F490804

General Info

Members Datasets Scaffolds Average Seq Length
1146 456 1126 472

Family's Representative Sequence

Representative Sequence 3300049571|Ga0501034_0030744|Ga0501034_0030744_1378_2946
Length 522
Sequence MAVIVDPLRLNGHYGRHDWGEDIVHQGTLSAALAGCKPALDGPWLQRQFPHELETAMNLAAKPSRDRKAAIDALTAAFGNRVVTSQAVREQHGNTVTWLPNEPPDAVVFPQSTQDVQQIVGMCAEHNMPIVPFGTGSSLEGHVNAPFGGVSIDFRDMNKVLAVHAEDLDCVIEPGLTRKALNEYLRASGVFFPIDPGADASLGGMTATRASGTNAVRYGTMKDNVLALKVVMPNGELMTTARRAKKTSAGYDLTRLMVGSEGTLGVITELTLKLHGIPEAISGGTCPFPSVEACCNTAIQTIQTGIPIARIELLDALQVRAVNLHSKLGLPETPMLFLEFHGTEASVAEQSQRFGEIAAEFGGGPFQWTTKQEERTKLWDARHHAAFSNFALRPGSHMIATDVCVPISRLAECVTQTQADIAESKLVAPIVGHIGDGNFHLTLLIDMNDADEIARAKALNERLVQRALSMDGTCTGEHGVGQGKMKYLKAEHGAPALAAMAAIKRALDPQNIMNPGKMIPLD

Samples

Sample ID Description Type Environment
1 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
2 2508501050 Microvirga lupini Lut6 Isolate Nodule
3 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
4 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
5 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
6 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
7 2643221734 Bosea sp. Root670 Isolate Unclassified
8 2773857925 Microvirga vignae BR3299 Isolate Unclassified
9 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
10 2818991467 Bosea vestrisii 3192 Isolate Unclassified
11 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
12 2841760612 Bosea sp. Tri-49 Isolate Nodule
13 2844104063 Bosea sp. Tri-39 Isolate Nodule
14 2851182111 Bosea sp. Tri-44 Isolate Nodule
15 2851246043 Bosea sp. Tri-54 Isolate Nodule
16 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
17 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
18 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
19 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
20 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
21 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
22 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
23 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
24 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
25 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
26 3300001430 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 Metagenome Rhizosphere
27 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
28 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
29 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
30 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
31 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
32 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
33 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
34 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
35 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
36 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
37 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
38 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
39 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
40 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
41 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
42 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
43 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
44 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
45 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
46 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
47 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
48 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
49 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
50 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
51 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
52 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
53 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
54 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
55 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
56 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
57 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
58 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
59 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
60 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
61 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
62 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
63 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
64 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
65 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
66 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
67 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
68 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
69 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
70 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
71 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
72 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
73 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
74 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
75 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
76 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
77 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
78 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
79 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
80 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
81 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
82 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
83 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
84 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
85 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
86 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
87 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
88 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
89 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
90 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
91 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
92 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
93 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
94 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
95 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
96 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
97 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
98 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
99 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
100 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
101 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
102 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
103 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
104 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
105 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
106 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
107 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
108 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
109 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
110 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
111 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
112 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
113 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
114 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
115 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
116 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
117 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
118 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
119 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
120 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
121 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
122 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
123 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
124 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
125 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
126 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
127 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
128 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
129 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
130 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
131 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
132 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
133 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
134 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
135 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
136 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
137 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
138 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
139 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
140 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
141 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
142 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
143 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
144 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
145 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
146 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
147 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
148 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
149 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
150 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
151 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
152 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
153 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
154 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
155 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
156 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
157 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
158 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
159 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
160 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
161 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
162 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
163 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
164 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
165 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
166 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
167 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
168 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
169 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
170 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
171 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
172 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
173 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
174 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
176 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
177 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
178 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
179 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
180 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
181 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
182 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
183 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
245 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
246 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
247 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
248 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
249 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
251 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
252 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
253 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
254 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
255 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
256 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
257 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
258 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
259 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
260 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
261 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
262 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
263 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
264 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
265 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
266 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
267 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
268 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
269 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
270 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
271 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
272 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
273 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
274 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
275 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
276 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
277 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
278 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
279 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
280 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
281 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
282 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
283 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
284 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
285 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
286 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
287 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
288 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
289 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
290 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
291 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
292 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
293 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
294 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
295 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
296 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
297 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
298 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
299 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
300 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
301 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
302 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
303 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
304 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
305 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
306 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
307 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
308 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
309 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
310 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
311 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
312 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
313 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
314 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
315 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
316 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
317 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
318 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
319 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
320 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
321 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
322 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
323 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
324 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
325 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
326 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
327 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
328 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
329 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
330 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
331 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
332 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
333 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
334 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
335 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
336 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
337 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
338 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
339 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
340 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
341 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
342 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
343 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
344 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
345 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
346 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
347 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
348 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
349 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
350 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
351 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
352 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
353 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
354 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
355 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
356 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
357 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
358 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
359 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
360 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
361 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
362 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
363 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
364 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
365 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
366 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
367 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
368 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
369 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
370 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
371 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
372 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
373 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
374 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
375 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
376 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
377 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
378 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
379 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
380 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
381 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
382 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
383 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
384 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
385 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
386 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
387 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
388 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
389 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
390 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
391 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
392 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
393 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
394 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
395 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
396 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
397 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
398 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
399 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
400 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
401 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
402 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
403 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
404 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
405 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
406 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
407 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
408 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
409 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
410 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
411 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
412 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
413 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
414 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
415 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
416 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
417 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
418 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
419 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
420 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
421 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
422 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
423 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
424 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
425 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
426 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
427 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
428 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
429 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
430 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
431 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
432 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
433 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
434 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
435 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
436 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
437 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
438 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
439 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
440 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
441 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
442 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
443 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
444 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
445 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
446 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
447 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
448 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
449 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
450 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
451 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
452 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
453 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
454 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
455 641522639 Methylobacterium sp. 4-46 Isolate Nodule
456 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.25
Metatranscriptomes 0
Isolates 1.75

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.4
Nodule 1.05
Rhizoplane 8.46
Rhizosphere 85.51
Stem 0
Stem Tuber 0
Unclassified 1.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 2214884074 2209111006 Bacteria 7920
2 ARcpr5oldR_c000047 3300000041 Bacteria 22345
3 ARSoilYngRDRAFT_c00157 3300000042 Bacteria 11648
4 ARcpr5yngRDRAFT_c000017 3300000043 Bacteria 27988
5 ARSoilOldRDRAFT_c000006 3300000044 Bacteria 57169
6 ARCol0oldRDRAFT_c00394 3300000045 Unclassified 4195
7 ARCol0yngRDRAFT_1000410 3300000652 Bacteria 5697
8 JGI24032J14994_100449 3300001430 Unclassified 2142
9 JGI24746J21847_1001205 3300001977 Unclassified 4101
10 JGI24739J22299_10012522 3300001989 Unclassified 3112
11 JGI24743J22301_10001864 3300001991 Bacteria 3053
12 JGI24743J22301_10001874 3300001991 Unclassified 3045
13 JGI24750J21931_1000171 3300002070 Bacteria 10831
14 JGI24745J21846_1000238 3300002073 Unclassified 4527
15 JGI24738J21930_10001962 3300002075 Bacteria 5541
16 JGI24749J21850_1000164 3300002076 Bacteria 10551
17 JGI24744J21845_10007217 3300002077 Unclassified 2296
18 JGI24742J22300_10001863 3300002244 Unclassified 3354
19 JGI25153J46596_10003929 3300003215 Bacteria 8151
20 Ga0055526_1003135 3300003771 Bacteria 10710
21 Ga0055524_1000020 3300003775 Bacteria 227971
22 Ga0065165_1000141 3300005262 Bacteria 125536
23 Ga0065716_1001609 3300005277 Bacteria 5289
24 Ga0065712_10008755 3300005290 Bacteria 2185
25 Ga0065712_10073346 3300005290 Bacteria 4422
26 Ga0065712_10095088 3300005290 Bacteria 2231
27 Ga0065707_10111240 3300005295 Bacteria 2401
28 Ga0070658_10001206 3300005327 Bacteria 22151
29 Ga0070658_10131161 3300005327 Bacteria 2089
30 Ga0070676_10008970 3300005328 Bacteria 5409
31 Ga0070676_10056584 3300005328 Bacteria 2318
32 Ga0070683_100007236 3300005329 Bacteria 9366
33 Ga0070683_100054816 3300005329 Bacteria 3697
34 Ga0070683_100139939 3300005329 Bacteria 2293
35 Ga0070690_100002695 3300005330 Bacteria 9575
36 Ga0070690_100007439 3300005330 Bacteria 6275
37 Ga0070670_100023880 3300005331 Bacteria 5260
38 Ga0070677_10000354 3300005333 Bacteria 16037
39 Ga0070677_10006029 3300005333 Bacteria 4017
40 Ga0068869_100000203 3300005334 Bacteria 31014
41 Ga0068869_100016314 3300005334 Bacteria 5004
42 Ga0070666_10003118 3300005335 Bacteria 10068
43 Ga0070666_10045931 3300005335 Bacteria 2928
44 Ga0070680_100002314 3300005336 Bacteria 14060
45 Ga0070680_100008076 3300005336 Bacteria 8038
46 Ga0070680_100018551 3300005336 Bacteria 5499
47 Ga0070680_100089192 3300005336 Bacteria 2552
48 Ga0070682_100000935 3300005337 Bacteria 17035
49 Ga0070682_100048701 3300005337 Bacteria 2639
50 Ga0068868_100002681 3300005338 Bacteria 12350
51 Ga0068868_100085147 3300005338 Bacteria 2539
52 Ga0068868_100086567 3300005338 Bacteria 2519
53 Ga0070660_100002042 3300005339 Bacteria 13931
54 Ga0070660_100039578 3300005339 Bacteria 3584
55 Ga0070689_100010750 3300005340 Bacteria 6536
56 Ga0070689_100012497 3300005340 Bacteria 6118
57 Ga0070689_100104060 3300005340 Bacteria 2250
58 Ga0070691_10000067 3300005341 Bacteria 28711
59 Ga0070691_10020556 3300005341 Bacteria 3050
60 Ga0070687_100077210 3300005343 Bacteria 1806
61 Ga0070661_100001273 3300005344 Bacteria 17718
62 Ga0070661_100066329 3300005344 Bacteria 2652
63 Ga0070692_10000279 3300005345 Bacteria 14346
64 Ga0070692_10011554 3300005345 Bacteria 4057
65 Ga0070668_100001472 3300005347 Bacteria 17006
66 Ga0070668_100043745 3300005347 Bacteria 3434
67 Ga0070668_100076963 3300005347 Bacteria 2607
68 Ga0070668_100094048 3300005347 Bacteria 2366
69 Ga0070669_100001453 3300005353 Bacteria 17173
70 Ga0070669_100177205 3300005353 Bacteria 1666
71 Ga0070675_100000701 3300005354 Bacteria 23221
72 Ga0070671_100001883 3300005355 Bacteria 16034
73 Ga0070671_100047421 3300005355 Bacteria 3573
74 Ga0070674_100008500 3300005356 Bacteria 6115
75 Ga0070674_100010760 3300005356 Bacteria 5547
76 Ga0070673_100000855 3300005364 Bacteria 17061
77 Ga0070673_100040814 3300005364 Bacteria 3563
78 Ga0070688_100002458 3300005365 Bacteria 9366
79 Ga0070688_100005328 3300005365 Bacteria 6760
80 Ga0070688_100009226 3300005365 Bacteria 5384
81 Ga0070688_100017152 3300005365 Bacteria 4154
82 Ga0070659_100002844 3300005366 Bacteria 12316
83 Ga0070659_100042026 3300005366 Bacteria 3574
84 Ga0070667_100002230 3300005367 Bacteria 17055
85 Ga0070667_100045305 3300005367 Bacteria 3697
86 Ga0070667_100193441 3300005367 Bacteria 1803
87 Ga0070709_10000219 3300005434 Bacteria 37061
88 Ga0070709_10010596 3300005434 Bacteria 5110
89 Ga0070709_10041879 3300005434 Bacteria 2824
90 Ga0070714_100011112 3300005435 Bacteria 7135
91 Ga0070714_100024143 3300005435 Bacteria 5001
92 Ga0070714_100111314 3300005435 Bacteria 2424
93 Ga0070713_100000224 3300005436 Bacteria 37679
94 Ga0070713_100054191 3300005436 Bacteria 3326
95 Ga0070713_100074935 3300005436 Bacteria 2869
96 Ga0070710_10000956 3300005437 Bacteria 13707
97 Ga0070701_10000732 3300005438 Bacteria 11634
98 Ga0070711_100075313 3300005439 Bacteria 2389
99 Ga0070711_100193408 3300005439 Bacteria 1565
100 Ga0070705_100002431 3300005440 Bacteria 9366
101 Ga0070705_100065255 3300005440 Bacteria 2179
102 Ga0070700_100011866 3300005441 Bacteria 4840
103 Ga0070700_100026381 3300005441 Bacteria 3430
104 Ga0070708_100006477 3300005445 Bacteria 9315
105 Ga0070663_100003237 3300005455 Bacteria 9366
106 Ga0070663_100079771 3300005455 Bacteria 2403
107 Ga0070663_100125422 3300005455 Bacteria 1944
108 Ga0070678_100001091 3300005456 Bacteria 14198
109 Ga0070678_100020981 3300005456 Bacteria 4297
110 Ga0070678_100081860 3300005456 Bacteria 2449
111 Ga0070662_100037125 3300005457 Bacteria 3452
112 Ga0070681_10006073 3300005458 Bacteria 11714
113 Ga0070681_10013953 3300005458 Bacteria 7993
114 Ga0070681_10059673 3300005458 Bacteria 3794
115 Ga0070681_10085943 3300005458 Bacteria 3098
116 Ga0070681_10089352 3300005458 Bacteria 3032
117 Ga0070681_10128583 3300005458 Bacteria 2466
118 Ga0068867_100000679 3300005459 Bacteria 22540
119 Ga0068867_100010686 3300005459 Bacteria 6475
120 Ga0068867_100131739 3300005459 Bacteria 1944
121 Ga0070685_10001017 3300005466 Bacteria 15078
122 Ga0070706_100034715 3300005467 Bacteria 4658
123 Ga0070698_100001178 3300005471 Bacteria 29022
124 Ga0070699_100014629 3300005518 Bacteria 6749
125 Ga0070679_100002677 3300005530 Bacteria 16220
126 Ga0070679_100072165 3300005530 Bacteria 3444
127 Ga0070679_100179538 3300005530 Bacteria 2089
128 Ga0070684_100000693 3300005535 Bacteria 23221
129 Ga0070684_100078587 3300005535 Bacteria 2915
130 Ga0070684_100141498 3300005535 Bacteria 2175
131 Ga0070684_100160910 3300005535 Bacteria 2037
132 Ga0070697_100104754 3300005536 Bacteria 2352
133 Ga0070672_100004245 3300005543 Bacteria 9369
134 Ga0070672_100021286 3300005543 Bacteria 4743
135 Ga0070672_100050976 3300005543 Bacteria 3226
136 Ga0070672_100096548 3300005543 Bacteria 2391
137 Ga0070686_100001302 3300005544 Bacteria 14092
138 Ga0070686_100002564 3300005544 Bacteria 10020
139 Ga0070686_100007632 3300005544 Bacteria 6043
140 Ga0070686_100028997 3300005544 Bacteria 3361
141 Ga0070695_100002461 3300005545 Bacteria 10663
142 Ga0070695_100009173 3300005545 Bacteria 5882
143 Ga0070696_100001783 3300005546 Bacteria 14106
144 Ga0070696_100007358 3300005546 Bacteria 7353
145 Ga0070696_100057982 3300005546 Bacteria 2704
146 Ga0070693_100001926 3300005547 Bacteria 9497
147 Ga0070693_100047279 3300005547 Bacteria 2448
148 Ga0070665_100042474 3300005548 Bacteria 4570
149 Ga0070704_100031373 3300005549 Bacteria 3574
150 Ga0068855_100010931 3300005563 Bacteria 10955
151 Ga0068855_100077988 3300005563 Bacteria 3843
152 Ga0068855_100163518 3300005563 Bacteria 2525
153 Ga0070664_100006539 3300005564 Bacteria 9399
154 Ga0070664_100117084 3300005564 Bacteria 2330
155 Ga0068857_100000534 3300005577 Bacteria 27500
156 Ga0068857_100025817 3300005577 Bacteria 5173
157 Ga0068857_100054713 3300005577 Bacteria 3542
158 Ga0068854_100003403 3300005578 Bacteria 9917
159 Ga0068854_100073166 3300005578 Bacteria 2511
160 Ga0068854_100148241 3300005578 Bacteria 1806
161 Ga0068856_100008075 3300005614 Bacteria 10274
162 Ga0068856_100157777 3300005614 Bacteria 2279
163 Ga0070702_100001579 3300005615 Bacteria 9391
164 Ga0070702_100020797 3300005615 Bacteria 3443
165 Ga0070702_100037145 3300005615 Bacteria 2704
166 Ga0068852_100003393 3300005616 Bacteria 11127
167 Ga0068852_100014120 3300005616 Bacteria 6133
168 Ga0068852_100041022 3300005616 Bacteria 3909
169 Ga0068852_100072068 3300005616 Bacteria 3035
170 Ga0068859_100003965 3300005617 Bacteria 15100
171 Ga0068859_100031525 3300005617 Bacteria 5323
172 Ga0068859_100037505 3300005617 Bacteria 4864
173 Ga0068859_100067082 3300005617 Bacteria 3622
174 Ga0068864_100004544 3300005618 Bacteria 11395
175 Ga0068864_100013878 3300005618 Bacteria 6678
176 Ga0068864_100083229 3300005618 Bacteria 2810
177 Ga0068866_10000252 3300005718 Bacteria 25051
178 Ga0068861_100001032 3300005719 Bacteria 17052
179 Ga0068861_100071527 3300005719 Bacteria 2689
180 Ga0068870_10013347 3300005840 Bacteria 3859
181 Ga0068863_100000150 3300005841 Bacteria 72968
182 Ga0068863_100084827 3300005841 Bacteria 3002
183 Ga0068863_100093117 3300005841 Bacteria 2860
184 Ga0068863_100177821 3300005841 Bacteria 2042
185 Ga0068858_100003904 3300005842 Bacteria 14725
186 Ga0068858_100013222 3300005842 Bacteria 7777
187 Ga0068858_100019307 3300005842 Bacteria 6373
188 Ga0068858_100212920 3300005842 Bacteria 1829
189 Ga0068860_100003148 3300005843 Bacteria 17055
190 Ga0068860_100049421 3300005843 Unclassified 4005
191 Ga0068862_100006993 3300005844 Bacteria 9366
192 Ga0068862_100009738 3300005844 Bacteria 7944
193 Ga0081455_10000185 3300005937 Bacteria 78750
194 Ga0081455_10002539 3300005937 Bacteria 21666
195 Ga0081455_10003484 3300005937 Bacteria 18077
196 Ga0081455_10005197 3300005937 Bacteria 14318
197 Ga0081455_10011999 3300005937 Bacteria 8671
198 Ga0081455_10017717 3300005937 Bacteria 6815
199 Ga0081538_10000638 3300005981 Bacteria 38813
200 Ga0081538_10017029 3300005981 Bacteria 5539
201 Ga0081538_10065488 3300005981 Bacteria 2045
202 Ga0081538_10071988 3300005981 Bacteria 1898
203 Ga0081540_1000925 3300005983 Bacteria 26377
204 Ga0081540_1004357 3300005983 Bacteria 10826
205 Ga0081540_1081091 3300005983 Bacteria 1460
206 Ga0081539_10002542 3300005985 Bacteria 25354
207 Ga0081539_10002695 3300005985 Bacteria 24099
208 Ga0070717_10000285 3300006028 Bacteria 34330
209 Ga0070717_10026319 3300006028 Bacteria 4640
210 Ga0075365_10039163 3300006038 Bacteria 3085
211 Ga0075364_10029445 3300006051 Bacteria 3521
212 Ga0075432_10000240 3300006058 Bacteria 14777
213 Ga0070715_10001307 3300006163 Bacteria 7164
214 Ga0070716_100011132 3300006173 Bacteria 4527
215 Ga0070716_100023971 3300006173 Bacteria 3244
216 Ga0070712_100020468 3300006175 Bacteria 4329
217 Ga0070712_100054255 3300006175 Bacteria 2802
218 Ga0075362_10014565 3300006177 Bacteria 3176
219 Ga0075362_10019606 3300006177 Bacteria 2815
220 Ga0075367_10012684 3300006178 Bacteria 4506
221 Ga0075367_10088361 3300006178 Bacteria 1883
222 Ga0097621_100000544 3300006237 Bacteria 26555
223 Ga0097621_100004712 3300006237 Bacteria 9530
224 Ga0097621_100025145 3300006237 Bacteria 4657
225 Ga0075370_10009286 3300006353 Bacteria 5103
226 Ga0075370_10064015 3300006353 Bacteria 2097
227 Ga0068871_100001366 3300006358 Bacteria 16355
228 Ga0068871_100003497 3300006358 Bacteria 10802
229 Ga0068871_100174820 3300006358 Bacteria 1843
230 Ga0075428_100000205 3300006844 Bacteria 56652
231 Ga0075428_100019769 3300006844 Bacteria 7453
232 Ga0075428_100082405 3300006844 Bacteria 3510
233 Ga0075428_100102778 3300006844 Bacteria 3117
234 Ga0075428_100201860 3300006844 Bacteria 2149
235 Ga0075430_100000012 3300006846 Bacteria 94359
236 Ga0075430_100004858 3300006846 Bacteria 11310
237 Ga0075430_100068023 3300006846 Bacteria 2989
238 Ga0075431_100000266 3300006847 Bacteria 40349
239 Ga0075431_100005460 3300006847 Bacteria 12559
240 Ga0075431_100014481 3300006847 Bacteria 7978
241 Ga0075431_100022527 3300006847 Bacteria 6441
242 Ga0075431_100072901 3300006847 Bacteria 3543
243 Ga0075431_100098627 3300006847 Bacteria 3016
244 Ga0075431_100248972 3300006847 Bacteria 1806
245 Ga0075433_10000338 3300006852 Bacteria 29055
246 Ga0075433_10004462 3300006852 Bacteria 10906
247 Ga0075433_10012596 3300006852 Bacteria 6840
248 Ga0075433_10080536 3300006852 Bacteria 2871
249 Ga0075434_100000373 3300006871 Bacteria 32610
250 Ga0075434_100009082 3300006871 Bacteria 9258
251 Ga0075434_100009842 3300006871 Bacteria 8940
252 Ga0075434_100012045 3300006871 Bacteria 8184
253 Ga0075434_100027939 3300006871 Bacteria 5538
254 Ga0075434_100133652 3300006871 Bacteria 2500
255 Ga0075429_100002160 3300006880 Bacteria 16411
256 Ga0075429_100022260 3300006880 Bacteria 5498
257 Ga0075429_100160193 3300006880 Bacteria 1971
258 Ga0068865_100000190 3300006881 Bacteria 34392
259 Ga0068865_100044980 3300006881 Bacteria 3024
260 Ga0068865_100168964 3300006881 Bacteria 1675
261 Ga0075436_100000443 3300006914 Bacteria 26527
262 Ga0097620_100003965 3300006931 Bacteria 15100
263 Ga0097620_100031525 3300006931 Bacteria 5323
264 Ga0097620_100037508 3300006931 Bacteria 4864
265 Ga0097620_100067084 3300006931 Bacteria 3622
266 Ga0075435_100013108 3300007076 Bacteria 6158
267 Ga0075435_100134915 3300007076 Bacteria 2067
268 Ga0075435_100173393 3300007076 Bacteria 1820
269 Ga0099794_10007253 3300007265 Bacteria 4543
270 Ga0105250_10010395 3300009092 Bacteria 3880
271 Ga0105250_10023450 3300009092 Bacteria 2486
272 Ga0105240_10003481 3300009093 Bacteria 24428
273 Ga0105240_10070736 3300009093 Bacteria 4316
274 Ga0105240_10160426 3300009093 Bacteria 2671
275 Ga0111539_10000299 3300009094 Bacteria 60010
276 Ga0111539_10005091 3300009094 Bacteria 17061
277 Ga0111539_10005821 3300009094 Bacteria 15939
278 Ga0111539_10025137 3300009094 Bacteria 7300
279 Ga0111539_10080025 3300009094 Bacteria 3844
280 Ga0111539_10179589 3300009094 Bacteria 2472
281 Ga0105245_10000543 3300009098 Bacteria 34420
282 Ga0105245_10017080 3300009098 Bacteria 6332
283 Ga0105245_10178269 3300009098 Bacteria 2028
284 Ga0105247_10026146 3300009101 Bacteria 3523
285 Ga0105247_10034263 3300009101 Bacteria 3093
286 Ga0105247_10104703 3300009101 Bacteria 1813
287 Ga0114129_10000640 3300009147 Bacteria 43706
288 Ga0114129_10016895 3300009147 Bacteria 10390
289 Ga0114129_10019077 3300009147 Bacteria 9768
290 Ga0114129_10106391 3300009147 Bacteria 3875
291 Ga0105243_10014840 3300009148 Bacteria 5895
292 Ga0105243_10020519 3300009148 Bacteria 5009
293 Ga0105243_10216149 3300009148 Bacteria 1691
294 Ga0105241_10002875 3300009174 Bacteria 12867
295 Ga0105241_10016416 3300009174 Bacteria 5431
296 Ga0105241_10045570 3300009174 Bacteria 3328
297 Ga0105242_10001766 3300009176 Bacteria 17062
298 Ga0105242_10004776 3300009176 Bacteria 10490
299 Ga0105242_10020801 3300009176 Bacteria 5147
300 Ga0105248_10000501 3300009177 Bacteria 44646
301 Ga0105248_10010945 3300009177 Bacteria 10011
302 Ga0105248_10017190 3300009177 Bacteria 7969
303 Ga0105248_10040194 3300009177 Bacteria 5244
304 Ga0105248_10095011 3300009177 Bacteria 3356
305 Ga0105238_10024549 3300009551 Bacteria 6144
306 Ga0105238_10116235 3300009551 Bacteria 2654
307 Ga0105249_10006521 3300009553 Bacteria 10153
308 Ga0105239_10005329 3300010375 Bacteria 15087
309 Ga0105239_10019260 3300010375 Bacteria 7538
310 Ga0105239_10035309 3300010375 Bacteria 5491
311 Ga0105239_10110589 3300010375 Bacteria 3046
312 Ga0105239_10127527 3300010375 Bacteria 2829
313 Ga0105246_10009901 3300011119 Bacteria 5878
314 Ga0105246_10064351 3300011119 Bacteria 2561
315 Ga0105246_10082067 3300011119 Bacteria 2300
316 Ga0157373_10060401 3300013100 Bacteria 2686
317 Ga0157371_10042393 3300013102 Bacteria 3243
318 Ga0157370_10026677 3300013104 Bacteria 5701
319 Ga0157370_10030889 3300013104 Bacteria 5246
320 Ga0157369_10048634 3300013105 Bacteria 4601
321 Ga0157369_10232379 3300013105 Bacteria 1928
322 Ga0171462_1032 3300013250 Bacteria 98473
323 Ga0157374_10013556 3300013296 Bacteria 7118
324 Ga0157374_10067536 3300013296 Bacteria 3361
325 Ga0157378_10003057 3300013297 Bacteria 14869
326 Ga0163162_10004207 3300013306 Bacteria 13834
327 Ga0163162_10083860 3300013306 Bacteria 3261
328 Ga0163162_10236195 3300013306 Bacteria 1958
329 Ga0157372_10028637 3300013307 Bacteria 6082
330 Ga0157375_10002141 3300013308 Bacteria 17061
331 Ga0157375_10009534 3300013308 Bacteria 8523
332 Ga0157375_10011822 3300013308 Bacteria 7718
333 Ga0157375_10289737 3300013308 Bacteria 1800
334 Ga0163163_10003931 3300014325 Bacteria 12675
335 Ga0163163_10010114 3300014325 Bacteria 8461
336 Ga0163163_10187720 3300014325 Bacteria 2115
337 Ga0157380_10000049 3300014326 Bacteria 71296
338 Ga0157380_10117233 3300014326 Bacteria 2249
339 Ga0182008_10048537 3300014497 Bacteria 2108
340 Ga0157377_10002000 3300014745 Bacteria 8928
341 Ga0157377_10013212 3300014745 Bacteria 4175
342 Ga0157379_10035738 3300014968 Bacteria 4430
343 Ga0157379_10080671 3300014968 Bacteria 2914
344 Ga0157376_10000099 3300014969 Bacteria 62912
345 Ga0157376_10148915 3300014969 Bacteria 2109
346 Ga0163161_10000081 3300017792 Bacteria 97213
347 Ga0163161_10075725 3300017792 Bacteria 2470
348 Ga0163161_10140989 3300017792 Bacteria 1825
349 Ga0213876_10001399 3300021384 Bacteria 15040
350 Ga0213876_10070589 3300021384 Bacteria 1845
351 Ga0213875_10004329 3300021388 Bacteria 7821
352 Ga0209233_1012396 3300025261 Bacteria 2475
353 Ga0207666_1000167 3300025271 Bacteria 10172
354 Ga0209130_1000178 3300025284 Bacteria 90293
355 Ga0207673_1000367 3300025290 Bacteria 4557
356 Ga0209675_1000692 3300025291 Bacteria 23450
357 Ga0209025_1000008 3300025294 Bacteria 1130876
358 Ga0209025_1002015 3300025294 Bacteria 23178
359 Ga0209564_1000049 3300025295 Bacteria 362075
360 Ga0209758_1007060 3300025297 Bacteria 7790
361 Ga0209256_1000014 3300025299 Bacteria 687409
362 Ga0209256_1000200 3300025299 Bacteria 112931
363 Ga0207426_1023081 3300025302 Bacteria 2126
364 Ga0207653_10000843 3300025885 Bacteria 10205
365 Ga0207682_10000046 3300025893 Bacteria 51587
366 Ga0207682_10000637 3300025893 Bacteria 16334
367 Ga0207692_10000988 3300025898 Bacteria 10376
368 Ga0207642_10001252 3300025899 Bacteria 7870
369 Ga0207710_10000850 3300025900 Bacteria 16454
370 Ga0207710_10009377 3300025900 Bacteria 4121
371 Ga0207710_10010799 3300025900 Bacteria 3846
372 Ga0207688_10001056 3300025901 Bacteria 14080
373 Ga0207688_10001343 3300025901 Bacteria 12782
374 Ga0207680_10002036 3300025903 Bacteria 9466
375 Ga0207680_10007258 3300025903 Bacteria 5390
376 Ga0207680_10048876 3300025903 Bacteria 2515
377 Ga0207647_10007296 3300025904 Bacteria 8002
378 Ga0207647_10079370 3300025904 Bacteria 1970
379 Ga0207685_10002344 3300025905 Bacteria 4314
380 Ga0207685_10014730 3300025905 Bacteria 2455
381 Ga0207699_10000312 3300025906 Bacteria 25999
382 Ga0207699_10037876 3300025906 Bacteria 2759
383 Ga0207645_10000162 3300025907 Bacteria 52720
384 Ga0207645_10037726 3300025907 Bacteria 3101
385 Ga0207643_10000025 3300025908 Bacteria 101583
386 Ga0207643_10001138 3300025908 Bacteria 15810
387 Ga0207654_10001641 3300025911 Bacteria 11696
388 Ga0207654_10033211 3300025911 Bacteria 2859
389 Ga0207707_10002255 3300025912 Bacteria 17449
390 Ga0207707_10010884 3300025912 Bacteria 7907
391 Ga0207707_10012619 3300025912 Bacteria 7342
392 Ga0207707_10073899 3300025912 Bacteria 2973
393 Ga0207707_10149927 3300025912 Bacteria 2039
394 Ga0207671_10010591 3300025914 Bacteria 7591
395 Ga0207693_10006436 3300025915 Bacteria 9731
396 Ga0207693_10036605 3300025915 Bacteria 3868
397 Ga0207693_10039616 3300025915 Bacteria 3711
398 Ga0207693_10040965 3300025915 Bacteria 3648
399 Ga0207663_10050345 3300025916 Bacteria 2588
400 Ga0207663_10076825 3300025916 Bacteria 2171
401 Ga0207660_10001243 3300025917 Bacteria 17069
402 Ga0207662_10016220 3300025918 Bacteria 4201
403 Ga0207662_10016564 3300025918 Bacteria 4161
404 Ga0207662_10107287 3300025918 Bacteria 1738
405 Ga0207657_10039151 3300025919 Bacteria 4215
406 Ga0207649_10000048 3300025920 Bacteria 110714
407 Ga0207652_10003743 3300025921 Bacteria 12479
408 Ga0207652_10019346 3300025921 Bacteria 5599
409 Ga0207652_10023862 3300025921 Bacteria 5072
410 Ga0207652_10042464 3300025921 Bacteria 3870
411 Ga0207652_10081384 3300025921 Bacteria 2832
412 Ga0207681_10000131 3300025923 Bacteria 61025
413 Ga0207694_10057921 3300025924 Bacteria 3013
414 Ga0207650_10002321 3300025925 Bacteria 13259
415 Ga0207650_10053527 3300025925 Bacteria 2992
416 Ga0207650_10140014 3300025925 Bacteria 1901
417 Ga0207659_10000040 3300025926 Bacteria 91375
418 Ga0207659_10048887 3300025926 Bacteria 2998
419 Ga0207659_10117466 3300025926 Bacteria 2033
420 Ga0207687_10000090 3300025927 Bacteria 66310
421 Ga0207687_10007813 3300025927 Bacteria 7014
422 Ga0207700_10000231 3300025928 Bacteria 33501
423 Ga0207700_10040992 3300025928 Bacteria 3384
424 Ga0207700_10080333 3300025928 Bacteria 2543
425 Ga0207700_10139355 3300025928 Bacteria 1991
426 Ga0207664_10026272 3300025929 Bacteria 4399
427 Ga0207664_10182187 3300025929 Bacteria 1804
428 Ga0207644_10000473 3300025931 Bacteria 25907
429 Ga0207644_10007385 3300025931 Bacteria 7160
430 Ga0207690_10000173 3300025932 Bacteria 50054
431 Ga0207706_10005557 3300025933 Bacteria 11754
432 Ga0207706_10048639 3300025933 Bacteria 3750
433 Ga0207706_10060198 3300025933 Bacteria 3344
434 Ga0207686_10002985 3300025934 Bacteria 9120
435 Ga0207686_10003177 3300025934 Bacteria 8843
436 Ga0207686_10025401 3300025934 Bacteria 3445
437 Ga0207709_10000585 3300025935 Bacteria 30473
438 Ga0207709_10064941 3300025935 Bacteria 2293
439 Ga0207670_10002222 3300025936 Bacteria 10152
440 Ga0207670_10002465 3300025936 Bacteria 9706
441 Ga0207670_10076952 3300025936 Bacteria 2323
442 Ga0207669_10000102 3300025937 Bacteria 42874
443 Ga0207669_10004690 3300025937 Bacteria 6046
444 Ga0207704_10000097 3300025938 Bacteria 49151
445 Ga0207704_10006584 3300025938 Bacteria 5432
446 Ga0207704_10012115 3300025938 Bacteria 4271
447 Ga0207665_10000487 3300025939 Bacteria 26772
448 Ga0207665_10000745 3300025939 Bacteria 21939
449 Ga0207665_10049274 3300025939 Bacteria 2829
450 Ga0207691_10001237 3300025940 Bacteria 25472
451 Ga0207691_10007973 3300025940 Bacteria 10188
452 Ga0207691_10012219 3300025940 Bacteria 8230
453 Ga0207711_10000847 3300025941 Bacteria 29585
454 Ga0207711_10001975 3300025941 Bacteria 18574
455 Ga0207711_10057697 3300025941 Bacteria 3338
456 Ga0207711_10189442 3300025941 Bacteria 1874
457 Ga0207689_10000677 3300025942 Bacteria 32501
458 Ga0207689_10003052 3300025942 Bacteria 15417
459 Ga0207689_10004233 3300025942 Bacteria 13052
460 Ga0207689_10052095 3300025942 Bacteria 3373
461 Ga0207661_10000204 3300025944 Bacteria 38344
462 Ga0207661_10111725 3300025944 Bacteria 2312
463 Ga0207679_10000090 3300025945 Bacteria 79412
464 Ga0207667_10018822 3300025949 Bacteria 7733
465 Ga0207667_10098381 3300025949 Bacteria 3019
466 Ga0207667_10122143 3300025949 Bacteria 2684
467 Ga0207667_10267315 3300025949 Bacteria 1748
468 Ga0207651_10000017 3300025960 Bacteria 100256
469 Ga0207651_10017251 3300025960 Bacteria 4260
470 Ga0207712_10000114 3300025961 Bacteria 87261
471 Ga0207712_10009218 3300025961 Bacteria 6250
472 Ga0207712_10067021 3300025961 Bacteria 2568
473 Ga0207668_10000139 3300025972 Bacteria 49764
474 Ga0207668_10011937 3300025972 Bacteria 5301
475 Ga0207668_10016242 3300025972 Bacteria 4642
476 Ga0207668_10084432 3300025972 Bacteria 2314
477 Ga0207640_10000221 3300025981 Bacteria 40097
478 Ga0207640_10109641 3300025981 Bacteria 1953
479 Ga0207640_10115559 3300025981 Bacteria 1911
480 Ga0207658_10001766 3300025986 Bacteria 16236
481 Ga0207658_10024367 3300025986 Bacteria 4234
482 Ga0207658_10062170 3300025986 Bacteria 2794
483 Ga0207658_10080747 3300025986 Bacteria 2492
484 Ga0207658_10138949 3300025986 Bacteria 1963
485 Ga0207658_10174420 3300025986 Unclassified 1774
486 Ga0207677_10023458 3300026023 Bacteria 3813
487 Ga0207677_10044776 3300026023 Bacteria 2950
488 Ga0207703_10001230 3300026035 Bacteria 23955
489 Ga0207703_10006478 3300026035 Bacteria 9348
490 Ga0207703_10011650 3300026035 Bacteria 6839
491 Ga0207703_10165148 3300026035 Bacteria 1942
492 Ga0207703_10180100 3300026035 Bacteria 1865
493 Ga0207639_10001275 3300026041 Bacteria 17013
494 Ga0207678_10010483 3300026067 Bacteria 8140
495 Ga0207708_10001855 3300026075 Bacteria 15567
496 Ga0207708_10040517 3300026075 Bacteria 3551
497 Ga0207708_10133814 3300026075 Bacteria 1940
498 Ga0207702_10000198 3300026078 Bacteria 71277
499 Ga0207641_10000417 3300026088 Bacteria 49719
500 Ga0207641_10044363 3300026088 Bacteria 3739
501 Ga0207641_10240009 3300026088 Bacteria 1688
502 Ga0207648_10000483 3300026089 Bacteria 44295
503 Ga0207648_10015227 3300026089 Bacteria 7075
504 Ga0207648_10027045 3300026089 Bacteria 5094
505 Ga0207648_10098232 3300026089 Unclassified 2563
506 Ga0207676_10000372 3300026095 Bacteria 38295
507 Ga0207676_10001984 3300026095 Bacteria 14895
508 Ga0207676_10015557 3300026095 Bacteria 5490
509 Ga0207674_10009004 3300026116 Bacteria 11470
510 Ga0207674_10035884 3300026116 Bacteria 5172
511 Ga0207674_10116617 3300026116 Bacteria 2641
512 Ga0207675_100005906 3300026118 Bacteria 11682
513 Ga0207675_100053176 3300026118 Bacteria 3779
514 Ga0207683_10000141 3300026121 Bacteria 59587
515 Ga0207683_10003008 3300026121 Bacteria 14733
516 Ga0207683_10007416 3300026121 Bacteria 9407
517 Ga0207683_10024647 3300026121 Bacteria 5182
518 Ga0207683_10026401 3300026121 Bacteria 5012
519 Ga0207683_10045434 3300026121 Bacteria 3841
520 Ga0207698_10005863 3300026142 Bacteria 7634
521 Ga0207698_10270873 3300026142 Bacteria 1565
522 Ga0207698_10277801 3300026142 Bacteria 1547
523 Ga0209971_1002132 3300027682 Bacteria 4814
524 Ga0209998_10007120 3300027717 Bacteria 2320
525 Ga0209998_10008001 3300027717 Bacteria 2194
526 Ga0209974_10042219 3300027876 Bacteria 1518
527 Ga0207428_10000058 3300027907 Bacteria 158579
528 Ga0207428_10001115 3300027907 Bacteria 29201
529 Ga0207428_10002874 3300027907 Bacteria 17069
530 Ga0268266_10002234 3300028379 Bacteria 21139
531 Ga0268266_10024665 3300028379 Bacteria 5117
532 Ga0268266_10028466 3300028379 Bacteria 4749
533 Ga0268265_10003432 3300028380 Bacteria 11404
534 Ga0268265_10043620 3300028380 Bacteria 3335
535 Ga0268265_10226512 3300028380 Bacteria 1640
536 Ga0268264_10000412 3300028381 Bacteria 60566
537 Ga0265337_1010903 3300028556 Bacteria 3159
538 Ga0265330_10036549 3300031235 Bacteria 2189
539 Ga0265332_10000849 3300031238 Bacteria 18521
540 Ga0265325_10000036 3300031241 Bacteria 96858
541 Ga0265325_10000464 3300031241 Bacteria 29365
542 Ga0265325_10007651 3300031241 Bacteria 6456
543 Ga0265325_10047190 3300031241 Bacteria 2230
544 Ga0265340_10004313 3300031247 Bacteria 7968
545 Ga0265340_10038095 3300031247 Bacteria 2379
546 Ga0265339_10001612 3300031249 Bacteria 16687
547 Ga0265339_10004115 3300031249 Bacteria 10026
548 Ga0265339_10007937 3300031249 Bacteria 6807
549 Ga0265331_10014085 3300031250 Bacteria 4272
550 Ga0265331_10018026 3300031250 Bacteria 3670
551 Ga0265316_10028221 3300031344 Bacteria 4632
552 Ga0265316_10118153 3300031344 Bacteria 2004
553 Ga0265313_10000513 3300031595 Bacteria 40580
554 Ga0265313_10001147 3300031595 Bacteria 25315
555 Ga0265313_10001570 3300031595 Bacteria 21191
556 Ga0265313_10003857 3300031595 Bacteria 11830
557 Ga0265313_10013620 3300031595 Bacteria 4865
558 Ga0265313_10026302 3300031595 Bacteria 3067
559 Ga0265313_10066220 3300031595 Bacteria 1675
560 Ga0265314_10007314 3300031711 Bacteria 9589
561 Ga0265314_10024700 3300031711 Bacteria 4550
562 Ga0265314_10034461 3300031711 Bacteria 3701
563 Ga0265314_10120567 3300031711 Bacteria 1652
564 Ga0265342_10000360 3300031712 Bacteria 50461
565 Ga0265342_10002687 3300031712 Bacteria 15127
566 Ga0265342_10010083 3300031712 Bacteria 6587
567 Ga0265342_10017720 3300031712 Bacteria 4625
568 Ga0265342_10030918 3300031712 Bacteria 3314
569 Ga0265342_10049630 3300031712 Bacteria 2510
570 Ga0307411_10103866 3300032005 Bacteria 2017
571 Ga0373930_0000011 3300034816 Bacteria 18016
572 Ga0373948_0000241 3300034817 Bacteria 6519
573 Ga0373950_0002353 3300034818 Bacteria 2594
574 Ga0373958_0000313 3300034819 Bacteria 5848
575 Ga0373959_0005453 3300034820 Bacteria 2086
576 Ga0373938_0000404 3300034957 Bacteria 6956
577 Ga0373926_0013686 3300035083 Bacteria 2754
578 Ga0373926_0017166 3300035083 Bacteria 2482
579 Ga0373928_0000880 3300035084 Bacteria 5888
580 Ga0373929_0000816 3300035085 Bacteria 6065
581 Ga0373940_0000619 3300035088 Bacteria 5660
582 Ga0373944_0010711 3300035089 Bacteria 2503
583 Ga0373951_0000312 3300035091 Bacteria 15385
584 Ga0373951_0006275 3300035091 Unclassified 2722
585 Ga0373952_0000253 3300035092 Bacteria 8714
586 Ga0373952_0003999 3300035092 Bacteria 2664
587 Ga0373923_0015576 3300035111 Bacteria 2873
588 Ga0373923_0054353 3300035111 Bacteria 1685
589 Ga0373932_0001887 3300035112 Bacteria 5600
590 Ga0373932_0008193 3300035112 Bacteria 2497
591 Ga0373932_0008544 3300035112 Bacteria 2449
592 Ga0373936_0048268 3300035113 Bacteria 1718
593 Ga0373939_0000502 3300035114 Bacteria 9837
594 Ga0373939_0000832 3300035114 Bacteria 7638
595 Ga0373939_0002168 3300035114 Bacteria 4660
596 Ga0373941_0000330 3300035115 Bacteria 9276
597 Ga0373945_0004542 3300035116 Bacteria 4411
598 Ga0373945_0007082 3300035116 Bacteria 3628
599 Ga0373945_0010369 3300035116 Bacteria 3068
600 Ga0373953_0017789 3300035117 Bacteria 2619
601 Ga0373953_0025159 3300035117 Bacteria 2271
602 Ga0373954_0000753 3300035118 Bacteria 12522
603 Ga0373956_0001330 3300035119 Bacteria 10205
604 Ga0373956_0015305 3300035119 Bacteria 3210
605 Ga0373957_0006863 3300035120 Bacteria 3611
606 Ga0373957_0008264 3300035120 Bacteria 3365
607 Ga0373960_0000137 3300035121 Bacteria 12098
608 Ga0373943_0003107 3300035170 Bacteria 7543
609 Ga0373946_0001852 3300035171 Bacteria 7383
610 Ga0373946_0002090 3300035171 Bacteria 7018
611 Ga0373946_0013540 3300035171 Bacteria 3068
612 Ga0373946_0023809 3300035171 Bacteria 2394
613 Ga0373955_0000158 3300035172 Bacteria 27228
614 Ga0373955_0002098 3300035172 Bacteria 8610
615 Ga0373961_0000492 3300035241 Bacteria 15342
616 Ga0373961_0003857 3300035241 Bacteria 3659
617 Ga0373962_0000279 3300035242 Bacteria 10997
618 Ga0316574_0023419 3300035398 Bacteria 3686
619 Ga0373924_0007302 3300035410 Bacteria 3985
620 Ga0373931_0000131 3300035691 Bacteria 34406
621 Ga0373931_0005561 3300035691 Bacteria 5841
622 Ga0373931_0011848 3300035691 Bacteria 4216
623 Ga0373931_0063546 3300035691 Unclassified 1995
624 Ga0373935_0000026 3300035692 Bacteria 58851
625 Ga0373927_0006909 3300035695 Bacteria 7711
626 Ga0373927_0023307 3300035695 Bacteria 4054
627 Ga0373927_0042130 3300035695 Bacteria 2959
628 Ga0373927_0069958 3300035695 Bacteria 2271
629 Ga0373933_0001665 3300035724 Bacteria 12922
630 Ga0373933_0011017 3300035724 Bacteria 4967
631 Ga0373947_0004512 3300035725 Bacteria 8165
632 Ga0373947_0016533 3300035725 Bacteria 4239
633 Ga0373947_0054904 3300035725 Bacteria 2405
634 Ga0373937_0002145 3300036401 Bacteria 16512
635 Ga0373937_0003289 3300036401 Bacteria 13564
636 Ga0373937_0005585 3300036401 Bacteria 10787
637 Ga0373937_0011521 3300036401 Bacteria 7761
638 Ga0373937_0030958 3300036401 Bacteria 4845
639 Ga0373937_0075764 3300036401 Bacteria 3107
640 Ga0373937_0213011 3300036401 Bacteria 1818
641 Ga0316584_0011236 3300036712 Bacteria 6285
642 Ga0373925_0000034 3300037068 Bacteria 144257
643 Ga0373925_0001381 3300037068 Bacteria 21133
644 Ga0373925_0006934 3300037068 Bacteria 8288
645 Ga0373925_0007514 3300037068 Bacteria 7944
646 Ga0373925_0027906 3300037068 Bacteria 4133
647 Ga0373925_0036449 3300037068 Bacteria 3630
648 Ga0373925_0080847 3300037068 Bacteria 2471
649 Ga0395899_0078953 3300037312 Bacteria 2398
650 Ga0395899_0141107 3300037312 Bacteria 1714
651 Ga0395900_0007587 3300037418 Bacteria 11203
652 Ga0395900_0023602 3300037418 Bacteria 6292
653 Ga0395900_0093408 3300037418 Bacteria 3090
654 Ga0395898_0006512 3300037466 Bacteria 12478
655 Ga0395898_0028469 3300037466 Bacteria 5597
656 Ga0395898_0061182 3300037466 Bacteria 3658
657 Ga0395898_0108979 3300037466 Bacteria 2655
658 Ga0395898_0175469 3300037466 Bacteria 2048
659 Ga0436364_0308859 3300037853 Bacteria 7431
660 Ga0436364_0631135 3300037853 Bacteria 32086
661 Ga0395901_0005082 3300038443 Bacteria 13285
662 Ga0395901_0010709 3300038443 Bacteria 9296
663 Ga0395901_0018368 3300038443 Bacteria 7139
664 Ga0395901_0173895 3300038443 Bacteria 2259
665 Ga0436365_0174563 3300039437 Bacteria 17649
666 Ga0436365_0231168 3300039437 Bacteria 6346
667 Ga0436365_1231055 3300039437 Bacteria 2961
668 Ga0436361_0164715 3300039447 Bacteria 1770
669 Ga0436361_0377742 3300039447 Bacteria 7150
670 Ga0436363_0874280 3300039450 Bacteria 11837
671 Ga0436362_0837885 3300039453 Bacteria 10424
672 Ga0439441_005457 3300042001 Bacteria 1978
673 Ga0466969_0073136 3300044656 Bacteria 1645
674 Ga0466966_0053978 3300044684 Bacteria 2548
675 Ga0466963_0072116 3300044694 Bacteria 2326
676 Ga0466963_0148797 3300044694 Bacteria 1625
677 Ga0466957_0051372 3300044842 Bacteria 2509
678 Ga0451576_0017698 3300045051 Bacteria 7831
679 Ga0495592_0000031 3300046454 Bacteria 128596
680 Ga0495592_0001425 3300046454 Bacteria 16601
681 Ga0495603_0002046 3300046455 Bacteria 11869
682 Ga0495603_0013789 3300046455 Bacteria 4890
683 Ga0495603_0018444 3300046455 Bacteria 4221
684 Ga0495629_0001317 3300046459 Bacteria 19520
685 Ga0495629_0011658 3300046459 Bacteria 6378
686 Ga0495638_0005408 3300046460 Bacteria 9506
687 Ga0495651_0000200 3300046462 Bacteria 45618
688 Ga0495651_0001028 3300046462 Bacteria 21603
689 Ga0495651_0006877 3300046462 Bacteria 8692
690 Ga0495651_0034700 3300046462 Bacteria 3932
691 Ga0495653_0000012 3300046463 Bacteria 266880
692 Ga0495580_0012176 3300046472 Bacteria 6610
693 Ga0495580_0027217 3300046472 Bacteria 4161
694 Ga0495580_0081889 3300046472 Bacteria 2249
695 Ga0495582_0002161 3300046473 Bacteria 10999
696 Ga0495582_0008114 3300046473 Bacteria 5799
697 Ga0495582_0038565 3300046473 Bacteria 2629
698 Ga0495639_0007711 3300046475 Bacteria 4628
699 Ga0495662_0005794 3300046476 Bacteria 6180
700 Ga0495662_0009602 3300046476 Bacteria 4743
701 Ga0495664_0000004 3300046477 Bacteria 489411
702 Ga0495664_0009525 3300046477 Bacteria 5437
703 Ga0495584_0013764 3300046491 Bacteria 4126
704 Ga0495584_0034654 3300046491 Bacteria 2552
705 Ga0495585_0002983 3300046492 Bacteria 11691
706 Ga0495594_0004109 3300046499 Bacteria 7487
707 Ga0495594_0023399 3300046499 Bacteria 3310
708 Ga0495594_0120822 3300046499 Bacteria 1481
709 Ga0495607_0033049 3300046501 Bacteria 3150
710 Ga0495606_0005478 3300046507 Bacteria 12151
711 Ga0495608_0000005 3300046511 Bacteria 350726
712 Ga0495608_0011395 3300046511 Bacteria 6187
713 Ga0495608_0011757 3300046511 Bacteria 6088
714 Ga0495608_0046951 3300046511 Bacteria 2872
715 Ga0495616_0029782 3300046513 Bacteria 2878
716 Ga0495618_0000024 3300046514 Bacteria 122536
717 Ga0495618_0015603 3300046514 Bacteria 4636
718 Ga0495628_0000001 3300046516 Bacteria 917742
719 Ga0495628_0032380 3300046516 Bacteria 4220
720 Ga0495628_0048931 3300046516 Bacteria 3348
721 Ga0495628_0103738 3300046516 Bacteria 2192
722 Ga0495630_0000433 3300046517 Bacteria 31976
723 Ga0495630_0072327 3300046517 Bacteria 2595
724 Ga0495644_0026755 3300046523 Bacteria 2187
725 Ga0495666_0021525 3300046526 Bacteria 3192
726 Ga0495652_0000002 3300046529 Bacteria 946606
727 Ga0495652_0006243 3300046529 Bacteria 11114
728 Ga0495665_0008064 3300046531 Bacteria 5711
729 Ga0495665_0047533 3300046531 Bacteria 2276
730 Ga0495665_0075077 3300046531 Bacteria 1780
731 Ga0495640_0000001 3300046533 Bacteria 853827
732 Ga0495640_0022609 3300046533 Bacteria 4592
733 Ga0495640_0066862 3300046533 Bacteria 2423
734 Ga0495587_0000016 3300046536 Bacteria 185585
735 Ga0495587_0012035 3300046536 Bacteria 5464
736 Ga0495598_0001760 3300046537 Bacteria 4349
737 Ga0495598_0006198 3300046537 Bacteria 2691
738 Ga0495645_0000002 3300046543 Bacteria 651644
739 Ga0495645_0008421 3300046543 Bacteria 7204
740 Ga0495622_0006154 3300046557 Bacteria 5577
741 Ga0495633_0047131 3300046558 Bacteria 2037
742 Ga0495667_0000007 3300046559 Bacteria 234736
743 Ga0495667_0004749 3300046559 Bacteria 9187
744 Ga0495667_0017859 3300046559 Bacteria 4793
745 Ga0495667_0123335 3300046559 Bacteria 1672
746 Ga0495656_0002224 3300046615 Bacteria 6412
747 Ga0495634_0000637 3300046642 Bacteria 34135
748 Ga0495634_0059015 3300046642 Bacteria 2556
749 Ga0495635_0000002 3300046663 Bacteria 490490
750 Ga0495635_0003581 3300046663 Bacteria 10750
751 Ga0495635_0084095 3300046663 Bacteria 2178
752 Ga0495635_0086692 3300046663 Bacteria 2142
753 Ga0495659_0002344 3300046664 Bacteria 6116
754 Ga0495588_0001979 3300046674 Bacteria 8763
755 Ga0495588_0010900 3300046674 Bacteria 4249
756 Ga0495657_0000628 3300046675 Bacteria 31950
757 Ga0495657_0015907 3300046675 Bacteria 5492
758 Ga0495657_0018234 3300046675 Bacteria 5085
759 Ga0495599_0000005 3300046678 Bacteria 300169
760 Ga0495599_0005324 3300046678 Bacteria 7680
761 Ga0495599_0068953 3300046678 Bacteria 2208
762 Ga0495623_0000016 3300046679 Bacteria 113454
763 Ga0495623_0000554 3300046679 Bacteria 24925
764 Ga0495646_0000002 3300046680 Bacteria 310568
765 Ga0495647_0002658 3300046681 Bacteria 5670
766 Ga0495658_0004985 3300046683 Bacteria 6518
767 Ga0495658_0006650 3300046683 Bacteria 5684
768 Ga0495658_0007896 3300046683 Bacteria 5267
769 Ga0495658_0015425 3300046683 Bacteria 3919
770 Ga0495669_0064220 3300046684 Bacteria 1666
771 Ga0495613_0003637 3300046689 Bacteria 11546
772 Ga0495613_0054770 3300046689 Bacteria 2931
773 Ga0495624_0013261 3300046690 Bacteria 5619
774 Ga0495624_0044384 3300046690 Bacteria 2833
775 Ga0495670_0010273 3300046691 Bacteria 4600
776 Ga0495670_0038246 3300046691 Bacteria 2392
777 Ga0495600_0000018 3300046809 Bacteria 102683
778 Ga0495600_0000989 3300046809 Bacteria 15327
779 Ga0495660_0083899 3300046810 Bacteria 1667
780 Ga0495581_0006932 3300047315 Bacteria 6564
781 Ga0495581_0011122 3300047315 Bacteria 5200
782 Ga0495581_0035026 3300047315 Bacteria 2905
783 Ga0495604_0000020 3300047317 Bacteria 171989
784 Ga0495604_0007911 3300047317 Bacteria 8420
785 Ga0495604_0008426 3300047317 Bacteria 8143
786 Ga0495604_0162420 3300047317 Bacteria 1577
787 Ga0495674_0000002 3300047319 Bacteria 642785
788 Ga0495674_0042306 3300047319 Bacteria 4065
789 Ga0495676_0017061 3300047321 Bacteria 6423
790 Ga0495676_0060276 3300047321 Bacteria 2975
791 Ga0495680_0001158 3300047322 Bacteria 29075
792 Ga0495680_0001832 3300047322 Bacteria 22412
793 Ga0495680_0007696 3300047322 Bacteria 9835
794 Ga0495680_0022544 3300047322 Bacteria 5245
795 Ga0495680_0047732 3300047322 Bacteria 3366
796 Ga0495680_0083674 3300047322 Bacteria 2405
797 Ga0495675_0000284 3300047444 Bacteria 36681
798 Ga0495675_0000625 3300047444 Bacteria 22516
799 Ga0495684_0000017 3300047471 Bacteria 160663
800 Ga0495684_0000517 3300047471 Bacteria 31334
801 Ga0495684_0019009 3300047471 Bacteria 5290
802 Ga0495684_0053566 3300047471 Bacteria 3078
803 Ga0495593_0000759 3300047673 Bacteria 18716
804 Ga0495593_0011494 3300047673 Bacteria 5083
805 Ga0495593_0019161 3300047673 Bacteria 3840
806 Ga0495593_0041222 3300047673 Bacteria 2483
807 Ga0495602_0000040 3300048088 Bacteria 127280
808 Ga0495602_0017182 3300048088 Bacteria 7254
809 Ga0495602_0035207 3300048088 Bacteria 4671
810 Ga0495602_0052529 3300048088 Bacteria 3619
811 Ga0495614_0002673 3300048089 Bacteria 7926
812 Ga0495614_0018347 3300048089 Bacteria 3031
813 Ga0495614_0024776 3300048089 Bacteria 2590
814 Ga0496100_0001217 3300048903 Bacteria 12503
815 Ga0496100_0001822 3300048903 Bacteria 10654
816 Ga0496100_0007937 3300048903 Bacteria 5896
817 Ga0496100_0017190 3300048903 Bacteria 4265
818 Ga0496100_0036333 3300048903 Bacteria 3106
819 Ga0496101_0000800 3300048904 Bacteria 18616
820 Ga0496101_0001253 3300048904 Bacteria 15192
821 Ga0496101_0001810 3300048904 Bacteria 12876
822 Ga0496101_0035739 3300048904 Bacteria 3515
823 Ga0496102_0002101 3300048905 Bacteria 17126
824 Ga0496102_0023824 3300048905 Bacteria 5439
825 Ga0496102_0167895 3300048905 Bacteria 2065
826 Ga0496102_0196536 3300048905 Bacteria 1901
827 Ga0496103_0003368 3300048906 Bacteria 9769
828 Ga0496103_0004504 3300048906 Bacteria 8442
829 Ga0496103_0005932 3300048906 Bacteria 7302
830 Ga0496103_0017251 3300048906 Bacteria 4318
831 Ga0496103_0019471 3300048906 Bacteria 4077
832 Ga0496103_0063198 3300048906 Bacteria 2305
833 Ga0496104_0000055 3300048907 Bacteria 124267
834 Ga0496104_0001184 3300048907 Bacteria 22438
835 Ga0496104_0003351 3300048907 Bacteria 13834
836 Ga0496104_0017343 3300048907 Bacteria 6554
837 Ga0496104_0023547 3300048907 Bacteria 5662
838 Ga0496104_0033443 3300048907 Bacteria 4789
839 Ga0496104_0043386 3300048907 Bacteria 4224
840 Ga0496104_0056436 3300048907 Bacteria 3714
841 Ga0496104_0081672 3300048907 Bacteria 3082
842 Ga0496104_0099014 3300048907 Bacteria 2791
843 Ga0496104_0158430 3300048907 Bacteria 2172
844 Ga0496105_0000918 3300048908 Bacteria 20094
845 Ga0496105_0004894 3300048908 Bacteria 10124
846 Ga0496105_0010872 3300048908 Bacteria 7166
847 Ga0496105_0015814 3300048908 Bacteria 6019
848 Ga0496105_0027859 3300048908 Bacteria 4619
849 Ga0496105_0168117 3300048908 Bacteria 1798
850 Ga0496106_0000317 3300048909 Bacteria 33879
851 Ga0496106_0013398 3300048909 Bacteria 6054
852 Ga0496106_0023257 3300048909 Bacteria 4604
853 Ga0496106_0031823 3300048909 Bacteria 3931
854 Ga0496106_0039870 3300048909 Bacteria 3517
855 Ga0496107_0000272 3300048910 Bacteria 27458
856 Ga0496107_0011403 3300048910 Bacteria 6190
857 Ga0496107_0015091 3300048910 Bacteria 5412
858 Ga0496107_0024456 3300048910 Bacteria 4272
859 Ga0496107_0038665 3300048910 Bacteria 3421
860 Ga0496107_0069882 3300048910 Bacteria 2549
861 Ga0496107_0150840 3300048910 Bacteria 1719
862 Ga0496108_0000333 3300048911 Bacteria 39976
863 Ga0496108_0002477 3300048911 Bacteria 14777
864 Ga0496108_0015151 3300048911 Bacteria 6290
865 Ga0496108_0041814 3300048911 Bacteria 3827
866 Ga0496108_0043056 3300048911 Bacteria 3770
867 Ga0496108_0086804 3300048911 Bacteria 2656
868 Ga0496108_0092288 3300048911 Bacteria 2574
869 Ga0496109_0000812 3300048912 Bacteria 26052
870 Ga0496109_0005773 3300048912 Bacteria 10358
871 Ga0496109_0018601 3300048912 Bacteria 6104
872 Ga0496109_0022601 3300048912 Bacteria 5571
873 Ga0496109_0027809 3300048912 Bacteria 5053
874 Ga0496109_0036508 3300048912 Bacteria 4436
875 Ga0496109_0051967 3300048912 Bacteria 3733
876 Ga0496109_0091894 3300048912 Bacteria 2807
877 Ga0496110_0004023 3300048913 Bacteria 11334
878 Ga0496110_0028476 3300048913 Bacteria 4798
879 Ga0496110_0029025 3300048913 Bacteria 4755
880 Ga0496110_0057529 3300048913 Bacteria 3423
881 Ga0496110_0076083 3300048913 Bacteria 2984
882 Ga0496110_0086278 3300048913 Bacteria 2802
883 Ga0496110_0232298 3300048913 Bacteria 1677
884 Ga0496111_0001052 3300048914 Bacteria 15204
885 Ga0496111_0005383 3300048914 Bacteria 8190
886 Ga0496111_0006334 3300048914 Bacteria 7673
887 Ga0496111_0011787 3300048914 Bacteria 5903
888 Ga0496111_0020826 3300048914 Bacteria 4571
889 Ga0496112_0000838 3300048915 Bacteria 21919
890 Ga0496112_0002948 3300048915 Bacteria 13879
891 Ga0496112_0084814 3300048915 Bacteria 3134
892 Ga0496112_0134520 3300048915 Bacteria 2443
893 Ga0496113_0000693 3300048916 Bacteria 17195
894 Ga0496113_0002078 3300048916 Bacteria 11521
895 Ga0496113_0016912 3300048916 Bacteria 5049
896 Ga0496113_0020421 3300048916 Bacteria 4656
897 Ga0496113_0023896 3300048916 Bacteria 4339
898 Ga0496113_0034483 3300048916 Bacteria 3692
899 Ga0496113_0159288 3300048916 Bacteria 1784
900 Ga0496114_0003697 3300048917 Bacteria 11773
901 Ga0496114_0009608 3300048917 Bacteria 7682
902 Ga0496114_0011582 3300048917 Bacteria 7048
903 Ga0496114_0011924 3300048917 Bacteria 6955
904 Ga0496114_0026852 3300048917 Bacteria 4717
905 Ga0496115_0008581 3300048918 Bacteria 7564
906 Ga0496115_0026529 3300048918 Bacteria 4522
907 Ga0496115_0029394 3300048918 Bacteria 4316
908 Ga0496115_0045335 3300048918 Bacteria 3509
909 Ga0496115_0084107 3300048918 Bacteria 2594
910 Ga0496115_0149071 3300048918 Bacteria 1931
911 Ga0496117_0069747 3300048920 Bacteria 2365
912 Ga0496123_0077248 3300048926 Bacteria 2045
913 Ga0501032_0009993 3300049569 Bacteria 6853
914 Ga0501032_0062656 3300049569 Bacteria 2491
915 Ga0501033_0023629 3300049570 Bacteria 4636
916 Ga0501033_0098467 3300049570 Bacteria 2135
917 Ga0501034_0000197 3300049571 Bacteria 114088
918 Ga0501034_0001247 3300049571 Bacteria 34598
919 Ga0501034_0001484 3300049571 Bacteria 30939
920 Ga0501034_0009010 3300049571 Bacteria 10481
921 Ga0501034_0022549 3300049571 Bacteria 6416
922 Ga0501034_0030744 3300049571 Bacteria 5457
923 Ga0501034_0048161 3300049571 Bacteria 4302
924 Ga0501034_0071341 3300049571 Bacteria 3483
925 Ga0501034_0072575 3300049571 Bacteria 3450
926 Ga0501034_0149834 3300049571 Bacteria 2309
927 Ga0501034_0174344 3300049571 Bacteria 2117
928 Ga0501034_0185427 3300049571 Bacteria 2044
929 Ga0501034_0210554 3300049571 Bacteria 1899
930 Ga0501036_0005919 3300049572 Bacteria 9907
931 Ga0501036_0014217 3300049572 Bacteria 6622
932 Ga0501036_0023090 3300049572 Bacteria 5235
933 Ga0501036_0024606 3300049572 Bacteria 5077
934 Ga0501036_0055574 3300049572 Bacteria 3354
935 Ga0501037_0007042 3300049573 Bacteria 8212
936 Ga0501037_0012566 3300049573 Bacteria 6238
937 Ga0501037_0026037 3300049573 Bacteria 4322
938 Ga0501037_0053216 3300049573 Bacteria 2961
939 Ga0501037_0105255 3300049573 Bacteria 2033
940 Ga0501038_0007088 3300049574 Bacteria 10352
941 Ga0501038_0008817 3300049574 Bacteria 9250
942 Ga0501038_0022499 3300049574 Bacteria 5647
943 Ga0501038_0037071 3300049574 Bacteria 4277
944 Ga0501038_0084138 3300049574 Bacteria 2677
945 Ga0501039_0013196 3300049575 Bacteria 6314
946 Ga0501039_0068437 3300049575 Bacteria 2757
947 Ga0501040_0005271 3300049576 Bacteria 8359
948 Ga0501040_0050270 3300049576 Bacteria 2851
949 Ga0501041_0033375 3300049577 Bacteria 3114
950 Ga0501041_0039968 3300049577 Bacteria 2847
951 Ga0501042_0009123 3300049578 Bacteria 6594
952 Ga0501042_0035498 3300049578 Bacteria 3537
953 Ga0501043_0006297 3300049579 Bacteria 9530
954 Ga0501043_0015583 3300049579 Bacteria 5957
955 Ga0501043_0015624 3300049579 Bacteria 5952
956 Ga0501043_0032179 3300049579 Bacteria 4122
957 Ga0501043_0135173 3300049579 Bacteria 1932
958 Ga0501046_0025250 3300049580 Bacteria 4864
959 Ga0501046_0032639 3300049580 Bacteria 4215
960 Ga0501046_0162587 3300049580 Bacteria 1678
961 Ga0501047_0001499 3300049581 Bacteria 22761
962 Ga0501047_0022488 3300049581 Bacteria 6055
963 Ga0501047_0046860 3300049581 Bacteria 4176
964 Ga0501047_0126099 3300049581 Bacteria 2440
965 Ga0501047_0144977 3300049581 Bacteria 2252
966 Ga0501048_0000856 3300049582 Bacteria 22438
967 Ga0501048_0005853 3300049582 Bacteria 9350
968 Ga0501067_0015236 3300049583 Bacteria 4257
969 Ga0501067_0015989 3300049583 Bacteria 4151
970 Ga0501068_0003005 3300049584 Bacteria 8989
971 Ga0501068_0010125 3300049584 Bacteria 5290
972 Ga0501068_0040713 3300049584 Bacteria 2790
973 Ga0501069_0001041 3300049585 Bacteria 13260
974 Ga0501070_0005480 3300049586 Bacteria 10830
975 Ga0501070_0009844 3300049586 Bacteria 8083
976 Ga0501070_0018733 3300049586 Bacteria 5808
977 Ga0501070_0023917 3300049586 Bacteria 5119
978 Ga0501070_0031183 3300049586 Bacteria 4466
979 Ga0501070_0034636 3300049586 Bacteria 4220
980 Ga0501070_0090512 3300049586 Bacteria 2532
981 Ga0501070_0111438 3300049586 Bacteria 2262
982 Ga0501071_0021040 3300049587 Bacteria 4541
983 Ga0501071_0076439 3300049587 Bacteria 2446
984 Ga0501072_0011866 3300049588 Bacteria 6656
985 Ga0501072_0031660 3300049588 Bacteria 4143
986 Ga0501072_0032646 3300049588 Bacteria 4078
987 Ga0501072_0032742 3300049588 Bacteria 4071
988 Ga0501072_0041202 3300049588 Bacteria 3627
989 Ga0501072_0112278 3300049588 Bacteria 2170
990 Ga0501073_0021662 3300049589 Bacteria 4630
991 Ga0501073_0055594 3300049589 Bacteria 2769
992 Ga0501074_0022407 3300049590 Bacteria 4588
993 Ga0501074_0059241 3300049590 Bacteria 2759
994 Ga0501075_0015464 3300049591 Bacteria 5477
995 Ga0501075_0074712 3300049591 Bacteria 2564
996 Ga0501076_0006991 3300049592 Bacteria 8199
997 Ga0501076_0032446 3300049592 Bacteria 4076
998 Ga0501076_0042538 3300049592 Bacteria 3577
999 Ga0501076_0124488 3300049592 Bacteria 2088
1000 Ga0501077_0022260 3300049593 Bacteria 4015
1001 Ga0501077_0070230 3300049593 Bacteria 2220
1002 Ga0501077_0070722 3300049593 Bacteria 2211
1003 Ga0501079_0013648 3300049741 Bacteria 6195
1004 Ga0501079_0034801 3300049741 Bacteria 3876
1005 Ga0501079_0038466 3300049741 Bacteria 3689
1006 Ga0501079_0063709 3300049741 Bacteria 2844
1007 Ga0501079_0067352 3300049741 Bacteria 2763
1008 Ga0501079_0126523 3300049741 Bacteria 1988
1009 Ga0501080_0053915 3300049742 Bacteria 3745
1010 Ga0501080_0059890 3300049742 Bacteria 3543
1011 Ga0501080_0082526 3300049742 Bacteria 2985
1012 Ga0501080_0084847 3300049742 Bacteria 2943
1013 Ga0501080_0205923 3300049742 Bacteria 1804
1014 Ga0501080_0216580 3300049742 Bacteria 1753
1015 Ga0501081_0006174 3300049743 Bacteria 7760
1016 Ga0501081_0008015 3300049743 Bacteria 6855
1017 Ga0501081_0027992 3300049743 Bacteria 3801
1018 Ga0501081_0038505 3300049743 Bacteria 3267
1019 Ga0501083_0017096 3300049744 Bacteria 5061
1020 Ga0501083_0022117 3300049744 Bacteria 4413
1021 Ga0501083_0064214 3300049744 Bacteria 2447
1022 Ga0501083_0095636 3300049744 Bacteria 1960
1023 Ga0501083_0103568 3300049744 Bacteria 1875
1024 Ga0501035_0003255 3300049822 Bacteria 15561
1025 Ga0501035_0042607 3300049822 Bacteria 4094
1026 Ga0501035_0058650 3300049822 Bacteria 3429
1027 Ga0501035_0081216 3300049822 Bacteria 2861
1028 Ga0501044_0000708 3300049823 Bacteria 40261
1029 Ga0501044_0003448 3300049823 Bacteria 17811
1030 Ga0501044_0023822 3300049823 Bacteria 6506
1031 Ga0501044_0138283 3300049823 Bacteria 2425
1032 Ga0501044_0211490 3300049823 Bacteria 1893
1033 Ga0501044_0229647 3300049823 Bacteria 1804
1034 Ga0501045_0031096 3300049824 Bacteria 3866
1035 Ga0501045_0116135 3300049824 Bacteria 1986
1036 Ga0501045_0164173 3300049824 Bacteria 1653
1037 nmdc:mga03683_8170_c2 3300050489 Bacteria 3085
1038 nmdc:mga00v17_17587_c1 3300050491 Bacteria 4050
1039 nmdc:mga0yw44_24491_c1 3300050492 Bacteria 3416
1040 nmdc:mga0yw44_36543_c1 3300050492 Bacteria 2895
1041 nmdc:mga0yw44_6036_c1 3300050492 Bacteria 5803
1042 nmdc:mga06z11_27068_c1 3300050494 Bacteria 2738
1043 nmdc:mga06z11_56833_c1 3300050494 Bacteria 2025
1044 nmdc:mga07m45_15749_c1 3300050496 Bacteria 4040
1045 nmdc:mga07m45_79108_c1 3300050496 Bacteria 1876
1046 nmdc:mga05p37_178457_c1 3300050507 Bacteria 2586
1047 nmdc:mga05p37_187410_c1 3300050507 Bacteria 2515
1048 nmdc:mga05p37_335814_c1 3300050507 Bacteria 1783
1049 nmdc:mga05p37_39331_c1 3300050507 Bacteria 5806
1050 nmdc:mga05p37_6218_c1 3300050507 Bacteria 14054
1051 nmdc:mga05p37_675_c1 3300050507 Bacteria 37726
1052 nmdc:mga05p37_9875_c1 3300050507 Bacteria 11327
1053 nmdc:mga09592_11427_c1 3300050508 Bacteria 7221
1054 nmdc:mga09592_12884_c1 3300050508 Bacteria 6819
1055 nmdc:mga0qj67_229_c1 3300050509 Bacteria 38215
1056 nmdc:mga0qj67_267_c1 3300050509 Bacteria 35925
1057 nmdc:mga0qj67_41899_c1 3300050509 Bacteria 3603
1058 nmdc:mga0qj67_82604_c1 3300050509 Bacteria 2576
1059 nmdc:mga06r32_122772_c1 3300050510 Bacteria 2563
1060 nmdc:mga06r32_147605_c1 3300050510 Bacteria 2329
1061 nmdc:mga06r32_21208_c1 3300050510 Bacteria 5996
1062 nmdc:mga06r32_36012_c1 3300050510 Bacteria 4673
1063 nmdc:mga06r32_4977_c1 3300050510 Bacteria 11971
1064 nmdc:mga06r32_64_c1 3300050510 Bacteria 67984
1065 nmdc:mga08y16_1152_c1 3300050511 Bacteria 26044
1066 nmdc:mga08y16_148802_c1 3300050511 Bacteria 2434
1067 nmdc:mga08y16_6860_c1 3300050511 Bacteria 11941
1068 nmdc:mga08y16_8101_c1 3300050511 Bacteria 10988
1069 nmdc:mga08y16_906_c1 3300050511 Bacteria 28665
1070 nmdc:mga0n895_14204_c1 3300050512 Bacteria 7222
1071 nmdc:mga0n895_24792_c1 3300050512 Bacteria 5658
1072 nmdc:mga0n895_2947_c1 3300050512 Bacteria 13508
1073 nmdc:mga0n895_3362_c1 3300050512 Bacteria 12865
1074 nmdc:mga0n895_55579_c1 3300050512 Bacteria 3896
1075 nmdc:mga0n895_73_c1 3300050512 Bacteria 57709
1076 nmdc:mga0n895_9100_c1 3300050512 Bacteria 8666
1077 nmdc:mga0rr50_138021_c1 3300050513 Bacteria 1959
1078 nmdc:mga0rr50_747_c1 3300050513 Bacteria 14216
1079 nmdc:mga08x19_66_c1 3300050514 Bacteria 105609
1080 nmdc:mga0a205_16585_c1 3300050515 Bacteria 6900
1081 nmdc:mga0a205_214946_c1 3300050515 Bacteria 1810
1082 nmdc:mga0a205_29219_c1 3300050515 Bacteria 5275
1083 nmdc:mga0a205_30916_c1 3300050515 Bacteria 5129
1084 nmdc:mga0a205_4115_c1 3300050515 Bacteria 13018
1085 nmdc:mga0a205_59_c1 3300050515 Bacteria 60447
1086 nmdc:mga0sz30_3395_c1 3300050516 Bacteria 5732
1087 Ga0495601_0000018 3300053077 Bacteria 171665
1088 Ga0495601_0000357 3300053077 Bacteria 23996
1089 Ga0495601_0000555 3300053077 Bacteria 19790
1090 Ga0495601_0022810 3300053077 Bacteria 3845
1091 Ga0495612_0000011 3300053078 Bacteria 224729
1092 Ga0495612_0000539 3300053078 Bacteria 15250
1093 Ga0495612_0014087 3300053078 Bacteria 3219
1094 Ga0495612_0016752 3300053078 Bacteria 2935
1095 Ga0495612_0027133 3300053078 Bacteria 2302
1096 Ga0495655_0000451 3300053083 Bacteria 6920
1097 Ga0495595_0000016 3300053084 Bacteria 134329
1098 Ga0495595_0000939 3300053084 Bacteria 11212
1099 Ga0495595_0001313 3300053084 Bacteria 9655
1100 Ga0495595_0002410 3300053084 Bacteria 7299
1101 Ga0495595_0019761 3300053084 Bacteria 2926
1102 Ga0495595_0069748 3300053084 Bacteria 1660
1103 Ga0495619_0000014 3300053085 Bacteria 261449
1104 Ga0495619_0000085 3300053085 Bacteria 70073
1105 Ga0495619_0000380 3300053085 Bacteria 30640
1106 Ga0495619_0000636 3300053085 Bacteria 23148
1107 Ga0495619_0002427 3300053085 Bacteria 12237
1108 Ga0495619_0003404 3300053085 Bacteria 10276
1109 Ga0495619_0009386 3300053085 Bacteria 6172
1110 Ga0495619_0064422 3300053085 Bacteria 2443
1111 Ga0500651_0053147 3300053093 Bacteria 2540
1112 Ga0500641_0000932 3300053096 Bacteria 10439
1113 Ga0500641_0002842 3300053096 Bacteria 6135
1114 Ga0500641_0008319 3300053096 Bacteria 3699
1115 Ga0500595_000024 3300053119 Bacteria 144160
1116 Ga0500616_0000458 3300053153 Bacteria 53402
1117 Ga0500645_000874 3300053730 Bacteria 17538
1118 Ga0501084_0038702 3300054114 Bacteria 3987
1119 Ga0501084_0232500 3300054114 Bacteria 1556
1120 Ga0501082_0004773 3300060353 Bacteria 11829
1121 Ga0501082_0011414 3300060353 Bacteria 7644
1122 Ga0501082_0044248 3300060353 Bacteria 3840
1123 Ga0530510_0029715 3300061734 Bacteria 3923
1124 Ga0530510_0036852 3300061734 Bacteria 3524
1125 Ga0530510_0064081 3300061734 Bacteria 2662
1126 Ga0530510_0080846 3300061734 Bacteria 2365

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047317 Ga0495604_0162420 Ga0495604_0162420_260_1567 435
2 3300048915 Ga0496112_0134520 Ga0496112_0134520_27_1334 435
3 3300048089 Ga0495614_0024776 Ga0495614_0024776_1258_2580 440
4 3300054114 Ga0501084_0232500 Ga0501084_0232500_220_1545 441
5 iso_pu_bacteria 2841760612 2841760930 448
6 iso_pu_bacteria 2844104063 2844106587 448
7 iso_pu_bacteria 2851182111 2851183739 448
8 iso_pu_bacteria 2851246043 2851246943 448
9 3300005459 Ga0068867_100131739 Ga0068867_1001317392 449
10 3300048909 Ga0496106_0031823 Ga0496106_0031823_784_2133 449
11 3300049571 Ga0501034_0149834 Ga0501034_0149834_932_2293 453
12 3300036401 Ga0373937_0075764 Ga0373937_0075764_267_1673 454
13 3300037068 Ga0373925_0007514 Ga0373925_0007514_494_1900 454
14 3300046455 Ga0495603_0002046 Ga0495603_0002046_4711_6117 454
15 3300046472 Ga0495580_0012176 Ga0495580_0012176_3437_4843 454
16 3300046473 Ga0495582_0002161 Ga0495582_0002161_2753_4159 454
17 3300046499 Ga0495594_0004109 Ga0495594_0004109_5866_7272 454
18 3300046531 Ga0495665_0047533 Ga0495665_0047533_98_1504 454
19 3300046557 Ga0495622_0006154 Ga0495622_0006154_115_1521 454
20 3300046674 Ga0495588_0010900 Ga0495588_0010900_675_2081 454
21 3300046683 Ga0495658_0006650 Ga0495658_0006650_16_1422 454
22 3300046689 Ga0495613_0003637 Ga0495613_0003637_5740_7146 454
23 3300047322 Ga0495680_0007696 Ga0495680_0007696_4680_6086 454
24 3300047673 Ga0495593_0000759 Ga0495593_0000759_10283_11689 454
25 3300048089 Ga0495614_0018347 Ga0495614_0018347_1171_2577 454
26 3300053085 Ga0495619_0003404 Ga0495619_0003404_5433_6839 454
27 3300031247 Ga0265340_10004313 Ga0265340_100043134 455
28 3300031249 Ga0265339_10001612 Ga0265339_1000161212 455
29 3300031595 Ga0265313_10001147 Ga0265313_100011474 455
30 3300031712 Ga0265342_10017720 Ga0265342_100177202 455
31 3300005336 Ga0070680_100089192 Ga0070680_1000891922 456
32 3300048907 Ga0496104_0158430 Ga0496104_0158430_521_1927 457
33 3300048909 Ga0496106_0039870 Ga0496106_0039870_32_1438 457
34 3300048916 Ga0496113_0159288 Ga0496113_0159288_190_1596 457
35 3300049587 Ga0501071_0076439 Ga0501071_0076439_530_1945 458
36 3300049588 Ga0501072_0112278 Ga0501072_0112278_634_2049 458
37 3300005439 Ga0070711_100193408 Ga0070711_1001934081 461
38 3300006847 Ga0075431_100248972 Ga0075431_1002489721 461
39 3300036401 Ga0373937_0011521 Ga0373937_0011521_3018_4448 461
40 3300053084 Ga0495595_0069748 Ga0495595_0069748_86_1576 461
41 3300061734 Ga0530510_0080846 Ga0530510_0080846_41_1465 461
42 iso_pu_bacteria 2508501114 2509077924 462
43 iso_pu_bacteria 2775506901 2776258787 462
44 iso_pu_bacteria 2835312727 2835312888 462
45 iso_pu_bacteria 2882456835 2882457992 462
46 iso_pu_bacteria 2894232714 2894242386 462
47 3300005290 Ga0065712_10008755 Ga0065712_100087551 463
48 3300005333 Ga0070677_10006029 Ga0070677_100060291 463
49 3300005340 Ga0070689_100104060 Ga0070689_1001040602 463
50 3300005543 Ga0070672_100096548 Ga0070672_1000965482 463
51 3300005937 Ga0081455_10003484 Ga0081455_100034845 463
52 3300005983 Ga0081540_1000925 Ga0081540_10009258 463
53 3300006846 Ga0075430_100068023 Ga0075430_1000680232 463
54 3300006847 Ga0075431_100072901 Ga0075431_1000729014 463
55 3300009098 Ga0105245_10178269 Ga0105245_101782691 463
56 3300009101 Ga0105247_10026146 Ga0105247_100261463 463
57 3300014326 Ga0157380_10117233 Ga0157380_101172332 463
58 3300014969 Ga0157376_10148915 Ga0157376_101489152 463
59 3300017792 Ga0163161_10140989 Ga0163161_101409891 463
60 3300025302 Ga0207426_1023081 Ga0207426_10230812 463
61 3300025893 Ga0207682_10000637 Ga0207682_1000063716 463
62 3300025918 Ga0207662_10107287 Ga0207662_101072872 463
63 3300025936 Ga0207670_10076952 Ga0207670_100769523 463
64 3300025937 Ga0207669_10004690 Ga0207669_100046903 463
65 3300025940 Ga0207691_10012219 Ga0207691_100122196 463
66 3300025986 Ga0207658_10062170 Ga0207658_100621702 463
67 3300026089 Ga0207648_10015227 Ga0207648_100152277 463
68 3300026118 Ga0207675_100053176 Ga0207675_1000531764 463
69 3300026121 Ga0207683_10003008 Ga0207683_100030082 463
70 3300027717 Ga0209998_10008001 Ga0209998_100080012 463
71 3300046507 Ga0495606_0005478 Ga0495606_0005478_6507_7907 463
72 3300046537 Ga0495598_0001760 Ga0495598_0001760_517_1914 463
73 3300049575 Ga0501039_0013196 Ga0501039_0013196_925_2325 463
74 3300049576 Ga0501040_0050270 Ga0501040_0050270_1429_2829 463
75 3300049577 Ga0501041_0033375 Ga0501041_0033375_1115_2515 463
76 3300049588 Ga0501072_0032646 Ga0501072_0032646_2173_3573 463
77 3300049592 Ga0501076_0032446 Ga0501076_0032446_1702_3102 463
78 3300049592 Ga0501076_0124488 Ga0501076_0124488_596_2002 463
79 3300049741 Ga0501079_0067352 Ga0501079_0067352_493_1893 463
80 3300049743 Ga0501081_0038505 Ga0501081_0038505_1336_2736 463
81 3300049824 Ga0501045_0164173 Ga0501045_0164173_25_1431 463
82 3300050509 nmdc:mga0qj67_41899_c1 nmdc:mga0qj67_41899_c1_211_1611 463
83 3300061734 Ga0530510_0029715 Ga0530510_0029715_1567_2967 463
84 iso_pu_bacteria 2513237087 2513590344 463
85 iso_pu_bacteria 3003665799 3003670267 463
86 3300005347 Ga0070668_100094048 Ga0070668_1000940482 464
87 3300005985 Ga0081539_10002542 Ga0081539_100025424 464
88 3300006178 Ga0075367_10012684 Ga0075367_100126842 464
89 3300006237 Ga0097621_100025145 Ga0097621_1000251453 464
90 3300009148 Ga0105243_10216149 Ga0105243_102161492 464
91 3300021384 Ga0213876_10070589 Ga0213876_100705891 464
92 3300025915 Ga0207693_10040965 Ga0207693_100409652 464
93 3300025986 Ga0207658_10080747 Ga0207658_100807472 464
94 3300032005 Ga0307411_10103866 Ga0307411_101038662 464
95 3300039437 Ga0436365_1231055 Ga0436365_1231055_1161_2555 464
96 3300048907 Ga0496104_0099014 Ga0496104_0099014_294_1706 464
97 iso_pu_bacteria 2545555834 2545673131 464
98 iso_pu_bacteria 2773857925 2774870261 464
99 iso_pu_bacteria 641522639 641642265 464
100 3300005981 Ga0081538_10000638 Ga0081538_1000063823 465
101 3300009094 Ga0111539_10025137 Ga0111539_100251375 465
102 3300037312 Ga0395899_0141107 Ga0395899_0141107_191_1588 465
103 3300037418 Ga0395900_0007587 Ga0395900_0007587_3006_4403 465
104 3300037466 Ga0395898_0028469 Ga0395898_0028469_149_1546 465
105 3300037466 Ga0395898_0061182 Ga0395898_0061182_640_2037 465
106 3300037466 Ga0395898_0108979 Ga0395898_0108979_607_2004 465
107 3300038443 Ga0395901_0173895 Ga0395901_0173895_819_2216 465
108 3300046533 Ga0495640_0066862 Ga0495640_0066862_383_1798 465
109 3300053083 Ga0495655_0000451 Ga0495655_0000451_639_2048 465
110 3300005327 Ga0070658_10001206 Ga0070658_100012063 466
111 3300005336 Ga0070680_100008076 Ga0070680_1000080768 466
112 3300005353 Ga0070669_100177205 Ga0070669_1001772051 466
113 3300005458 Ga0070681_10085943 Ga0070681_100859432 466
114 3300005467 Ga0070706_100034715 Ga0070706_1000347155 466
115 3300005471 Ga0070698_100001178 Ga0070698_1000011783 466
116 3300005535 Ga0070684_100141498 Ga0070684_1001414982 466
117 3300005536 Ga0070697_100104754 Ga0070697_1001047542 466
118 3300005981 Ga0081538_10071988 Ga0081538_100719882 466
119 3300005985 Ga0081539_10002695 Ga0081539_1000269524 466
120 3300006177 Ga0075362_10014565 Ga0075362_100145652 466
121 3300006177 Ga0075362_10019606 Ga0075362_100196062 466
122 3300006178 Ga0075367_10088361 Ga0075367_100883612 466
123 3300006353 Ga0075370_10009286 Ga0075370_100092861 466
124 3300010375 Ga0105239_10110589 Ga0105239_101105892 466
125 3300011119 Ga0105246_10082067 Ga0105246_100820671 466
126 3300013105 Ga0157369_10048634 Ga0157369_100486344 466
127 3300013308 Ga0157375_10011822 Ga0157375_100118222 466
128 3300021384 Ga0213876_10001399 Ga0213876_100013993 466
129 3300025912 Ga0207707_10010884 Ga0207707_100108844 466
130 3300025919 Ga0207657_10039151 Ga0207657_100391513 466
131 3300025949 Ga0207667_10098381 Ga0207667_100983812 466
132 3300025949 Ga0207667_10267315 Ga0207667_102673152 466
133 3300025972 Ga0207668_10011937 Ga0207668_100119373 466
134 3300026116 Ga0207674_10116617 Ga0207674_101166173 466
135 3300026121 Ga0207683_10045434 Ga0207683_100454341 466
136 3300028379 Ga0268266_10024665 Ga0268266_100246651 466
137 3300028380 Ga0268265_10226512 Ga0268265_102265121 466
138 3300037068 Ga0373925_0036449 Ga0373925_0036449_159_1562 466
139 3300037312 Ga0395899_0078953 Ga0395899_0078953_466_1869 466
140 3300037418 Ga0395900_0023602 Ga0395900_0023602_4537_5940 466
141 3300037418 Ga0395900_0093408 Ga0395900_0093408_1012_2415 466
142 3300037466 Ga0395898_0006512 Ga0395898_0006512_6462_7865 466
143 3300038443 Ga0395901_0005082 Ga0395901_0005082_11331_12734 466
144 3300038443 Ga0395901_0010709 Ga0395901_0010709_4431_5846 466
145 3300038443 Ga0395901_0018368 Ga0395901_0018368_173_1576 466
146 3300039447 Ga0436361_0377742 Ga0436361_0377742_327_1754 466
147 3300039450 Ga0436363_0874280 Ga0436363_0874280_2825_4252 466
148 3300044694 Ga0466963_0148797 Ga0466963_0148797_46_1452 466
149 3300044842 Ga0466957_0051372 Ga0466957_0051372_352_1758 466
150 3300046499 Ga0495594_0120822 Ga0495594_0120822_53_1456 466
151 3300048903 Ga0496100_0001217 Ga0496100_0001217_230_1645 466
152 3300048905 Ga0496102_0023824 Ga0496102_0023824_1426_2841 466
153 3300048906 Ga0496103_0005932 Ga0496103_0005932_5784_7199 466
154 3300048907 Ga0496104_0033443 Ga0496104_0033443_1136_2551 466
155 3300048908 Ga0496105_0168117 Ga0496105_0168117_199_1614 466
156 3300048910 Ga0496107_0000272 Ga0496107_0000272_18596_20011 466
157 3300048910 Ga0496107_0011403 Ga0496107_0011403_3478_4890 466
158 3300048911 Ga0496108_0015151 Ga0496108_0015151_3910_5325 466
159 3300048912 Ga0496109_0027809 Ga0496109_0027809_3126_4541 466
160 3300048913 Ga0496110_0028476 Ga0496110_0028476_2250_3665 466
161 3300048913 Ga0496110_0029025 Ga0496110_0029025_2250_3665 466
162 3300048914 Ga0496111_0006334 Ga0496111_0006334_1091_2506 466
163 3300048915 Ga0496112_0084814 Ga0496112_0084814_1523_2938 466
164 3300048916 Ga0496113_0020421 Ga0496113_0020421_2477_3892 466
165 3300048917 Ga0496114_0026852 Ga0496114_0026852_2569_3984 466
166 3300049569 Ga0501032_0062656 Ga0501032_0062656_749_2230 466
167 3300049570 Ga0501033_0098467 Ga0501033_0098467_573_2054 466
168 3300049571 Ga0501034_0000197 Ga0501034_0000197_24554_25954 466
169 3300049571 Ga0501034_0001247 Ga0501034_0001247_20792_22201 466
170 3300049571 Ga0501034_0001484 Ga0501034_0001484_19321_20736 466
171 3300049571 Ga0501034_0030744 Ga0501034_0030744_1378_2946 466
172 3300049571 Ga0501034_0072575 Ga0501034_0072575_620_2101 466
173 3300049571 Ga0501034_0185427 Ga0501034_0185427_465_1868 466
174 3300049572 Ga0501036_0005919 Ga0501036_0005919_2463_3872 466
175 3300049572 Ga0501036_0023090 Ga0501036_0023090_1776_3344 466
176 3300049572 Ga0501036_0024606 Ga0501036_0024606_2848_4329 466
177 3300049573 Ga0501037_0007042 Ga0501037_0007042_3022_4431 466
178 3300049573 Ga0501037_0026037 Ga0501037_0026037_2172_3740 466
179 3300049573 Ga0501037_0105255 Ga0501037_0105255_160_1641 466
180 3300049574 Ga0501038_0007088 Ga0501038_0007088_1764_3332 466
181 3300049574 Ga0501038_0037071 Ga0501038_0037071_1222_2703 466
182 3300049575 Ga0501039_0068437 Ga0501039_0068437_670_2079 466
183 3300049579 Ga0501043_0015583 Ga0501043_0015583_2325_3893 466
184 3300049579 Ga0501043_0015624 Ga0501043_0015624_4369_5769 466
185 3300049579 Ga0501043_0032179 Ga0501043_0032179_2510_3919 466
186 3300049580 Ga0501046_0032639 Ga0501046_0032639_2198_3766 466
187 3300049580 Ga0501046_0162587 Ga0501046_0162587_41_1441 466
188 3300049581 Ga0501047_0001499 Ga0501047_0001499_18772_20181 466
189 3300049581 Ga0501047_0022488 Ga0501047_0022488_744_2312 466
190 3300049582 Ga0501048_0000856 Ga0501048_0000856_4158_5567 466
191 3300049583 Ga0501067_0015236 Ga0501067_0015236_1543_2949 466
192 3300049584 Ga0501068_0003005 Ga0501068_0003005_5266_6747 466
193 3300049584 Ga0501068_0010125 Ga0501068_0010125_34_1449 466
194 3300049586 Ga0501070_0005480 Ga0501070_0005480_7241_8650 466
195 3300049586 Ga0501070_0018733 Ga0501070_0018733_85_1653 466
196 3300049589 Ga0501073_0055594 Ga0501073_0055594_450_1859 466
197 3300049590 Ga0501074_0022407 Ga0501074_0022407_2470_3951 466
198 3300049741 Ga0501079_0038466 Ga0501079_0038466_622_2103 466
199 3300049742 Ga0501080_0082526 Ga0501080_0082526_455_2023 466
200 3300049744 Ga0501083_0022117 Ga0501083_0022117_2244_3653 466
201 3300049822 Ga0501035_0058650 Ga0501035_0058650_107_1507 466
202 3300049822 Ga0501035_0081216 Ga0501035_0081216_159_1640 466
203 3300049823 Ga0501044_0003448 Ga0501044_0003448_5643_7052 466
204 3300049823 Ga0501044_0211490 Ga0501044_0211490_366_1766 466
205 3300049824 Ga0501045_0116135 Ga0501045_0116135_227_1633 466
206 3300050489 nmdc:mga03683_8170_c2 nmdc:mga03683_8170_c2_381_1784 466
207 3300050492 nmdc:mga0yw44_36543_c1 nmdc:mga0yw44_36543_c1_1221_2627 466
208 3300050494 nmdc:mga06z11_27068_c1 nmdc:mga06z11_27068_c1_1305_2711 466
209 3300050494 nmdc:mga06z11_56833_c1 nmdc:mga06z11_56833_c1_135_1538 466
210 3300050496 nmdc:mga07m45_15749_c1 nmdc:mga07m45_15749_c1_1167_2570 466
211 3300050516 nmdc:mga0sz30_3395_c1 nmdc:mga0sz30_3395_c1_2801_4204 466
212 3300053093 Ga0500651_0053147 Ga0500651_0053147_277_1680 466
213 3300053096 Ga0500641_0002842 Ga0500641_0002842_3684_5090 466
214 iso_pu_bacteria 2643221547 2643755202 466
215 iso_pu_bacteria 2643221734 2644735000 466
216 iso_pu_bacteria 2818991467 2819719552 466
217 iso_pu_bacteria 2917699015 2917704791 466
218 3300005546 Ga0070696_100007358 Ga0070696_1000073582 467
219 3300005549 Ga0070704_100031373 Ga0070704_1000313735 467
220 3300005577 Ga0068857_100054713 Ga0068857_1000547132 467
221 3300005617 Ga0068859_100037505 Ga0068859_1000375052 467
222 3300005618 Ga0068864_100083229 Ga0068864_1000832292 467
223 3300006175 Ga0070712_100054255 Ga0070712_1000542552 467
224 3300006358 Ga0068871_100174820 Ga0068871_1001748202 467
225 3300006844 Ga0075428_100082405 Ga0075428_1000824053 467
226 3300006852 Ga0075433_10012596 Ga0075433_100125965 467
227 3300006871 Ga0075434_100012045 Ga0075434_1000120452 467
228 3300006914 Ga0075436_100000443 Ga0075436_10000044313 467
229 3300006931 Ga0097620_100037508 Ga0097620_1000375082 467
230 3300007076 Ga0075435_100134915 Ga0075435_1001349152 467
231 3300009094 Ga0111539_10080025 Ga0111539_100800252 467
232 3300009101 Ga0105247_10034263 Ga0105247_100342632 467
233 3300009147 Ga0114129_10106391 Ga0114129_101063912 467
234 3300025915 Ga0207693_10039616 Ga0207693_100396163 467
235 3300025942 Ga0207689_10052095 Ga0207689_100520951 467
236 3300025961 Ga0207712_10067021 Ga0207712_100670212 467
237 3300025972 Ga0207668_10084432 Ga0207668_100844322 467
238 3300025981 Ga0207640_10109641 Ga0207640_101096411 467
239 3300026095 Ga0207676_10015557 Ga0207676_100155573 467
240 3300026116 Ga0207674_10009004 Ga0207674_100090043 467
241 3300031241 Ga0265325_10000464 Ga0265325_1000046424 467
242 3300035695 Ga0373927_0023307 Ga0373927_0023307_1793_3205 467
243 3300039447 Ga0436361_0164715 Ga0436361_0164715_190_1620 467
244 3300044656 Ga0466969_0073136 Ga0466969_0073136_79_1518 467
245 3300044684 Ga0466966_0053978 Ga0466966_0053978_860_2299 467
246 3300046491 Ga0495584_0034654 Ga0495584_0034654_105_1520 467
247 3300048912 Ga0496109_0091894 Ga0496109_0091894_1132_2547 467
248 3300049571 Ga0501034_0210554 Ga0501034_0210554_127_1542 467
249 3300049572 Ga0501036_0055574 Ga0501036_0055574_378_1781 467
250 3300049574 Ga0501038_0022499 Ga0501038_0022499_3136_4539 467
251 3300049576 Ga0501040_0005271 Ga0501040_0005271_5581_6996 467
252 3300049578 Ga0501042_0035498 Ga0501042_0035498_1262_2686 467
253 3300049580 Ga0501046_0025250 Ga0501046_0025250_443_1858 467
254 3300049586 Ga0501070_0031183 Ga0501070_0031183_2555_3970 467
255 3300049588 Ga0501072_0011866 Ga0501072_0011866_3782_5197 467
256 3300049591 Ga0501075_0015464 Ga0501075_0015464_3817_5223 467
257 3300049591 Ga0501075_0074712 Ga0501075_0074712_240_1655 467
258 3300049593 Ga0501077_0070230 Ga0501077_0070230_97_1503 467
259 3300049593 Ga0501077_0070722 Ga0501077_0070722_50_1465 467
260 3300049741 Ga0501079_0013648 Ga0501079_0013648_3225_4631 467
261 3300049742 Ga0501080_0205923 Ga0501080_0205923_148_1563 467
262 3300049743 Ga0501081_0006174 Ga0501081_0006174_1565_2971 467
263 3300049743 Ga0501081_0008015 Ga0501081_0008015_5239_6654 467
264 3300049744 Ga0501083_0064214 Ga0501083_0064214_796_2202 467
265 3300049744 Ga0501083_0095636 Ga0501083_0095636_273_1688 467
266 3300049822 Ga0501035_0042607 Ga0501035_0042607_887_2302 467
267 3300049823 Ga0501044_0138283 Ga0501044_0138283_794_2197 467
268 3300050507 nmdc:mga05p37_178457_c1 nmdc:mga05p37_178457_c1_25_1437 467
269 3300050507 nmdc:mga05p37_39331_c1 nmdc:mga05p37_39331_c1_2677_4098 467
270 3300050512 nmdc:mga0n895_9100_c1 nmdc:mga0n895_9100_c1_1470_2882 467
271 3300050514 nmdc:mga08x19_66_c1 nmdc:mga08x19_66_c1_58975_60378 467
272 3300050515 nmdc:mga0a205_30916_c1 nmdc:mga0a205_30916_c1_2608_4020 467
273 3300053153 Ga0500616_0000458 Ga0500616_0000458_860_2275 467
274 3300060353 Ga0501082_0011414 Ga0501082_0011414_108_1523 467
275 3300005336 Ga0070680_100018551 Ga0070680_1000185512 468
276 3300005577 Ga0068857_100025817 Ga0068857_1000258174 468
277 3300005578 Ga0068854_100148241 Ga0068854_1001482411 468
278 3300005841 Ga0068863_100084827 Ga0068863_1000848272 468
279 3300005937 Ga0081455_10005197 Ga0081455_1000519710 468
280 3300005981 Ga0081538_10017029 Ga0081538_100170294 468
281 3300006844 Ga0075428_100000205 Ga0075428_10000020544 468
282 3300006846 Ga0075430_100004858 Ga0075430_1000048586 468
283 3300006847 Ga0075431_100000266 Ga0075431_10000026624 468
284 3300006847 Ga0075431_100022527 Ga0075431_1000225276 468
285 3300006880 Ga0075429_100022260 Ga0075429_1000222603 468
286 3300006880 Ga0075429_100160193 Ga0075429_1001601931 468
287 3300009093 Ga0105240_10003481 Ga0105240_100034815 468
288 3300009147 Ga0114129_10000640 Ga0114129_1000064024 468
289 3300013104 Ga0157370_10026677 Ga0157370_100266775 468
290 3300013104 Ga0157370_10030889 Ga0157370_100308895 468
291 3300025921 Ga0207652_10023862 Ga0207652_100238622 468
292 3300026075 Ga0207708_10133814 Ga0207708_101338142 468
293 3300026116 Ga0207674_10035884 Ga0207674_100358842 468
294 3300031238 Ga0265332_10000849 Ga0265332_1000084917 468
295 3300031249 Ga0265339_10004115 Ga0265339_100041158 468
296 3300031250 Ga0265331_10018026 Ga0265331_100180263 468
297 3300031711 Ga0265314_10007314 Ga0265314_100073144 468
298 3300031711 Ga0265314_10034461 Ga0265314_100344612 468
299 3300031712 Ga0265342_10000360 Ga0265342_1000036020 468
300 3300039437 Ga0436365_0231168 Ga0436365_0231168_3382_4788 468
301 3300049574 Ga0501038_0084138 Ga0501038_0084138_653_2065 468
302 3300049742 Ga0501080_0053915 Ga0501080_0053915_170_1576 468
303 3300049744 Ga0501083_0103568 Ga0501083_0103568_415_1827 468
304 3300050507 nmdc:mga05p37_187410_c1 nmdc:mga05p37_187410_c1_292_1704 468
305 3300050507 nmdc:mga05p37_6218_c1 nmdc:mga05p37_6218_c1_4560_5984 468
306 3300050508 nmdc:mga09592_11427_c1 nmdc:mga09592_11427_c1_3169_4593 468
307 3300050509 nmdc:mga0qj67_267_c1 nmdc:mga0qj67_267_c1_32394_33809 468
308 3300050509 nmdc:mga0qj67_82604_c1 nmdc:mga0qj67_82604_c1_959_2377 468
309 3300050510 nmdc:mga06r32_122772_c1 nmdc:mga06r32_122772_c1_1075_2487 468
310 3300050510 nmdc:mga06r32_64_c1 nmdc:mga06r32_64_c1_25764_27188 468
311 3300050511 nmdc:mga08y16_148802_c1 nmdc:mga08y16_148802_c1_976_2388 468
312 3300050511 nmdc:mga08y16_906_c1 nmdc:mga08y16_906_c1_11499_12923 468
313 3300053096 Ga0500641_0000932 Ga0500641_0000932_1508_2923 468
314 3300060353 Ga0501082_0044248 Ga0501082_0044248_1361_2773 468
315 iso_pu_bacteria 8057529695 8057530848 468
316 3300003215 JGI25153J46596_10003929 JGI25153J46596_100039292 469
317 3300005327 Ga0070658_10131161 Ga0070658_101311611 469
318 3300005329 Ga0070683_100139939 Ga0070683_1001399391 469
319 3300005330 Ga0070690_100002695 Ga0070690_1000026957 469
320 3300005356 Ga0070674_100010760 Ga0070674_1000107605 469
321 3300005365 Ga0070688_100005328 Ga0070688_1000053283 469
322 3300005456 Ga0070678_100081860 Ga0070678_1000818602 469
323 3300005458 Ga0070681_10006073 Ga0070681_100060738 469
324 3300005530 Ga0070679_100002677 Ga0070679_1000026776 469
325 3300005616 Ga0068852_100014120 Ga0068852_1000141202 469
326 3300005616 Ga0068852_100072068 Ga0068852_1000720682 469
327 3300006844 Ga0075428_100102778 Ga0075428_1001027782 469
328 3300006847 Ga0075431_100098627 Ga0075431_1000986273 469
329 3300007076 Ga0075435_100173393 Ga0075435_1001733932 469
330 3300007265 Ga0099794_10007253 Ga0099794_100072532 469
331 3300009177 Ga0105248_10010945 Ga0105248_1001094511 469
332 3300014325 Ga0163163_10187720 Ga0163163_101877201 469
333 3300014497 Ga0182008_10048537 Ga0182008_100485372 469
334 3300017792 Ga0163161_10075725 Ga0163161_100757252 469
335 3300025297 Ga0209758_1007060 Ga0209758_10070604 469
336 3300025912 Ga0207707_10012619 Ga0207707_100126195 469
337 3300025921 Ga0207652_10019346 Ga0207652_100193462 469
338 3300025926 Ga0207659_10048887 Ga0207659_100488872 469
339 3300025941 Ga0207711_10189442 Ga0207711_101894422 469
340 3300025981 Ga0207640_10115559 Ga0207640_101155592 469
341 3300026035 Ga0207703_10180100 Ga0207703_101801002 469
342 3300026121 Ga0207683_10024647 Ga0207683_100246472 469
343 3300026142 Ga0207698_10270873 Ga0207698_102708731 469
344 3300031247 Ga0265340_10038095 Ga0265340_100380951 469
345 3300031250 Ga0265331_10014085 Ga0265331_100140852 469
346 3300031344 Ga0265316_10028221 Ga0265316_100282212 469
347 3300031595 Ga0265313_10003857 Ga0265313_100038575 469
348 3300031711 Ga0265314_10024700 Ga0265314_100247001 469
349 3300031712 Ga0265342_10010083 Ga0265342_100100832 469
350 3300031712 Ga0265342_10049630 Ga0265342_100496301 469
351 3300035083 Ga0373926_0013686 Ga0373926_0013686_671_2110 469
352 3300035116 Ga0373945_0004542 Ga0373945_0004542_292_1719 469
353 3300035116 Ga0373945_0010369 Ga0373945_0010369_889_2328 469
354 3300035117 Ga0373953_0025159 Ga0373953_0025159_71_1498 469
355 3300035118 Ga0373954_0000753 Ga0373954_0000753_4121_5548 469
356 3300035119 Ga0373956_0015305 Ga0373956_0015305_503_1930 469
357 3300035170 Ga0373943_0003107 Ga0373943_0003107_4284_5711 469
358 3300035171 Ga0373946_0001852 Ga0373946_0001852_4412_5839 469
359 3300035172 Ga0373955_0000158 Ga0373955_0000158_17677_19104 469
360 3300035398 Ga0316574_0023419 Ga0316574_0023419_1118_2548 469
361 3300035410 Ga0373924_0007302 Ga0373924_0007302_1593_3020 469
362 3300035691 Ga0373931_0005561 Ga0373931_0005561_4076_5491 469
363 3300035692 Ga0373935_0000026 Ga0373935_0000026_1106_2533 469
364 3300035695 Ga0373927_0006909 Ga0373927_0006909_2773_4212 469
365 3300035695 Ga0373927_0042130 Ga0373927_0042130_1021_2448 469
366 3300035725 Ga0373947_0004512 Ga0373947_0004512_2557_3984 469
367 3300036401 Ga0373937_0030958 Ga0373937_0030958_1736_3163 469
368 3300036712 Ga0316584_0011236 Ga0316584_0011236_187_1617 469
369 3300037068 Ga0373925_0000034 Ga0373925_0000034_94380_95807 469
370 3300037068 Ga0373925_0027906 Ga0373925_0027906_2586_4001 469
371 3300046454 Ga0495592_0000031 Ga0495592_0000031_26665_28092 469
372 3300046455 Ga0495603_0013789 Ga0495603_0013789_37_1476 469
373 3300046459 Ga0495629_0011658 Ga0495629_0011658_4470_5897 469
374 3300046460 Ga0495638_0005408 Ga0495638_0005408_5722_7140 469
375 3300046462 Ga0495651_0000200 Ga0495651_0000200_3664_5091 469
376 3300046463 Ga0495653_0000012 Ga0495653_0000012_10900_12327 469
377 3300046476 Ga0495662_0009602 Ga0495662_0009602_1626_3053 469
378 3300046477 Ga0495664_0000004 Ga0495664_0000004_369990_371417 469
379 3300046511 Ga0495608_0000005 Ga0495608_0000005_172119_173546 469
380 3300046513 Ga0495616_0029782 Ga0495616_0029782_92_1531 469
381 3300046514 Ga0495618_0000024 Ga0495618_0000024_21876_23303 469
382 3300046516 Ga0495628_0000001 Ga0495628_0000001_369979_371406 469
383 3300046516 Ga0495628_0103738 Ga0495628_0103738_421_1836 469
384 3300046517 Ga0495630_0000433 Ga0495630_0000433_12660_14087 469
385 3300046529 Ga0495652_0000002 Ga0495652_0000002_584513_585940 469
386 3300046531 Ga0495665_0075077 Ga0495665_0075077_49_1488 469
387 3300046533 Ga0495640_0000001 Ga0495640_0000001_678517_679944 469
388 3300046536 Ga0495587_0000016 Ga0495587_0000016_85026_86453 469
389 3300046543 Ga0495645_0000002 Ga0495645_0000002_369992_371419 469
390 3300046559 Ga0495667_0000007 Ga0495667_0000007_162727_164154 469
391 3300046642 Ga0495634_0000637 Ga0495634_0000637_20618_22045 469
392 3300046663 Ga0495635_0000002 Ga0495635_0000002_115518_116945 469
393 3300046663 Ga0495635_0084095 Ga0495635_0084095_350_1789 469
394 3300046675 Ga0495657_0000628 Ga0495657_0000628_1761_3188 469
395 3300046678 Ga0495599_0000005 Ga0495599_0000005_198214_199641 469
396 3300046679 Ga0495623_0000016 Ga0495623_0000016_22164_23591 469
397 3300046680 Ga0495646_0000002 Ga0495646_0000002_100470_101897 469
398 3300046689 Ga0495613_0054770 Ga0495613_0054770_1260_2699 469
399 3300046690 Ga0495624_0044384 Ga0495624_0044384_700_2127 469
400 3300046691 Ga0495670_0010273 Ga0495670_0010273_42_1481 469
401 3300046809 Ga0495600_0000018 Ga0495600_0000018_96945_98372 469
402 3300047315 Ga0495581_0006932 Ga0495581_0006932_3750_5177 469
403 3300047317 Ga0495604_0000020 Ga0495604_0000020_126716_128143 469
404 3300047319 Ga0495674_0000002 Ga0495674_0000002_369980_371407 469
405 3300047321 Ga0495676_0017061 Ga0495676_0017061_1293_2732 469
406 3300047322 Ga0495680_0001158 Ga0495680_0001158_1717_3144 469
407 3300047444 Ga0495675_0000284 Ga0495675_0000284_15588_17015 469
408 3300047471 Ga0495684_0000017 Ga0495684_0000017_122353_123780 469
409 3300047673 Ga0495593_0019161 Ga0495593_0019161_1704_3131 469
410 3300047673 Ga0495593_0041222 Ga0495593_0041222_29_1468 469
411 3300048088 Ga0495602_0000040 Ga0495602_0000040_24290_25717 469
412 3300048904 Ga0496101_0001810 Ga0496101_0001810_9525_10940 469
413 3300048905 Ga0496102_0167895 Ga0496102_0167895_147_1586 469
414 3300048906 Ga0496103_0063198 Ga0496103_0063198_61_1482 469
415 3300048907 Ga0496104_0023547 Ga0496104_0023547_1806_3221 469
416 3300048907 Ga0496104_0081672 Ga0496104_0081672_1423_2844 469
417 3300048908 Ga0496105_0010872 Ga0496105_0010872_1393_2814 469
418 3300048909 Ga0496106_0023257 Ga0496106_0023257_134_1555 469
419 3300048910 Ga0496107_0150840 Ga0496107_0150840_59_1498 469
420 3300048911 Ga0496108_0000333 Ga0496108_0000333_25602_27023 469
421 3300048911 Ga0496108_0041814 Ga0496108_0041814_460_1875 469
422 3300048912 Ga0496109_0005773 Ga0496109_0005773_1395_2816 469
423 3300048912 Ga0496109_0036508 Ga0496109_0036508_2447_3862 469
424 3300048913 Ga0496110_0086278 Ga0496110_0086278_134_1549 469
425 3300048913 Ga0496110_0232298 Ga0496110_0232298_144_1565 469
426 3300048914 Ga0496111_0005383 Ga0496111_0005383_1412_2833 469
427 3300048915 Ga0496112_0000838 Ga0496112_0000838_779_2200 469
428 3300048916 Ga0496113_0000693 Ga0496113_0000693_13172_14593 469
429 3300048917 Ga0496114_0011924 Ga0496114_0011924_1087_2502 469
430 3300048918 Ga0496115_0045335 Ga0496115_0045335_131_1552 469
431 3300049570 Ga0501033_0023629 Ga0501033_0023629_2400_3818 469
432 3300049571 Ga0501034_0022549 Ga0501034_0022549_563_1981 469
433 3300049586 Ga0501070_0009844 Ga0501070_0009844_5128_6549 469
434 3300049586 Ga0501070_0034636 Ga0501070_0034636_1913_3331 469
435 3300049586 Ga0501070_0090512 Ga0501070_0090512_812_2230 469
436 3300050507 nmdc:mga05p37_335814_c1 nmdc:mga05p37_335814_c1_220_1641 469
437 3300050507 nmdc:mga05p37_9875_c1 nmdc:mga05p37_9875_c1_1209_2630 469
438 3300050510 nmdc:mga06r32_147605_c1 nmdc:mga06r32_147605_c1_591_2006 469
439 3300050510 nmdc:mga06r32_21208_c1 nmdc:mga06r32_21208_c1_3440_4906 469
440 3300050512 nmdc:mga0n895_55579_c1 nmdc:mga0n895_55579_c1_2363_3784 469
441 3300053077 Ga0495601_0000018 Ga0495601_0000018_111593_113020 469
442 3300053078 Ga0495612_0000011 Ga0495612_0000011_122659_124086 469
443 3300053084 Ga0495595_0000016 Ga0495595_0000016_36786_38213 469
444 3300053084 Ga0495595_0019761 Ga0495595_0019761_691_2106 469
445 3300053085 Ga0495619_0000014 Ga0495619_0000014_160847_162274 469
446 3300053085 Ga0495619_0064422 Ga0495619_0064422_130_1569 469
447 3300053096 Ga0500641_0008319 Ga0500641_0008319_1721_3130 469
448 3300001991 JGI24743J22301_10001864 JGI24743J22301_100018642 470
449 3300003771 Ga0055526_1003135 Ga0055526_10031354 470
450 3300003775 Ga0055524_1000020 Ga0055524_1000020174 470
451 3300005262 Ga0065165_1000141 Ga0065165_100014171 470
452 3300005334 Ga0068869_100016314 Ga0068869_1000163142 470
453 3300005338 Ga0068868_100086567 Ga0068868_1000865672 470
454 3300005341 Ga0070691_10020556 Ga0070691_100205562 470
455 3300005345 Ga0070692_10011554 Ga0070692_100115542 470
456 3300005347 Ga0070668_100076963 Ga0070668_1000769632 470
457 3300005365 Ga0070688_100017152 Ga0070688_1000171523 470
458 3300005434 Ga0070709_10010596 Ga0070709_100105963 470
459 3300005434 Ga0070709_10041879 Ga0070709_100418792 470
460 3300005435 Ga0070714_100011112 Ga0070714_1000111128 470
461 3300005435 Ga0070714_100111314 Ga0070714_1001113141 470
462 3300005441 Ga0070700_100011866 Ga0070700_1000118662 470
463 3300005455 Ga0070663_100079771 Ga0070663_1000797712 470
464 3300005456 Ga0070678_100020981 Ga0070678_1000209812 470
465 3300005458 Ga0070681_10059673 Ga0070681_100596732 470
466 3300005459 Ga0068867_100010686 Ga0068867_1000106862 470
467 3300005518 Ga0070699_100014629 Ga0070699_1000146293 470
468 3300005535 Ga0070684_100160910 Ga0070684_1001609102 470
469 3300005543 Ga0070672_100050976 Ga0070672_1000509763 470
470 3300005544 Ga0070686_100007632 Ga0070686_1000076322 470
471 3300005547 Ga0070693_100047279 Ga0070693_1000472792 470
472 3300005563 Ga0068855_100077988 Ga0068855_1000779882 470
473 3300005563 Ga0068855_100163518 Ga0068855_1001635182 470
474 3300005615 Ga0070702_100020797 Ga0070702_1000207972 470
475 3300005616 Ga0068852_100041022 Ga0068852_1000410224 470
476 3300005617 Ga0068859_100031525 Ga0068859_1000315253 470
477 3300005618 Ga0068864_100004544 Ga0068864_1000045446 470
478 3300005840 Ga0068870_10013347 Ga0068870_100133473 470
479 3300005841 Ga0068863_100093117 Ga0068863_1000931173 470
480 3300005842 Ga0068858_100013222 Ga0068858_1000132226 470
481 3300005937 Ga0081455_10002539 Ga0081455_100025395 470
482 3300005937 Ga0081455_10011999 Ga0081455_100119991 470
483 3300005981 Ga0081538_10065488 Ga0081538_100654882 470
484 3300005983 Ga0081540_1004357 Ga0081540_10043573 470
485 3300005983 Ga0081540_1081091 Ga0081540_10810911 470
486 3300006038 Ga0075365_10039163 Ga0075365_100391632 470
487 3300006051 Ga0075364_10029445 Ga0075364_100294453 470
488 3300006844 Ga0075428_100201860 Ga0075428_1002018602 470
489 3300006847 Ga0075431_100014481 Ga0075431_1000144812 470
490 3300006881 Ga0068865_100044980 Ga0068865_1000449802 470
491 3300006931 Ga0097620_100031525 Ga0097620_1000315253 470
492 3300009093 Ga0105240_10070736 Ga0105240_100707364 470
493 3300009098 Ga0105245_10017080 Ga0105245_100170804 470
494 3300009174 Ga0105241_10045570 Ga0105241_100455702 470
495 3300009176 Ga0105242_10020801 Ga0105242_100208012 470
496 3300009177 Ga0105248_10017190 Ga0105248_100171902 470
497 3300011119 Ga0105246_10009901 Ga0105246_100099012 470
498 3300013100 Ga0157373_10060401 Ga0157373_100604012 470
499 3300013250 Ga0171462_1032 Ga0171462_103228 470
500 3300013306 Ga0163162_10236195 Ga0163162_102361951 470
501 3300013308 Ga0157375_10009534 Ga0157375_100095343 470
502 3300014745 Ga0157377_10013212 Ga0157377_100132123 470
503 3300014968 Ga0157379_10035738 Ga0157379_100357382 470
504 3300021388 Ga0213875_10004329 Ga0213875_100043294 470
505 3300025261 Ga0209233_1012396 Ga0209233_10123961 470
506 3300025284 Ga0209130_1000178 Ga0209130_100017872 470
507 3300025291 Ga0209675_1000692 Ga0209675_100069211 470
508 3300025294 Ga0209025_1000008 Ga0209025_1000008814 470
509 3300025294 Ga0209025_1002015 Ga0209025_100201520 470
510 3300025295 Ga0209564_1000049 Ga0209564_1000049297 470
511 3300025299 Ga0209256_1000014 Ga0209256_1000014342 470
512 3300025299 Ga0209256_1000200 Ga0209256_100020034 470
513 3300025900 Ga0207710_10010799 Ga0207710_100107994 470
514 3300025901 Ga0207688_10001343 Ga0207688_100013436 470
515 3300025903 Ga0207680_10007258 Ga0207680_100072586 470
516 3300025904 Ga0207647_10079370 Ga0207647_100793702 470
517 3300025908 Ga0207643_10001138 Ga0207643_1000113810 470
518 3300025915 Ga0207693_10006436 Ga0207693_100064362 470
519 3300025916 Ga0207663_10050345 Ga0207663_100503451 470
520 3300025921 Ga0207652_10042464 Ga0207652_100424642 470
521 3300025925 Ga0207650_10140014 Ga0207650_101400142 470
522 3300025927 Ga0207687_10007813 Ga0207687_100078134 470
523 3300025928 Ga0207700_10080333 Ga0207700_100803332 470
524 3300025928 Ga0207700_10139355 Ga0207700_101393552 470
525 3300025934 Ga0207686_10025401 Ga0207686_100254012 470
526 3300025938 Ga0207704_10006584 Ga0207704_100065844 470
527 3300025939 Ga0207665_10000745 Ga0207665_100007455 470
528 3300025940 Ga0207691_10001237 Ga0207691_1000123714 470
529 3300025942 Ga0207689_10004233 Ga0207689_100042339 470
530 3300025949 Ga0207667_10122143 Ga0207667_101221431 470
531 3300025961 Ga0207712_10009218 Ga0207712_100092185 470
532 3300025972 Ga0207668_10016242 Ga0207668_100162424 470
533 3300025986 Ga0207658_10024367 Ga0207658_100243671 470
534 3300026035 Ga0207703_10011650 Ga0207703_100116502 470
535 3300026067 Ga0207678_10010483 Ga0207678_100104835 470
536 3300026075 Ga0207708_10001855 Ga0207708_100018558 470
537 3300026089 Ga0207648_10027045 Ga0207648_100270452 470
538 3300026118 Ga0207675_100005906 Ga0207675_1000059069 470
539 3300026121 Ga0207683_10026401 Ga0207683_100264012 470
540 3300026142 Ga0207698_10277801 Ga0207698_102778011 470
541 3300031235 Ga0265330_10036549 Ga0265330_100365491 470
542 3300031241 Ga0265325_10007651 Ga0265325_100076518 470
543 3300031249 Ga0265339_10007937 Ga0265339_100079375 470
544 3300031595 Ga0265313_10001570 Ga0265313_1000157020 470
545 3300031595 Ga0265313_10013620 Ga0265313_100136202 470
546 3300031595 Ga0265313_10026302 Ga0265313_100263023 470
547 3300031595 Ga0265313_10066220 Ga0265313_100662201 470
548 3300031711 Ga0265314_10120567 Ga0265314_101205671 470
549 3300031712 Ga0265342_10002687 Ga0265342_1000268710 470
550 3300031712 Ga0265342_10030918 Ga0265342_100309183 470
551 3300037466 Ga0395898_0175469 Ga0395898_0175469_325_1749 470
552 3300037853 Ga0436364_0308859 Ga0436364_0308859_70_1500 470
553 3300037853 Ga0436364_0631135 Ga0436364_0631135_7258_8676 470
554 3300039437 Ga0436365_0174563 Ga0436365_0174563_14071_15501 470
555 3300039453 Ga0436362_0837885 Ga0436362_0837885_6117_7547 470
556 3300044694 Ga0466963_0072116 Ga0466963_0072116_403_1827 470
557 3300046810 Ga0495660_0083899 Ga0495660_0083899_28_1467 470
558 3300048903 Ga0496100_0017190 Ga0496100_0017190_226_1668 470
559 3300048904 Ga0496101_0000800 Ga0496101_0000800_4123_5565 470
560 3300048905 Ga0496102_0196536 Ga0496102_0196536_16_1440 470
561 3300048906 Ga0496103_0003368 Ga0496103_0003368_6060_7502 470
562 3300048907 Ga0496104_0001184 Ga0496104_0001184_4301_5725 470
563 3300048907 Ga0496104_0003351 Ga0496104_0003351_10277_11701 470
564 3300048907 Ga0496104_0017343 Ga0496104_0017343_2635_4077 470
565 3300048908 Ga0496105_0004894 Ga0496105_0004894_354_1796 470
566 3300048908 Ga0496105_0015814 Ga0496105_0015814_4542_5966 470
567 3300048909 Ga0496106_0013398 Ga0496106_0013398_354_1796 470
568 3300048910 Ga0496107_0024456 Ga0496107_0024456_353_1795 470
569 3300048911 Ga0496108_0043056 Ga0496108_0043056_32_1474 470
570 3300048912 Ga0496109_0018601 Ga0496109_0018601_4243_5685 470
571 3300048914 Ga0496111_0001052 Ga0496111_0001052_7438_8880 470
572 3300048916 Ga0496113_0002078 Ga0496113_0002078_2751_4193 470
573 3300048917 Ga0496114_0009608 Ga0496114_0009608_2599_4041 470
574 3300048918 Ga0496115_0149071 Ga0496115_0149071_333_1757 470
575 3300048920 Ga0496117_0069747 Ga0496117_0069747_676_2115 470
576 3300048926 Ga0496123_0077248 Ga0496123_0077248_240_1679 470
577 3300049571 Ga0501034_0048161 Ga0501034_0048161_636_2075 470
578 3300049571 Ga0501034_0071341 Ga0501034_0071341_492_1907 470
579 3300049571 Ga0501034_0174344 Ga0501034_0174344_553_1965 470
580 3300049573 Ga0501037_0053216 Ga0501037_0053216_1372_2811 470
581 3300049593 Ga0501077_0022260 Ga0501077_0022260_176_1606 470
582 3300049741 Ga0501079_0126523 Ga0501079_0126523_549_1973 470
583 3300049742 Ga0501080_0084847 Ga0501080_0084847_1513_2931 470
584 3300049822 Ga0501035_0003255 Ga0501035_0003255_7782_9197 470
585 3300050491 nmdc:mga00v17_17587_c1 nmdc:mga00v17_17587_c1_1150_2574 470
586 3300050492 nmdc:mga0yw44_24491_c1 nmdc:mga0yw44_24491_c1_372_1796 470
587 3300050492 nmdc:mga0yw44_6036_c1 nmdc:mga0yw44_6036_c1_566_1990 470
588 3300050510 nmdc:mga06r32_36012_c1 nmdc:mga06r32_36012_c1_2923_4347 470
589 3300050515 nmdc:mga0a205_29219_c1 nmdc:mga0a205_29219_c1_1394_2818 470
590 3300053119 Ga0500595_000024 Ga0500595_000024_67946_69367 470
591 3300053730 Ga0500645_000874 Ga0500645_000874_7177_8598 470
592 3300061734 Ga0530510_0036852 Ga0530510_0036852_529_1953 470
593 iso_pu_bacteria 2508501050 2508729266 470
594 2209111006 2214884074 2213936910 471
595 3300000041 ARcpr5oldR_c000047 ARcpr5oldR_00004717 471
596 3300000042 ARSoilYngRDRAFT_c00157 ARSoilYngRDRAFT_0015713 471
597 3300000043 ARcpr5yngRDRAFT_c000017 ARcpr5yngRDRAFT_00001725 471
598 3300000044 ARSoilOldRDRAFT_c000006 ARSoilOldRDRAFT_00000629 471
599 3300000045 ARCol0oldRDRAFT_c00394 ARCol0oldRDRAFT_003944 471
600 3300000652 ARCol0yngRDRAFT_1000410 ARCol0yngRDRAFT_10004102 471
601 3300001430 JGI24032J14994_100449 JGI24032J14994_1004491 471
602 3300001977 JGI24746J21847_1001205 JGI24746J21847_10012052 471
603 3300001989 JGI24739J22299_10012522 JGI24739J22299_100125222 471
604 3300001991 JGI24743J22301_10001874 JGI24743J22301_100018743 471
605 3300002070 JGI24750J21931_1000171 JGI24750J21931_10001711 471
606 3300002073 JGI24745J21846_1000238 JGI24745J21846_10002382 471
607 3300002075 JGI24738J21930_10001962 JGI24738J21930_100019621 471
608 3300002076 JGI24749J21850_1000164 JGI24749J21850_10001642 471
609 3300002077 JGI24744J21845_10007217 JGI24744J21845_100072172 471
610 3300002244 JGI24742J22300_10001863 JGI24742J22300_100018632 471
611 3300005277 Ga0065716_1001609 Ga0065716_10016094 471
612 3300005290 Ga0065712_10073346 Ga0065712_100733465 471
613 3300005290 Ga0065712_10095088 Ga0065712_100950881 471
614 3300005295 Ga0065707_10111240 Ga0065707_101112401 471
615 3300005328 Ga0070676_10008970 Ga0070676_100089702 471
616 3300005328 Ga0070676_10056584 Ga0070676_100565841 471
617 3300005329 Ga0070683_100007236 Ga0070683_1000072363 471
618 3300005329 Ga0070683_100054816 Ga0070683_1000548162 471
619 3300005330 Ga0070690_100007439 Ga0070690_1000074397 471
620 3300005331 Ga0070670_100023880 Ga0070670_1000238802 471
621 3300005333 Ga0070677_10000354 Ga0070677_1000035411 471
622 3300005334 Ga0068869_100000203 Ga0068869_10000020312 471
623 3300005335 Ga0070666_10003118 Ga0070666_100031184 471
624 3300005335 Ga0070666_10045931 Ga0070666_100459311 471
625 3300005336 Ga0070680_100002314 Ga0070680_10000231412 471
626 3300005337 Ga0070682_100000935 Ga0070682_10000093512 471
627 3300005337 Ga0070682_100048701 Ga0070682_1000487012 471
628 3300005338 Ga0068868_100002681 Ga0068868_1000026814 471
629 3300005338 Ga0068868_100085147 Ga0068868_1000851472 471
630 3300005339 Ga0070660_100002042 Ga0070660_1000020422 471
631 3300005339 Ga0070660_100039578 Ga0070660_1000395782 471
632 3300005340 Ga0070689_100010750 Ga0070689_1000107503 471
633 3300005340 Ga0070689_100012497 Ga0070689_1000124974 471
634 3300005341 Ga0070691_10000067 Ga0070691_1000006723 471
635 3300005343 Ga0070687_100077210 Ga0070687_1000772102 471
636 3300005344 Ga0070661_100001273 Ga0070661_10000127313 471
637 3300005344 Ga0070661_100066329 Ga0070661_1000663292 471
638 3300005345 Ga0070692_10000279 Ga0070692_100002792 471
639 3300005347 Ga0070668_100001472 Ga0070668_1000014726 471
640 3300005347 Ga0070668_100043745 Ga0070668_1000437452 471
641 3300005353 Ga0070669_100001453 Ga0070669_10000145312 471
642 3300005354 Ga0070675_100000701 Ga0070675_1000007013 471
643 3300005355 Ga0070671_100001883 Ga0070671_10000188312 471
644 3300005355 Ga0070671_100047421 Ga0070671_1000474212 471
645 3300005356 Ga0070674_100008500 Ga0070674_1000085003 471
646 3300005364 Ga0070673_100000855 Ga0070673_10000085512 471
647 3300005364 Ga0070673_100040814 Ga0070673_1000408144 471
648 3300005365 Ga0070688_100002458 Ga0070688_1000024586 471
649 3300005365 Ga0070688_100009226 Ga0070688_1000092265 471
650 3300005366 Ga0070659_100002844 Ga0070659_1000028446 471
651 3300005366 Ga0070659_100042026 Ga0070659_1000420265 471
652 3300005367 Ga0070667_100002230 Ga0070667_1000022306 471
653 3300005367 Ga0070667_100045305 Ga0070667_1000453052 471
654 3300005367 Ga0070667_100193441 Ga0070667_1001934411 471
655 3300005434 Ga0070709_10000219 Ga0070709_100002196 471
656 3300005435 Ga0070714_100024143 Ga0070714_1000241432 471
657 3300005436 Ga0070713_100000224 Ga0070713_10000022426 471
658 3300005436 Ga0070713_100054191 Ga0070713_1000541912 471
659 3300005436 Ga0070713_100074935 Ga0070713_1000749351 471
660 3300005437 Ga0070710_10000956 Ga0070710_1000095610 471
661 3300005438 Ga0070701_10000732 Ga0070701_100007325 471
662 3300005439 Ga0070711_100075313 Ga0070711_1000753131 471
663 3300005440 Ga0070705_100002431 Ga0070705_1000024313 471
664 3300005440 Ga0070705_100065255 Ga0070705_1000652552 471
665 3300005441 Ga0070700_100026381 Ga0070700_1000263813 471
666 3300005445 Ga0070708_100006477 Ga0070708_1000064776 471
667 3300005455 Ga0070663_100003237 Ga0070663_1000032373 471
668 3300005455 Ga0070663_100125422 Ga0070663_1001254221 471
669 3300005456 Ga0070678_100001091 Ga0070678_10000109110 471
670 3300005457 Ga0070662_100037125 Ga0070662_1000371253 471
671 3300005458 Ga0070681_10013953 Ga0070681_100139535 471
672 3300005458 Ga0070681_10089352 Ga0070681_100893522 471
673 3300005458 Ga0070681_10128583 Ga0070681_101285832 471
674 3300005459 Ga0068867_100000679 Ga0068867_10000067913 471
675 3300005466 Ga0070685_10001017 Ga0070685_1000101711 471
676 3300005530 Ga0070679_100072165 Ga0070679_1000721652 471
677 3300005530 Ga0070679_100179538 Ga0070679_1001795382 471
678 3300005535 Ga0070684_100000693 Ga0070684_1000006933 471
679 3300005535 Ga0070684_100078587 Ga0070684_1000785874 471
680 3300005543 Ga0070672_100004245 Ga0070672_1000042453 471
681 3300005543 Ga0070672_100021286 Ga0070672_1000212864 471
682 3300005544 Ga0070686_100001302 Ga0070686_10000130212 471
683 3300005544 Ga0070686_100002564 Ga0070686_1000025645 471
684 3300005544 Ga0070686_100028997 Ga0070686_1000289975 471
685 3300005545 Ga0070695_100002461 Ga0070695_1000024612 471
686 3300005545 Ga0070695_100009173 Ga0070695_1000091732 471
687 3300005546 Ga0070696_100001783 Ga0070696_10000178312 471
688 3300005546 Ga0070696_100057982 Ga0070696_1000579821 471
689 3300005547 Ga0070693_100001926 Ga0070693_1000019263 471
690 3300005548 Ga0070665_100042474 Ga0070665_1000424744 471
691 3300005563 Ga0068855_100010931 Ga0068855_10001093113 471
692 3300005564 Ga0070664_100006539 Ga0070664_1000065396 471
693 3300005564 Ga0070664_100117084 Ga0070664_1001170842 471
694 3300005577 Ga0068857_100000534 Ga0068857_10000053424 471
695 3300005578 Ga0068854_100003403 Ga0068854_1000034036 471
696 3300005578 Ga0068854_100073166 Ga0068854_1000731662 471
697 3300005614 Ga0068856_100008075 Ga0068856_1000080758 471
698 3300005614 Ga0068856_100157777 Ga0068856_1001577772 471
699 3300005615 Ga0070702_100001579 Ga0070702_1000015793 471
700 3300005615 Ga0070702_100037145 Ga0070702_1000371452 471
701 3300005616 Ga0068852_100003393 Ga0068852_1000033932 471
702 3300005617 Ga0068859_100003965 Ga0068859_10000396512 471
703 3300005617 Ga0068859_100067082 Ga0068859_1000670822 471
704 3300005618 Ga0068864_100013878 Ga0068864_1000138784 471
705 3300005718 Ga0068866_10000252 Ga0068866_1000025216 471
706 3300005719 Ga0068861_100001032 Ga0068861_10000103212 471
707 3300005719 Ga0068861_100071527 Ga0068861_1000715272 471
708 3300005841 Ga0068863_100000150 Ga0068863_1000001504 471
709 3300005841 Ga0068863_100177821 Ga0068863_1001778212 471
710 3300005842 Ga0068858_100003904 Ga0068858_10000390412 471
711 3300005842 Ga0068858_100019307 Ga0068858_1000193073 471
712 3300005842 Ga0068858_100212920 Ga0068858_1002129201 471
713 3300005843 Ga0068860_100003148 Ga0068860_1000031487 471
714 3300005843 Ga0068860_100049421 Ga0068860_1000494212 471
715 3300005844 Ga0068862_100006993 Ga0068862_1000069933 471
716 3300005844 Ga0068862_100009738 Ga0068862_1000097384 471
717 3300005937 Ga0081455_10000185 Ga0081455_1000018553 471
718 3300005937 Ga0081455_10017717 Ga0081455_100177172 471
719 3300006028 Ga0070717_10000285 Ga0070717_100002857 471
720 3300006028 Ga0070717_10026319 Ga0070717_100263193 471
721 3300006058 Ga0075432_10000240 Ga0075432_100002402 471
722 3300006163 Ga0070715_10001307 Ga0070715_100013074 471
723 3300006173 Ga0070716_100011132 Ga0070716_1000111324 471
724 3300006173 Ga0070716_100023971 Ga0070716_1000239713 471
725 3300006175 Ga0070712_100020468 Ga0070712_1000204684 471
726 3300006237 Ga0097621_100000544 Ga0097621_10000054420 471
727 3300006237 Ga0097621_100004712 Ga0097621_1000047123 471
728 3300006353 Ga0075370_10064015 Ga0075370_100640152 471
729 3300006358 Ga0068871_100001366 Ga0068871_1000013662 471
730 3300006358 Ga0068871_100003497 Ga0068871_1000034977 471
731 3300006844 Ga0075428_100019769 Ga0075428_1000197694 471
732 3300006846 Ga0075430_100000012 Ga0075430_10000001287 471
733 3300006847 Ga0075431_100005460 Ga0075431_1000054608 471
734 3300006852 Ga0075433_10000338 Ga0075433_100003387 471
735 3300006852 Ga0075433_10004462 Ga0075433_100044626 471
736 3300006852 Ga0075433_10080536 Ga0075433_100805364 471
737 3300006871 Ga0075434_100000373 Ga0075434_10000037322 471
738 3300006871 Ga0075434_100009082 Ga0075434_1000090826 471
739 3300006871 Ga0075434_100009842 Ga0075434_1000098422 471
740 3300006871 Ga0075434_100027939 Ga0075434_1000279396 471
741 3300006871 Ga0075434_100133652 Ga0075434_1001336521 471
742 3300006880 Ga0075429_100002160 Ga0075429_10000216010 471
743 3300006881 Ga0068865_100000190 Ga0068865_1000001906 471
744 3300006881 Ga0068865_100168964 Ga0068865_1001689641 471
745 3300006931 Ga0097620_100003965 Ga0097620_1000039655 471
746 3300006931 Ga0097620_100067084 Ga0097620_1000670842 471
747 3300007076 Ga0075435_100013108 Ga0075435_1000131082 471
748 3300009092 Ga0105250_10010395 Ga0105250_100103951 471
749 3300009092 Ga0105250_10023450 Ga0105250_100234502 471
750 3300009093 Ga0105240_10160426 Ga0105240_101604262 471
751 3300009094 Ga0111539_10000299 Ga0111539_1000029958 471
752 3300009094 Ga0111539_10005091 Ga0111539_100050916 471
753 3300009094 Ga0111539_10005821 Ga0111539_100058216 471
754 3300009094 Ga0111539_10179589 Ga0111539_101795892 471
755 3300009098 Ga0105245_10000543 Ga0105245_1000054323 471
756 3300009101 Ga0105247_10104703 Ga0105247_101047032 471
757 3300009147 Ga0114129_10016895 Ga0114129_100168954 471
758 3300009147 Ga0114129_10019077 Ga0114129_100190774 471
759 3300009148 Ga0105243_10014840 Ga0105243_100148406 471
760 3300009148 Ga0105243_10020519 Ga0105243_100205192 471
761 3300009174 Ga0105241_10002875 Ga0105241_100028752 471
762 3300009174 Ga0105241_10016416 Ga0105241_100164166 471
763 3300009176 Ga0105242_10001766 Ga0105242_100017666 471
764 3300009176 Ga0105242_10004776 Ga0105242_100047763 471
765 3300009177 Ga0105248_10000501 Ga0105248_1000050141 471
766 3300009177 Ga0105248_10040194 Ga0105248_100401942 471
767 3300009177 Ga0105248_10095011 Ga0105248_100950112 471
768 3300009551 Ga0105238_10024549 Ga0105238_100245494 471
769 3300009551 Ga0105238_10116235 Ga0105238_101162353 471
770 3300009553 Ga0105249_10006521 Ga0105249_100065211 471
771 3300010375 Ga0105239_10005329 Ga0105239_100053296 471
772 3300010375 Ga0105239_10019260 Ga0105239_100192604 471
773 3300010375 Ga0105239_10035309 Ga0105239_100353092 471
774 3300010375 Ga0105239_10127527 Ga0105239_101275272 471
775 3300011119 Ga0105246_10064351 Ga0105246_100643512 471
776 3300013102 Ga0157371_10042393 Ga0157371_100423934 471
777 3300013105 Ga0157369_10232379 Ga0157369_102323793 471
778 3300013296 Ga0157374_10013556 Ga0157374_100135564 471
779 3300013296 Ga0157374_10067536 Ga0157374_100675362 471
780 3300013297 Ga0157378_10003057 Ga0157378_100030576 471
781 3300013306 Ga0163162_10004207 Ga0163162_100042073 471
782 3300013306 Ga0163162_10083860 Ga0163162_100838602 471
783 3300013307 Ga0157372_10028637 Ga0157372_100286373 471
784 3300013308 Ga0157375_10002141 Ga0157375_100021416 471
785 3300013308 Ga0157375_10289737 Ga0157375_102897372 471
786 3300014325 Ga0163163_10003931 Ga0163163_100039312 471
787 3300014325 Ga0163163_10010114 Ga0163163_100101143 471
788 3300014326 Ga0157380_10000049 Ga0157380_1000004915 471
789 3300014745 Ga0157377_10002000 Ga0157377_100020002 471
790 3300014968 Ga0157379_10080671 Ga0157379_100806712 471
791 3300014969 Ga0157376_10000099 Ga0157376_1000009963 471
792 3300017792 Ga0163161_10000081 Ga0163161_1000008123 471
793 3300025271 Ga0207666_1000167 Ga0207666_100016712 471
794 3300025290 Ga0207673_1000367 Ga0207673_10003672 471
795 3300025885 Ga0207653_10000843 Ga0207653_1000084312 471
796 3300025893 Ga0207682_10000046 Ga0207682_1000004618 471
797 3300025898 Ga0207692_10000988 Ga0207692_100009886 471
798 3300025899 Ga0207642_10001252 Ga0207642_100012526 471
799 3300025900 Ga0207710_10000850 Ga0207710_1000085014 471
800 3300025900 Ga0207710_10009377 Ga0207710_100093773 471
801 3300025901 Ga0207688_10001056 Ga0207688_1000105612 471
802 3300025903 Ga0207680_10002036 Ga0207680_100020364 471
803 3300025903 Ga0207680_10048876 Ga0207680_100488762 471
804 3300025904 Ga0207647_10007296 Ga0207647_1000729610 471
805 3300025905 Ga0207685_10002344 Ga0207685_100023442 471
806 3300025905 Ga0207685_10014730 Ga0207685_100147302 471
807 3300025906 Ga0207699_10000312 Ga0207699_1000031225 471
808 3300025906 Ga0207699_10037876 Ga0207699_100378762 471
809 3300025907 Ga0207645_10000162 Ga0207645_1000016255 471
810 3300025907 Ga0207645_10037726 Ga0207645_100377264 471
811 3300025908 Ga0207643_10000025 Ga0207643_1000002585 471
812 3300025911 Ga0207654_10001641 Ga0207654_1000164113 471
813 3300025911 Ga0207654_10033211 Ga0207654_100332113 471
814 3300025912 Ga0207707_10002255 Ga0207707_100022555 471
815 3300025912 Ga0207707_10073899 Ga0207707_100738992 471
816 3300025912 Ga0207707_10149927 Ga0207707_101499271 471
817 3300025914 Ga0207671_10010591 Ga0207671_100105919 471
818 3300025915 Ga0207693_10036605 Ga0207693_100366052 471
819 3300025916 Ga0207663_10076825 Ga0207663_100768252 471
820 3300025917 Ga0207660_10001243 Ga0207660_100012437 471
821 3300025918 Ga0207662_10016220 Ga0207662_100162205 471
822 3300025918 Ga0207662_10016564 Ga0207662_100165642 471
823 3300025920 Ga0207649_10000048 Ga0207649_1000004873 471
824 3300025921 Ga0207652_10003743 Ga0207652_100037437 471
825 3300025921 Ga0207652_10081384 Ga0207652_100813842 471
826 3300025923 Ga0207681_10000131 Ga0207681_1000013113 471
827 3300025924 Ga0207694_10057921 Ga0207694_100579212 471
828 3300025925 Ga0207650_10002321 Ga0207650_1000232111 471
829 3300025925 Ga0207650_10053527 Ga0207650_100535274 471
830 3300025926 Ga0207659_10000040 Ga0207659_1000004012 471
831 3300025926 Ga0207659_10117466 Ga0207659_101174662 471
832 3300025927 Ga0207687_10000090 Ga0207687_1000009064 471
833 3300025928 Ga0207700_10000231 Ga0207700_1000023127 471
834 3300025928 Ga0207700_10040992 Ga0207700_100409922 471
835 3300025929 Ga0207664_10026272 Ga0207664_100262724 471
836 3300025929 Ga0207664_10182187 Ga0207664_101821871 471
837 3300025931 Ga0207644_10000473 Ga0207644_1000047323 471
838 3300025931 Ga0207644_10007385 Ga0207644_100073855 471
839 3300025932 Ga0207690_10000173 Ga0207690_100001736 471
840 3300025933 Ga0207706_10005557 Ga0207706_100055573 471
841 3300025933 Ga0207706_10048639 Ga0207706_100486392 471
842 3300025933 Ga0207706_10060198 Ga0207706_100601982 471
843 3300025934 Ga0207686_10002985 Ga0207686_100029856 471
844 3300025934 Ga0207686_10003177 Ga0207686_100031775 471
845 3300025935 Ga0207709_10000585 Ga0207709_1000058523 471
846 3300025935 Ga0207709_10064941 Ga0207709_100649412 471
847 3300025936 Ga0207670_10002222 Ga0207670_100022221 471
848 3300025936 Ga0207670_10002465 Ga0207670_100024654 471
849 3300025937 Ga0207669_10000102 Ga0207669_1000010217 471
850 3300025938 Ga0207704_10000097 Ga0207704_1000009751 471
851 3300025938 Ga0207704_10012115 Ga0207704_100121152 471
852 3300025939 Ga0207665_10000487 Ga0207665_1000048727 471
853 3300025939 Ga0207665_10049274 Ga0207665_100492743 471
854 3300025940 Ga0207691_10007973 Ga0207691_100079731 471
855 3300025941 Ga0207711_10000847 Ga0207711_1000084711 471
856 3300025941 Ga0207711_10001975 Ga0207711_1000197514 471
857 3300025941 Ga0207711_10057697 Ga0207711_100576972 471
858 3300025942 Ga0207689_10000677 Ga0207689_100006774 471
859 3300025942 Ga0207689_10003052 Ga0207689_1000305210 471
860 3300025944 Ga0207661_10000204 Ga0207661_1000020416 471
861 3300025944 Ga0207661_10111725 Ga0207661_101117251 471
862 3300025945 Ga0207679_10000090 Ga0207679_1000009063 471
863 3300025949 Ga0207667_10018822 Ga0207667_100188222 471
864 3300025960 Ga0207651_10000017 Ga0207651_1000001765 471
865 3300025960 Ga0207651_10017251 Ga0207651_100172514 471
866 3300025961 Ga0207712_10000114 Ga0207712_1000011423 471
867 3300025972 Ga0207668_10000139 Ga0207668_1000013912 471
868 3300025981 Ga0207640_10000221 Ga0207640_1000022125 471
869 3300025986 Ga0207658_10001766 Ga0207658_100017663 471
870 3300025986 Ga0207658_10138949 Ga0207658_101389492 471
871 3300025986 Ga0207658_10174420 Ga0207658_101744201 471
872 3300026023 Ga0207677_10023458 Ga0207677_100234582 471
873 3300026023 Ga0207677_10044776 Ga0207677_100447762 471
874 3300026035 Ga0207703_10001230 Ga0207703_1000123012 471
875 3300026035 Ga0207703_10006478 Ga0207703_100064784 471
876 3300026035 Ga0207703_10165148 Ga0207703_101651482 471
877 3300026041 Ga0207639_10001275 Ga0207639_1000127512 471
878 3300026075 Ga0207708_10040517 Ga0207708_100405172 471
879 3300026078 Ga0207702_10000198 Ga0207702_1000019830 471
880 3300026088 Ga0207641_10000417 Ga0207641_1000041710 471
881 3300026088 Ga0207641_10044363 Ga0207641_100443632 471
882 3300026088 Ga0207641_10240009 Ga0207641_102400092 471
883 3300026089 Ga0207648_10000483 Ga0207648_1000048333 471
884 3300026089 Ga0207648_10098232 Ga0207648_100982322 471
885 3300026095 Ga0207676_10000372 Ga0207676_1000037212 471
886 3300026095 Ga0207676_10001984 Ga0207676_100019845 471
887 3300026121 Ga0207683_10000141 Ga0207683_100001415 471
888 3300026121 Ga0207683_10007416 Ga0207683_100074167 471
889 3300026142 Ga0207698_10005863 Ga0207698_100058639 471
890 3300027682 Ga0209971_1002132 Ga0209971_10021322 471
891 3300027717 Ga0209998_10007120 Ga0209998_100071202 471
892 3300027876 Ga0209974_10042219 Ga0209974_100422191 471
893 3300027907 Ga0207428_10000058 Ga0207428_10000058148 471
894 3300027907 Ga0207428_10001115 Ga0207428_100011156 471
895 3300027907 Ga0207428_10002874 Ga0207428_1000287412 471
896 3300028379 Ga0268266_10002234 Ga0268266_100022347 471
897 3300028379 Ga0268266_10028466 Ga0268266_100284662 471
898 3300028380 Ga0268265_10003432 Ga0268265_100034327 471
899 3300028380 Ga0268265_10043620 Ga0268265_100436202 471
900 3300028381 Ga0268264_10000412 Ga0268264_1000041253 471
901 3300028556 Ga0265337_1010903 Ga0265337_10109033 471
902 3300031241 Ga0265325_10000036 Ga0265325_1000003687 471
903 3300031241 Ga0265325_10047190 Ga0265325_100471902 471
904 3300031344 Ga0265316_10118153 Ga0265316_101181532 471
905 3300031595 Ga0265313_10000513 Ga0265313_1000051335 471
906 3300034816 Ga0373930_0000011 Ga0373930_0000011_4984_6399 471
907 3300034817 Ga0373948_0000241 Ga0373948_0000241_1632_3047 471
908 3300034818 Ga0373950_0002353 Ga0373950_0002353_600_2015 471
909 3300034819 Ga0373958_0000313 Ga0373958_0000313_1096_2511 471
910 3300034820 Ga0373959_0005453 Ga0373959_0005453_575_1996 471
911 3300034957 Ga0373938_0000404 Ga0373938_0000404_4500_5915 471
912 3300035083 Ga0373926_0017166 Ga0373926_0017166_341_1762 471
913 3300035084 Ga0373928_0000880 Ga0373928_0000880_2685_4100 471
914 3300035085 Ga0373929_0000816 Ga0373929_0000816_2057_3472 471
915 3300035088 Ga0373940_0000619 Ga0373940_0000619_4028_5443 471
916 3300035089 Ga0373944_0010711 Ga0373944_0010711_430_1851 471
917 3300035091 Ga0373951_0000312 Ga0373951_0000312_4660_6075 471
918 3300035091 Ga0373951_0006275 Ga0373951_0006275_420_1841 471
919 3300035092 Ga0373952_0000253 Ga0373952_0000253_6428_7843 471
920 3300035092 Ga0373952_0003999 Ga0373952_0003999_262_1683 471
921 3300035111 Ga0373923_0015576 Ga0373923_0015576_1034_2455 471
922 3300035111 Ga0373923_0054353 Ga0373923_0054353_169_1590 471
923 3300035112 Ga0373932_0001887 Ga0373932_0001887_713_2128 471
924 3300035112 Ga0373932_0008193 Ga0373932_0008193_728_2143 471
925 3300035112 Ga0373932_0008544 Ga0373932_0008544_332_1753 471
926 3300035113 Ga0373936_0048268 Ga0373936_0048268_173_1594 471
927 3300035114 Ga0373939_0000502 Ga0373939_0000502_2056_3471 471
928 3300035114 Ga0373939_0000832 Ga0373939_0000832_6101_7516 471
929 3300035114 Ga0373939_0002168 Ga0373939_0002168_3218_4639 471
930 3300035115 Ga0373941_0000330 Ga0373941_0000330_938_2353 471
931 3300035116 Ga0373945_0007082 Ga0373945_0007082_2105_3526 471
932 3300035117 Ga0373953_0017789 Ga0373953_0017789_975_2396 471
933 3300035119 Ga0373956_0001330 Ga0373956_0001330_5711_7132 471
934 3300035120 Ga0373957_0006863 Ga0373957_0006863_1533_2954 471
935 3300035120 Ga0373957_0008264 Ga0373957_0008264_1497_2921 471
936 3300035121 Ga0373960_0000137 Ga0373960_0000137_4605_6020 471
937 3300035171 Ga0373946_0002090 Ga0373946_0002090_3515_4936 471
938 3300035171 Ga0373946_0013540 Ga0373946_0013540_1098_2519 471
939 3300035171 Ga0373946_0023809 Ga0373946_0023809_744_2165 471
940 3300035172 Ga0373955_0002098 Ga0373955_0002098_5736_7157 471
941 3300035241 Ga0373961_0000492 Ga0373961_0000492_3460_4875 471
942 3300035241 Ga0373961_0003857 Ga0373961_0003857_2127_3548 471
943 3300035242 Ga0373962_0000279 Ga0373962_0000279_2657_4072 471
944 3300035691 Ga0373931_0000131 Ga0373931_0000131_6927_8342 471
945 3300035691 Ga0373931_0011848 Ga0373931_0011848_745_2160 471
946 3300035691 Ga0373931_0063546 Ga0373931_0063546_107_1528 471
947 3300035695 Ga0373927_0069958 Ga0373927_0069958_41_1462 471
948 3300035724 Ga0373933_0001665 Ga0373933_0001665_4108_5532 471
949 3300035724 Ga0373933_0011017 Ga0373933_0011017_2678_4099 471
950 3300035725 Ga0373947_0016533 Ga0373947_0016533_970_2391 471
951 3300035725 Ga0373947_0054904 Ga0373947_0054904_89_1510 471
952 3300036401 Ga0373937_0002145 Ga0373937_0002145_14551_15972 471
953 3300036401 Ga0373937_0003289 Ga0373937_0003289_7020_8441 471
954 3300036401 Ga0373937_0005585 Ga0373937_0005585_497_1918 471
955 3300036401 Ga0373937_0213011 Ga0373937_0213011_91_1512 471
956 3300037068 Ga0373925_0001381 Ga0373925_0001381_16740_18161 471
957 3300037068 Ga0373925_0006934 Ga0373925_0006934_3079_4500 471
958 3300037068 Ga0373925_0080847 Ga0373925_0080847_28_1449 471
959 3300042001 Ga0439441_005457 Ga0439441_005457_548_1963 471
960 3300045051 Ga0451576_0017698 Ga0451576_0017698_2051_3466 471
961 3300046454 Ga0495592_0001425 Ga0495592_0001425_12271_13692 471
962 3300046455 Ga0495603_0018444 Ga0495603_0018444_2266_3687 471
963 3300046459 Ga0495629_0001317 Ga0495629_0001317_8006_9427 471
964 3300046462 Ga0495651_0001028 Ga0495651_0001028_4268_5689 471
965 3300046462 Ga0495651_0006877 Ga0495651_0006877_5121_6542 471
966 3300046462 Ga0495651_0034700 Ga0495651_0034700_1584_3005 471
967 3300046472 Ga0495580_0027217 Ga0495580_0027217_151_1572 471
968 3300046472 Ga0495580_0081889 Ga0495580_0081889_818_2239 471
969 3300046473 Ga0495582_0008114 Ga0495582_0008114_2635_4056 471
970 3300046473 Ga0495582_0038565 Ga0495582_0038565_239_1660 471
971 3300046475 Ga0495639_0007711 Ga0495639_0007711_1712_3133 471
972 3300046476 Ga0495662_0005794 Ga0495662_0005794_2532_3953 471
973 3300046477 Ga0495664_0009525 Ga0495664_0009525_1779_3200 471
974 3300046491 Ga0495584_0013764 Ga0495584_0013764_263_1684 471
975 3300046492 Ga0495585_0002983 Ga0495585_0002983_5715_7136 471
976 3300046499 Ga0495594_0023399 Ga0495594_0023399_1214_2635 471
977 3300046501 Ga0495607_0033049 Ga0495607_0033049_648_2069 471
978 3300046511 Ga0495608_0011395 Ga0495608_0011395_696_2117 471
979 3300046511 Ga0495608_0011757 Ga0495608_0011757_4211_5632 471
980 3300046511 Ga0495608_0046951 Ga0495608_0046951_604_2028 471
981 3300046514 Ga0495618_0015603 Ga0495618_0015603_1115_2536 471
982 3300046516 Ga0495628_0032380 Ga0495628_0032380_772_2193 471
983 3300046516 Ga0495628_0048931 Ga0495628_0048931_1701_3122 471
984 3300046517 Ga0495630_0072327 Ga0495630_0072327_980_2401 471
985 3300046523 Ga0495644_0026755 Ga0495644_0026755_102_1523 471
986 3300046526 Ga0495666_0021525 Ga0495666_0021525_514_1935 471
987 3300046529 Ga0495652_0006243 Ga0495652_0006243_2405_3826 471
988 3300046531 Ga0495665_0008064 Ga0495665_0008064_373_1794 471
989 3300046533 Ga0495640_0022609 Ga0495640_0022609_300_1721 471
990 3300046536 Ga0495587_0012035 Ga0495587_0012035_1701_3122 471
991 3300046537 Ga0495598_0006198 Ga0495598_0006198_1239_2660 471
992 3300046543 Ga0495645_0008421 Ga0495645_0008421_5521_6942 471
993 3300046558 Ga0495633_0047131 Ga0495633_0047131_197_1618 471
994 3300046559 Ga0495667_0004749 Ga0495667_0004749_5664_7085 471
995 3300046559 Ga0495667_0017859 Ga0495667_0017859_2521_3942 471
996 3300046559 Ga0495667_0123335 Ga0495667_0123335_193_1617 471
997 3300046615 Ga0495656_0002224 Ga0495656_0002224_2460_3881 471
998 3300046642 Ga0495634_0059015 Ga0495634_0059015_138_1559 471
999 3300046663 Ga0495635_0003581 Ga0495635_0003581_7101_8522 471
1000 3300046663 Ga0495635_0086692 Ga0495635_0086692_234_1655 471
1001 3300046664 Ga0495659_0002344 Ga0495659_0002344_3610_5031 471
1002 3300046674 Ga0495588_0001979 Ga0495588_0001979_6381_7802 471
1003 3300046675 Ga0495657_0015907 Ga0495657_0015907_428_1849 471
1004 3300046675 Ga0495657_0018234 Ga0495657_0018234_3310_4734 471
1005 3300046678 Ga0495599_0005324 Ga0495599_0005324_3264_4685 471
1006 3300046678 Ga0495599_0068953 Ga0495599_0068953_696_2117 471
1007 3300046679 Ga0495623_0000554 Ga0495623_0000554_12974_14395 471
1008 3300046681 Ga0495647_0002658 Ga0495647_0002658_675_2096 471
1009 3300046683 Ga0495658_0004985 Ga0495658_0004985_2693_4114 471
1010 3300046683 Ga0495658_0007896 Ga0495658_0007896_1770_3191 471
1011 3300046683 Ga0495658_0015425 Ga0495658_0015425_114_1535 471
1012 3300046684 Ga0495669_0064220 Ga0495669_0064220_58_1473 471
1013 3300046690 Ga0495624_0013261 Ga0495624_0013261_618_2039 471
1014 3300046691 Ga0495670_0038246 Ga0495670_0038246_247_1668 471
1015 3300046809 Ga0495600_0000989 Ga0495600_0000989_6809_8230 471
1016 3300047315 Ga0495581_0011122 Ga0495581_0011122_1955_3376 471
1017 3300047315 Ga0495581_0035026 Ga0495581_0035026_575_1996 471
1018 3300047317 Ga0495604_0007911 Ga0495604_0007911_269_1690 471
1019 3300047317 Ga0495604_0008426 Ga0495604_0008426_253_1674 471
1020 3300047319 Ga0495674_0042306 Ga0495674_0042306_425_1846 471
1021 3300047321 Ga0495676_0060276 Ga0495676_0060276_794_2215 471
1022 3300047322 Ga0495680_0001832 Ga0495680_0001832_9019_10440 471
1023 3300047322 Ga0495680_0022544 Ga0495680_0022544_49_1470 471
1024 3300047322 Ga0495680_0047732 Ga0495680_0047732_533_1954 471
1025 3300047322 Ga0495680_0083674 Ga0495680_0083674_428_1849 471
1026 3300047444 Ga0495675_0000625 Ga0495675_0000625_10442_11863 471
1027 3300047471 Ga0495684_0000517 Ga0495684_0000517_26300_27721 471
1028 3300047471 Ga0495684_0019009 Ga0495684_0019009_630_2051 471
1029 3300047471 Ga0495684_0053566 Ga0495684_0053566_1083_2504 471
1030 3300047673 Ga0495593_0011494 Ga0495593_0011494_976_2397 471
1031 3300048088 Ga0495602_0017182 Ga0495602_0017182_596_2017 471
1032 3300048088 Ga0495602_0035207 Ga0495602_0035207_2081_3505 471
1033 3300048088 Ga0495602_0052529 Ga0495602_0052529_2093_3514 471
1034 3300048089 Ga0495614_0002673 Ga0495614_0002673_376_1797 471
1035 3300048903 Ga0496100_0001822 Ga0496100_0001822_8814_10235 471
1036 3300048903 Ga0496100_0007937 Ga0496100_0007937_4132_5547 471
1037 3300048903 Ga0496100_0036333 Ga0496100_0036333_921_2342 471
1038 3300048904 Ga0496101_0001253 Ga0496101_0001253_6849_8264 471
1039 3300048904 Ga0496101_0035739 Ga0496101_0035739_1326_2747 471
1040 3300048905 Ga0496102_0002101 Ga0496102_0002101_6929_8344 471
1041 3300048906 Ga0496103_0004504 Ga0496103_0004504_6192_7607 471
1042 3300048906 Ga0496103_0017251 Ga0496103_0017251_1323_2744 471
1043 3300048906 Ga0496103_0019471 Ga0496103_0019471_974_2389 471
1044 3300048907 Ga0496104_0000055 Ga0496104_0000055_74812_76233 471
1045 3300048907 Ga0496104_0043386 Ga0496104_0043386_645_2066 471
1046 3300048907 Ga0496104_0056436 Ga0496104_0056436_1216_2637 471
1047 3300048908 Ga0496105_0000918 Ga0496105_0000918_8887_10308 471
1048 3300048908 Ga0496105_0027859 Ga0496105_0027859_2120_3541 471
1049 3300048909 Ga0496106_0000317 Ga0496106_0000317_25536_26951 471
1050 3300048910 Ga0496107_0015091 Ga0496107_0015091_3572_4993 471
1051 3300048910 Ga0496107_0038665 Ga0496107_0038665_836_2251 471
1052 3300048910 Ga0496107_0069882 Ga0496107_0069882_415_1830 471
1053 3300048911 Ga0496108_0002477 Ga0496108_0002477_6457_7872 471
1054 3300048911 Ga0496108_0086804 Ga0496108_0086804_987_2408 471
1055 3300048911 Ga0496108_0092288 Ga0496108_0092288_1111_2526 471
1056 3300048912 Ga0496109_0000812 Ga0496109_0000812_17787_19202 471
1057 3300048912 Ga0496109_0022601 Ga0496109_0022601_338_1753 471
1058 3300048912 Ga0496109_0051967 Ga0496109_0051967_1326_2747 471
1059 3300048913 Ga0496110_0004023 Ga0496110_0004023_6166_7587 471
1060 3300048913 Ga0496110_0057529 Ga0496110_0057529_46_1461 471
1061 3300048913 Ga0496110_0076083 Ga0496110_0076083_754_2169 471
1062 3300048914 Ga0496111_0011787 Ga0496111_0011787_817_2232 471
1063 3300048914 Ga0496111_0020826 Ga0496111_0020826_1226_2647 471
1064 3300048915 Ga0496112_0002948 Ga0496112_0002948_6133_7554 471
1065 3300048916 Ga0496113_0016912 Ga0496113_0016912_2603_4018 471
1066 3300048916 Ga0496113_0023896 Ga0496113_0023896_2469_3884 471
1067 3300048916 Ga0496113_0034483 Ga0496113_0034483_1046_2467 471
1068 3300048917 Ga0496114_0003697 Ga0496114_0003697_3414_4829 471
1069 3300048917 Ga0496114_0011582 Ga0496114_0011582_1893_3314 471
1070 3300048918 Ga0496115_0008581 Ga0496115_0008581_321_1742 471
1071 3300048918 Ga0496115_0026529 Ga0496115_0026529_3049_4470 471
1072 3300048918 Ga0496115_0029394 Ga0496115_0029394_881_2296 471
1073 3300048918 Ga0496115_0084107 Ga0496115_0084107_649_2070 471
1074 3300049569 Ga0501032_0009993 Ga0501032_0009993_2263_3684 471
1075 3300049571 Ga0501034_0009010 Ga0501034_0009010_3200_4621 471
1076 3300049572 Ga0501036_0014217 Ga0501036_0014217_3072_4493 471
1077 3300049573 Ga0501037_0012566 Ga0501037_0012566_2150_3571 471
1078 3300049574 Ga0501038_0008817 Ga0501038_0008817_2640_4061 471
1079 3300049577 Ga0501041_0039968 Ga0501041_0039968_845_2266 471
1080 3300049578 Ga0501042_0009123 Ga0501042_0009123_4184_5605 471
1081 3300049579 Ga0501043_0006297 Ga0501043_0006297_5038_6459 471
1082 3300049579 Ga0501043_0135173 Ga0501043_0135173_416_1858 471
1083 3300049581 Ga0501047_0046860 Ga0501047_0046860_1215_2636 471
1084 3300049581 Ga0501047_0126099 Ga0501047_0126099_814_2256 471
1085 3300049581 Ga0501047_0144977 Ga0501047_0144977_377_1798 471
1086 3300049582 Ga0501048_0005853 Ga0501048_0005853_2999_4420 471
1087 3300049583 Ga0501067_0015989 Ga0501067_0015989_2529_3950 471
1088 3300049584 Ga0501068_0040713 Ga0501068_0040713_1183_2604 471
1089 3300049585 Ga0501069_0001041 Ga0501069_0001041_7367_8788 471
1090 3300049586 Ga0501070_0023917 Ga0501070_0023917_499_1920 471
1091 3300049586 Ga0501070_0111438 Ga0501070_0111438_566_1984 471
1092 3300049587 Ga0501071_0021040 Ga0501071_0021040_27_1448 471
1093 3300049588 Ga0501072_0031660 Ga0501072_0031660_528_1949 471
1094 3300049588 Ga0501072_0032742 Ga0501072_0032742_1623_3044 471
1095 3300049588 Ga0501072_0041202 Ga0501072_0041202_1204_2625 471
1096 3300049589 Ga0501073_0021662 Ga0501073_0021662_1541_2962 471
1097 3300049590 Ga0501074_0059241 Ga0501074_0059241_842_2260 471
1098 3300049592 Ga0501076_0006991 Ga0501076_0006991_1593_3014 471
1099 3300049592 Ga0501076_0042538 Ga0501076_0042538_299_1720 471
1100 3300049741 Ga0501079_0034801 Ga0501079_0034801_828_2249 471
1101 3300049741 Ga0501079_0063709 Ga0501079_0063709_432_1850 471
1102 3300049742 Ga0501080_0059890 Ga0501080_0059890_1184_2605 471
1103 3300049742 Ga0501080_0216580 Ga0501080_0216580_30_1448 471
1104 3300049743 Ga0501081_0027992 Ga0501081_0027992_869_2290 471
1105 3300049744 Ga0501083_0017096 Ga0501083_0017096_1279_2700 471
1106 3300049823 Ga0501044_0000708 Ga0501044_0000708_22079_23500 471
1107 3300049823 Ga0501044_0023822 Ga0501044_0023822_3200_4621 471
1108 3300049823 Ga0501044_0229647 Ga0501044_0229647_143_1567 471
1109 3300049824 Ga0501045_0031096 Ga0501045_0031096_2113_3534 471
1110 3300050496 nmdc:mga07m45_79108_c1 nmdc:mga07m45_79108_c1_317_1738 471
1111 3300050507 nmdc:mga05p37_675_c1 nmdc:mga05p37_675_c1_26739_28160 471
1112 3300050508 nmdc:mga09592_12884_c1 nmdc:mga09592_12884_c1_699_2120 471
1113 3300050509 nmdc:mga0qj67_229_c1 nmdc:mga0qj67_229_c1_9998_11419 471
1114 3300050510 nmdc:mga06r32_4977_c1 nmdc:mga06r32_4977_c1_6574_7995 471
1115 3300050511 nmdc:mga08y16_1152_c1 nmdc:mga08y16_1152_c1_14643_16064 471
1116 3300050511 nmdc:mga08y16_6860_c1 nmdc:mga08y16_6860_c1_6926_8341 471
1117 3300050511 nmdc:mga08y16_8101_c1 nmdc:mga08y16_8101_c1_3452_4867 471
1118 3300050512 nmdc:mga0n895_14204_c1 nmdc:mga0n895_14204_c1_5513_6940 471
1119 3300050512 nmdc:mga0n895_24792_c1 nmdc:mga0n895_24792_c1_4105_5526 471
1120 3300050512 nmdc:mga0n895_2947_c1 nmdc:mga0n895_2947_c1_6499_7914 471
1121 3300050512 nmdc:mga0n895_3362_c1 nmdc:mga0n895_3362_c1_4398_5819 471
1122 3300050512 nmdc:mga0n895_73_c1 nmdc:mga0n895_73_c1_7049_8470 471
1123 3300050513 nmdc:mga0rr50_138021_c1 nmdc:mga0rr50_138021_c1_158_1579 471
1124 3300050513 nmdc:mga0rr50_747_c1 nmdc:mga0rr50_747_c1_5795_7216 471
1125 3300050515 nmdc:mga0a205_16585_c1 nmdc:mga0a205_16585_c1_1739_3160 471
1126 3300050515 nmdc:mga0a205_214946_c1 nmdc:mga0a205_214946_c1_46_1461 471
1127 3300050515 nmdc:mga0a205_4115_c1 nmdc:mga0a205_4115_c1_8445_9860 471
1128 3300050515 nmdc:mga0a205_59_c1 nmdc:mga0a205_59_c1_7030_8451 471
1129 3300053077 Ga0495601_0000357 Ga0495601_0000357_15532_16953 471
1130 3300053077 Ga0495601_0000555 Ga0495601_0000555_5888_7309 471
1131 3300053077 Ga0495601_0022810 Ga0495601_0022810_1445_2866 471
1132 3300053078 Ga0495612_0000539 Ga0495612_0000539_8671_10092 471
1133 3300053078 Ga0495612_0014087 Ga0495612_0014087_254_1675 471
1134 3300053078 Ga0495612_0016752 Ga0495612_0016752_421_1842 471
1135 3300053078 Ga0495612_0027133 Ga0495612_0027133_421_1845 471
1136 3300053084 Ga0495595_0000939 Ga0495595_0000939_1847_3268 471
1137 3300053084 Ga0495595_0001313 Ga0495595_0001313_6661_8082 471
1138 3300053084 Ga0495595_0002410 Ga0495595_0002410_5597_7021 471
1139 3300053085 Ga0495619_0000085 Ga0495619_0000085_41551_42972 471
1140 3300053085 Ga0495619_0000380 Ga0495619_0000380_24053_25474 471
1141 3300053085 Ga0495619_0000636 Ga0495619_0000636_6294_7715 471
1142 3300053085 Ga0495619_0002427 Ga0495619_0002427_3948_5369 471
1143 3300053085 Ga0495619_0009386 Ga0495619_0009386_1619_3043 471
1144 3300054114 Ga0501084_0038702 Ga0501084_0038702_1041_2462 471
1145 3300060353 Ga0501082_0004773 Ga0501082_0004773_3169_4590 471
1146 3300061734 Ga0530510_0064081 Ga0530510_0064081_885_2300 471

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01565

FAD_binding_4

FAD binding domain

104

241

0.98

PF02913

FAD-oxidase_C

FAD linked oxidases, C-terminal domain

277

518

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
8jde-assembly1.cif.gz_A crystal structure of mldhd in complex with d-lactate 0.9535 17 468
8jdo-assembly1.cif.gz_A crystal structure of h405a mldhd in complex with d-2-hydroxyhexanoic acid 0.9493 12 468
8jdp-assembly1.cif.gz_A crystal structure of h405a mldhd in complex with d-2-hydroxyisovaleric acid 0.9484 12 468
8jdc-assembly1.cif.gz_A crystal structure of mldhd in apo form 0.9482 12 468
8jdx-assembly1.cif.gz_A crystal structure of mldhd in complex with 2-ketoisovaleric acid 0.9477 12 468
ID Description Score Start End Superfamily
af_Q7TNG8_361_443_3.30.70.2740 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9913 347 427 3.30.70.2740
af_Q86WU2_267_377_3.30.70.2190 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9867 228 337 3.30.70.2190
af_Q55BQ4_423_504_3.30.70.2740 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9822 347 427 3.30.70.2740
af_Q7TPJ4_275_344_3.30.70.2190 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9778 248 316 3.30.70.2190
af_Q94AX4_441_520_3.30.70.2740 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9709 348 427 3.30.70.2740
ID Description Score Start End GO Terms
AF-A0A7T7BD72-F1-model_v4 deleted 0.9779 239 419
AF-A0A436FTH0-F1-model_v4 FAD-binding oxidoreductase 0.9748 171 471 GO:0004458
GO:0008720
GO:0071949
GO:1903457
AF-A0A803RAW2-F1-model_v4 FAD-binding oxidoreductase/transferase type 4 C-terminal domain-containing protein 0.971 264 468 GO:0004458
GO:0005739
GO:0008720
GO:0050660
GO:1903457
AF-A0A436FTH0-F1-model_v4 FAD-binding oxidoreductase 0.9684 171 471 GO:0004458
GO:0008720
GO:0071949
GO:1903457
AF-A0A821IVH0-F1-model_v4 D-lactate dehydrogenase (cytochrome) (EC 1.1.2.4) 0.966 14 468 GO:0004458
GO:0005739
GO:0008720
GO:0071949
GO:1903457

Feature Viewer

pLDDT pTM Quality
91.15 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map