_1000407962 | 144 |
| 33 | 3300009176 | Ga0105242_11755633 | Ga0105242_117556331 | 144 |
| 34 | 3300011119 | Ga0105246_10639571 | Ga0105246_106395712 | 144 |
| 35 | 3300012495 | Ga0157323_1032919 | Ga0157323_10329191 | 144 |
| 36 | 3300013104 | Ga0157370_11714495 | Ga0157370_117144951 | 144 |
| 37 | 3300014325 | Ga0163163_10352379 | Ga0163163_103523791 | 144 |
| 38 | 3300025928 | Ga0207700_10049919 | Ga0207700_100499194 | 144 |
| 39 | 3300035089 | Ga0373944_0084400 | Ga0373944_0084400_107_553 | 144 |
| 40 | 3300035118 | Ga0373954_0037873 | Ga0373954_0037873_1408_1854 | 144 |
| 41 | 3300035119 | Ga0373956_0075670 | Ga0373956_0075670_943_1389 | 144 |
| 42 | 3300035170 | Ga0373943_0322188 | Ga0373943_0322188_58_504 | 144 |
| 43 | 3300035172 | Ga0373955_0001316 | Ga0373955_0001316_10021_10467 | 144 |
| 44 | 3300035410 | Ga0373924_0311726 | Ga0373924_0311726_75_521 | 144 |
| 45 | 3300035691 | Ga0373931_0256809 | Ga0373931_0256809_458_892 | 144 |
| 46 | 3300035724 | Ga0373933_0140708 | Ga0373933_0140708_518_964 | 144 |
| 47 | 3300035725 | Ga0373947_0671894 | Ga0373947_0671894_136_582 | 144 |
| 48 | 3300036401 | Ga0373937_0307671 | Ga0373937_0307671_410_856 | 144 |
| 49 | 3300037068 | Ga0373925_0015018 | Ga0373925_0015018_581_1027 | 144 |
| 50 | 3300037853 | Ga0436364_0882487 | Ga0436364_0882487_701_1135 | 144 |
| 51 | 3300039437 | Ga0436365_1797166 | Ga0436365_1797166_2304_2738 | 144 |
| 52 | 3300041463 | Ga0451804_0414830 | Ga0451804_0414830_804_1238 | 144 |
| 53 | 3300044735 | Ga0466968_0534909 | Ga0466968_0534909_142_576 | 144 |
| 54 | 3300046454 | Ga0495592_0178672 | Ga0495592_0178672_842_1288 | 144 |
| 55 | 3300046460 | Ga0495638_0171184 | Ga0495638_0171184_553_987 | 144 |
| 56 | 3300046462 | Ga0495651_0294311 | Ga0495651_0294311_524_970 | 144 |
| 57 | 3300046473 | Ga0495582_0035455 | Ga0495582_0035455_1930_2376 | 144 |
| 58 | 3300046475 | Ga0495639_0017275 | Ga0495639_0017275_1171_1617 | 144 |
| 59 | 3300046477 | Ga0495664_0005611 | Ga0495664_0005611_2918_3364 | 144 |
| 60 | 3300046500 | Ga0495596_0255726 | Ga0495596_0255726_199_633 | 144 |
| 61 | 3300046516 | Ga0495628_0145485 | Ga0495628_0145485_1351_1797 | 144 |
| 62 | 3300046517 | Ga0495630_0061491 | Ga0495630_0061491_711_1157 | 144 |
| 63 | 3300046524 | Ga0495648_0002468 | Ga0495648_0002468_7814_8251 | 144 |
| 64 | 3300046531 | Ga0495665_0117142 | Ga0495665_0117142_708_1154 | 144 |
| 65 | 3300046536 | Ga0495587_0191209 | Ga0495587_0191209_642_1088 | 144 |
| 66 | 3300046543 | Ga0495645_0229171 | Ga0495645_0229171_749_1195 | 144 |
| 67 | 3300046558 | Ga0495633_0059593 | Ga0495633_0059593_444_878 | 144 |
| 68 | 3300046559 | Ga0495667_0219659 | Ga0495667_0219659_158_604 | 144 |
| 69 | 3300046615 | Ga0495656_0204232 | Ga0495656_0204232_193_627 | 144 |
| 70 | 3300046616 | Ga0495668_0245080 | Ga0495668_0245080_62_496 | 144 |
| 71 | 3300046663 | Ga0495635_0080378 | Ga0495635_0080378_399_845 | 144 |
| 72 | 3300046675 | Ga0495657_0122415 | Ga0495657_0122415_232_678 | 144 |
| 73 | 3300046675 | Ga0495657_0382005 | Ga0495657_0382005_226_672 | 144 |
| 74 | 3300046678 | Ga0495599_0205791 | Ga0495599_0205791_300_746 | 144 |
| 75 | 3300046690 | Ga0495624_0023400 | Ga0495624_0023400_818_1264 | 144 |
| 76 | 3300046694 | Ga0495649_0577965 | Ga0495649_0577965_109_543 | 144 |
| 77 | 3300046794 | Ga0495589_0184747 | Ga0495589_0184747_464_898 | 144 |
| 78 | 3300047319 | Ga0495674_0137802 | Ga0495674_0137802_463_909 | 144 |
| 79 | 3300047322 | Ga0495680_0381303 | Ga0495680_0381303_268_714 | 144 |
| 80 | 3300047444 | Ga0495675_0201168 | Ga0495675_0201168_560_1006 | 144 |
| 81 | 3300047471 | Ga0495684_0023628 | Ga0495684_0023628_1066_1512 | 144 |
| 82 | 3300048090 | Ga0495615_0164390 | Ga0495615_0164390_177_611 | 144 |
| 83 | 3300048903 | Ga0496100_0547128 | Ga0496100_0547128_40_474 | 144 |
| 84 | 3300048904 | Ga0496101_0768817 | Ga0496101_0768817_59_493 | 144 |
| 85 | 3300048911 | Ga0496108_1025587 | Ga0496108_1025587_90_524 | 144 |
| 86 | 3300048919 | Ga0496116_0105741 | Ga0496116_0105741_766_1200 | 144 |
| 87 | 3300048920 | Ga0496117_0067364 | Ga0496117_0067364_809_1243 | 144 |
| 88 | 3300048921 | Ga0496118_0037271 | Ga0496118_0037271_2325_2759 | 144 |
| 89 | 3300048922 | Ga0496119_0166289 | Ga0496119_0166289_648_1082 | 144 |
| 90 | 3300048924 | Ga0496121_0023293 | Ga0496121_0023293_4090_4524 | 144 |
| 91 | 3300048929 | Ga0496126_0137276 | Ga0496126_0137276_274_708 | 144 |
| 92 | 3300049570 | Ga0501033_0334289 | Ga0501033_0334289_226_660 | 144 |
| 93 | 3300049575 | Ga0501039_0378603 | Ga0501039_0378603_609_1043 | 144 |
| 94 | 3300049576 | Ga0501040_0641337 | Ga0501040_0641337_41_475 | 144 |
| 95 | 3300049580 | Ga0501046_0615435 | Ga0501046_0615435_54_488 | 144 |
| 96 | 3300049581 | Ga0501047_0008133 | Ga0501047_0008133_9166_9600 | 144 |
| 97 | 3300049586 | Ga0501070_0201587 | Ga0501070_0201587_205_639 | 144 |
| 98 | 3300049589 | Ga0501073_0136093 | Ga0501073_0136093_627_1061 | 144 |
| 99 | 3300049590 | Ga0501074_0348805 | Ga0501074_0348805_11_445 | 144 |
| 100 | 3300049742 | Ga0501080_0091806 | Ga0501080_0091806_1439_1873 | 144 |
| 101 | 3300049742 | Ga0501080_0310700 | Ga0501080_0310700_700_1134 | 144 |
| 102 | 3300049823 | Ga0501044_0228722 | Ga0501044_0228722_505_939 | 144 |
| 103 | 3300053078 | Ga0495612_0013169 | Ga0495612_0013169_566_1012 | 144 |
| 104 | 3300053078 | Ga0495612_0046079 | Ga0495612_0046079_202_648 | 144 |
| 105 | 3300053084 | Ga0495595_0014623 | Ga0495595_0014623_2040_2486 | 144 |
| 106 | 3300053085 | Ga0495619_0162170 | Ga0495619_0162170_389_835 | 144 |
| 107 | 3300053087 | Ga0500643_000057 | Ga0500643_000057_130761_131195 | 144 |
| 108 | 3300053093 | Ga0500651_0264840 | Ga0500651_0264840_455_904 | 144 |
| 109 | 3300053103 | Ga0500555_172903 | Ga0500555_172903_33_482 | 144 |
| 110 | 3300053134 | Ga0500658_0353272 | Ga0500658_0353272_129_578 | 144 |
| 111 | iso_pu_bacteria | 2513237137 | 2513861430 | 144 |
| 112 | iso_pu_bacteria | 2513237145 | 2513915800 | 144 |
| 113 | iso_pu_bacteria | 2524023210 | 2524466585 | 144 |
| 114 | iso_pu_bacteria | 2667528175 | 2671123004 | 144 |
| 115 | iso_pu_bacteria | 2791355197 | 2793071991 | 144 |
| 116 | iso_pu_bacteria | 2885374607 | 2885383105 | 144 |
| 117 | iso_pu_bacteria | 2903748898 | 2903756571 | 144 |
| 118 | iso_pu_bacteria | 2903768456 | 2903769756 | 144 |
| 119 | iso_pu_bacteria | 2904699407 | 2904706150 | 144 |
| 120 | iso_pu_bacteria | 2906660503 | 2906660647 | 144 |
| 121 | iso_pu_bacteria | 2935630451 | 2935632337 | 144 |
| 122 | iso_pu_bacteria | 2941507105 | 2941508284 | 144 |
| 123 | iso_pu_bacteria | 2941515067 | 2941515210 | 144 |
| 124 | iso_pu_bacteria | 2941523033 | 2941524215 | 144 |
| 125 | iso_pu_bacteria | 3005474847 | 3005477431 | 144 |
| 126 | iso_pu_bacteria | 3005483717 | 3005487505 | 144 |
| 127 | iso_pu_bacteria | 8006933436 | 8006933804 | 144 |
| 128 | iso_pu_bacteria | 8006973647 | 8006983476 | 144 |
| 129 | 3300032002 | Ga0307416_100230256 | Ga0307416_1002302562 | 145 |
| 130 | 3300046511 | Ga0495608_0271971 | Ga0495608_0271971_199_648 | 145 |
| 131 | 3300050510 | nmdc:mga06r32_654631_c1 | nmdc:mga06r32_654631_c1_13_474 | 145 |
| 132 | 3300050511 | nmdc:mga08y16_831057_c1 | nmdc:mga08y16_831057_c1_219_671 | 145 |
| 133 | iso_pu_bacteria | 2507262055 | 2507511169 | 145 |
| 134 | iso_pu_bacteria | 2508501009 | 2508544978 | 145 |
| 135 | iso_pu_bacteria | 2508501042 | 2508693714 | 145 |
| 136 | iso_pu_bacteria | 2511231028 | 2511396510 | 145 |
| 137 | iso_pu_bacteria | 2513237094 | 2513637322 | 145 |
| 138 | iso_pu_bacteria | 2513237095 | 2513650882 | 145 |
| 139 | iso_pu_bacteria | 2513237101 | 2513693388 | 145 |
| 140 | iso_pu_bacteria | 2513237102 | 2513700471 | 145 |
| 141 | iso_pu_bacteria | 2513237139 | 2513874791 | 145 |
| 142 | iso_pu_bacteria | 2513237161 | 2514010491 | 145 |
| 143 | iso_pu_bacteria | 2515154112 | 2515625265 | 145 |
| 144 | iso_pu_bacteria | 2517093001 | 2517100740 | 145 |
| 145 | iso_pu_bacteria | 2617270735 | 2617353565 | 145 |
| 146 | iso_pu_bacteria | 2617270741 | 2617373290 | 145 |
| 147 | iso_pu_bacteria | 2744054633 | 2745080996 | 145 |
| 148 | iso_pu_bacteria | 2791355196 | 2793061893 | 145 |
| 149 | iso_pu_bacteria | 2802429603 | 2805916792 | 145 |
| 150 | iso_pu_bacteria | 2816332527 | 2818238304 | 145 |
| 151 | iso_pu_bacteria | 2824600985 | 2824603983 | 145 |
| 152 | iso_pu_bacteria | 2824609381 | 2824611564 | 145 |
| 153 | iso_pu_bacteria | 2824617872 | 2824622472 | 145 |
| 154 | iso_pu_bacteria | 2824626560 | 2824630348 | 145 |
| 155 | iso_pu_bacteria | 2824635225 | 2824638324 | 145 |
| 156 | iso_pu_bacteria | 2824644064 | 2824645938 | 145 |
| 157 | iso_pu_bacteria | 2824653114 | 2824655412 | 145 |
| 158 | iso_pu_bacteria | 2824679649 | 2824680926 | 145 |
| 159 | iso_pu_bacteria | 2824696289 | 2824701265 | 145 |
| 160 | iso_pu_bacteria | 2824714736 | 2824716059 | 145 |
| 161 | iso_pu_bacteria | 2824723954 | 2824725915 | 145 |
| 162 | iso_pu_bacteria | 2824732956 | 2824734730 | 145 |
| 163 | iso_pu_bacteria | 2824746037 | 2824747697 | 145 |
| 164 | iso_pu_bacteria | 2824753945 | 2824754595 | 145 |
| 165 | iso_pu_bacteria | 2824763712 | 2824765359 | 145 |
| 166 | iso_pu_bacteria | 2824773399 | 2824773458 | 145 |
| 167 | iso_pu_bacteria | 2838122688 | 2838128038 | 145 |
| 168 | iso_pu_bacteria | 2841941048 | 2841943335 | 145 |
| 169 | iso_pu_bacteria | 2841949485 | 2841953936 | 145 |
| 170 | iso_pu_bacteria | 2841957949 | 2841962031 | 145 |
| 171 | iso_pu_bacteria | 2841966195 | 2841968029 | 145 |
| 172 | iso_pu_bacteria | 2841974524 | 2841981283 | 145 |
| 173 | iso_pu_bacteria | 2841983080 | 2841988134 | 145 |
| 174 | iso_pu_bacteria | 2842038055 | 2842042558 | 145 |
| 175 | iso_pu_bacteria | 2842045827 | 2842050601 | 145 |
| 176 | iso_pu_bacteria | 2844315083 | 2844316763 | 145 |
| 177 | iso_pu_bacteria | 2847930680 | 2847938709 | 145 |
| 178 | iso_pu_bacteria | 2847939898 | 2847944093 | 145 |
| 179 | iso_pu_bacteria | 2857509624 | 2857512334 | 145 |
| 180 | iso_pu_bacteria | 2874590934 | 2874597903 | 145 |
| 181 | iso_pu_bacteria | 2874604998 | 2874607485 | 145 |
| 182 | iso_pu_bacteria | 2874620515 | 2874626182 | 145 |
| 183 | iso_pu_bacteria | 2874628541 | 2874631380 | 145 |
| 184 | iso_pu_bacteria | 2874645413 | 2874651431 | 145 |
| 185 | iso_pu_bacteria | 2876771140 | 2876776503 | 145 |
| 186 | iso_pu_bacteria | 2876808645 | 2876816294 | 145 |
| 187 | iso_pu_bacteria | 2876818435 | 2876824907 | 145 |
| 188 | iso_pu_bacteria | 2879074833 | 2879081634 | 145 |
| 189 | iso_pu_bacteria | 2879110137 | 2879111030 | 145 |
| 190 | iso_pu_bacteria | 2881364244 | 2881365940 | 145 |
| 191 | iso_pu_bacteria | 2885366525 | 2885366790 | 145 |
| 192 | iso_pu_bacteria | 2885409591 | 2885415876 | 145 |
| 193 | iso_pu_bacteria | 2888378607 | 2888381372 | 145 |
| 194 | iso_pu_bacteria | 2888388044 | 2888389266 | 145 |
| 195 | iso_pu_bacteria | 2903727486 | 2903733818 | 145 |
| 196 | iso_pu_bacteria | 2904666416 | 2904669200 | 145 |
| 197 | iso_pu_bacteria | 2904711408 | 2904719396 | 145 |
| 198 | iso_pu_bacteria | 2906602504 | 2906606755 | 145 |
| 199 | iso_pu_bacteria | 2906626472 | 2906627481 | 145 |
| 200 | iso_pu_bacteria | 2908775508 | 2908781748 | 145 |
| 201 | iso_pu_bacteria | 2922393267 | 2922401152 | 145 |
| 202 | iso_pu_bacteria | 2922425934 | 2922427716 | 145 |
| 203 | iso_pu_bacteria | 2935648319 | 2935653501 | 145 |
| 204 | iso_pu_bacteria | 2935656913 | 2935662250 | 145 |
| 205 | iso_pu_bacteria | 2935777560 | 2935785269 | 145 |
| 206 | iso_pu_bacteria | 2935908558 | 2935912086 | 145 |
| 207 | iso_pu_bacteria | 2935916978 | 2935922297 | 145 |
| 208 | iso_pu_bacteria | 2935926038 | 2935929115 | 145 |
| 209 | iso_pu_bacteria | 2935934488 | 2935935746 | 145 |
| 210 | iso_pu_bacteria | 2935942939 | 2935947312 | 145 |
| 211 | iso_pu_bacteria | 2935951376 | 2935953594 | 145 |
| 212 | iso_pu_bacteria | 2935959822 | 2935961894 | 145 |
| 213 | iso_pu_bacteria | 2935967501 | 2935968620 | 145 |
| 214 | iso_pu_bacteria | 2935975950 | 2935976802 | 145 |
| 215 | iso_pu_bacteria | 2935984226 | 2935992110 | 145 |
| 216 | iso_pu_bacteria | 2936011229 | 2936016552 | 145 |
| 217 | iso_pu_bacteria | 2936019824 | 2936025134 | 145 |
| 218 | iso_pu_bacteria | 2936028420 | 2936034027 | 145 |
| 219 | iso_pu_bacteria | 2936046547 | 2936052033 | 145 |
| 220 | iso_pu_bacteria | 2936055302 | 2936059806 | 145 |
| 221 | iso_pu_bacteria | 3005506211 | 3005511367 | 145 |
| 222 | iso_pu_bacteria | 3005587118 | 3005592932 | 145 |
| 223 | iso_pu_bacteria | 3005594810 | 3005596372 | 145 |
| 224 | iso_pu_bacteria | 3005710791 | 3005712454 | 145 |
| 225 | iso_pu_bacteria | 3005718088 | 3005719528 | 145 |
| 226 | iso_pu_bacteria | 8006926726 | 8006930132 | 145 |
| 227 | iso_pu_bacteria | 8016583857 | 8016588931 | 145 |
| 228 | iso_pu_bacteria | 8016613128 | 8016620490 | 145 |
| 229 | iso_pu_bacteria | 8016630954 | 8016637904 | 145 |
| 230 | iso_pu_bacteria | 8019538911 | 8019538931 | 145 |
| 231 | iso_pu_bacteria | 8019565922 | 8019569840 | 145 |
| 232 | iso_pu_bacteria | 8019619141 | 8019624972 | 145 |
| 233 | iso_pu_bacteria | 8019629233 | 8019637209 | 145 |
| 234 | iso_pu_bacteria | 8019638758 | 8019642381 | 145 |
| 235 | iso_pu_bacteria | 8019648815 | 8019650198 | 145 |
| 236 | iso_pu_bacteria | 8019687851 | 8019694284 | 145 |
| 237 | iso_pu_bacteria | 8056967851 | 8056973577 | 145 |
| 238 | 3300005434 | Ga0070709_10017852 | Ga0070709_100178524 | 146 |
| 239 | 3300005434 | Ga0070709_10731884 | Ga0070709_107318841 | 146 |
| 240 | 3300005436 | Ga0070713_100027751 | Ga0070713_1000277511 | 146 |
| 241 | 3300005437 | Ga0070710_10000509 | Ga0070710_1000050912 | 146 |
| 242 | 3300006028 | Ga0070717_11278861 | Ga0070717_112788611 | 146 |
| 243 | 3300006163 | Ga0070715_10135225 | Ga0070715_101352252 | 146 |
| 244 | 3300006175 | Ga0070712_100822714 | Ga0070712_1008227141 | 146 |
| 245 | 3300025906 | Ga0207699_10047079 | Ga0207699_100470792 | 146 |
| 246 | 3300025906 | Ga0207699_10629452 | Ga0207699_106294522 | 146 |
| 247 | 3300025915 | Ga0207693_10073082 | Ga0207693_100730822 | 146 |
| 248 | 3300031247 | Ga0265340_10001728 | Ga0265340_1000172811 | 146 |
| 249 | 3300031249 | Ga0265339_10002990 | Ga0265339_100029904 | 146 |
| 250 | 3300031250 | Ga0265331_10019457 | Ga0265331_100194574 | 146 |
| 251 | 3300031711 | Ga0265314_10057154 | Ga0265314_100571543 | 146 |
| 252 | 3300031712 | Ga0265342_10000444 | Ga0265342_1000044414 | 146 |
| 253 | 3300025254 | Ga0209148_1008346 | Ga0209148_10083462 | 147 |
| 254 | 3300025272 | Ga0209455_1007598 | Ga0209455_10075982 | 147 |
| 255 | 3300025900 | Ga0207710_10131988 | Ga0207710_101319882 | 147 |
| 256 | 3300031344 | Ga0265316_10334795 | Ga0265316_103347952 | 147 |
| 257 | 3300031730 | Ga0307516_10005798 | Ga0307516_100057984 | 147 |
| 258 | 3300035695 | Ga0373927_1178075 | Ga0373927_1178075_33_491 | 147 |
| 259 | 3300039450 | Ga0436363_0134632 | Ga0436363_0134632_388_834 | 147 |
| 260 | 3300046462 | Ga0495651_0206179 | Ga0495651_0206179_625_1086 | 147 |
| 261 | 3300046477 | Ga0495664_0224520 | Ga0495664_0224520_374_835 | 147 |
| 262 | 3300046559 | Ga0495667_0179609 | Ga0495667_0179609_706_1167 | 147 |
| 263 | 3300046675 | Ga0495657_0272849 | Ga0495657_0272849_346_807 | 147 |
| 264 | 3300046809 | Ga0495600_0153015 | Ga0495600_0153015_275_736 | 147 |
| 265 | 3300048922 | Ga0496119_0418230 | Ga0496119_0418230_126_569 | 147 |
| 266 | 3300048923 | Ga0496120_0211508 | Ga0496120_0211508_48_491 | 147 |
| 267 | 3300048924 | Ga0496121_0123570 | Ga0496121_0123570_450_893 | 147 |
| 268 | 3300048929 | Ga0496126_0406873 | Ga0496126_0406873_160_603 | 147 |
| 269 | 3300005327 | Ga0070658_10212875 | Ga0070658_102128752 | 148 |
| 270 | 3300005336 | Ga0070680_100047508 | Ga0070680_1000475082 | 148 |
| 271 | 3300005344 | Ga0070661_101084222 | Ga0070661_1010842222 | 148 |
| 272 | 3300005434 | Ga0070709_10007376 | Ga0070709_100073763 | 148 |
| 273 | 3300005434 | Ga0070709_10294047 | Ga0070709_102940472 | 148 |
| 274 | 3300005435 | Ga0070714_100980272 | Ga0070714_1009802722 | 148 |
| 275 | 3300005436 | Ga0070713_100025767 | Ga0070713_1000257674 | 148 |
| 276 | 3300005437 | Ga0070710_10037161 | Ga0070710_100371613 | 148 |
| 277 | 3300005439 | Ga0070711_100007654 | Ga0070711_1000076545 | 148 |
| 278 | 3300005458 | Ga0070681_10131917 | Ga0070681_101319171 | 148 |
| 279 | 3300005518 | Ga0070699_100122767 | Ga0070699_1001227674 | 148 |
| 280 | 3300005530 | Ga0070679_100048075 | Ga0070679_1000480752 | 148 |
| 281 | 3300005539 | Ga0068853_100132768 | Ga0068853_1001327682 | 148 |
| 282 | 3300005543 | Ga0070672_102022741 | Ga0070672_1020227411 | 148 |
| 283 | 3300005547 | Ga0070693_100735925 | Ga0070693_1007359252 | 148 |
| 284 | 3300005563 | Ga0068855_100008246 | Ga0068855_1000082469 | 148 |
| 285 | 3300005937 | Ga0081455_10002888 | Ga0081455_100028886 | 148 |
| 286 | 3300006163 | Ga0070715_10043635 | Ga0070715_100436352 | 148 |
| 287 | 3300006173 | Ga0070716_100049801 | Ga0070716_1000498013 | 148 |
| 288 | 3300006173 | Ga0070716_100072066 | Ga0070716_1000720662 | 148 |
| 289 | 3300006175 | Ga0070712_100004995 | Ga0070712_1000049952 | 148 |
| 290 | 3300006942 | Ga0099824_1009392 | Ga0099824_10093928 | 148 |
| 291 | 3300006943 | Ga0099822_1000514 | Ga0099822_100051419 | 148 |
| 292 | 3300009093 | Ga0105240_10233840 | Ga0105240_102338403 | 148 |
| 293 | 3300009545 | Ga0105237_10205488 | Ga0105237_102054882 | 148 |
| 294 | 3300010375 | Ga0105239_10568477 | Ga0105239_105684772 | 148 |
| 295 | 3300013104 | Ga0157370_10067944 | Ga0157370_100679443 | 148 |
| 296 | 3300013104 | Ga0157370_10208636 | Ga0157370_102086363 | 148 |
| 297 | 3300013105 | Ga0157369_10630778 | Ga0157369_106307782 | 148 |
| 298 | 3300013105 | Ga0157369_10640261 | Ga0157369_106402611 | 148 |
| 299 | 3300025906 | Ga0207699_10042139 | Ga0207699_100421391 | 148 |
| 300 | 3300025906 | Ga0207699_10448861 | Ga0207699_104488612 | 148 |
| 301 | 3300025909 | Ga0207705_10063754 | Ga0207705_100637542 | 148 |
| 302 | 3300025910 | Ga0207684_10264942 | Ga0207684_102649422 | 148 |
| 303 | 3300025912 | Ga0207707_11034968 | Ga0207707_110349681 | 148 |
| 304 | 3300025913 | Ga0207695_10419804 | Ga0207695_104198042 | 148 |
| 305 | 3300025915 | Ga0207693_10002721 | Ga0207693_100027213 | 148 |
| 306 | 3300025917 | Ga0207660_10046176 | Ga0207660_100461762 | 148 |
| 307 | 3300025928 | Ga0207700_10034721 | Ga0207700_100347212 | 148 |
| 308 | 3300025928 | Ga0207700_11377182 | Ga0207700_113771821 | 148 |
| 309 | 3300025929 | Ga0207664_10005551 | Ga0207664_100055517 | 148 |
| 310 | 3300025932 | Ga0207690_10583846 | Ga0207690_105838461 | 148 |
| 311 | 3300025939 | Ga0207665_10044199 | Ga0207665_100441993 | 148 |
| 312 | 3300025939 | Ga0207665_10158096 | Ga0207665_101580962 | 148 |
| 313 | 3300025949 | Ga0207667_10024730 | Ga0207667_100247301 | 148 |
| 314 | 3300026067 | Ga0207678_10432481 | Ga0207678_104324811 | 148 |
| 315 | 3300027357 | Ga0209589_1000007 | Ga0209589_100000733 | 148 |
| 316 | 3300027361 | Ga0209489_100008 | Ga0209489_10000833 | 148 |
| 317 | 3300027363 | Ga0209700_100009 | Ga0209700_10000933 | 148 |
| 318 | 3300031548 | Ga0307408_100660726 | Ga0307408_1006607262 | 148 |
| 319 | 3300031731 | Ga0307405_10299483 | Ga0307405_102994832 | 148 |
| 320 | 3300031824 | Ga0307413_10136694 | Ga0307413_101366942 | 148 |
| 321 | 3300031903 | Ga0307407_10193574 | Ga0307407_101935742 | 148 |
| 322 | 3300031911 | Ga0307412_10558885 | Ga0307412_105588852 | 148 |
| 323 | 3300031995 | Ga0307409_100377484 | Ga0307409_1003774842 | 148 |
| 324 | 3300032002 | Ga0307416_100041830 | Ga0307416_1000418302 | 148 |
| 325 | 3300032004 | Ga0307414_10335122 | Ga0307414_103351222 | 148 |
| 326 | 3300032005 | Ga0307411_10053188 | Ga0307411_100531884 | 148 |
| 327 | 3300035113 | Ga0373936_0017211 | Ga0373936_0017211_887_1384 | 148 |
| 328 | 3300035113 | Ga0373936_0098441 | Ga0373936_0098441_398_847 | 148 |
| 329 | 3300035171 | Ga0373946_0461348 | Ga0373946_0461348_85_540 | 148 |
| 330 | 3300035695 | Ga0373927_0158701 | Ga0373927_0158701_329_784 | 148 |
| 331 | 3300041486 | Ga0451807_1542365 | Ga0451807_1542365_318_764 | 148 |
| 332 | 3300041509 | Ga0451843_1086481 | Ga0451843_1086481_232_678 | 148 |
| 333 | 3300044656 | Ga0466969_0043185 | Ga0466969_0043185_579_1025 | 148 |
| 334 | 3300044694 | Ga0466963_0992467 | Ga0466963_0992467_18_479 | 148 |
| 335 | 3300044765 | Ga0466970_0405278 | Ga0466970_0405278_287_733 | 148 |
| 336 | 3300045049 | Ga0466959_0248511 | Ga0466959_0248511_600_1046 | 148 |
| 337 | 3300048905 | Ga0496102_0392845 | Ga0496102_0392845_766_1212 | 148 |
| 338 | 3300048909 | Ga0496106_0191605 | Ga0496106_0191605_700_1146 | 148 |
| 339 | 3300048922 | Ga0496119_0201214 | Ga0496119_0201214_28_477 | 148 |
| 340 | 3300048924 | Ga0496121_0128251 | Ga0496121_0128251_301_747 | 148 |
| 341 | 3300048924 | Ga0496121_0180100 | Ga0496121_0180100_748_1194 | 148 |
| 342 | 3300048929 | Ga0496126_0061075 | Ga0496126_0061075_1109_1615 | 148 |
| 343 | 3300048929 | Ga0496126_0387263 | Ga0496126_0387263_429_878 | 148 |
| 344 | 3300048929 | Ga0496126_0612840 | Ga0496126_0612840_316_762 | 148 |
| 345 | 3300049568 | Ga0501031_0338979 | Ga0501031_0338979_20_541 | 148 |
| 346 | 3300049569 | Ga0501032_0004425 | Ga0501032_0004425_2505_3026 | 148 |
| 347 | 3300049570 | Ga0501033_0000244 | Ga0501033_0000244_30939_31460 | 148 |
| 348 | 3300049571 | Ga0501034_0000159 | Ga0501034_0000159_20772_21293 | 148 |
| 349 | 3300049572 | Ga0501036_0000039 | Ga0501036_0000039_21805_22326 | 148 |
| 350 | 3300049573 | Ga0501037_0000882 | Ga0501037_0000882_13058_13579 | 148 |
| 351 | 3300049574 | Ga0501038_0000207 | Ga0501038_0000207_41841_42362 | 148 |
| 352 | 3300049575 | Ga0501039_0000148 | Ga0501039_0000148_45119_45640 | 148 |
| 353 | 3300049578 | Ga0501042_0045184 | Ga0501042_0045184_991_1512 | 148 |
| 354 | 3300049579 | Ga0501043_0001205 | Ga0501043_0001205_16549_17070 | 148 |
| 355 | 3300049580 | Ga0501046_0000185 | Ga0501046_0000185_39981_40502 | 148 |
| 356 | 3300049581 | Ga0501047_0000385 | Ga0501047_0000385_28343_28864 | 148 |
| 357 | 3300049583 | Ga0501067_0014764 | Ga0501067_0014764_2188_2709 | 148 |
| 358 | 3300049583 | Ga0501067_0042385 | Ga0501067_0042385_1911_2369 | 148 |
| 359 | 3300049584 | Ga0501068_0000371 | Ga0501068_0000371_8915_9436 | 148 |
| 360 | 3300049586 | Ga0501070_0002140 | Ga0501070_0002140_11302_11823 | 148 |
| 361 | 3300049587 | Ga0501071_0249897 | Ga0501071_0249897_346_867 | 148 |
| 362 | 3300049588 | Ga0501072_0008681 | Ga0501072_0008681_1349_1870 | 148 |
| 363 | 3300049589 | Ga0501073_0000702 | Ga0501073_0000702_20106_20627 | 148 |
| 364 | 3300049590 | Ga0501074_0000271 | Ga0501074_0000271_68_589 | 148 |
| 365 | 3300049741 | Ga0501079_0004349 | Ga0501079_0004349_5926_6447 | 148 |
| 366 | 3300049742 | Ga0501080_0000380 | Ga0501080_0000380_13459_13980 | 148 |
| 367 | 3300049743 | Ga0501081_0087849 | Ga0501081_0087849_310_831 | 148 |
| 368 | 3300049744 | Ga0501083_0000118 | Ga0501083_0000118_5048_5569 | 148 |
| 369 | 3300049822 | Ga0501035_0004827 | Ga0501035_0004827_11169_11690 | 148 |
| 370 | 3300049823 | Ga0501044_0000548 | Ga0501044_0000548_16797_17318 | 148 |
| 371 | 3300049824 | Ga0501045_0003030 | Ga0501045_0003030_469_990 | 148 |
| 372 | 3300053080 | Ga0500635_0076503 | Ga0500635_0076503_16_465 | 148 |
| 373 | 3300053091 | Ga0500647_0096086 | Ga0500647_0096086_491_940 | 148 |
| 374 | 3300053094 | Ga0500566_0000239 | Ga0500566_0000239_23311_23760 | 148 |
| 375 | 3300053095 | Ga0500640_032259 | Ga0500640_032259_658_1107 | 148 |
| 376 | 3300053111 | Ga0500572_002004 | Ga0500572_002004_2208_2657 | 148 |
| 377 | 3300053122 | Ga0500608_010552 | Ga0500608_010552_1761_2210 | 148 |
| 378 | 3300053136 | Ga0500559_0003940 | Ga0500559_0003940_4767_5216 | 148 |
| 379 | 3300053144 | Ga0500585_125611 | Ga0500585_125611_296_745 | 148 |
| 380 | 3300053148 | Ga0500590_042653 | Ga0500590_042653_1763_2212 | 148 |
| 381 | 3300053150 | Ga0500603_002048 | Ga0500603_002048_1814_2263 | 148 |
| 382 | 3300053159 | Ga0500630_003788 | Ga0500630_003788_4745_5194 | 148 |
| 383 | 3300053162 | Ga0500638_049719 | Ga0500638_049719_1126_1575 | 148 |
| 384 | 3300053163 | Ga0500639_000076 | Ga0500639_000076_33580_34029 | 148 |
| 385 | 3300053177 | Ga0500636_0227094 | Ga0500636_0227094_370_819 | 148 |
| 386 | 3300053735 | Ga0500596_003456 | Ga0500596_003456_407_856 | 148 |
| 387 | 3300053737 | Ga0500601_003860 | Ga0500601_003860_809_1258 | 148 |
| 388 | 3300054114 | Ga0501084_0002995 | Ga0501084_0002995_1815_2336 | 148 |
| 389 | 3300060353 | Ga0501082_0000570 | Ga0501082_0000570_20775_21296 | 148 |
| 390 | 3300001904 | JGI24736J21556_1021087 | JGI24736J21556_10210871 | 149 |
| 391 | 3300001989 | JGI24739J22299_10146617 | JGI24739J22299_101466172 | 149 |
| 392 | 3300003214 | JGI25165J46597_1012230 | JGI25165J46597_10122302 | 149 |
| 393 | 3300003214 | JGI25165J46597_1026221 | JGI25165J46597_10262211 | 149 |
| 394 | 3300003215 | JGI25153J46596_10002319 | JGI25153J46596_100023196 | 149 |
| 395 | 3300003215 | JGI25153J46596_10009452 | JGI25153J46596_100094526 | 149 |
| 396 | 3300003215 | JGI25153J46596_10015838 | JGI25153J46596_100158385 | 149 |
| 397 | 3300003215 | JGI25153J46596_10079426 | JGI25153J46596_100794261 | 149 |
| 398 | 3300003354 | JGI25160J50197_1002079 | JGI25160J50197_10020797 | 149 |
| 399 | 3300003354 | JGI25160J50197_1003509 | JGI25160J50197_10035094 | 149 |
| 400 | 3300003794 | Ga0055531_10010256 | Ga0055531_100102564 | 149 |
| 401 | 3300004625 | Ga0055543_1003926 | Ga0055543_10039266 | 149 |
| 402 | 3300005262 | Ga0065165_1001577 | Ga0065165_100157720 | 149 |
| 403 | 3300005262 | Ga0065165_1003271 | Ga0065165_10032717 | 149 |
| 404 | 3300005262 | Ga0065165_1011199 | Ga0065165_10111994 | 149 |
| 405 | 3300005295 | Ga0065707_10180538 | Ga0065707_101805382 | 149 |
| 406 | 3300005327 | Ga0070658_10417327 | Ga0070658_104173272 | 149 |
| 407 | 3300005327 | Ga0070658_10901556 | Ga0070658_109015562 | 149 |
| 408 | 3300005328 | Ga0070676_10364825 | Ga0070676_103648252 | 149 |
| 409 | 3300005329 | Ga0070683_100097917 | Ga0070683_1000979174 | 149 |
| 410 | 3300005330 | Ga0070690_100160818 | Ga0070690_1001608181 | 149 |
| 411 | 3300005334 | Ga0068869_100020962 | Ga0068869_1000209625 | 149 |
| 412 | 3300005334 | Ga0068869_100194276 | Ga0068869_1001942763 | 149 |
| 413 | 3300005335 | Ga0070666_10171222 | Ga0070666_101712222 | 149 |
| 414 | 3300005335 | Ga0070666_10528762 | Ga0070666_105287622 | 149 |
| 415 | 3300005336 | Ga0070680_101253899 | Ga0070680_1012538991 | 149 |
| 416 | 3300005337 | Ga0070682_100048952 | Ga0070682_1000489522 | 149 |
| 417 | 3300005337 | Ga0070682_101275761 | Ga0070682_1012757612 | 149 |
| 418 | 3300005337 | Ga0070682_101930484 | Ga0070682_1019304841 | 149 |
| 419 | 3300005338 | Ga0068868_100057233 | Ga0068868_1000572332 | 149 |
| 420 | 3300005338 | Ga0068868_100301779 | Ga0068868_1003017793 | 149 |
| 421 | 3300005338 | Ga0068868_100539476 | Ga0068868_1005394762 | 149 |
| 422 | 3300005340 | Ga0070689_100413365 | Ga0070689_1004133651 | 149 |
| 423 | 3300005340 | Ga0070689_101670846 | Ga0070689_1016708461 | 149 |
| 424 | 3300005343 | Ga0070687_101535525 | Ga0070687_1015355251 | 149 |
| 425 | 3300005344 | Ga0070661_100037493 | Ga0070661_1000374932 | 149 |
| 426 | 3300005347 | Ga0070668_100030699 | Ga0070668_1000306993 | 149 |
| 427 | 3300005347 | Ga0070668_100144595 | Ga0070668_1001445951 | 149 |
| 428 | 3300005347 | Ga0070668_100202596 | Ga0070668_1002025962 | 149 |
| 429 | 3300005347 | Ga0070668_100220982 | Ga0070668_1002209821 | 149 |
| 430 | 3300005347 | Ga0070668_100536575 | Ga0070668_1005365752 | 149 |
| 431 | 3300005347 | Ga0070668_100883897 | Ga0070668_1008838971 | 149 |
| 432 | 3300005353 | Ga0070669_100084960 | Ga0070669_1000849602 | 149 |
| 433 | 3300005353 | Ga0070669_100571491 | Ga0070669_1005714912 | 149 |
| 434 | 3300005353 | Ga0070669_100827498 | Ga0070669_1008274982 | 149 |
| 435 | 3300005354 | Ga0070675_100787007 | Ga0070675_1007870071 | 149 |
| 436 | 3300005355 | Ga0070671_100016959 | Ga0070671_1000169595 | 149 |
| 437 | 3300005355 | Ga0070671_100173004 | Ga0070671_1001730043 | 149 |
| 438 | 3300005355 | Ga0070671_100375167 | Ga0070671_1003751672 | 149 |
| 439 | 3300005355 | Ga0070671_100400113 | Ga0070671_1004001132 | 149 |
| 440 | 3300005356 | Ga0070674_100054414 | Ga0070674_1000544142 | 149 |
| 441 | 3300005366 | Ga0070659_100309167 | Ga0070659_1003091672 | 149 |
| 442 | 3300005366 | Ga0070659_100368183 | Ga0070659_1003681832 | 149 |
| 443 | 3300005367 | Ga0070667_100198123 | Ga0070667_1001981233 | 149 |
| 444 | 3300005367 | Ga0070667_100323630 | Ga0070667_1003236301 | 149 |
| 445 | 3300005367 | Ga0070667_100566270 | Ga0070667_1005662702 | 149 |
| 446 | 3300005367 | Ga0070667_100755351 | Ga0070667_1007553512 | 149 |
| 447 | 3300005435 | Ga0070714_100587337 | Ga0070714_1005873372 | 149 |
| 448 | 3300005436 | Ga0070713_100020602 | Ga0070713_1000206023 | 149 |
| 449 | 3300005438 | Ga0070701_10490322 | Ga0070701_104903222 | 149 |
| 450 | 3300005441 | Ga0070700_100271444 | Ga0070700_1002714441 | 149 |
| 451 | 3300005441 | Ga0070700_100303333 | Ga0070700_1003033331 | 149 |
| 452 | 3300005444 | Ga0070694_100422542 | Ga0070694_1004225422 | 149 |
| 453 | 3300005455 | Ga0070663_100005879 | Ga0070663_1000058798 | 149 |
| 454 | 3300005455 | Ga0070663_100085339 | Ga0070663_1000853392 | 149 |
| 455 | 3300005455 | Ga0070663_100106479 | Ga0070663_1001064791 | 149 |
| 456 | 3300005455 | Ga0070663_100138533 | Ga0070663_1001385332 | 149 |
| 457 | 3300005455 | Ga0070663_100142887 | Ga0070663_1001428873 | 149 |
| 458 | 3300005455 | Ga0070663_100309624 | Ga0070663_1003096242 | 149 |
| 459 | 3300005455 | Ga0070663_100558360 | Ga0070663_1005583602 | 149 |
| 460 | 3300005456 | Ga0070678_100006542 | Ga0070678_1000065426 | 149 |
| 461 | 3300005456 | Ga0070678_100036131 | Ga0070678_1000361312 | 149 |
| 462 | 3300005456 | Ga0070678_100036166 | Ga0070678_1000361663 | 149 |
| 463 | 3300005456 | Ga0070678_100051998 | Ga0070678_1000519983 | 149 |
| 464 | 3300005456 | Ga0070678_100099960 | Ga0070678_1000999602 | 149 |
| 465 | 3300005457 | Ga0070662_100241273 | Ga0070662_1002412731 | 149 |
| 466 | 3300005466 | Ga0070685_10058764 | Ga0070685_100587643 | 149 |
| 467 | 3300005466 | Ga0070685_10340258 | Ga0070685_103402582 | 149 |
| 468 | 3300005466 | Ga0070685_10950487 | Ga0070685_109504871 | 149 |
| 469 | 3300005467 | Ga0070706_100820314 | Ga0070706_1008203141 | 149 |
| 470 | 3300005518 | Ga0070699_100087190 | Ga0070699_1000871903 | 149 |
| 471 | 3300005530 | Ga0070679_101078241 | Ga0070679_1010782411 | 149 |
| 472 | 3300005535 | Ga0070684_101069546 | Ga0070684_1010695461 | 149 |
| 473 | 3300005535 | Ga0070684_101409654 | Ga0070684_1014096541 | 149 |
| 474 | 3300005539 | Ga0068853_100180909 | Ga0068853_1001809092 | 149 |
| 475 | 3300005539 | Ga0068853_100521118 | Ga0068853_1005211181 | 149 |
| 476 | 3300005539 | Ga0068853_100587591 | Ga0068853_1005875912 | 149 |
| 477 | 3300005543 | Ga0070672_100012466 | Ga0070672_1000124662 | 149 |
| 478 | 3300005543 | Ga0070672_101289933 | Ga0070672_1012899332 | 149 |
| 479 | 3300005545 | Ga0070695_100088185 | Ga0070695_1000881852 | 149 |
| 480 | 3300005545 | Ga0070695_100476496 | Ga0070695_1004764962 | 149 |
| 481 | 3300005546 | Ga0070696_100041134 | Ga0070696_1000411343 | 149 |
| 482 | 3300005547 | Ga0070693_100434639 | Ga0070693_1004346391 | 149 |
| 483 | 3300005547 | Ga0070693_100818671 | Ga0070693_1008186711 | 149 |
| 484 | 3300005548 | Ga0070665_100037937 | Ga0070665_1000379373 | 149 |
| 485 | 3300005548 | Ga0070665_100038593 | Ga0070665_1000385935 | 149 |
| 486 | 3300005548 | Ga0070665_100038996 | Ga0070665_1000389966 | 149 |
| 487 | 3300005548 | Ga0070665_100051102 | Ga0070665_1000511024 | 149 |
| 488 | 3300005548 | Ga0070665_100082922 | Ga0070665_1000829223 | 149 |
| 489 | 3300005548 | Ga0070665_100223303 | Ga0070665_1002233033 | 149 |
| 490 | 3300005564 | Ga0070664_101193111 | Ga0070664_1011931111 | 149 |
| 491 | 3300005578 | Ga0068854_100576307 | Ga0068854_1005763071 | 149 |
| 492 | 3300005578 | Ga0068854_100635685 | Ga0068854_1006356851 | 149 |
| 493 | 3300005614 | Ga0068856_100089112 | Ga0068856_1000891124 | 149 |
| 494 | 3300005614 | Ga0068856_100119368 | Ga0068856_1001193682 | 149 |
| 495 | 3300005614 | Ga0068856_101170178 | Ga0068856_1011701782 | 149 |
| 496 | 3300005614 | Ga0068856_102492042 | Ga0068856_1024920421 | 149 |
| 497 | 3300005616 | Ga0068852_100128340 | Ga0068852_1001283401 | 149 |
| 498 | 3300005616 | Ga0068852_100393855 | Ga0068852_1003938552 | 149 |
| 499 | 3300005616 | Ga0068852_100606399 | Ga0068852_1006063991 | 149 |
| 500 | 3300005616 | Ga0068852_101187831 | Ga0068852_1011878311 | 149 |
| 501 | 3300005617 | Ga0068859_100190639 | Ga0068859_1001906393 | 149 |
| 502 | 3300005617 | Ga0068859_100201434 | Ga0068859_1002014341 | 149 |
| 503 | 3300005617 | Ga0068859_102126299 | Ga0068859_1021262991 | 149 |
| 504 | 3300005618 | Ga0068864_100085670 | Ga0068864_1000856702 | 149 |
| 505 | 3300005618 | Ga0068864_100896179 | Ga0068864_1008961791 | 149 |
| 506 | 3300005618 | Ga0068864_101566270 | Ga0068864_1015662701 | 149 |
| 507 | 3300005718 | Ga0068866_10047267 | Ga0068866_100472674 | 149 |
| 508 | 3300005718 | Ga0068866_10196323 | Ga0068866_101963231 | 149 |
| 509 | 3300005719 | Ga0068861_100116638 | Ga0068861_1001166383 | 149 |
| 510 | 3300005719 | Ga0068861_100397802 | Ga0068861_1003978022 | 149 |
| 511 | 3300005719 | Ga0068861_102118750 | Ga0068861_1021187501 | 149 |
| 512 | 3300005841 | Ga0068863_100174025 | Ga0068863_1001740252 | 149 |
| 513 | 3300005841 | Ga0068863_100230130 | Ga0068863_1002301301 | 149 |
| 514 | 3300005841 | Ga0068863_100694930 | Ga0068863_1006949302 | 149 |
| 515 | 3300005841 | Ga0068863_101086733 | Ga0068863_1010867331 | 149 |
| 516 | 3300005842 | Ga0068858_100032885 | Ga0068858_1000328852 | 149 |
| 517 | 3300005842 | Ga0068858_100204734 | Ga0068858_1002047343 | 149 |
| 518 | 3300005842 | Ga0068858_100354447 | Ga0068858_1003544473 | 149 |
| 519 | 3300005842 | Ga0068858_101355394 | Ga0068858_1013553941 | 149 |
| 520 | 3300005842 | Ga0068858_101417153 | Ga0068858_1014171531 | 149 |
| 521 | 3300005843 | Ga0068860_100224288 | Ga0068860_1002242882 | 149 |
| 522 | 3300005843 | Ga0068860_100400551 | Ga0068860_1004005512 | 149 |
| 523 | 3300005844 | Ga0068862_100212473 | Ga0068862_1002124733 | 149 |
| 524 | 3300005844 | Ga0068862_100240010 | Ga0068862_1002400102 | 149 |
| 525 | 3300005844 | Ga0068862_100451097 | Ga0068862_1004510972 | 149 |
| 526 | 3300005844 | Ga0068862_100625080 | Ga0068862_1006250801 | 149 |
| 527 | 3300005937 | Ga0081455_10090886 | Ga0081455_100908862 | 149 |
| 528 | 3300005937 | Ga0081455_10150392 | Ga0081455_101503922 | 149 |
| 529 | 3300005937 | Ga0081455_10209166 | Ga0081455_102091663 | 149 |
| 530 | 3300005937 | Ga0081455_10241891 | Ga0081455_102418912 | 149 |
| 531 | 3300005937 | Ga0081455_10394015 | Ga0081455_103940151 | 149 |
| 532 | 3300005983 | Ga0081540_1012679 | Ga0081540_10126796 | 149 |
| 533 | 3300005983 | Ga0081540_1030256 | Ga0081540_10302563 | 149 |
| 534 | 3300005983 | Ga0081540_1039809 | Ga0081540_10398093 | 149 |
| 535 | 3300005985 | Ga0081539_10000945 | Ga0081539_1000094542 | 149 |
| 536 | 3300005985 | Ga0081539_10043762 | Ga0081539_100437622 | 149 |
| 537 | 3300005985 | Ga0081539_10083471 | Ga0081539_100834712 | 149 |
| 538 | 3300006028 | Ga0070717_10269788 | Ga0070717_102697882 | 149 |
| 539 | 3300006038 | Ga0075365_10894864 | Ga0075365_108948641 | 149 |
| 540 | 3300006042 | Ga0075368_10015524 | Ga0075368_100155243 | 149 |
| 541 | 3300006042 | Ga0075368_10117281 | Ga0075368_101172812 | 149 |
| 542 | 3300006048 | Ga0075363_100006916 | Ga0075363_1000069165 | 149 |
| 543 | 3300006048 | Ga0075363_100035829 | Ga0075363_1000358295 | 149 |
| 544 | 3300006048 | Ga0075363_100238096 | Ga0075363_1002380962 | 149 |
| 545 | 3300006048 | Ga0075363_100244794 | Ga0075363_1002447942 | 149 |
| 546 | 3300006051 | Ga0075364_10019010 | Ga0075364_100190105 | 149 |
| 547 | 3300006051 | Ga0075364_10091731 | Ga0075364_100917312 | 149 |
| 548 | 3300006173 | Ga0070716_101764138 | Ga0070716_1017641381 | 149 |
| 549 | 3300006175 | Ga0070712_100048327 | Ga0070712_1000483274 | 149 |
| 550 | 3300006177 | Ga0075362_10072825 | Ga0075362_100728253 | 149 |
| 551 | 3300006177 | Ga0075362_10146714 | Ga0075362_101467142 | 149 |
| 552 | 3300006177 | Ga0075362_10248331 | Ga0075362_102483312 | 149 |
| 553 | 3300006178 | Ga0075367_10005440 | Ga0075367_100054403 | 149 |
| 554 | 3300006178 | Ga0075367_10018947 | Ga0075367_100189474 | 149 |
| 555 | 3300006178 | Ga0075367_10056226 | Ga0075367_100562262 | 149 |
| 556 | 3300006178 | Ga0075367_10293192 | Ga0075367_102931922 | 149 |
| 557 | 3300006178 | Ga0075367_10510503 | Ga0075367_105105032 | 149 |
| 558 | 3300006186 | Ga0075369_10125152 | Ga0075369_101251522 | 149 |
| 559 | 3300006195 | Ga0075366_10048174 | Ga0075366_100481746 | 149 |
| 560 | 3300006195 | Ga0075366_10195698 | Ga0075366_101956981 | 149 |
| 561 | 3300006237 | Ga0097621_100283128 | Ga0097621_1002831282 | 149 |
| 562 | 3300006237 | Ga0097621_100881220 | Ga0097621_1008812202 | 149 |
| 563 | 3300006237 | Ga0097621_101325842 | Ga0097621_1013258421 | 149 |
| 564 | 3300006353 | Ga0075370_10062772 | Ga0075370_100627722 | 149 |
| 565 | 3300006353 | Ga0075370_10079858 | Ga0075370_100798582 | 149 |
| 566 | 3300006353 | Ga0075370_10372660 | Ga0075370_103726601 | 149 |
| 567 | 3300006358 | Ga0068871_100619219 | Ga0068871_1006192192 | 149 |
| 568 | 3300006358 | Ga0068871_101167842 | Ga0068871_1011678421 | 149 |
| 569 | 3300006358 | Ga0068871_101427706 | Ga0068871_1014277061 | 149 |
| 570 | 3300006881 | Ga0068865_100127424 | Ga0068865_1001274242 | 149 |
| 571 | 3300006881 | Ga0068865_100626176 | Ga0068865_1006261762 | 149 |
| 572 | 3300006931 | Ga0097620_100190656 | Ga0097620_1001906563 | 149 |
| 573 | 3300006931 | Ga0097620_100201420 | Ga0097620_1002014201 | 149 |
| 574 | 3300006931 | Ga0097620_102126300 | Ga0097620_1021263001 | 149 |
| 575 | 3300006944 | Ga0099823_1022671 | Ga0099823_10226716 | 149 |
| 576 | 3300007265 | Ga0099794_10262941 | Ga0099794_102629411 | 149 |
| 577 | 3300007788 | Ga0099795_10015351 | Ga0099795_100153512 | 149 |
| 578 | 3300007788 | Ga0099795_10037493 | Ga0099795_100374932 | 149 |
| 579 | 3300009092 | Ga0105250_10162509 | Ga0105250_101625092 | 149 |
| 580 | 3300009092 | Ga0105250_10427447 | Ga0105250_104274471 | 149 |
| 581 | 3300009093 | Ga0105240_10060844 | Ga0105240_100608446 | 149 |
| 582 | 3300009093 | Ga0105240_10201857 | Ga0105240_102018573 | 149 |
| 583 | 3300009094 | Ga0111539_10718369 | Ga0111539_107183692 | 149 |
| 584 | 3300009098 | Ga0105245_10009619 | Ga0105245_100096196 | 149 |
| 585 | 3300009098 | Ga0105245_10030906 | Ga0105245_100309061 | 149 |
| 586 | 3300009098 | Ga0105245_10415340 | Ga0105245_104153402 | 149 |
| 587 | 3300009098 | Ga0105245_10593730 | Ga0105245_105937301 | 149 |
| 588 | 3300009101 | Ga0105247_10012238 | Ga0105247_100122385 | 149 |
| 589 | 3300009101 | Ga0105247_11189065 | Ga0105247_111890651 | 149 |
| 590 | 3300009147 | Ga0114129_11297391 | Ga0114129_112973911 | 149 |
| 591 | 3300009148 | Ga0105243_10240844 | Ga0105243_102408443 | 149 |
| 592 | 3300009148 | Ga0105243_10304699 | Ga0105243_103046991 | 149 |
| 593 | 3300009148 | Ga0105243_10364502 | Ga0105243_103645022 | 149 |
| 594 | 3300009174 | Ga0105241_10078928 | Ga0105241_100789282 | 149 |
| 595 | 3300009174 | Ga0105241_10379256 | Ga0105241_103792562 | 149 |
| 596 | 3300009174 | Ga0105241_10722583 | Ga0105241_107225832 | 149 |
| 597 | 3300009174 | Ga0105241_11310460 | Ga0105241_113104601 | 149 |
| 598 | 3300009176 | Ga0105242_10354340 | Ga0105242_103543403 | 149 |
| 599 | 3300009176 | Ga0105242_10529692 | Ga0105242_105296922 | 149 |
| 600 | 3300009176 | Ga0105242_10550984 | Ga0105242_105509841 | 149 |
| 601 | 3300009177 | Ga0105248_10236929 | Ga0105248_102369293 | 149 |
| 602 | 3300009177 | Ga0105248_10772422 | Ga0105248_107724221 | 149 |
| 603 | 3300009177 | Ga0105248_11199924 | Ga0105248_111999241 | 149 |
| 604 | 3300009545 | Ga0105237_10047396 | Ga0105237_100473965 | 149 |
| 605 | 3300009545 | Ga0105237_10217744 | Ga0105237_102177442 | 149 |
| 606 | 3300009545 | Ga0105237_10283700 | Ga0105237_102837002 | 149 |
| 607 | 3300009545 | Ga0105237_10353753 | Ga0105237_103537533 | 149 |
| 608 | 3300009545 | Ga0105237_11114500 | Ga0105237_111145001 | 149 |
| 609 | 3300009545 | Ga0105237_12285899 | Ga0105237_122858991 | 149 |
| 610 | 3300009551 | Ga0105238_10160883 | Ga0105238_101608832 | 149 |
| 611 | 3300009551 | Ga0105238_10366840 | Ga0105238_103668401 | 149 |
| 612 | 3300009551 | Ga0105238_10723596 | Ga0105238_107235962 | 149 |
| 613 | 3300009551 | Ga0105238_11283815 | Ga0105238_112838151 | 149 |
| 614 | 3300009553 | Ga0105249_10371858 | Ga0105249_103718582 | 149 |
| 615 | 3300009553 | Ga0105249_10910208 | Ga0105249_109102082 | 149 |
| 616 | 3300010159 | Ga0099796_10011316 | Ga0099796_100113162 | 149 |
| 617 | 3300010375 | Ga0105239_10048157 | Ga0105239_100481575 | 149 |
| 618 | 3300010375 | Ga0105239_10143828 | Ga0105239_101438285 | 149 |
| 619 | 3300010375 | Ga0105239_10160763 | Ga0105239_101607632 | 149 |
| 620 | 3300010375 | Ga0105239_10420828 | Ga0105239_104208282 | 149 |
| 621 | 3300010375 | Ga0105239_10473650 | Ga0105239_104736502 | 149 |
| 622 | 3300010375 | Ga0105239_12022104 | Ga0105239_120221041 | 149 |
| 623 | 3300011119 | Ga0105246_10016029 | Ga0105246_100160291 | 149 |
| 624 | 3300011119 | Ga0105246_10081283 | Ga0105246_100812833 | 149 |
| 625 | 3300011119 | Ga0105246_10250258 | Ga0105246_102502582 | 149 |
| 626 | 3300013100 | Ga0157373_10296683 | Ga0157373_102966831 | 149 |
| 627 | 3300013104 | Ga0157370_10128852 | Ga0157370_101288523 | 149 |
| 628 | 3300013105 | Ga0157369_10006777 | Ga0157369_100067773 | 149 |
| 629 | 3300013105 | Ga0157369_11063775 | Ga0157369_110637752 | 149 |
| 630 | 3300013296 | Ga0157374_10640324 | Ga0157374_106403242 | 149 |
| 631 | 3300013297 | Ga0157378_10052677 | Ga0157378_100526773 | 149 |
| 632 | 3300013297 | Ga0157378_11792963 | Ga0157378_117929632 | 149 |
| 633 | 3300013306 | Ga0163162_10041842 | Ga0163162_100418425 | 149 |
| 634 | 3300013306 | Ga0163162_10168343 | Ga0163162_101683432 | 149 |
| 635 | 3300013306 | Ga0163162_10403251 | Ga0163162_104032511 | 149 |
| 636 | 3300013306 | Ga0163162_10477785 | Ga0163162_104777852 | 149 |
| 637 | 3300013306 | Ga0163162_11305588 | Ga0163162_113055881 | 149 |
| 638 | 3300013306 | Ga0163162_11347941 | Ga0163162_113479411 | 149 |
| 639 | 3300013306 | Ga0163162_11688210 | Ga0163162_116882101 | 149 |
| 640 | 3300013308 | Ga0157375_10268156 | Ga0157375_102681563 | 149 |
| 641 | 3300014325 | Ga0163163_10139629 | Ga0163163_101396292 | 149 |
| 642 | 3300014325 | Ga0163163_10502220 | Ga0163163_105022201 | 149 |
| 643 | 3300014325 | Ga0163163_10980453 | Ga0163163_109804531 | 149 |
| 644 | 3300014325 | Ga0163163_11395180 | Ga0163163_113951801 | 149 |
| 645 | 3300014326 | Ga0157380_10222173 | Ga0157380_102221731 | 149 |
| 646 | 3300014326 | Ga0157380_10288892 | Ga0157380_102888921 | 149 |
| 647 | 3300014326 | Ga0157380_10439756 | Ga0157380_104397562 | 149 |
| 648 | 3300014497 | Ga0182008_10744428 | Ga0182008_107444281 | 149 |
| 649 | 3300014745 | Ga0157377_10165116 | Ga0157377_101651162 | 149 |
| 650 | 3300014968 | Ga0157379_10228819 | Ga0157379_102288192 | 149 |
| 651 | 3300014968 | Ga0157379_10404762 | Ga0157379_104047622 | 149 |
| 652 | 3300014968 | Ga0157379_11024733 | Ga0157379_110247331 | 149 |
| 653 | 3300014969 | Ga0157376_10126305 | Ga0157376_101263052 | 149 |
| 654 | 3300014969 | Ga0157376_10441462 | Ga0157376_104414622 | 149 |
| 655 | 3300015262 | Ga0182007_10162187 | Ga0182007_101621872 | 149 |
| 656 | 3300017792 | Ga0163161_10127501 | Ga0163161_101275012 | 149 |
| 657 | 3300021320 | Ga0214544_1000001 | Ga0214544_1000001189 | 149 |
| 658 | 3300021321 | Ga0214542_1000005 | Ga0214542_1000005189 | 149 |
| 659 | 3300021321 | Ga0214542_1027073 | Ga0214542_10270733 | 149 |
| 660 | 3300021324 | Ga0214545_1000003 | Ga0214545_1000003575 | 149 |
| 661 | 3300021324 | Ga0214545_1019813 | Ga0214545_10198133 | 149 |
| 662 | 3300021327 | Ga0214543_1000002 | Ga0214543_1000002190 | 149 |
| 663 | 3300021327 | Ga0214543_1039960 | Ga0214543_10399602 | 149 |
| 664 | 3300021358 | Ga0213873_10031211 | Ga0213873_100312111 | 149 |
| 665 | 3300021441 | Ga0213871_10018916 | Ga0213871_100189162 | 149 |
| 666 | 3300025230 | Ga0209563_110124 | Ga0209563_1101241 | 149 |
| 667 | 3300025245 | Ga0207425_1009648 | Ga0207425_10096482 | 149 |
| 668 | 3300025253 | Ga0209677_105397 | Ga0209677_1053974 | 149 |
| 669 | 3300025261 | Ga0209233_1003418 | Ga0209233_10034184 | 149 |
| 670 | 3300025261 | Ga0209233_1006411 | Ga0209233_10064114 | 149 |
| 671 | 3300025261 | Ga0209233_1008559 | Ga0209233_10085593 | 149 |
| 672 | 3300025261 | Ga0209233_1022427 | Ga0209233_10224271 | 149 |
| 673 | 3300025272 | Ga0209455_1021895 | Ga0209455_10218951 | 149 |
| 674 | 3300025297 | Ga0209758_1000026 | Ga0209758_1000026131 | 149 |
| 675 | 3300025297 | Ga0209758_1000479 | Ga0209758_100047929 | 149 |
| 676 | 3300025297 | Ga0209758_1005453 | Ga0209758_10054537 | 149 |
| 677 | 3300025297 | Ga0209758_1005713 | Ga0209758_10057131 | 149 |
| 678 | 3300025297 | Ga0209758_1009114 | Ga0209758_10091146 | 149 |
| 679 | 3300025297 | Ga0209758_1029176 | Ga0209758_10291762 | 149 |
| 680 | 3300025297 | Ga0209758_1059991 | Ga0209758_10599912 | 149 |
| 681 | 3300025299 | Ga0209256_1027256 | Ga0209256_10272561 | 149 |
| 682 | 3300025302 | Ga0207426_1001455 | Ga0207426_100145512 | 149 |
| 683 | 3300025302 | Ga0207426_1002534 | Ga0207426_10025347 | 149 |
| 684 | 3300025302 | Ga0207426_1030642 | Ga0207426_10306423 | 149 |
| 685 | 3300025302 | Ga0207426_1045255 | Ga0207426_10452552 | 149 |
| 686 | 3300025303 | Ga0209051_1069589 | Ga0209051_10695891 | 149 |
| 687 | 3300025303 | Ga0209051_1146783 | Ga0209051_11467831 | 149 |
| 688 | 3300025304 | Ga0209257_1005738 | Ga0209257_10057386 | 149 |
| 689 | 3300025304 | Ga0209257_1009389 | Ga0209257_10093894 | 149 |
| 690 | 3300025315 | Ga0207697_10017910 | Ga0207697_100179101 | 149 |
| 691 | 3300025315 | Ga0207697_10095675 | Ga0207697_100956752 | 149 |
| 692 | 3300025321 | Ga0207656_10303524 | Ga0207656_103035241 | 149 |
| 693 | 3300025901 | Ga0207688_10147599 | Ga0207688_101475991 | 149 |
| 694 | 3300025901 | Ga0207688_10295931 | Ga0207688_102959312 | 149 |
| 695 | 3300025901 | Ga0207688_10416004 | Ga0207688_104160041 | 149 |
| 696 | 3300025901 | Ga0207688_10557880 | Ga0207688_105578802 | 149 |
| 697 | 3300025901 | Ga0207688_10772746 | Ga0207688_107727461 | 149 |
| 698 | 3300025903 | Ga0207680_10153136 | Ga0207680_101531363 | 149 |
| 699 | 3300025904 | Ga0207647_10001122 | Ga0207647_100011224 | 149 |
| 700 | 3300025904 | Ga0207647_10127468 | Ga0207647_101274682 | 149 |
| 701 | 3300025904 | Ga0207647_10359708 | Ga0207647_103597081 | 149 |
| 702 | 3300025907 | Ga0207645_10109815 | Ga0207645_101098154 | 149 |
| 703 | 3300025907 | Ga0207645_10294283 | Ga0207645_102942832 | 149 |
| 704 | 3300025907 | Ga0207645_10372972 | Ga0207645_103729722 | 149 |
| 705 | 3300025909 | Ga0207705_10350171 | Ga0207705_103501712 | 149 |
| 706 | 3300025910 | Ga0207684_10466915 | Ga0207684_104669152 | 149 |
| 707 | 3300025911 | Ga0207654_10031489 | Ga0207654_100314895 | 149 |
| 708 | 3300025911 | Ga0207654_10057695 | Ga0207654_100576952 | 149 |
| 709 | 3300025911 | Ga0207654_10514235 | Ga0207654_105142351 | 149 |
| 710 | 3300025913 | Ga0207695_10146707 | Ga0207695_101467071 | 149 |
| 711 | 3300025913 | Ga0207695_10249945 | Ga0207695_102499452 | 149 |
| 712 | 3300025913 | Ga0207695_10704868 | Ga0207695_107048681 | 149 |
| 713 | 3300025914 | Ga0207671_11054244 | Ga0207671_110542441 | 149 |
| 714 | 3300025914 | Ga0207671_11343030 | Ga0207671_113430301 | 149 |
| 715 | 3300025915 | Ga0207693_10165680 | Ga0207693_101656801 | 149 |
| 716 | 3300025916 | Ga0207663_10168514 | Ga0207663_101685142 | 149 |
| 717 | 3300025918 | Ga0207662_10142934 | Ga0207662_101429343 | 149 |
| 718 | 3300025919 | Ga0207657_10090831 | Ga0207657_100908315 | 149 |
| 719 | 3300025919 | Ga0207657_10642127 | Ga0207657_106421272 | 149 |
| 720 | 3300025919 | Ga0207657_10944750 | Ga0207657_109447501 | 149 |
| 721 | 3300025922 | Ga0207646_11030532 | Ga0207646_110305321 | 149 |
| 722 | 3300025923 | Ga0207681_10056349 | Ga0207681_100563494 | 149 |
| 723 | 3300025924 | Ga0207694_10249101 | Ga0207694_102491012 | 149 |
| 724 | 3300025924 | Ga0207694_10459638 | Ga0207694_104596382 | 149 |
| 725 | 3300025925 | Ga0207650_10157843 | Ga0207650_101578431 | 149 |
| 726 | 3300025925 | Ga0207650_10656129 | Ga0207650_106561292 | 149 |
| 727 | 3300025925 | Ga0207650_10864118 | Ga0207650_108641181 | 149 |
| 728 | 3300025926 | Ga0207659_10488826 | Ga0207659_104888262 | 149 |
| 729 | 3300025927 | Ga0207687_10178430 | Ga0207687_101784301 | 149 |
| 730 | 3300025927 | Ga0207687_10240498 | Ga0207687_102404982 | 149 |
| 731 | 3300025928 | Ga0207700_10527112 | Ga0207700_105271122 | 149 |
| 732 | 3300025929 | Ga0207664_11449492 | Ga0207664_114494921 | 149 |
| 733 | 3300025931 | Ga0207644_10329070 | Ga0207644_103290702 | 149 |
| 734 | 3300025931 | Ga0207644_11418262 | Ga0207644_114182621 | 149 |
| 735 | 3300025932 | Ga0207690_11231681 | Ga0207690_112316812 | 149 |
| 736 | 3300025933 | Ga0207706_10101453 | Ga0207706_101014532 | 149 |
| 737 | 3300025933 | Ga0207706_10193204 | Ga0207706_101932042 | 149 |
| 738 | 3300025933 | Ga0207706_10856691 | Ga0207706_108566912 | 149 |
| 739 | 3300025935 | Ga0207709_10007189 | Ga0207709_100071893 | 149 |
| 740 | 3300025935 | Ga0207709_10155618 | Ga0207709_101556182 | 149 |
| 741 | 3300025935 | Ga0207709_10275668 | Ga0207709_102756681 | 149 |
| 742 | 3300025935 | Ga0207709_11154410 | Ga0207709_111544101 | 149 |
| 743 | 3300025940 | Ga0207691_10068065 | Ga0207691_100680653 | 149 |
| 744 | 3300025941 | Ga0207711_10551367 | Ga0207711_105513672 | 149 |
| 745 | 3300025941 | Ga0207711_10797332 | Ga0207711_107973322 | 149 |
| 746 | 3300025942 | Ga0207689_10118666 | Ga0207689_101186663 | 149 |
| 747 | 3300025942 | Ga0207689_10924399 | Ga0207689_109243991 | 149 |
| 748 | 3300025944 | Ga0207661_10159549 | Ga0207661_101595492 | 149 |
| 749 | 3300025945 | Ga0207679_10168233 | Ga0207679_101682333 | 149 |
| 750 | 3300025949 | Ga0207667_10127423 | Ga0207667_101274233 | 149 |
| 751 | 3300025949 | Ga0207667_11175661 | Ga0207667_111756611 | 149 |
| 752 | 3300025960 | Ga0207651_10051526 | Ga0207651_100515263 | 149 |
| 753 | 3300025960 | Ga0207651_10514884 | Ga0207651_105148842 | 149 |
| 754 | 3300025960 | Ga0207651_11837211 | Ga0207651_118372111 | 149 |
| 755 | 3300025961 | Ga0207712_10019100 | Ga0207712_100191004 | 149 |
| 756 | 3300025961 | Ga0207712_10030112 | Ga0207712_100301123 | 149 |
| 757 | 3300025972 | Ga0207668_10168921 | Ga0207668_101689212 | 149 |
| 758 | 3300025972 | Ga0207668_10331912 | Ga0207668_103319122 | 149 |
| 759 | 3300025972 | Ga0207668_10691884 | Ga0207668_106918842 | 149 |
| 760 | 3300025981 | Ga0207640_10433088 | Ga0207640_104330882 | 149 |
| 761 | 3300025981 | Ga0207640_10577726 | Ga0207640_105777262 | 149 |
| 762 | 3300025981 | Ga0207640_11435223 | Ga0207640_114352231 | 149 |
| 763 | 3300025981 | Ga0207640_11442622 | Ga0207640_114426221 | 149 |
| 764 | 3300025986 | Ga0207658_10079721 | Ga0207658_100797215 | 149 |
| 765 | 3300025986 | Ga0207658_10814510 | Ga0207658_108145101 | 149 |
| 766 | 3300025986 | Ga0207658_11557304 | Ga0207658_115573041 | 149 |
| 767 | 3300026023 | Ga0207677_10024382 | Ga0207677_100243822 | 149 |
| 768 | 3300026023 | Ga0207677_10040965 | Ga0207677_100409653 | 149 |
| 769 | 3300026023 | Ga0207677_10694527 | Ga0207677_106945271 | 149 |
| 770 | 3300026035 | Ga0207703_10088219 | Ga0207703_100882193 | 149 |
| 771 | 3300026035 | Ga0207703_10372095 | Ga0207703_103720952 | 149 |
| 772 | 3300026035 | Ga0207703_11219268 | Ga0207703_112192681 | 149 |
| 773 | 3300026035 | Ga0207703_11398401 | Ga0207703_113984011 | 149 |
| 774 | 3300026041 | Ga0207639_10123255 | Ga0207639_101232552 | 149 |
| 775 | 3300026041 | Ga0207639_10160965 | Ga0207639_101609651 | 149 |
| 776 | 3300026041 | Ga0207639_10177963 | Ga0207639_101779632 | 149 |
| 777 | 3300026041 | Ga0207639_10222140 | Ga0207639_102221403 | 149 |
| 778 | 3300026067 | Ga0207678_10010858 | Ga0207678_100108588 | 149 |
| 779 | 3300026067 | Ga0207678_10026500 | Ga0207678_100265005 | 149 |
| 780 | 3300026067 | Ga0207678_10040964 | Ga0207678_100409642 | 149 |
| 781 | 3300026067 | Ga0207678_10044407 | Ga0207678_100444072 | 149 |
| 782 | 3300026067 | Ga0207678_10047043 | Ga0207678_100470432 | 149 |
| 783 | 3300026067 | Ga0207678_10089203 | Ga0207678_100892032 | 149 |
| 784 | 3300026067 | Ga0207678_11227649 | Ga0207678_112276492 | 149 |
| 785 | 3300026075 | Ga0207708_10032916 | Ga0207708_100329163 | 149 |
| 786 | 3300026075 | Ga0207708_10091810 | Ga0207708_100918102 | 149 |
| 787 | 3300026075 | Ga0207708_10206436 | Ga0207708_102064361 | 149 |
| 788 | 3300026075 | Ga0207708_10582403 | Ga0207708_105824032 | 149 |
| 789 | 3300026078 | Ga0207702_10075783 | Ga0207702_100757832 | 149 |
| 790 | 3300026078 | Ga0207702_10997288 | Ga0207702_109972881 | 149 |
| 791 | 3300026078 | Ga0207702_11057578 | Ga0207702_110575781 | 149 |
| 792 | 3300026078 | Ga0207702_11117735 | Ga0207702_111177351 | 149 |
| 793 | 3300026088 | Ga0207641_10169171 | Ga0207641_101691713 | 149 |
| 794 | 3300026088 | Ga0207641_10222696 | Ga0207641_102226962 | 149 |
| 795 | 3300026088 | Ga0207641_10255998 | Ga0207641_102559982 | 149 |
| 796 | 3300026089 | Ga0207648_10232722 | Ga0207648_102327222 | 149 |
| 797 | 3300026089 | Ga0207648_10305220 | Ga0207648_103052202 | 149 |
| 798 | 3300026095 | Ga0207676_10416254 | Ga0207676_104162542 | 149 |
| 799 | 3300026095 | Ga0207676_10522185 | Ga0207676_105221851 | 149 |
| 800 | 3300026095 | Ga0207676_11251383 | Ga0207676_112513832 | 149 |
| 801 | 3300026118 | Ga0207675_100167936 | Ga0207675_1001679363 | 149 |
| 802 | 3300026118 | Ga0207675_100489012 | Ga0207675_1004890122 | 149 |
| 803 | 3300026121 | Ga0207683_10034874 | Ga0207683_100348745 | 149 |
| 804 | 3300026121 | Ga0207683_10047287 | Ga0207683_100472873 | 149 |
| 805 | 3300026121 | Ga0207683_10353514 | Ga0207683_103535142 | 149 |
| 806 | 3300026121 | Ga0207683_10575045 | Ga0207683_105750451 | 149 |
| 807 | 3300026121 | Ga0207683_10673488 | Ga0207683_106734882 | 149 |
| 808 | 3300026142 | Ga0207698_10068650 | Ga0207698_100686502 | 149 |
| 809 | 3300026142 | Ga0207698_10180252 | Ga0207698_101802522 | 149 |
| 810 | 3300026142 | Ga0207698_10620973 | Ga0207698_106209732 | 149 |
| 811 | 3300027296 | Ga0209389_1000057 | Ga0209389_100005739 | 149 |
| 812 | 3300027361 | Ga0209489_100226 | Ga0209489_10022628 | 149 |
| 813 | 3300027363 | Ga0209700_100085 | Ga0209700_10008556 | 149 |
| 814 | 3300027512 | Ga0209179_1011461 | Ga0209179_10114612 | 149 |
| 815 | 3300027866 | Ga0209813_10035974 | Ga0209813_100359742 | 149 |
| 816 | 3300027866 | Ga0209813_10127925 | Ga0209813_101279252 | 149 |
| 817 | 3300028379 | Ga0268266_10001410 | Ga0268266_100014103 | 149 |
| 818 | 3300028379 | Ga0268266_10007006 | Ga0268266_100070068 | 149 |
| 819 | 3300028379 | Ga0268266_10027864 | Ga0268266_100278644 | 149 |
| 820 | 3300028379 | Ga0268266_10029572 | Ga0268266_100295727 | 149 |
| 821 | 3300028379 | Ga0268266_10046226 | Ga0268266_100462262 | 149 |
| 822 | 3300028379 | Ga0268266_10100933 | Ga0268266_101009332 | 149 |
| 823 | 3300028379 | Ga0268266_10331734 | Ga0268266_103317343 | 149 |
| 824 | 3300028380 | Ga0268265_10108662 | Ga0268265_101086622 | 149 |
| 825 | 3300028380 | Ga0268265_10301740 | Ga0268265_103017402 | 149 |
| 826 | 3300028380 | Ga0268265_10358339 | Ga0268265_103583392 | 149 |
| 827 | 3300028381 | Ga0268264_10278652 | Ga0268264_102786522 | 149 |
| 828 | 3300028381 | Ga0268264_10475490 | Ga0268264_104754902 | 149 |
| 829 | 3300028381 | Ga0268264_10821987 | Ga0268264_108219872 | 149 |
| 830 | 3300028786 | Ga0307517_10000248 | Ga0307517_1000024838 | 149 |
| 831 | 3300028786 | Ga0307517_10183062 | Ga0307517_101830622 | 149 |
| 832 | 3300028794 | Ga0307515_10405686 | Ga0307515_104056861 | 149 |
| 833 | 3300028794 | Ga0307515_10616379 | Ga0307515_106163792 | 149 |
| 834 | 3300028794 | Ga0307515_10707915 | Ga0307515_107079151 | 149 |
| 835 | 3300031235 | Ga0265330_10055866 | Ga0265330_100558662 | 149 |
| 836 | 3300031507 | Ga0307509_11006177 | Ga0307509_110061771 | 149 |
| 837 | 3300031548 | Ga0307408_100524460 | Ga0307408_1005244602 | 149 |
| 838 | 3300031616 | Ga0307508_10086597 | Ga0307508_100865972 | 149 |
| 839 | 3300031730 | Ga0307516_10948613 | Ga0307516_109486131 | 149 |
| 840 | 3300031852 | Ga0307410_10021949 | Ga0307410_100219492 | 149 |
| 841 | 3300031901 | Ga0307406_10094255 | Ga0307406_100942553 | 149 |
| 842 | 3300031995 | Ga0307409_100249168 | Ga0307409_1002491681 | 149 |
| 843 | 3300032002 | Ga0307416_100117420 | Ga0307416_1001174202 | 149 |
| 844 | 3300032002 | Ga0307416_102330311 | Ga0307416_1023303111 | 149 |
| 845 | 3300032126 | Ga0307415_100585659 | Ga0307415_1005856592 | 149 |
| 846 | 3300033180 | Ga0307510_10049737 | Ga0307510_100497374 | 149 |
| 847 | 3300033180 | Ga0307510_10505153 | Ga0307510_105051531 | 149 |
| 848 | 3300035113 | Ga0373936_0093954 | Ga0373936_0093954_354_803 | 149 |
| 849 | 3300035170 | Ga0373943_0024083 | Ga0373943_0024083_2141_2590 | 149 |
| 850 | 3300035171 | Ga0373946_0077256 | Ga0373946_0077256_915_1364 | 149 |
| 851 | 3300035692 | Ga0373935_0485782 | Ga0373935_0485782_352_801 | 149 |
| 852 | 3300035695 | Ga0373927_0099946 | Ga0373927_0099946_446_895 | 149 |
| 853 | 3300035695 | Ga0373927_0251915 | Ga0373927_0251915_429_878 | 149 |
| 854 | 3300036401 | Ga0373937_0280743 | Ga0373937_0280743_456_905 | 149 |
| 855 | 3300037068 | Ga0373925_0081538 | Ga0373925_0081538_1781_2230 | 149 |
| 856 | 3300037068 | Ga0373925_0314730 | Ga0373925_0314730_192_641 | 149 |
| 857 | 3300037312 | Ga0395899_0168635 | Ga0395899_0168635_157_606 | 149 |
| 858 | 3300037418 | Ga0395900_0026521 | Ga0395900_0026521_2125_2574 | 149 |
| 859 | 3300037418 | Ga0395900_0150164 | Ga0395900_0150164_1769_2218 | 149 |
| 860 | 3300037466 | Ga0395898_0007695 | Ga0395898_0007695_4869_5318 | 149 |
| 861 | 3300037466 | Ga0395898_0011882 | Ga0395898_0011882_2025_2474 | 149 |
| 862 | 3300037471 | Ga0395905_0043972 | Ga0395905_0043972_3581_4030 | 149 |
| 863 | 3300037471 | Ga0395905_0619250 | Ga0395905_0619250_415_864 | 149 |
| 864 | 3300038443 | Ga0395901_0030065 | Ga0395901_0030065_4223_4672 | 149 |
| 865 | 3300038443 | Ga0395901_0491347 | Ga0395901_0491347_455_904 | 149 |
| 866 | 3300038443 | Ga0395901_0654608 | Ga0395901_0654608_236_685 | 149 |
| 867 | 3300039438 | Ga0436360_0417419 | Ga0436360_0417419_938_1387 | 149 |
| 868 | 3300039447 | Ga0436361_1149151 | Ga0436361_1149151_1404_1853 | 149 |
| 869 | 3300039453 | Ga0436362_1272358 | Ga0436362_1272358_619_1068 | 149 |
| 870 | 3300041441 | Ga0451787_372953 | Ga0451787_372953_68_547 | 149 |
| 871 | 3300041492 | Ga0451835_0089850 | Ga0451835_0089850_133_612 | 149 |
| 872 | 3300041505 | Ga0451849_0907426 | Ga0451849_0907426_60_512 | 149 |
| 873 | 3300042438 | Ga0439459_0112710 | Ga0439459_0112710_80_529 | 149 |
| 874 | 3300042439 | Ga0439464_0092267 | Ga0439464_0092267_454_903 | 149 |
| 875 | 3300044656 | Ga0466969_0010526 | Ga0466969_0010526_717_1166 | 149 |
| 876 | 3300044658 | Ga0466972_0016778 | Ga0466972_0016778_1858_2307 | 149 |
| 877 | 3300044658 | Ga0466972_0124109 | Ga0466972_0124109_218_667 | 149 |
| 878 | 3300044684 | Ga0466966_0005947 | Ga0466966_0005947_4891_5340 | 149 |
| 879 | 3300044684 | Ga0466966_0218088 | Ga0466966_0218088_501_950 | 149 |
| 880 | 3300044693 | Ga0466961_0000863 | Ga0466961_0000863_15482_15931 | 149 |
| 881 | 3300044693 | Ga0466961_0046672 | Ga0466961_0046672_1391_1840 | 149 |
| 882 | 3300044694 | Ga0466963_0071599 | Ga0466963_0071599_538_987 | 149 |
| 883 | 3300044706 | Ga0466964_0157200 | Ga0466964_0157200_500_949 | 149 |
| 884 | 3300044719 | Ga0466971_0022035 | Ga0466971_0022035_637_1086 | 149 |
| 885 | 3300044735 | Ga0466968_0046951 | Ga0466968_0046951_124_573 | 149 |
| 886 | 3300044842 | Ga0466957_0187308 | Ga0466957_0187308_57_506 | 149 |
| 887 | 3300044901 | Ga0466960_0132092 | Ga0466960_0132092_34_483 | 149 |
| 888 | 3300045049 | Ga0466959_0014195 | Ga0466959_0014195_401_850 | 149 |
| 889 | 3300045049 | Ga0466959_0093008 | Ga0466959_0093008_815_1264 | 149 |
| 890 | 3300045836 | Ga0466958_0155703 | Ga0466958_0155703_470_919 | 149 |
| 891 | 3300046455 | Ga0495603_0036047 | Ga0495603_0036047_1449_1898 | 149 |
| 892 | 3300046455 | Ga0495603_0118183 | Ga0495603_0118183_563_1012 | 149 |
| 893 | 3300046455 | Ga0495603_0205571 | Ga0495603_0205571_665_1114 | 149 |
| 894 | 3300046455 | Ga0495603_0240085 | Ga0495603_0240085_134_583 | 149 |
| 895 | 3300046455 | Ga0495603_0249360 | Ga0495603_0249360_224_727 | 149 |
| 896 | 3300046457 | Ga0495590_0335619 | Ga0495590_0335619_75_524 | 149 |
| 897 | 3300046459 | Ga0495629_0095010 | Ga0495629_0095010_1514_1963 | 149 |
| 898 | 3300046459 | Ga0495629_0167408 | Ga0495629_0167408_645_1097 | 149 |
| 899 | 3300046462 | Ga0495651_0008654 | Ga0495651_0008654_2568_3017 | 149 |
| 900 | 3300046463 | Ga0495653_0116906 | Ga0495653_0116906_248_697 | 149 |
| 901 | 3300046472 | Ga0495580_0115240 | Ga0495580_0115240_609_1058 | 149 |
| 902 | 3300046473 | Ga0495582_0234013 | Ga0495582_0234013_579_1028 | 149 |
| 903 | 3300046477 | Ga0495664_0063668 | Ga0495664_0063668_509_958 | 149 |
| 904 | 3300046491 | Ga0495584_0224376 | Ga0495584_0224376_336_785 | 149 |
| 905 | 3300046492 | Ga0495585_0155892 | Ga0495585_0155892_694_1143 | 149 |
| 906 | 3300046492 | Ga0495585_0157607 | Ga0495585_0157607_393_842 | 149 |
| 907 | 3300046492 | Ga0495585_0232576 | Ga0495585_0232576_68_517 | 149 |
| 908 | 3300046499 | Ga0495594_0353547 | Ga0495594_0353547_93_542 | 149 |
| 909 | 3300046500 | Ga0495596_0149803 | Ga0495596_0149803_106_555 | 149 |
| 910 | 3300046511 | Ga0495608_0091559 | Ga0495608_0091559_41_490 | 149 |
| 911 | 3300046513 | Ga0495616_0094138 | Ga0495616_0094138_558_1007 | 149 |
| 912 | 3300046513 | Ga0495616_0281096 | Ga0495616_0281096_21_470 | 149 |
| 913 | 3300046514 | Ga0495618_0605289 | Ga0495618_0605289_160_624 | 149 |
| 914 | 3300046515 | Ga0495620_0028297 | Ga0495620_0028297_1046_1495 | 149 |
| 915 | 3300046515 | Ga0495620_0103221 | Ga0495620_0103221_175_624 | 149 |
| 916 | 3300046516 | Ga0495628_0016659 | Ga0495628_0016659_5051_5500 | 149 |
| 917 | 3300046516 | Ga0495628_0839973 | Ga0495628_0839973_62_511 | 149 |
| 918 | 3300046517 | Ga0495630_0589230 | Ga0495630_0589230_329_778 | 149 |
| 919 | 3300046517 | Ga0495630_0593423 | Ga0495630_0593423_257_706 | 149 |
| 920 | 3300046518 | Ga0495631_0051527 | Ga0495631_0051527_972_1421 | 149 |
| 921 | 3300046518 | Ga0495631_0240123 | Ga0495631_0240123_132_581 | 149 |
| 922 | 3300046519 | Ga0495632_0372245 | Ga0495632_0372245_113_562 | 149 |
| 923 | 3300046522 | Ga0495643_0117762 | Ga0495643_0117762_244_693 | 149 |
| 924 | 3300046522 | Ga0495643_0124719 | Ga0495643_0124719_669_1118 | 149 |
| 925 | 3300046523 | Ga0495644_0161793 | Ga0495644_0161793_388_837 | 149 |
| 926 | 3300046529 | Ga0495652_0584099 | Ga0495652_0584099_256_705 | 149 |
| 927 | 3300046533 | Ga0495640_0433394 | Ga0495640_0433394_251_715 | 149 |
| 928 | 3300046538 | Ga0495609_0450824 | Ga0495609_0450824_26_475 | 149 |
| 929 | 3300046542 | Ga0495597_0147643 | Ga0495597_0147643_92_541 | 149 |
| 930 | 3300046543 | Ga0495645_0087057 | Ga0495645_0087057_756_1205 | 149 |
| 931 | 3300046558 | Ga0495633_0388063 | Ga0495633_0388063_80_529 | 149 |
| 932 | 3300046615 | Ga0495656_0189414 | Ga0495656_0189414_401_850 | 149 |
| 933 | 3300046616 | Ga0495668_0238234 | Ga0495668_0238234_520_969 | 149 |
| 934 | 3300046616 | Ga0495668_0267924 | Ga0495668_0267924_278_727 | 149 |
| 935 | 3300046642 | Ga0495634_0044257 | Ga0495634_0044257_1789_2238 | 149 |
| 936 | 3300046660 | Ga0495625_0118150 | Ga0495625_0118150_561_1010 | 149 |
| 937 | 3300046660 | Ga0495625_0452441 | Ga0495625_0452441_98_547 | 149 |
| 938 | 3300046660 | Ga0495625_0637581 | Ga0495625_0637581_67_516 | 149 |
| 939 | 3300046663 | Ga0495635_0023808 | Ga0495635_0023808_2975_3439 | 149 |
| 940 | 3300046663 | Ga0495635_0062415 | Ga0495635_0062415_528_977 | 149 |
| 941 | 3300046664 | Ga0495659_0016184 | Ga0495659_0016184_961_1410 | 149 |
| 942 | 3300046674 | Ga0495588_0012639 | Ga0495588_0012639_2166_2615 | 149 |
| 943 | 3300046674 | Ga0495588_0351167 | Ga0495588_0351167_293_742 | 149 |
| 944 | 3300046675 | Ga0495657_0005091 | Ga0495657_0005091_5525_5974 | 149 |
| 945 | 3300046678 | Ga0495599_0046216 | Ga0495599_0046216_2165_2614 | 149 |
| 946 | 3300046679 | Ga0495623_0019288 | Ga0495623_0019288_1439_1888 | 149 |
| 947 | 3300046680 | Ga0495646_0027624 | Ga0495646_0027624_2213_2662 | 149 |
| 948 | 3300046684 | Ga0495669_0006514 | Ga0495669_0006514_3908_4357 | 149 |
| 949 | 3300046684 | Ga0495669_0087771 | Ga0495669_0087771_615_1064 | 149 |
| 950 | 3300046691 | Ga0495670_0014413 | Ga0495670_0014413_1967_2416 | 149 |
| 951 | 3300046692 | Ga0495671_0056832 | Ga0495671_0056832_542_991 | 149 |
| 952 | 3300046692 | Ga0495671_0151037 | Ga0495671_0151037_83_532 | 149 |
| 953 | 3300046809 | Ga0495600_0003192 | Ga0495600_0003192_1890_2339 | 149 |
| 954 | 3300046810 | Ga0495660_0158452 | Ga0495660_0158452_88_537 | 149 |
| 955 | 3300047317 | Ga0495604_0001817 | Ga0495604_0001817_12614_13063 | 149 |
| 956 | 3300047317 | Ga0495604_0128306 | Ga0495604_0128306_362_826 | 149 |
| 957 | 3300047317 | Ga0495604_0177007 | Ga0495604_0177007_901_1353 | 149 |
| 958 | 3300047317 | Ga0495604_0527042 | Ga0495604_0527042_154_603 | 149 |
| 959 | 3300047318 | Ga0495636_0466618 | Ga0495636_0466618_26_475 | 149 |
| 960 | 3300047319 | Ga0495674_0083125 | Ga0495674_0083125_885_1334 | 149 |
| 961 | 3300047321 | Ga0495676_0042637 | Ga0495676_0042637_2162_2626 | 149 |
| 962 | 3300047321 | Ga0495676_0051596 | Ga0495676_0051596_1078_1527 | 149 |
| 963 | 3300047321 | Ga0495676_0703042 | Ga0495676_0703042_154_603 | 149 |
| 964 | 3300047322 | Ga0495680_0004783 | Ga0495680_0004783_12141_12590 | 149 |
| 965 | 3300047323 | Ga0495683_0142882 | Ga0495683_0142882_460_909 | 149 |
| 966 | 3300047323 | Ga0495683_0209513 | Ga0495683_0209513_112_600 | 149 |
| 967 | 3300047323 | Ga0495683_0210923 | Ga0495683_0210923_115_564 | 149 |
| 968 | 3300047443 | Ga0495687_019578 | Ga0495687_019578_2282_2731 | 149 |
| 969 | 3300047443 | Ga0495687_024634 | Ga0495687_024634_1694_2143 | 149 |
| 970 | 3300047444 | Ga0495675_0010677 | Ga0495675_0010677_2945_3394 | 149 |
| 971 | 3300047445 | Ga0495677_0033517 | Ga0495677_0033517_758_1207 | 149 |
| 972 | 3300047469 | Ga0495673_0093296 | Ga0495673_0093296_326_775 | 149 |
| 973 | 3300047472 | Ga0495686_0029502 | Ga0495686_0029502_1302_1754 | 149 |
| 974 | 3300047673 | Ga0495593_0101512 | Ga0495593_0101512_960_1424 | 149 |
| 975 | 3300048088 | Ga0495602_0102240 | Ga0495602_0102240_1349_1798 | 149 |
| 976 | 3300048089 | Ga0495614_0380819 | Ga0495614_0380819_125_574 | 149 |
| 977 | 3300048903 | Ga0496100_0070326 | Ga0496100_0070326_1512_1961 | 149 |
| 978 | 3300048903 | Ga0496100_0186968 | Ga0496100_0186968_412_861 | 149 |
| 979 | 3300048904 | Ga0496101_0020038 | Ga0496101_0020038_2548_2997 | 149 |
| 980 | 3300048904 | Ga0496101_0151979 | Ga0496101_0151979_528_977 | 149 |
| 981 | 3300048904 | Ga0496101_0362286 | Ga0496101_0362286_142_606 | 149 |
| 982 | 3300048904 | Ga0496101_0815985 | Ga0496101_0815985_252_701 | 149 |
| 983 | 3300048904 | Ga0496101_0990750 | Ga0496101_0990750_197_646 | 149 |
| 984 | 3300048904 | Ga0496101_1037073 | Ga0496101_1037073_100_549 | 149 |
| 985 | 3300048905 | Ga0496102_0003789 | Ga0496102_0003789_3107_3556 | 149 |
| 986 | 3300048905 | Ga0496102_0027530 | Ga0496102_0027530_2674_3123 | 149 |
| 987 | 3300048905 | Ga0496102_0256476 | Ga0496102_0256476_712_1161 | 149 |
| 988 | 3300048905 | Ga0496102_0396985 | Ga0496102_0396985_67_516 | 149 |
| 989 | 3300048905 | Ga0496102_0802533 | Ga0496102_0802533_399_848 | 149 |
| 990 | 3300048905 | Ga0496102_0881232 | Ga0496102_0881232_221_670 | 149 |
| 991 | 3300048906 | Ga0496103_0192742 | Ga0496103_0192742_259_708 | 149 |
| 992 | 3300048906 | Ga0496103_0313741 | Ga0496103_0313741_534_983 | 149 |
| 993 | 3300048906 | Ga0496103_0565859 | Ga0496103_0565859_87_536 | 149 |
| 994 | 3300048907 | Ga0496104_0002743 | Ga0496104_0002743_9908_10372 | 149 |
| 995 | 3300048907 | Ga0496104_0114217 | Ga0496104_0114217_403_852 | 149 |
| 996 | 3300048907 | Ga0496104_0182849 | Ga0496104_0182849_264_713 | 149 |
| 997 | 3300048907 | Ga0496104_0183435 | Ga0496104_0183435_1128_1577 | 149 |
| 998 | 3300048908 | Ga0496105_0056554 | Ga0496105_0056554_2497_2946 | 149 |
| 999 | 3300048908 | Ga0496105_0059798 | Ga0496105_0059798_1730_2179 | 149 |
| 1000 | 3300048908 | Ga0496105_0077738 | Ga0496105_0077738_1741_2205 | 149 |
| 1001 | 3300048908 | Ga0496105_0671521 | Ga0496105_0671521_201_650 | 149 |
| 1002 | 3300048909 | Ga0496106_0260204 | Ga0496106_0260204_576_1025 | 149 |
| 1003 | 3300048909 | Ga0496106_0309568 | Ga0496106_0309568_226_675 | 149 |
| 1004 | 3300048909 | Ga0496106_0555808 | Ga0496106_0555808_242_691 | 149 |
| 1005 | 3300048910 | Ga0496107_0008411 | Ga0496107_0008411_5616_6065 | 149 |
| 1006 | 3300048910 | Ga0496107_0229177 | Ga0496107_0229177_722_1171 | 149 |
| 1007 | 3300048911 | Ga0496108_0025878 | Ga0496108_0025878_1680_2129 | 149 |
| 1008 | 3300048911 | Ga0496108_0057500 | Ga0496108_0057500_1792_2241 | 149 |
| 1009 | 3300048911 | Ga0496108_0117977 | Ga0496108_0117977_127_576 | 149 |
| 1010 | 3300048912 | Ga0496109_0055881 | Ga0496109_0055881_410_859 | 149 |
| 1011 | 3300048912 | Ga0496109_0162114 | Ga0496109_0162114_352_801 | 149 |
| 1012 | 3300048912 | Ga0496109_0193483 | Ga0496109_0193483_693_1142 | 149 |
| 1013 | 3300048913 | Ga0496110_0023688 | Ga0496110_0023688_74_523 | 149 |
| 1014 | 3300048913 | Ga0496110_0040385 | Ga0496110_0040385_876_1325 | 149 |
| 1015 | 3300048913 | Ga0496110_0269168 | Ga0496110_0269168_1059_1508 | 149 |
| 1016 | 3300048913 | Ga0496110_0353908 | Ga0496110_0353908_877_1326 | 149 |
| 1017 | 3300048913 | Ga0496110_0456548 | Ga0496110_0456548_93_542 | 149 |
| 1018 | 3300048913 | Ga0496110_0545844 | Ga0496110_0545844_216_665 | 149 |
| 1019 | 3300048914 | Ga0496111_0046070 | Ga0496111_0046070_1675_2124 | 149 |
| 1020 | 3300048915 | Ga0496112_0043463 | Ga0496112_0043463_1079_1528 | 149 |
| 1021 | 3300048915 | Ga0496112_0205362 | Ga0496112_0205362_111_560 | 149 |
| 1022 | 3300048915 | Ga0496112_0419759 | Ga0496112_0419759_697_1146 | 149 |
| 1023 | 3300048916 | Ga0496113_0086238 | Ga0496113_0086238_126_575 | 149 |
| 1024 | 3300048916 | Ga0496113_0146665 | Ga0496113_0146665_171_620 | 149 |
| 1025 | 3300048916 | Ga0496113_0203112 | Ga0496113_0203112_37_486 | 149 |
| 1026 | 3300048916 | Ga0496113_1033424 | Ga0496113_1033424_157_606 | 149 |
| 1027 | 3300048916 | Ga0496113_1393184 | Ga0496113_1393184_15_479 | 149 |
| 1028 | 3300048917 | Ga0496114_0058730 | Ga0496114_0058730_857_1306 | 149 |
| 1029 | 3300048917 | Ga0496114_0239889 | Ga0496114_0239889_415_864 | 149 |
| 1030 | 3300048917 | Ga0496114_0510424 | Ga0496114_0510424_209_658 | 149 |
| 1031 | 3300048918 | Ga0496115_0001860 | Ga0496115_0001860_8891_9340 | 149 |
| 1032 | 3300048918 | Ga0496115_0101186 | Ga0496115_0101186_1407_1856 | 149 |
| 1033 | 3300048918 | Ga0496115_0171677 | Ga0496115_0171677_127_591 | 149 |
| 1034 | 3300048918 | Ga0496115_0274102 | Ga0496115_0274102_379_828 | 149 |
| 1035 | 3300048919 | Ga0496116_0183721 | Ga0496116_0183721_582_1070 | 149 |
| 1036 | 3300048920 | Ga0496117_0174889 | Ga0496117_0174889_232_681 | 149 |
| 1037 | 3300048920 | Ga0496117_0258020 | Ga0496117_0258020_201_650 | 149 |
| 1038 | 3300048920 | Ga0496117_0386165 | Ga0496117_0386165_133_582 | 149 |
| 1039 | 3300048921 | Ga0496118_0060898 | Ga0496118_0060898_149_598 | 149 |
| 1040 | 3300048921 | Ga0496118_0074666 | Ga0496118_0074666_542_991 | 149 |
| 1041 | 3300048921 | Ga0496118_0160053 | Ga0496118_0160053_412_861 | 149 |
| 1042 | 3300048921 | Ga0496118_0205111 | Ga0496118_0205111_58_522 | 149 |
| 1043 | 3300048922 | Ga0496119_0006768 | Ga0496119_0006768_10033_10497 | 149 |
| 1044 | 3300048922 | Ga0496119_0017432 | Ga0496119_0017432_381_839 | 149 |
| 1045 | 3300048922 | Ga0496119_0032207 | Ga0496119_0032207_1122_1571 | 149 |
| 1046 | 3300048922 | Ga0496119_0142601 | Ga0496119_0142601_798_1247 | 149 |
| 1047 | 3300048922 | Ga0496119_0320368 | Ga0496119_0320368_153_602 | 149 |
| 1048 | 3300048923 | Ga0496120_0010148 | Ga0496120_0010148_6022_6486 | 149 |
| 1049 | 3300048923 | Ga0496120_0271990 | Ga0496120_0271990_175_624 | 149 |
| 1050 | 3300048923 | Ga0496120_0318513 | Ga0496120_0318513_59_508 | 149 |
| 1051 | 3300048924 | Ga0496121_0002757 | Ga0496121_0002757_9200_9658 | 149 |
| 1052 | 3300048924 | Ga0496121_0058967 | Ga0496121_0058967_1662_2174 | 149 |
| 1053 | 3300048924 | Ga0496121_0059811 | Ga0496121_0059811_650_1099 | 149 |
| 1054 | 3300048924 | Ga0496121_0084494 | Ga0496121_0084494_1879_2328 | 149 |
| 1055 | 3300048924 | Ga0496121_0095355 | Ga0496121_0095355_1484_1933 | 149 |
| 1056 | 3300048924 | Ga0496121_0147869 | Ga0496121_0147869_338_787 | 149 |
| 1057 | 3300048924 | Ga0496121_0157463 | Ga0496121_0157463_60_524 | 149 |
| 1058 | 3300048924 | Ga0496121_0183767 | Ga0496121_0183767_352_801 | 149 |
| 1059 | 3300048925 | Ga0496122_0129467 | Ga0496122_0129467_170_622 | 149 |
| 1060 | 3300048925 | Ga0496122_0212991 | Ga0496122_0212991_532_981 | 149 |
| 1061 | 3300048927 | Ga0496124_0094099 | Ga0496124_0094099_339_803 | 149 |
| 1062 | 3300048927 | Ga0496124_0193650 | Ga0496124_0193650_106_555 | 149 |
| 1063 | 3300048928 | Ga0496125_0060549 | Ga0496125_0060549_1009_1458 | 149 |
| 1064 | 3300048928 | Ga0496125_0156377 | Ga0496125_0156377_593_1042 | 149 |
| 1065 | 3300048928 | Ga0496125_0184974 | Ga0496125_0184974_28_477 | 149 |
| 1066 | 3300048929 | Ga0496126_0003081 | Ga0496126_0003081_20080_20529 | 149 |
| 1067 | 3300048929 | Ga0496126_0177789 | Ga0496126_0177789_788_1237 | 149 |
| 1068 | 3300048929 | Ga0496126_0191942 | Ga0496126_0191942_512_964 | 149 |
| 1069 | 3300048929 | Ga0496126_0423102 | Ga0496126_0423102_88_537 | 149 |
| 1070 | 3300048929 | Ga0496126_0576429 | Ga0496126_0576429_265_729 | 149 |
| 1071 | 3300049574 | Ga0501038_0396234 | Ga0501038_0396234_16_468 | 149 |
| 1072 | 3300049577 | Ga0501041_0922063 | Ga0501041_0922063_11_463 | 149 |
| 1073 | 3300049578 | Ga0501042_0828290 | Ga0501042_0828290_127_579 | 149 |
| 1074 | 3300049589 | Ga0501073_0402537 | Ga0501073_0402537_86_538 | 149 |
| 1075 | 3300049592 | Ga0501076_0062840 | Ga0501076_0062840_1982_2431 | 149 |
| 1076 | 3300049822 | Ga0501035_1248499 | Ga0501035_1248499_46_498 | 149 |
| 1077 | 3300049824 | Ga0501045_0385189 | Ga0501045_0385189_33_485 | 149 |
| 1078 | 3300050489 | nmdc:mga03683_137063_c1 | nmdc:mga03683_137063_c1_74_535 | 149 |
| 1079 | 3300050489 | nmdc:mga03683_173532_c1 | nmdc:mga03683_173532_c1_248_697 | 149 |
| 1080 | 3300050489 | nmdc:mga03683_303422_c1 | nmdc:mga03683_303422_c1_236_685 | 149 |
| 1081 | 3300050490 | nmdc:mga03n38_1290_c1 | nmdc:mga03n38_1290_c1_2591_3040 | 149 |
| 1082 | 3300050490 | nmdc:mga03n38_245415_c1 | nmdc:mga03n38_245415_c1_89_538 | 149 |
| 1083 | 3300050490 | nmdc:mga03n38_886703_c1 | nmdc:mga03n38_886703_c1_32_481 | 149 |
| 1084 | 3300050491 | nmdc:mga00v17_165893_c1 | nmdc:mga00v17_165893_c1_32_481 | 149 |
| 1085 | 3300050491 | nmdc:mga00v17_6086_c1 | nmdc:mga00v17_6086_c1_1047_1496 | 149 |
| 1086 | 3300050492 | nmdc:mga0yw44_23704_c1 | nmdc:mga0yw44_23704_c1_1301_1780 | 149 |
| 1087 | 3300050493 | nmdc:mga0k408_110415_c1 | nmdc:mga0k408_110415_c1_234_683 | 149 |
| 1088 | 3300050493 | nmdc:mga0k408_155257_c1 | nmdc:mga0k408_155257_c1_289_738 | 149 |
| 1089 | 3300050493 | nmdc:mga0k408_71243_c1 | nmdc:mga0k408_71243_c1_1394_1843 | 149 |
| 1090 | 3300050494 | nmdc:mga06z11_1024452_c1 | nmdc:mga06z11_1024452_c1_44_493 | 149 |
| 1091 | 3300050494 | nmdc:mga06z11_23163_c1 | nmdc:mga06z11_23163_c1_1583_2032 | 149 |
| 1092 | 3300050494 | nmdc:mga06z11_2462_c1 | nmdc:mga06z11_2462_c1_1004_1453 | 149 |
| 1093 | 3300050494 | nmdc:mga06z11_374356_c1 | nmdc:mga06z11_374356_c1_217_666 | 149 |
| 1094 | 3300050494 | nmdc:mga06z11_64701_c1 | nmdc:mga06z11_64701_c1_550_999 | 149 |
| 1095 | 3300050494 | nmdc:mga06z11_94254_c1 | nmdc:mga06z11_94254_c1_578_1027 | 149 |
| 1096 | 3300050495 | nmdc:mga04h51_119879_c1 | nmdc:mga04h51_119879_c1_291_740 | 149 |
| 1097 | 3300050495 | nmdc:mga04h51_36991_c1 | nmdc:mga04h51_36991_c1_760_1209 | 149 |
| 1098 | 3300050496 | nmdc:mga07m45_11812_c1 | nmdc:mga07m45_11812_c1_938_1387 | 149 |
| 1099 | 3300050496 | nmdc:mga07m45_384521_c1 | nmdc:mga07m45_384521_c1_189_638 | 149 |
| 1100 | 3300050496 | nmdc:mga07m45_92163_c1 | nmdc:mga07m45_92163_c1_1045_1494 | 149 |
| 1101 | 3300050511 | nmdc:mga08y16_675762_c1 | nmdc:mga08y16_675762_c1_532_981 | 149 |
| 1102 | 3300050516 | nmdc:mga0sz30_28757_c1 | nmdc:mga0sz30_28757_c1_1569_2018 | 149 |
| 1103 | 3300050516 | nmdc:mga0sz30_408240_c1 | nmdc:mga0sz30_408240_c1_17_466 | 149 |
| 1104 | 3300050516 | nmdc:mga0sz30_64875_c1 | nmdc:mga0sz30_64875_c1_970_1419 | 149 |
| 1105 | 3300053077 | Ga0495601_0404170 | Ga0495601_0404170_94_543 | 149 |
| 1106 | 3300053080 | Ga0500635_0150850 | Ga0500635_0150850_119_568 | 149 |
| 1107 | 3300053085 | Ga0495619_0113450 | Ga0495619_0113450_1157_1606 | 149 |
| 1108 | 3300053085 | Ga0495619_1105612 | Ga0495619_1105612_53_502 | 149 |
| 1109 | 3300053091 | Ga0500647_0016425 | Ga0500647_0016425_1991_2440 | 149 |
| 1110 | 3300053093 | Ga0500651_0664090 | Ga0500651_0664090_49_498 | 149 |
| 1111 | 3300053094 | Ga0500566_0001729 | Ga0500566_0001729_7078_7527 | 149 |
| 1112 | 3300053095 | Ga0500640_110454 | Ga0500640_110454_308_757 | 149 |
| 1113 | 3300053097 | Ga0500648_242341 | Ga0500648_242341_325_774 | 149 |
| 1114 | 3300053102 | Ga0500554_049782 | Ga0500554_049782_310_759 | 149 |
| 1115 | 3300053102 | Ga0500554_198972 | Ga0500554_198972_191_640 | 149 |
| 1116 | 3300053103 | Ga0500555_005133 | Ga0500555_005133_1995_2480 | 149 |
| 1117 | 3300053109 | Ga0500569_013364 | Ga0500569_013364_138_587 | 149 |
| 1118 | 3300053111 | Ga0500572_012619 | Ga0500572_012619_951_1400 | 149 |
| 1119 | 3300053118 | Ga0500594_0108397 | Ga0500594_0108397_186_671 | 149 |
| 1120 | 3300053119 | Ga0500595_000393 | Ga0500595_000393_25183_25641 | 149 |
| 1121 | 3300053119 | Ga0500595_142504 | Ga0500595_142504_53_502 | 149 |
| 1122 | 3300053119 | Ga0500595_156500 | Ga0500595_156500_42_491 | 149 |
| 1123 | 3300053122 | Ga0500608_045010 | Ga0500608_045010_1061_1510 | 149 |
| 1124 | 3300053122 | Ga0500608_105888 | Ga0500608_105888_646_1095 | 149 |
| 1125 | 3300053123 | Ga0500614_294736 | Ga0500614_294736_20_484 | 149 |
| 1126 | 3300053133 | Ga0500655_125919 | Ga0500655_125919_62_511 | 149 |
| 1127 | 3300053134 | Ga0500658_0147378 | Ga0500658_0147378_168_617 | 149 |
| 1128 | 3300053139 | Ga0500568_0046269 | Ga0500568_0046269_486_944 | 149 |
| 1129 | 3300053142 | Ga0500577_0000303 | Ga0500577_0000303_7706_8155 | 149 |
| 1130 | 3300053142 | Ga0500577_0117604 | Ga0500577_0117604_474_959 | 149 |
| 1131 | 3300053150 | Ga0500603_001096 | Ga0500603_001096_734_1183 | 149 |
| 1132 | 3300053161 | Ga0500634_0221373 | Ga0500634_0221373_144_629 | 149 |
| 1133 | 3300053162 | Ga0500638_025857 | Ga0500638_025857_133_582 | 149 |
| 1134 | 3300053163 | Ga0500639_111425 | Ga0500639_111425_71_535 | 149 |
| 1135 | 3300053163 | Ga0500639_178358 | Ga0500639_178358_266_715 | 149 |
| 1136 | 3300053177 | Ga0500636_0004999 | Ga0500636_0004999_4457_4906 | 149 |
| 1137 | 3300053177 | Ga0500636_0045048 | Ga0500636_0045048_1645_2127 | 149 |
| 1138 | 3300053177 | Ga0500636_0385937 | Ga0500636_0385937_136_585 | 149 |
| 1139 | 3300053177 | Ga0500636_0489122 | Ga0500636_0489122_77_526 | 149 |
| 1140 | 3300053178 | Ga0500637_0222349 | Ga0500637_0222349_564_1013 | 149 |
| 1141 | 3300053729 | Ga0500625_007215 | Ga0500625_007215_3905_4354 | 149 |
| 1142 | 3300053730 | Ga0500645_073882 | Ga0500645_073882_444_893 | 149 |
| 1143 | 3300053737 | Ga0500601_001060 | Ga0500601_001060_2581_3030 | 149 |
| 1144 | 3300053737 | Ga0500601_014325 | Ga0500601_014325_12_494 | 149 |
| 1145 | 3300055283 | Ga0500661_006131 | Ga0500661_006131_545_994 | 149 |
| 1146 | 3300061719 | Ga0466962_0027977 | Ga0466962_0027977_1903_2352 | 149 |
| 1147 | 3300061734 | Ga0530510_0606541 | Ga0530510_0606541_178_630 | 149 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2pd2-assembly1.cif.gz_A | crystal structure of (st0148) conserved hypothetical from sulfolobus tokodaii strain7 | 0.9289 | 35 | 149 |
| 2pd2-assembly1.cif.gz_A | crystal structure of (st0148) conserved hypothetical from sulfolobus tokodaii strain7 | 0.9209 | 35 | 149 |
| 1l1s-assembly1.cif.gz_A | structure of protein of unknown function mth1491 from methanobacterium thermoautotrophicum | 0.8797 | 34 | 149 |
| 1l1s-assembly1.cif.gz_A | structure of protein of unknown function mth1491 from methanobacterium thermoautotrophicum | 0.8724 | 34 | 149 |
| 3pnx-assembly2.cif.gz_E | crystal structure of a putative sulfurtransferase dsre (swol_2425) from syntrophomonas wolfei str. goettingen at 1.92 a resolution | 0.7837 | 34 | 149 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2pd2B00 | Alpha Beta;3-Layer(aba) Sandwich;Hypothetical Protein Ychn; Chain: A,;DsrEFH-like | 0.9231 | 35 | 149 | 3.40.1260.10 |
| 2pd2B00 | Alpha Beta;3-Layer(aba) Sandwich;Hypothetical Protein Ychn; Chain: A,;DsrEFH-like | 0.9151 | 35 | 149 | 3.40.1260.10 |
| af_Q86HR3_48_158_3.40.1260.10 | Alpha Beta;3-Layer(aba) Sandwich;Hypothetical Protein Ychn; Chain: A,;DsrEFH-like | 0.882 | 36 | 147 | 3.40.1260.10 |
| af_Q86HR3_48_158_3.40.1260.10 | Alpha Beta;3-Layer(aba) Sandwich;Hypothetical Protein Ychn; Chain: A,;DsrEFH-like | 0.8746 | 36 | 147 | 3.40.1260.10 |
| 1l1sA00 | Alpha Beta;3-Layer(aba) Sandwich;Hypothetical Protein Ychn; Chain: A,;DsrEFH-like | 0.8611 | 34 | 149 | 3.40.1260.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A401U1G0-F1-model_v4 | Uncharacterized protein | 0.9965 | 71 | 149 |
|
| AF-A0A528TPR5-F1-model_v4 | Uncharacterized protein | 0.9925 | 35 | 149 |
|
| AF-A0A526YEJ7-F1-model_v4 | Uncharacterized protein | 0.992 | 69 | 149 |
|
| AF-A0A401U1G0-F1-model_v4 | Uncharacterized protein | 0.9841 | 71 | 149 |
|
| AF-A0A528TPR5-F1-model_v4 | Uncharacterized protein | 0.9838 | 35 | 149 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar