F490702

General Info

Members Datasets Scaffolds Average Seq Length
1140 380 1125 227

Family's Representative Sequence

Representative Sequence 3300028379|Ga0268266_10473503|Ga0268266_104735031
Length 231
Sequence MAQQLLMPKATAIWLVDNTALSFDQIAQFCKLHPLEVKAIADGEAAQGIKGLDPIATGQLSRDEIARAEGNPNYKLKLSEPKVRVPESKRRGPRYTPVSKRQDKPDGIAWIIRNHPEVSDGQISKLIGTTRTTIAAIRDRTHWNIANIVPKDPVTLGLCSQRELDAVVAKAAKAAGIEAQTDTRLEGDREALIEQLRAERDAAARGADATLADEEAALFGNSSGFQDPFKR

Samples

Sample ID Description Type Environment
1 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
2 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
3 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
4 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
5 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
6 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
7 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
8 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
9 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
10 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere
11 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
12 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
13 2990265787 Sphingomonas sp. SORGH_AS802 Isolate Aerial Root
14 2993693658 Sphingomonas sp. SORGH_AS438 Isolate Aerial Root
15 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
16 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
17 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
18 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
19 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
20 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
21 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
22 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
23 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
24 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
25 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
26 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
27 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
28 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
29 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
30 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
31 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
32 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
33 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
34 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
35 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
36 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
37 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
38 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
39 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
40 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
41 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
42 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
43 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
44 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
45 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
46 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
47 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
48 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
49 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
50 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
51 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
52 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
53 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
54 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
55 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
56 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
57 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
58 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
59 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
60 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
61 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
62 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
63 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
64 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
65 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
66 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
67 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
68 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
69 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
70 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
71 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
72 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
73 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
74 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
75 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
76 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
77 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
78 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
79 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
80 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
81 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
82 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
83 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
84 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
85 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
86 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
87 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
88 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
89 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
90 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
91 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
92 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
93 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
94 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
95 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
96 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
97 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
98 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
99 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
100 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
101 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
102 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
103 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
104 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
105 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
106 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
107 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
108 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
109 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
110 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
111 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
112 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
113 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
114 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
115 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
116 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
117 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
118 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
119 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
120 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
121 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
122 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
123 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
124 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
125 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
126 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
127 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
128 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
129 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
130 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
131 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
132 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
133 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
134 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
135 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
136 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
137 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
142 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
143 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
144 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
146 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
148 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
149 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
150 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
151 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
152 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
153 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
154 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
213 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
214 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
215 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
216 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
217 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
218 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
219 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
220 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
221 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
222 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
223 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
224 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
225 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
226 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
227 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
228 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
229 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
230 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
231 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
232 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
233 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
234 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
235 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
236 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
237 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
238 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
239 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
240 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
241 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
242 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
243 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
244 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
245 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
246 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
247 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
248 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
249 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
250 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
251 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
252 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
253 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
254 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
255 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
256 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
257 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
258 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
259 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
260 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
261 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
262 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
263 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
264 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
265 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
266 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
267 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
268 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
269 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
270 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
271 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
272 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
273 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
274 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
275 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
276 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
277 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
278 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
279 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
280 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
281 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
282 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
283 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
284 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
285 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
286 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
287 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
288 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
289 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
290 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
291 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
292 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
293 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
294 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
295 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
296 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
297 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
298 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
299 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
300 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
301 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
302 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
303 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
304 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
305 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
306 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
307 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
308 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
309 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
310 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
311 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
312 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
313 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
314 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
315 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
316 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
317 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
318 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
319 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
320 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
321 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
322 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
323 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
324 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
325 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
326 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
327 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
328 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
329 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
330 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
331 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
332 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
333 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
334 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
335 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
336 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
337 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
338 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
339 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
340 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
341 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
342 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
343 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
344 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
345 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
346 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
347 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
348 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
349 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
350 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
351 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
352 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
353 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
354 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
355 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
356 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
357 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
358 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
359 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
360 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
361 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
362 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
363 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
364 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
365 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
366 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
367 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
368 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
369 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
370 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
371 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
372 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
373 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
374 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
375 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
376 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
377 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
378 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
379 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
380 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.33
Metatranscriptomes 0.35
Isolates 1.32

Biome Distribution

Category Percentage (%)
Aerial Root 0.18
Bulb 0
Endosphere 7.89
Nodule 0
Rhizoplane 4.74
Rhizosphere 82.72
Stem 0
Stem Tuber 0
Unclassified 4.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1000030 3300001904 Bacteria 24315
2 JGI24741J21665_1001317 3300001915 Bacteria 7262
3 JGI24741J21665_1004089 3300001915 Bacteria 3310
4 JGI24752J21851_1004310 3300001976 Bacteria 1866
5 JGI24740J21852_10003058 3300001979 Bacteria 7400
6 JGI24740J21852_10030569 3300001979 Bacteria 1750
7 JGI24739J22299_10001692 3300001989 Bacteria 8378
8 JGI24739J22299_10006535 3300001989 Bacteria 4392
9 JGI24739J22299_10047732 3300001989 Bacteria 1395
10 JGI24737J22298_10002390 3300001990 Bacteria 6695
11 JGI24737J22298_10005137 3300001990 Bacteria 4532
12 JGI24737J22298_10039840 3300001990 Bacteria 1443
13 JGI24735J21928_10000944 3300002067 Bacteria 10388
14 JGI24735J21928_10014907 3300002067 Bacteria 2431
15 JGI24735J21928_10021243 3300002067 Bacteria 1982
16 JGI24735J21928_10023346 3300002067 Bacteria 1876
17 JGI24735J21928_10051268 3300002067 Bacteria 1191
18 JGI24750J21931_1000713 3300002070 Bacteria 4792
19 JGI24748J21848_1000015 3300002074 Bacteria 143883
20 JGI24738J21930_10000900 3300002075 Bacteria 8536
21 JGI24738J21930_10034667 3300002075 Bacteria 1028
22 JGI24034J26672_10000006 3300002239 Bacteria 294495
23 JGI24034J26672_10011930 3300002239 Bacteria 1306
24 JGI24742J22300_10002123 3300002244 Bacteria 3152
25 JGI24751J29686_10000093 3300002459 Bacteria 50074
26 JGI24751J29686_10004337 3300002459 Bacteria 2879
27 JGI25150J39212_1000855 3300002774 Bacteria 10133
28 JGI25165J46597_1000024 3300003214 Bacteria 335150
29 JGI25153J46596_10000008 3300003215 Bacteria 376808
30 JGI25153J46596_10000091 3300003215 Bacteria 105614
31 JGI25153J46596_10000186 3300003215 Bacteria 60427
32 JGI25153J46596_10004838 3300003215 Bacteria 7177
33 Ga0055542_1004222 3300003762 Bacteria 3565
34 Ga0055537_1001760 3300003773 Bacteria 7934
35 Ga0055537_1002910 3300003773 Bacteria 5462
36 Ga0055524_1000118 3300003775 Bacteria 93202
37 Ga0055530_10000072 3300003791 Bacteria 85675
38 Ga0055530_10019126 3300003791 Bacteria 2083
39 Ga0055540_1001847 3300003792 Bacteria 11935
40 Ga0055531_10000114 3300003794 Bacteria 88453
41 Ga0055531_10001624 3300003794 Bacteria 16296
42 Ga0065165_1002052 3300005262 Bacteria 18661
43 Ga0065165_1012710 3300005262 Bacteria 3406
44 Ga0065704_10097475 3300005289 Bacteria 2393
45 Ga0065712_10079995 3300005290 Bacteria 3157
46 Ga0065707_10082467 3300005295 Bacteria 14795
47 Ga0065707_10082564 3300005295 Bacteria 13708
48 Ga0070658_10000181 3300005327 Bacteria 55191
49 Ga0070658_10001561 3300005327 Bacteria 19422
50 Ga0070658_10007616 3300005327 Bacteria 8731
51 Ga0070658_10028040 3300005327 Bacteria 4520
52 Ga0070658_10079969 3300005327 Bacteria 2684
53 Ga0070658_10192660 3300005327 Bacteria 1718
54 Ga0070676_10005147 3300005328 Bacteria 6940
55 Ga0070676_10091881 3300005328 Bacteria 1861
56 Ga0070676_10217451 3300005328 Bacteria 1260
57 Ga0070683_100006563 3300005329 Bacteria 9770
58 Ga0070683_100122456 3300005329 Bacteria 2457
59 Ga0070683_100195833 3300005329 Bacteria 1919
60 Ga0070690_100000012 3300005330 Bacteria 91852
61 Ga0070670_100000005 3300005331 Bacteria 351569
62 Ga0070670_100000169 3300005331 Bacteria 59093
63 Ga0070670_100000528 3300005331 Bacteria 30641
64 Ga0070670_100002960 3300005331 Bacteria 14072
65 Ga0070670_100036176 3300005331 Bacteria 4250
66 Ga0070670_100049951 3300005331 Bacteria 3595
67 Ga0070677_10061237 3300005333 Bacteria 1553
68 Ga0068869_100000635 3300005334 Bacteria 19852
69 Ga0070666_10000014 3300005335 Bacteria 224479
70 Ga0070666_10004574 3300005335 Bacteria 8436
71 Ga0070666_10012077 3300005335 Bacteria 5438
72 Ga0070680_100414715 3300005336 Bacteria 1149
73 Ga0068868_100000049 3300005338 Bacteria 67274
74 Ga0068868_100119637 3300005338 Bacteria 2147
75 Ga0070660_100003617 3300005339 Bacteria 10682
76 Ga0070660_100024707 3300005339 Bacteria 4459
77 Ga0070660_100031552 3300005339 Bacteria 3980
78 Ga0070660_100045703 3300005339 Bacteria 3353
79 Ga0070660_100193300 3300005339 Bacteria 1649
80 Ga0070660_100550573 3300005339 Bacteria 962
81 Ga0070689_100029687 3300005340 Bacteria 4142
82 Ga0070691_10000763 3300005341 Bacteria 12747
83 Ga0070661_100005116 3300005344 Bacteria 9042
84 Ga0070661_100015407 3300005344 Bacteria 5396
85 Ga0070661_100022812 3300005344 Bacteria 4482
86 Ga0070661_100029811 3300005344 Bacteria 3940
87 Ga0070661_100036547 3300005344 Bacteria 3570
88 Ga0070661_100138860 3300005344 Bacteria 1830
89 Ga0070692_10060955 3300005345 Bacteria 1987
90 Ga0070692_10125102 3300005345 Bacteria 1439
91 Ga0070668_100000007 3300005347 Bacteria 150621
92 Ga0070668_100002131 3300005347 Bacteria 14472
93 Ga0070668_100011256 3300005347 Bacteria 6662
94 Ga0070668_100021509 3300005347 Bacteria 4873
95 Ga0070668_100124704 3300005347 Bacteria 2062
96 Ga0070668_100399676 3300005347 Bacteria 1173
97 Ga0070669_100000195 3300005353 Bacteria 53791
98 Ga0070669_100000351 3300005353 Bacteria 35974
99 Ga0070669_100034494 3300005353 Bacteria 3663
100 Ga0070669_100291587 3300005353 Bacteria 1310
101 Ga0070675_100002343 3300005354 Bacteria 14076
102 Ga0070675_100013583 3300005354 Bacteria 6403
103 Ga0070671_100000388 3300005355 Bacteria 30256
104 Ga0070671_100000461 3300005355 Bacteria 28331
105 Ga0070671_100014361 3300005355 Bacteria 6397
106 Ga0070671_100020224 3300005355 Bacteria 5426
107 Ga0070671_100078984 3300005355 Bacteria 2750
108 Ga0070671_100121302 3300005355 Bacteria 2200
109 Ga0070671_100239139 3300005355 Bacteria 1541
110 Ga0070674_100032561 3300005356 Bacteria 3462
111 Ga0070674_100215623 3300005356 Bacteria 1490
112 Ga0070674_100218977 3300005356 Bacteria 1480
113 Ga0070673_100000006 3300005364 Bacteria 184299
114 Ga0070673_100020191 3300005364 Bacteria 4801
115 Ga0070673_100024623 3300005364 Bacteria 4417
116 Ga0070673_100045414 3300005364 Bacteria 3406
117 Ga0070673_100065042 3300005364 Bacteria 2907
118 Ga0070688_100010920 3300005365 Bacteria 5029
119 Ga0070659_100005974 3300005366 Bacteria 8778
120 Ga0070659_100007753 3300005366 Bacteria 7808
121 Ga0070659_100031286 3300005366 Bacteria 4121
122 Ga0070659_100059821 3300005366 Bacteria 3008
123 Ga0070659_100151979 3300005366 Bacteria 1889
124 Ga0070659_100235550 3300005366 Bacteria 1513
125 Ga0070667_100000003 3300005367 Bacteria 447715
126 Ga0070667_100000327 3300005367 Bacteria 52972
127 Ga0070667_100000873 3300005367 Bacteria 27955
128 Ga0070667_100001850 3300005367 Bacteria 18783
129 Ga0070667_100022481 3300005367 Bacteria 5230
130 Ga0070667_100033868 3300005367 Bacteria 4273
131 Ga0070667_100113824 3300005367 Bacteria 2348
132 Ga0070667_100674259 3300005367 Bacteria 955
133 Ga0070714_100188223 3300005435 Bacteria 1882
134 Ga0070713_100502716 3300005436 Bacteria 1144
135 Ga0070705_100710137 3300005440 Bacteria 791
136 Ga0070663_100016888 3300005455 Bacteria 4750
137 Ga0070663_100028223 3300005455 Bacteria 3819
138 Ga0070663_100051649 3300005455 Bacteria 2930
139 Ga0070663_100113967 3300005455 Bacteria 2035
140 Ga0070663_100671073 3300005455 Bacteria 878
141 Ga0070663_100695733 3300005455 Bacteria 864
142 Ga0070678_100000505 3300005456 Bacteria 18820
143 Ga0070678_100008600 3300005456 Bacteria 6119
144 Ga0070678_100166600 3300005456 Bacteria 1791
145 Ga0070662_100005871 3300005457 Bacteria 7879
146 Ga0070662_100006250 3300005457 Bacteria 7670
147 Ga0070662_100021277 3300005457 Bacteria 4427
148 Ga0070662_100131956 3300005457 Bacteria 1927
149 Ga0070662_100228129 3300005457 Bacteria 1489
150 Ga0070681_10029966 3300005458 Bacteria 5461
151 Ga0070681_10069647 3300005458 Bacteria 3484
152 Ga0068867_100000001 3300005459 Bacteria 427563
153 Ga0068867_100029493 3300005459 Bacteria 3953
154 Ga0068867_100524361 3300005459 Bacteria 1022
155 Ga0070685_10002655 3300005466 Bacteria 9156
156 Ga0070679_100033561 3300005530 Bacteria 5082
157 Ga0070679_100153616 3300005530 Bacteria 2278
158 Ga0070684_100004255 3300005535 Bacteria 10845
159 Ga0070684_100125792 3300005535 Bacteria 2309
160 Ga0070684_100143776 3300005535 Bacteria 2158
161 Ga0068853_100016963 3300005539 Bacteria 6003
162 Ga0068853_100035156 3300005539 Bacteria 4255
163 Ga0068853_100064038 3300005539 Bacteria 3186
164 Ga0068853_100066503 3300005539 Bacteria 3130
165 Ga0068853_100106522 3300005539 Bacteria 2485
166 Ga0068853_100191840 3300005539 Bacteria 1857
167 Ga0068853_100261358 3300005539 Bacteria 1591
168 Ga0068853_100289580 3300005539 Bacteria 1512
169 Ga0070672_100006310 3300005543 Bacteria 7951
170 Ga0070672_100014230 3300005543 Bacteria 5633
171 Ga0070672_100064036 3300005543 Bacteria 2904
172 Ga0070672_100185299 3300005543 Bacteria 1736
173 Ga0070686_100000002 3300005544 Bacteria 336303
174 Ga0070686_100046913 3300005544 Bacteria 2729
175 Ga0070695_100011571 3300005545 Bacteria 5279
176 Ga0070696_100003877 3300005546 Bacteria 9991
177 Ga0070696_100006531 3300005546 Bacteria 7787
178 Ga0070665_100000025 3300005548 Bacteria 367488
179 Ga0070665_100000471 3300005548 Bacteria 58097
180 Ga0070665_100009495 3300005548 Bacteria 9838
181 Ga0070665_100050070 3300005548 Bacteria 4192
182 Ga0070665_100069910 3300005548 Bacteria 3518
183 Ga0070665_100597007 3300005548 Bacteria 1117
184 Ga0068855_100000023 3300005563 Bacteria 190440
185 Ga0068855_100003431 3300005563 Bacteria 19388
186 Ga0068855_100058591 3300005563 Bacteria 4509
187 Ga0068855_100256310 3300005563 Bacteria 1950
188 Ga0068855_100259344 3300005563 Bacteria 1937
189 Ga0070664_100000093 3300005564 Bacteria 57415
190 Ga0070664_100003267 3300005564 Bacteria 13100
191 Ga0070664_100006241 3300005564 Bacteria 9626
192 Ga0070664_100062965 3300005564 Bacteria 3162
193 Ga0070664_100073476 3300005564 Bacteria 2934
194 Ga0070664_100081692 3300005564 Bacteria 2786
195 Ga0070664_100168737 3300005564 Bacteria 1940
196 Ga0068857_100015202 3300005577 Bacteria 6716
197 Ga0068857_100015964 3300005577 Bacteria 6577
198 Ga0068857_100288529 3300005577 Bacteria 1510
199 Ga0068854_100000722 3300005578 Bacteria 19534
200 Ga0068854_100005206 3300005578 Bacteria 8205
201 Ga0068854_100027141 3300005578 Bacteria 3944
202 Ga0068854_100029193 3300005578 Bacteria 3817
203 Ga0068854_100095691 3300005578 Bacteria 2217
204 Ga0068854_100100723 3300005578 Bacteria 2166
205 Ga0068854_100121256 3300005578 Bacteria 1985
206 Ga0068854_100164056 3300005578 Bacteria 1723
207 Ga0068854_100247681 3300005578 Bacteria 1421
208 Ga0068856_100033806 3300005614 Bacteria 5007
209 Ga0068856_100042299 3300005614 Bacteria 4481
210 Ga0068856_100063293 3300005614 Bacteria 3655
211 Ga0068856_100275276 3300005614 Bacteria 1700
212 Ga0068856_100290640 3300005614 Bacteria 1651
213 Ga0068852_100001538 3300005616 Bacteria 15655
214 Ga0068852_100021306 3300005616 Bacteria 5172
215 Ga0068852_100043422 3300005616 Bacteria 3813
216 Ga0068852_100049064 3300005616 Bacteria 3610
217 Ga0068859_100007110 3300005617 Bacteria 11360
218 Ga0068859_100008939 3300005617 Bacteria 10118
219 Ga0068859_100014394 3300005617 Bacteria 7938
220 Ga0068859_100021440 3300005617 Bacteria 6485
221 Ga0068859_100029142 3300005617 Bacteria 5540
222 Ga0068859_100065318 3300005617 Bacteria 3673
223 Ga0068859_100127874 3300005617 Bacteria 2611
224 Ga0068859_100256410 3300005617 Bacteria 1840
225 Ga0068859_100358221 3300005617 Bacteria 1554
226 Ga0068864_100000004 3300005618 Bacteria 489341
227 Ga0068864_100000011 3300005618 Bacteria 350056
228 Ga0068864_100000078 3300005618 Bacteria 103622
229 Ga0068864_100003288 3300005618 Bacteria 13355
230 Ga0068864_100012174 3300005618 Bacteria 7111
231 Ga0068864_100017806 3300005618 Bacteria 5927
232 Ga0068864_100070649 3300005618 Bacteria 3038
233 Ga0068866_10001322 3300005718 Bacteria 10746
234 Ga0068861_100000132 3300005719 Bacteria 38465
235 Ga0068861_100000629 3300005719 Bacteria 20887
236 Ga0068861_100017934 3300005719 Bacteria 5033
237 Ga0068861_100233353 3300005719 Bacteria 1561
238 Ga0068851_10005578 3300005834 Bacteria 5708
239 Ga0068851_10025486 3300005834 Bacteria 2901
240 Ga0068851_10027636 3300005834 Bacteria 2797
241 Ga0068851_10078004 3300005834 Bacteria 1725
242 Ga0068851_10090935 3300005834 Bacteria 1606
243 Ga0068863_100000002 3300005841 Bacteria 489510
244 Ga0068863_100000270 3300005841 Bacteria 54081
245 Ga0068863_100001062 3300005841 Bacteria 27480
246 Ga0068863_100001939 3300005841 Bacteria 20551
247 Ga0068863_100002169 3300005841 Bacteria 19450
248 Ga0068863_100003398 3300005841 Bacteria 15704
249 Ga0068863_100004607 3300005841 Bacteria 13580
250 Ga0068863_100017965 3300005841 Bacteria 6769
251 Ga0068863_100053028 3300005841 Bacteria 3843
252 Ga0068863_100076334 3300005841 Bacteria 3170
253 Ga0068863_100370262 3300005841 Bacteria 1398
254 Ga0068858_100000181 3300005842 Bacteria 66254
255 Ga0068858_100000832 3300005842 Bacteria 32118
256 Ga0068858_100006226 3300005842 Bacteria 11628
257 Ga0068858_100006347 3300005842 Bacteria 11512
258 Ga0068858_100007133 3300005842 Bacteria 10854
259 Ga0068858_100180276 3300005842 Bacteria 1994
260 Ga0068860_100000001 3300005843 Bacteria 703043
261 Ga0068860_100000045 3300005843 Bacteria 223252
262 Ga0068860_100000834 3300005843 Bacteria 34494
263 Ga0068860_100004334 3300005843 Bacteria 14504
264 Ga0068860_100016501 3300005843 Bacteria 7203
265 Ga0068860_100060507 3300005843 Bacteria 3599
266 Ga0068860_100076230 3300005843 Bacteria 3189
267 Ga0068860_100080027 3300005843 Bacteria 3107
268 Ga0068860_100347777 3300005843 Bacteria 1458
269 Ga0068860_100423460 3300005843 Bacteria 1320
270 Ga0068860_100693098 3300005843 Bacteria 1028
271 Ga0068862_100000002 3300005844 Bacteria 489341
272 Ga0068862_100000011 3300005844 Bacteria 270105
273 Ga0068862_100000032 3300005844 Bacteria 179887
274 Ga0068862_100000048 3300005844 Bacteria 150043
275 Ga0068862_100000989 3300005844 Bacteria 27179
276 Ga0068862_100007656 3300005844 Bacteria 8943
277 Ga0068862_100009813 3300005844 Bacteria 7911
278 Ga0068862_100199992 3300005844 Bacteria 1801
279 Ga0070712_100210454 3300006175 Bacteria 1533
280 Ga0097621_100002557 3300006237 Bacteria 12458
281 Ga0068871_100031090 3300006358 Bacteria 4207
282 Ga0075430_100038654 3300006846 Bacteria 4042
283 Ga0068865_100000003 3300006881 Bacteria 231761
284 Ga0097620_100007111 3300006931 Bacteria 11360
285 Ga0097620_100008939 3300006931 Bacteria 10118
286 Ga0097620_100014392 3300006931 Bacteria 7938
287 Ga0097620_100021440 3300006931 Bacteria 6485
288 Ga0097620_100029143 3300006931 Bacteria 5540
289 Ga0097620_100065319 3300006931 Bacteria 3673
290 Ga0097620_100127861 3300006931 Bacteria 2611
291 Ga0097620_100256395 3300006931 Bacteria 1840
292 Ga0097620_100358208 3300006931 Bacteria 1554
293 Ga0105251_10000342 3300009011 Bacteria 46221
294 Ga0105250_10005428 3300009092 Bacteria 5719
295 Ga0105240_10009282 3300009093 Bacteria 13947
296 Ga0105240_10011291 3300009093 Bacteria 12447
297 Ga0105240_10040268 3300009093 Bacteria 5978
298 Ga0105240_10075745 3300009093 Bacteria 4150
299 Ga0105240_10079587 3300009093 Bacteria 4032
300 Ga0111539_10073522 3300009094 Bacteria 4030
301 Ga0105245_10001536 3300009098 Bacteria 20925
302 Ga0105245_10006243 3300009098 Bacteria 10483
303 Ga0105245_10031992 3300009098 Bacteria 4657
304 Ga0105247_10012347 3300009101 Bacteria 5130
305 Ga0105247_10155492 3300009101 Bacteria 1510
306 Ga0105243_10000611 3300009148 Bacteria 35583
307 Ga0105243_10001363 3300009148 Bacteria 21679
308 Ga0105243_10412562 3300009148 Bacteria 1257
309 Ga0105241_10011404 3300009174 Bacteria 6515
310 Ga0105242_10000818 3300009176 Bacteria 24172
311 Ga0105242_10003633 3300009176 Bacteria 12007
312 Ga0105242_10258590 3300009176 Bacteria 1572
313 Ga0105242_10719686 3300009176 Bacteria 979
314 Ga0105248_10000016 3300009177 Bacteria 308151
315 Ga0105248_10000069 3300009177 Bacteria 120989
316 Ga0105248_10002223 3300009177 Bacteria 21450
317 Ga0105248_10002773 3300009177 Bacteria 19480
318 Ga0105248_10014376 3300009177 Bacteria 8711
319 Ga0105248_10026331 3300009177 Bacteria 6470
320 Ga0105248_10033496 3300009177 Bacteria 5739
321 Ga0105248_10046730 3300009177 Bacteria 4853
322 Ga0105248_10065059 3300009177 Bacteria 4093
323 Ga0105248_10069459 3300009177 Bacteria 3955
324 Ga0105248_10155231 3300009177 Bacteria 2583
325 Ga0105248_10374757 3300009177 Bacteria 1602
326 Ga0105248_10426907 3300009177 Bacteria 1493
327 Ga0105248_10471263 3300009177 Bacteria 1415
328 Ga0105237_10030869 3300009545 Bacteria 5438
329 Ga0105237_10032851 3300009545 Bacteria 5253
330 Ga0105237_10054983 3300009545 Bacteria 3987
331 Ga0105237_10155275 3300009545 Bacteria 2285
332 Ga0105237_10570343 3300009545 Bacteria 1138
333 Ga0105238_10003703 3300009551 Bacteria 15217
334 Ga0105238_10016971 3300009551 Bacteria 7389
335 Ga0105238_10020220 3300009551 Bacteria 6776
336 Ga0105238_10025509 3300009551 Bacteria 6026
337 Ga0105238_10056843 3300009551 Bacteria 3924
338 Ga0105238_10067233 3300009551 Bacteria 3585
339 Ga0105238_10154632 3300009551 Bacteria 2269
340 Ga0105238_10367966 3300009551 Bacteria 1428
341 Ga0105238_10633714 3300009551 Bacteria 1078
342 Ga0105238_10969517 3300009551 Bacteria 870
343 Ga0105249_10000005 3300009553 Bacteria 362467
344 Ga0105249_10000017 3300009553 Bacteria 277115
345 Ga0105249_10000106 3300009553 Bacteria 115526
346 Ga0105249_10005694 3300009553 Bacteria 10774
347 Ga0105249_10166446 3300009553 Bacteria 2134
348 Ga0105249_10266691 3300009553 Bacteria 1704
349 Ga0105239_10070023 3300010375 Bacteria 3853
350 Ga0105239_10098131 3300010375 Bacteria 3238
351 Ga0105246_10000620 3300011119 Bacteria 19799
352 Ga0157373_10028624 3300013100 Bacteria 4019
353 Ga0157373_10085988 3300013100 Bacteria 2216
354 Ga0157373_10102585 3300013100 Bacteria 2013
355 Ga0157373_10136279 3300013100 Bacteria 1726
356 Ga0157373_10272680 3300013100 Bacteria 1198
357 Ga0157373_10429189 3300013100 Bacteria 949
358 Ga0157373_10537277 3300013100 Bacteria 847
359 Ga0157371_10000110 3300013102 Bacteria 124933
360 Ga0157371_10037024 3300013102 Bacteria 3494
361 Ga0157371_10040991 3300013102 Bacteria 3306
362 Ga0157371_10128541 3300013102 Bacteria 1802
363 Ga0157371_10152424 3300013102 Bacteria 1649
364 Ga0157370_10012605 3300013104 Bacteria 8761
365 Ga0157370_10041223 3300013104 Bacteria 4456
366 Ga0157370_10112118 3300013104 Bacteria 2549
367 Ga0157369_10002495 3300013105 Bacteria 22057
368 Ga0157369_10003524 3300013105 Bacteria 18600
369 Ga0157369_10008669 3300013105 Bacteria 11658
370 Ga0157369_10008947 3300013105 Bacteria 11468
371 Ga0157369_10009057 3300013105 Bacteria 11398
372 Ga0157369_10068610 3300013105 Bacteria 3810
373 Ga0157369_10094805 3300013105 Bacteria 3186
374 Ga0157374_10006203 3300013296 Bacteria 10133
375 Ga0157374_10046810 3300013296 Bacteria 4007
376 Ga0157374_10070052 3300013296 Bacteria 3303
377 Ga0157374_10080623 3300013296 Bacteria 3087
378 Ga0157374_10090575 3300013296 Bacteria 2916
379 Ga0157374_11346219 3300013296 Bacteria 736
380 Ga0157378_10008062 3300013297 Bacteria 9195
381 Ga0157378_10033143 3300013297 Bacteria 4566
382 Ga0157378_10042832 3300013297 Bacteria 4019
383 Ga0157378_10217265 3300013297 Bacteria 1816
384 Ga0163162_10005086 3300013306 Bacteria 12670
385 Ga0163162_10048885 3300013306 Bacteria 4238
386 Ga0163162_10050115 3300013306 Bacteria 4187
387 Ga0163162_10081335 3300013306 Bacteria 3310
388 Ga0163162_10091245 3300013306 Bacteria 3129
389 Ga0163162_10250436 3300013306 Bacteria 1903
390 Ga0157372_10064804 3300013307 Bacteria 4100
391 Ga0157372_10085245 3300013307 Bacteria 3583
392 Ga0157372_10107945 3300013307 Bacteria 3185
393 Ga0157372_10116707 3300013307 Bacteria 3061
394 Ga0157372_10305248 3300013307 Bacteria 1852
395 Ga0157372_10494116 3300013307 Bacteria 1427
396 Ga0157372_10510680 3300013307 Bacteria 1401
397 Ga0157372_10512443 3300013307 Bacteria 1399
398 Ga0157372_10605423 3300013307 Bacteria 1277
399 Ga0157375_10004152 3300013308 Bacteria 12569
400 Ga0157375_10035911 3300013308 Bacteria 4735
401 Ga0157375_10037485 3300013308 Bacteria 4646
402 Ga0157375_10435869 3300013308 Bacteria 1476
403 Ga0163163_10000588 3300014325 Bacteria 32034
404 Ga0163163_10039738 3300014325 Bacteria 4593
405 Ga0163163_10095415 3300014325 Bacteria 2994
406 Ga0163163_10346614 3300014325 Bacteria 1541
407 Ga0163163_11008936 3300014325 Bacteria 896
408 Ga0157380_10000363 3300014326 Bacteria 27231
409 Ga0157380_10001569 3300014326 Bacteria 15028
410 Ga0157380_10024926 3300014326 Bacteria 4532
411 Ga0157379_10031170 3300014968 Bacteria 4749
412 Ga0157379_10034380 3300014968 Bacteria 4520
413 Ga0157379_10154402 3300014968 Bacteria 2070
414 Ga0157379_10181989 3300014968 Bacteria 1899
415 Ga0157376_10000955 3300014969 Bacteria 18842
416 Ga0157376_10001235 3300014969 Bacteria 16843
417 Ga0163161_10000509 3300017792 Bacteria 31722
418 Ga0163161_10007048 3300017792 Bacteria 7777
419 Ga0163161_10294282 3300017792 Bacteria 1277
420 Ga0206356_10636768 3300020070 Bacteria 2955
421 Ga0206356_10794718 3300020070 Bacteria 2159
422 Ga0206354_10580221 3300020081 Bacteria 4717
423 Ga0206353_11160495 3300020082 Bacteria 3360
424 Ga0213876_10000714 3300021384 Bacteria 23269
425 Ga0213875_10001461 3300021388 Bacteria 15300
426 Ga0213875_10002933 3300021388 Bacteria 9939
427 Ga0207672_1001571 3300025223 Bacteria 1656
428 Ga0209563_100130 3300025230 Bacteria 98627
429 Ga0209677_107479 3300025253 Bacteria 2314
430 Ga0209148_1000171 3300025254 Bacteria 131700
431 Ga0209129_1003658 3300025258 Bacteria 6544
432 Ga0209233_1000084 3300025261 Bacteria 335222
433 Ga0209233_1018102 3300025261 Bacteria 1905
434 Ga0209565_1000011 3300025263 Bacteria 637062
435 Ga0209565_1000170 3300025263 Bacteria 84580
436 Ga0209455_1001814 3300025272 Bacteria 8967
437 Ga0209455_1009677 3300025272 Bacteria 2511
438 Ga0209673_1000827 3300025273 Bacteria 40748
439 Ga0209673_1008761 3300025273 Bacteria 4463
440 Ga0209676_1006991 3300025292 Bacteria 5422
441 Ga0209025_1000068 3300025294 Bacteria 294129
442 Ga0209564_1000335 3300025295 Bacteria 91079
443 Ga0209564_1016363 3300025295 Bacteria 2957
444 Ga0209758_1000017 3300025297 Bacteria 754393
445 Ga0209758_1000019 3300025297 Bacteria 743682
446 Ga0209050_1000001 3300025298 Bacteria 3563507
447 Ga0209050_1000108 3300025298 Bacteria 222534
448 Ga0209050_1000209 3300025298 Bacteria 130884
449 Ga0209050_1009517 3300025298 Bacteria 4957
450 Ga0209050_1009555 3300025298 Bacteria 4945
451 Ga0209050_1019060 3300025298 Bacteria 2629
452 Ga0209256_1000016 3300025299 Bacteria 599092
453 Ga0209051_1000239 3300025303 Bacteria 92575
454 Ga0209257_1000027 3300025304 Bacteria 703541
455 Ga0209257_1001066 3300025304 Bacteria 36225
456 Ga0209257_1001071 3300025304 Bacteria 36088
457 Ga0209257_1001515 3300025304 Bacteria 27237
458 Ga0209257_1013597 3300025304 Bacteria 3597
459 Ga0207697_10045640 3300025315 Bacteria 1804
460 Ga0207656_10001422 3300025321 Bacteria 7919
461 Ga0207656_10005083 3300025321 Bacteria 4626
462 Ga0207656_10028661 3300025321 Bacteria 2287
463 Ga0207656_10029028 3300025321 Bacteria 2275
464 Ga0207656_10039998 3300025321 Bacteria 1986
465 Ga0207656_10112987 3300025321 Bacteria 1257
466 Ga0207713_1003473 3300025735 Bacteria 10729
467 Ga0207642_10007833 3300025899 Bacteria 3628
468 Ga0207710_10068749 3300025900 Bacteria 1620
469 Ga0207710_10075666 3300025900 Bacteria 1552
470 Ga0207688_10015331 3300025901 Bacteria 4158
471 Ga0207680_10000004 3300025903 Bacteria 827324
472 Ga0207680_10002571 3300025903 Bacteria 8464
473 Ga0207680_10009078 3300025903 Bacteria 4915
474 Ga0207680_10175237 3300025903 Bacteria 1447
475 Ga0207647_10000805 3300025904 Bacteria 24314
476 Ga0207647_10005630 3300025904 Bacteria 9147
477 Ga0207647_10078400 3300025904 Bacteria 1984
478 Ga0207647_10084282 3300025904 Bacteria 1902
479 Ga0207647_10088179 3300025904 Bacteria 1853
480 Ga0207647_10117171 3300025904 Bacteria 1572
481 Ga0207647_10251248 3300025904 Bacteria 1014
482 Ga0207645_10015238 3300025907 Bacteria 5117
483 Ga0207645_10026774 3300025907 Bacteria 3725
484 Ga0207645_10080062 3300025907 Bacteria 2094
485 Ga0207645_10086739 3300025907 Bacteria 2011
486 Ga0207645_10110473 3300025907 Bacteria 1779
487 Ga0207705_10000121 3300025909 Bacteria 86649
488 Ga0207705_10000592 3300025909 Bacteria 30427
489 Ga0207705_10017650 3300025909 Bacteria 5106
490 Ga0207705_10024003 3300025909 Bacteria 4351
491 Ga0207705_10031278 3300025909 Bacteria 3797
492 Ga0207705_10042845 3300025909 Bacteria 3250
493 Ga0207705_10043256 3300025909 Bacteria 3235
494 Ga0207705_10079630 3300025909 Bacteria 2386
495 Ga0207654_10003722 3300025911 Bacteria 7699
496 Ga0207654_10011547 3300025911 Bacteria 4507
497 Ga0207707_10008275 3300025912 Bacteria 9025
498 Ga0207707_10096899 3300025912 Bacteria 2577
499 Ga0207707_10344103 3300025912 Bacteria 1285
500 Ga0207695_10002715 3300025913 Bacteria 25830
501 Ga0207695_10007597 3300025913 Bacteria 13744
502 Ga0207695_10016512 3300025913 Bacteria 8631
503 Ga0207695_10038816 3300025913 Bacteria 5122
504 Ga0207671_10001479 3300025914 Bacteria 27142
505 Ga0207671_10011623 3300025914 Bacteria 7144
506 Ga0207671_10013100 3300025914 Bacteria 6625
507 Ga0207671_10175338 3300025914 Bacteria 1666
508 Ga0207671_10254387 3300025914 Bacteria 1381
509 Ga0207671_10694554 3300025914 Bacteria 809
510 Ga0207693_10210615 3300025915 Bacteria 1528
511 Ga0207660_10038492 3300025917 Bacteria 3339
512 Ga0207660_10161905 3300025917 Bacteria 1727
513 Ga0207660_10181164 3300025917 Bacteria 1636
514 Ga0207657_10002178 3300025919 Bacteria 21220
515 Ga0207657_10003582 3300025919 Bacteria 16572
516 Ga0207657_10008376 3300025919 Bacteria 10500
517 Ga0207657_10012964 3300025919 Bacteria 8196
518 Ga0207657_10014496 3300025919 Bacteria 7691
519 Ga0207657_10016571 3300025919 Bacteria 7100
520 Ga0207657_10023959 3300025919 Bacteria 5667
521 Ga0207657_10035869 3300025919 Bacteria 4442
522 Ga0207657_10167232 3300025919 Bacteria 1783
523 Ga0207657_10247796 3300025919 Bacteria 1421
524 Ga0207657_10382327 3300025919 Bacteria 1108
525 Ga0207649_10000475 3300025920 Bacteria 28671
526 Ga0207649_10006830 3300025920 Bacteria 6201
527 Ga0207649_10015845 3300025920 Bacteria 4238
528 Ga0207649_10153329 3300025920 Bacteria 1589
529 Ga0207652_10037349 3300025921 Bacteria 4111
530 Ga0207681_10000001 3300025923 Bacteria 1105841
531 Ga0207681_10000038 3300025923 Bacteria 153694
532 Ga0207681_10049750 3300025923 Bacteria 2834
533 Ga0207681_10054598 3300025923 Bacteria 2717
534 Ga0207681_10059426 3300025923 Bacteria 2621
535 Ga0207681_10229385 3300025923 Bacteria 1440
536 Ga0207681_10250157 3300025923 Bacteria 1383
537 Ga0207681_10293046 3300025923 Bacteria 1285
538 Ga0207694_10001050 3300025924 Bacteria 24056
539 Ga0207694_10004743 3300025924 Bacteria 10571
540 Ga0207694_10009796 3300025924 Bacteria 7232
541 Ga0207694_10014424 3300025924 Bacteria 5957
542 Ga0207694_10021743 3300025924 Bacteria 4861
543 Ga0207694_10026198 3300025924 Bacteria 4433
544 Ga0207694_10053932 3300025924 Bacteria 3118
545 Ga0207694_10183155 3300025924 Bacteria 1699
546 Ga0207694_10512327 3300025924 Bacteria 1005
547 Ga0207650_10000018 3300025925 Bacteria 352120
548 Ga0207650_10000294 3300025925 Bacteria 50141
549 Ga0207650_10004568 3300025925 Bacteria 9467
550 Ga0207650_10024760 3300025925 Bacteria 4271
551 Ga0207650_10080057 3300025925 Bacteria 2476
552 Ga0207650_10121113 3300025925 Bacteria 2037
553 Ga0207650_10200919 3300025925 Bacteria 1597
554 Ga0207650_10287302 3300025925 Bacteria 1340
555 Ga0207659_10000922 3300025926 Bacteria 17511
556 Ga0207659_10271913 3300025926 Bacteria 1382
557 Ga0207687_10004504 3300025927 Bacteria 9272
558 Ga0207644_10000039 3300025931 Bacteria 121348
559 Ga0207644_10000197 3300025931 Bacteria 42679
560 Ga0207644_10000214 3300025931 Bacteria 39975
561 Ga0207644_10000863 3300025931 Bacteria 19167
562 Ga0207644_10002893 3300025931 Bacteria 11065
563 Ga0207644_10010201 3300025931 Bacteria 6189
564 Ga0207644_10020550 3300025931 Bacteria 4490
565 Ga0207644_10022249 3300025931 Bacteria 4330
566 Ga0207644_10031319 3300025931 Bacteria 3705
567 Ga0207644_10036676 3300025931 Bacteria 3444
568 Ga0207644_10537220 3300025931 Bacteria 967
569 Ga0207690_10002990 3300025932 Bacteria 10182
570 Ga0207690_10007682 3300025932 Bacteria 6398
571 Ga0207690_10008018 3300025932 Bacteria 6270
572 Ga0207690_10012702 3300025932 Bacteria 5047
573 Ga0207690_10056672 3300025932 Bacteria 2644
574 Ga0207690_10107312 3300025932 Bacteria 2005
575 Ga0207690_10363951 3300025932 Bacteria 1146
576 Ga0207706_10004569 3300025933 Bacteria 12991
577 Ga0207706_10005341 3300025933 Bacteria 11974
578 Ga0207706_10009419 3300025933 Bacteria 8966
579 Ga0207706_10011916 3300025933 Bacteria 7916
580 Ga0207706_10022091 3300025933 Bacteria 5710
581 Ga0207706_10028785 3300025933 Bacteria 4960
582 Ga0207706_10047492 3300025933 Bacteria 3798
583 Ga0207706_10051583 3300025933 Bacteria 3632
584 Ga0207706_10062580 3300025933 Bacteria 3277
585 Ga0207706_10373486 3300025933 Bacteria 1238
586 Ga0207686_10002145 3300025934 Bacteria 10850
587 Ga0207686_10013436 3300025934 Bacteria 4532
588 Ga0207709_10000629 3300025935 Bacteria 28906
589 Ga0207709_10000951 3300025935 Bacteria 21659
590 Ga0207709_10058533 3300025935 Bacteria 2395
591 Ga0207709_10614511 3300025935 Bacteria 862
592 Ga0207670_10106249 3300025936 Bacteria 2014
593 Ga0207669_10000755 3300025937 Bacteria 13988
594 Ga0207669_10005841 3300025937 Bacteria 5566
595 Ga0207669_10069602 3300025937 Bacteria 2202
596 Ga0207669_10209644 3300025937 Bacteria 1421
597 Ga0207704_10000001 3300025938 Bacteria 716296
598 Ga0207704_10061836 3300025938 Bacteria 2325
599 Ga0207704_10665084 3300025938 Bacteria 859
600 Ga0207691_10003283 3300025940 Bacteria 15755
601 Ga0207691_10056417 3300025940 Bacteria 3578
602 Ga0207691_10099573 3300025940 Bacteria 2595
603 Ga0207691_10704127 3300025940 Bacteria 852
604 Ga0207711_10000022 3300025941 Bacteria 340441
605 Ga0207711_10000042 3300025941 Bacteria 158782
606 Ga0207711_10001064 3300025941 Bacteria 26287
607 Ga0207711_10002492 3300025941 Bacteria 16434
608 Ga0207711_10012589 3300025941 Bacteria 7025
609 Ga0207711_10047359 3300025941 Bacteria 3675
610 Ga0207711_10063922 3300025941 Bacteria 3178
611 Ga0207711_10088519 3300025941 Bacteria 2719
612 Ga0207711_10209286 3300025941 Bacteria 1781
613 Ga0207711_10256413 3300025941 Bacteria 1607
614 Ga0207711_10371094 3300025941 Bacteria 1327
615 Ga0207689_10001710 3300025942 Bacteria 20764
616 Ga0207689_10069129 3300025942 Bacteria 2902
617 Ga0207689_10117639 3300025942 Bacteria 2185
618 Ga0207661_10228734 3300025944 Bacteria 1646
619 Ga0207661_10481259 3300025944 Bacteria 1133
620 Ga0207679_10002349 3300025945 Bacteria 11640
621 Ga0207679_10014116 3300025945 Bacteria 5244
622 Ga0207679_10014928 3300025945 Bacteria 5118
623 Ga0207679_10041360 3300025945 Bacteria 3305
624 Ga0207679_10058126 3300025945 Bacteria 2864
625 Ga0207679_10074849 3300025945 Bacteria 2567
626 Ga0207679_10222304 3300025945 Bacteria 1589
627 Ga0207679_10303461 3300025945 Bacteria 1377
628 Ga0207667_10000001 3300025949 Bacteria 1178522
629 Ga0207667_10000016 3300025949 Bacteria 391466
630 Ga0207667_10000651 3300025949 Bacteria 45008
631 Ga0207667_10000692 3300025949 Bacteria 43754
632 Ga0207667_10010455 3300025949 Bacteria 10845
633 Ga0207667_10021125 3300025949 Bacteria 7220
634 Ga0207667_10172630 3300025949 Bacteria 2222
635 Ga0207667_10367666 3300025949 Bacteria 1466
636 Ga0207651_10000002 3300025960 Bacteria 427663
637 Ga0207651_10003812 3300025960 Bacteria 7472
638 Ga0207651_10003837 3300025960 Bacteria 7452
639 Ga0207651_10011490 3300025960 Bacteria 4960
640 Ga0207651_10411755 3300025960 Bacteria 1152
641 Ga0207712_10000001 3300025961 Bacteria 750309
642 Ga0207712_10000012 3300025961 Bacteria 392363
643 Ga0207712_10000224 3300025961 Bacteria 55674
644 Ga0207712_10030985 3300025961 Bacteria 3599
645 Ga0207712_10101759 3300025961 Bacteria 2137
646 Ga0207712_10433445 3300025961 Bacteria 1111
647 Ga0207712_10733493 3300025961 Bacteria 864
648 Ga0207668_10000026 3300025972 Bacteria 128309
649 Ga0207668_10000228 3300025972 Bacteria 37684
650 Ga0207668_10000490 3300025972 Bacteria 24826
651 Ga0207668_10013664 3300025972 Bacteria 5008
652 Ga0207668_10014529 3300025972 Bacteria 4875
653 Ga0207668_10203323 3300025972 Bacteria 1579
654 Ga0207668_10548058 3300025972 Bacteria 1001
655 Ga0207640_10000891 3300025981 Bacteria 16939
656 Ga0207640_10004646 3300025981 Bacteria 7453
657 Ga0207640_10005537 3300025981 Bacteria 6881
658 Ga0207640_10037340 3300025981 Bacteria 3055
659 Ga0207640_10046863 3300025981 Bacteria 2785
660 Ga0207640_10047485 3300025981 Bacteria 2769
661 Ga0207640_10086439 3300025981 Bacteria 2159
662 Ga0207640_10095691 3300025981 Bacteria 2068
663 Ga0207640_10208530 3300025981 Bacteria 1487
664 Ga0207640_10281484 3300025981 Bacteria 1306
665 Ga0207640_10500198 3300025981 Bacteria 1012
666 Ga0207658_10000002 3300025986 Bacteria 1364188
667 Ga0207658_10000364 3300025986 Bacteria 44527
668 Ga0207658_10000545 3300025986 Bacteria 34100
669 Ga0207658_10000902 3300025986 Bacteria 24720
670 Ga0207658_10009480 3300025986 Bacteria 6606
671 Ga0207658_10009613 3300025986 Bacteria 6562
672 Ga0207658_10009967 3300025986 Bacteria 6457
673 Ga0207658_10049116 3300025986 Bacteria 3098
674 Ga0207658_10225527 3300025986 Bacteria 1579
675 Ga0207677_10000030 3300026023 Bacteria 120692
676 Ga0207677_10009857 3300026023 Bacteria 5385
677 Ga0207703_10000135 3300026035 Bacteria 89779
678 Ga0207703_10000404 3300026035 Bacteria 46297
679 Ga0207703_10001087 3300026035 Bacteria 25874
680 Ga0207703_10015254 3300026035 Bacteria 5995
681 Ga0207703_10054327 3300026035 Bacteria 3257
682 Ga0207639_10002074 3300026041 Bacteria 13509
683 Ga0207639_10007490 3300026041 Bacteria 7447
684 Ga0207639_10008847 3300026041 Bacteria 6924
685 Ga0207639_10044857 3300026041 Bacteria 3327
686 Ga0207639_10051972 3300026041 Bacteria 3120
687 Ga0207639_10095900 3300026041 Bacteria 2385
688 Ga0207639_10187075 3300026041 Bacteria 1766
689 Ga0207639_10254497 3300026041 Bacteria 1533
690 Ga0207678_10006676 3300026067 Bacteria 10229
691 Ga0207678_10008727 3300026067 Bacteria 8925
692 Ga0207678_10036870 3300026067 Bacteria 4256
693 Ga0207678_10048089 3300026067 Bacteria 3688
694 Ga0207678_10067448 3300026067 Bacteria 3071
695 Ga0207678_10076194 3300026067 Bacteria 2873
696 Ga0207678_10257733 3300026067 Bacteria 1494
697 Ga0207702_10000462 3300026078 Bacteria 45995
698 Ga0207702_10016406 3300026078 Bacteria 6131
699 Ga0207702_10052596 3300026078 Bacteria 3447
700 Ga0207702_10185626 3300026078 Bacteria 1918
701 Ga0207702_10198470 3300026078 Bacteria 1858
702 Ga0207702_10201102 3300026078 Bacteria 1847
703 Ga0207702_10414569 3300026078 Bacteria 1301
704 Ga0207702_10449235 3300026078 Bacteria 1250
705 Ga0207641_10000002 3300026088 Bacteria 981004
706 Ga0207641_10000024 3300026088 Bacteria 250751
707 Ga0207641_10000033 3300026088 Bacteria 219261
708 Ga0207641_10000277 3300026088 Bacteria 64441
709 Ga0207641_10000626 3300026088 Bacteria 38602
710 Ga0207641_10001261 3300026088 Bacteria 25224
711 Ga0207641_10002117 3300026088 Bacteria 18786
712 Ga0207641_10004973 3300026088 Bacteria 11403
713 Ga0207641_10005398 3300026088 Bacteria 10920
714 Ga0207641_10006503 3300026088 Bacteria 9839
715 Ga0207641_10017421 3300026088 Bacteria 5880
716 Ga0207641_10173019 3300026088 Bacteria 1972
717 Ga0207648_10000001 3300026089 Bacteria 427499
718 Ga0207648_10003494 3300026089 Bacteria 16462
719 Ga0207676_10000004 3300026095 Bacteria 725417
720 Ga0207676_10000040 3300026095 Bacteria 167947
721 Ga0207676_10000340 3300026095 Bacteria 40187
722 Ga0207676_10000600 3300026095 Bacteria 29522
723 Ga0207676_10002850 3300026095 Bacteria 12309
724 Ga0207676_10006287 3300026095 Bacteria 8388
725 Ga0207676_10042482 3300026095 Bacteria 3497
726 Ga0207676_10080658 3300026095 Bacteria 2641
727 Ga0207676_10107993 3300026095 Bacteria 2322
728 Ga0207674_10003716 3300026116 Bacteria 18636
729 Ga0207674_10010165 3300026116 Bacteria 10693
730 Ga0207674_10012150 3300026116 Bacteria 9640
731 Ga0207674_10014103 3300026116 Bacteria 8829
732 Ga0207674_10058492 3300026116 Bacteria 3904
733 Ga0207675_100000071 3300026118 Bacteria 77575
734 Ga0207675_100000171 3300026118 Bacteria 58198
735 Ga0207675_100004115 3300026118 Bacteria 14077
736 Ga0207675_100074164 3300026118 Bacteria 3184
737 Ga0207675_100275287 3300026118 Bacteria 1634
738 Ga0207675_100690505 3300026118 Bacteria 1029
739 Ga0207683_10030752 3300026121 Bacteria 4654
740 Ga0207683_10038419 3300026121 Bacteria 4172
741 Ga0207683_10059873 3300026121 Bacteria 3346
742 Ga0207683_10204941 3300026121 Bacteria 1794
743 Ga0207698_10008400 3300026142 Bacteria 6529
744 Ga0207698_10009783 3300026142 Bacteria 6125
745 Ga0207698_10013046 3300026142 Bacteria 5467
746 Ga0207698_10035886 3300026142 Bacteria 3632
747 Ga0207698_10064919 3300026142 Bacteria 2864
748 Ga0207698_10089859 3300026142 Bacteria 2510
749 Ga0207698_10158574 3300026142 Bacteria 1975
750 Ga0207698_10172860 3300026142 Bacteria 1904
751 Ga0207698_10207361 3300026142 Bacteria 1760
752 Ga0268266_10000028 3300028379 Bacteria 425294
753 Ga0268266_10398752 3300028379 Bacteria 1300
754 Ga0268266_10473503 3300028379 Bacteria 1193
755 Ga0268266_10664587 3300028379 Bacteria 1003
756 Ga0268265_10000002 3300028380 Bacteria 1035381
757 Ga0268265_10000003 3300028380 Bacteria 949201
758 Ga0268265_10000071 3300028380 Bacteria 132890
759 Ga0268265_10000081 3300028380 Bacteria 120869
760 Ga0268265_10001985 3300028380 Bacteria 16188
761 Ga0268265_10070456 3300028380 Bacteria 2719
762 Ga0268265_10155686 3300028380 Bacteria 1933
763 Ga0268264_10000006 3300028381 Bacteria 827324
764 Ga0268264_10000101 3300028381 Bacteria 225109
765 Ga0268264_10000277 3300028381 Bacteria 86740
766 Ga0268264_10002895 3300028381 Bacteria 14925
767 Ga0268264_10007584 3300028381 Bacteria 9048
768 Ga0268264_10017268 3300028381 Bacteria 5912
769 Ga0268264_10046924 3300028381 Bacteria 3590
770 Ga0268264_10046935 3300028381 Bacteria 3590
771 Ga0268264_10513770 3300028381 Bacteria 1170
772 Ga0268264_10648904 3300028381 Bacteria 1044
773 Ga0307517_10017543 3300028786 Bacteria 9325
774 Ga0314311_1253059 3300030733 Bacteria 1106
775 Ga0307513_10038050 3300031456 Bacteria 5347
776 Ga0307513_10062253 3300031456 Bacteria 3945
777 Ga0307408_100159239 3300031548 Bacteria 1791
778 Ga0307408_100375434 3300031548 Bacteria 1214
779 Ga0307405_10010820 3300031731 Bacteria 4749
780 Ga0307405_10019377 3300031731 Bacteria 3777
781 Ga0307413_10011043 3300031824 Bacteria 4417
782 Ga0307413_10177020 3300031824 Bacteria 1516
783 Ga0307413_10326141 3300031824 Bacteria 1175
784 Ga0307410_10051488 3300031852 Bacteria 2775
785 Ga0307410_10060530 3300031852 Bacteria 2588
786 Ga0307410_10101091 3300031852 Bacteria 2066
787 Ga0307410_10301796 3300031852 Bacteria 1264
788 Ga0307406_10107594 3300031901 Bacteria 1912
789 Ga0307406_10220312 3300031901 Bacteria 1410
790 Ga0307406_10833827 3300031901 Bacteria 780
791 Ga0307407_10014810 3300031903 Bacteria 3830
792 Ga0307412_10014384 3300031911 Bacteria 4665
793 Ga0307412_10119740 3300031911 Bacteria 1893
794 Ga0307412_10530911 3300031911 Bacteria 985
795 Ga0307409_100048881 3300031995 Bacteria 3222
796 Ga0307409_100309460 3300031995 Bacteria 1473
797 Ga0307409_100484735 3300031995 Bacteria 1201
798 Ga0307409_100510853 3300031995 Bacteria 1172
799 Ga0307416_100009723 3300032002 Bacteria 6315
800 Ga0307416_101033116 3300032002 Bacteria 925
801 Ga0307414_10001499 3300032004 Bacteria 12124
802 Ga0307414_10025253 3300032004 Bacteria 3802
803 Ga0307414_10070847 3300032004 Bacteria 2512
804 Ga0307414_10081762 3300032004 Bacteria 2366
805 Ga0307414_10159855 3300032004 Bacteria 1788
806 Ga0307411_10012651 3300032005 Bacteria 4617
807 Ga0307411_10040331 3300032005 Bacteria 2961
808 Ga0307411_10060206 3300032005 Bacteria 2520
809 Ga0307411_10070385 3300032005 Bacteria 2367
810 Ga0307411_10101841 3300032005 Bacteria 2033
811 Ga0307411_10207482 3300032005 Bacteria 1510
812 Ga0307411_10252169 3300032005 Bacteria 1388
813 Ga0307411_10347093 3300032005 Bacteria 1208
814 Ga0307411_10572468 3300032005 Bacteria 967
815 Ga0307415_100020974 3300032126 Bacteria 4003
816 Ga0307415_100100012 3300032126 Bacteria 2124
817 Ga0307510_10219879 3300033180 Bacteria 1412
818 Ga0307510_10238088 3300033180 Bacteria 1317
819 Ga0373941_0085440 3300035115 Bacteria 1073
820 Ga0373931_0246318 3300035691 Bacteria 1085
821 Ga0395899_0018782 3300037312 Bacteria 5252
822 Ga0395899_0037136 3300037312 Bacteria 3652
823 Ga0395900_0000764 3300037418 Bacteria 42836
824 Ga0395900_0081537 3300037418 Bacteria 3323
825 Ga0395900_0094288 3300037418 Bacteria 3074
826 Ga0395900_0178364 3300037418 Bacteria 2160
827 Ga0395900_0359544 3300037418 Bacteria 1427
828 Ga0395900_0579831 3300037418 Bacteria 1064
829 Ga0395900_0630950 3300037418 Bacteria 1010
830 Ga0395898_0021463 3300037466 Bacteria 6548
831 Ga0395898_0028931 3300037466 Bacteria 5553
832 Ga0395898_0058445 3300037466 Bacteria 3753
833 Ga0395898_0117307 3300037466 Bacteria 2550
834 Ga0395905_0003045 3300037471 Bacteria 18153
835 Ga0395905_0004674 3300037471 Bacteria 14154
836 Ga0395905_0013463 3300037471 Bacteria 7838
837 Ga0395905_0017316 3300037471 Bacteria 6842
838 Ga0395905_0033153 3300037471 Bacteria 4853
839 Ga0395905_0043534 3300037471 Bacteria 4211
840 Ga0395905_0044710 3300037471 Bacteria 4155
841 Ga0395905_0117126 3300037471 Bacteria 2503
842 Ga0395905_0158282 3300037471 Bacteria 2130
843 Ga0395905_0328782 3300037471 Bacteria 1419
844 Ga0395905_0742484 3300037471 Bacteria 884
845 Ga0395905_0755988 3300037471 Bacteria 874
846 Ga0395905_0794686 3300037471 Bacteria 849
847 Ga0436364_0612163 3300037853 Bacteria 25384
848 Ga0436364_0852694 3300037853 Bacteria 36694
849 Ga0395901_0005146 3300038443 Bacteria 13202
850 Ga0395901_0009829 3300038443 Bacteria 9698
851 Ga0395901_0118405 3300038443 Bacteria 2782
852 Ga0395901_0343089 3300038443 Bacteria 1543
853 Ga0395901_0438477 3300038443 Bacteria 1337
854 Ga0436365_0866041 3300039437 Bacteria 911
855 Ga0436363_1386082 3300039450 Bacteria 1243
856 Ga0439436_0044005 3300041404 Bacteria 1272
857 Ga0439439_0003354 3300041406 Bacteria 3524
858 Ga0439461_0000202 3300041410 Bacteria 8326
859 Ga0439461_0016751 3300041410 Bacteria 1418
860 Ga0439465_0000274 3300041413 Bacteria 14388
861 Ga0451807_0150684 3300041486 Bacteria 1517
862 Ga0439431_0000103 3300041997 Bacteria 14374
863 Ga0439445_0025915 3300042004 Bacteria 1498
864 Ga0439448_0013838 3300042005 Bacteria 2429
865 Ga0439432_012147 3300042006 Bacteria 2954
866 Ga0439432_030753 3300042006 Bacteria 1740
867 Ga0439432_032372 3300042006 Bacteria 1686
868 Ga0450919_005818 3300042121 Bacteria 1473
869 Ga0450905_001171 3300042142 Bacteria 3319
870 Ga0450889_002955 3300042144 Bacteria 1679
871 Ga0439458_0000559 3300042157 Bacteria 9582
872 Ga0439434_0021611 3300042435 Bacteria 1933
873 Ga0466972_0027337 3300044658 Bacteria 2823
874 Ga0466961_0011363 3300044693 Bacteria 5693
875 Ga0466961_0028348 3300044693 Bacteria 3600
876 Ga0466963_0015006 3300044694 Bacteria 4788
877 Ga0466963_0024760 3300044694 Bacteria 3822
878 Ga0466963_0034218 3300044694 Bacteria 3305
879 Ga0466963_0459130 3300044694 Bacteria 899
880 Ga0466968_0010515 3300044735 Bacteria 3590
881 Ga0466968_0253574 3300044735 Bacteria 836
882 Ga0466970_0177239 3300044765 Bacteria 1182
883 Ga0466957_0002027 3300044842 Bacteria 10800
884 Ga0466960_0025899 3300044901 Bacteria 2659
885 Ga0466959_0013667 3300045049 Bacteria 5890
886 Ga0466959_0033855 3300045049 Bacteria 3779
887 Ga0466959_0068216 3300045049 Bacteria 2577
888 Ga0451576_0064272 3300045051 Bacteria 3823
889 Ga0466958_0025243 3300045836 Bacteria 3502
890 Ga0466958_0246927 3300045836 Bacteria 1141
891 Ga0466967_0015627 3300045976 Bacteria 5956
892 Ga0466967_0037136 3300045976 Bacteria 4165
893 Ga0466967_0086428 3300045976 Bacteria 2841
894 Ga0466967_0146406 3300045976 Bacteria 2203
895 Ga0466967_0313871 3300045976 Bacteria 1511
896 Ga0466967_0402204 3300045976 Bacteria 1332
897 Ga0466967_0558545 3300045976 Bacteria 1127
898 Ga0495627_003594 3300046453 Bacteria 6757
899 Ga0495629_0237250 3300046459 Bacteria 1256
900 Ga0495638_0032605 3300046460 Bacteria 3338
901 Ga0495638_0325835 3300046460 Bacteria 819
902 Ga0495650_0000428 3300046471 Bacteria 68082
903 Ga0495582_0443271 3300046473 Bacteria 750
904 Ga0495662_0063501 3300046476 Bacteria 1784
905 Ga0495584_0162164 3300046491 Bacteria 1136
906 Ga0495585_0039184 3300046492 Bacteria 2664
907 Ga0495585_0041703 3300046492 Bacteria 2573
908 Ga0495583_0000023 3300046506 Bacteria 280019
909 Ga0495583_0001895 3300046506 Bacteria 19369
910 Ga0495583_0003188 3300046506 Bacteria 12867
911 Ga0495583_0069191 3300046506 Bacteria 1555
912 Ga0495606_0000383 3300046507 Bacteria 75070
913 Ga0495606_0007942 3300046507 Bacteria 9347
914 Ga0495606_0031914 3300046507 Bacteria 3656
915 Ga0495610_0000146 3300046512 Bacteria 77326
916 Ga0495610_0132277 3300046512 Bacteria 1082
917 Ga0495616_0189655 3300046513 Bacteria 909
918 Ga0495631_0001928 3300046518 Bacteria 12186
919 Ga0495637_0001942 3300046520 Bacteria 11707
920 Ga0495637_0011424 3300046520 Bacteria 4267
921 Ga0495643_0004145 3300046522 Bacteria 10301
922 Ga0495643_0006878 3300046522 Bacteria 7409
923 Ga0495643_0084923 3300046522 Bacteria 1642
924 Ga0495643_0236448 3300046522 Bacteria 859
925 Ga0495648_0001391 3300046524 Bacteria 23802
926 Ga0495663_0002898 3300046525 Bacteria 5065
927 Ga0495654_0066436 3300046530 Bacteria 1719
928 Ga0495654_0080270 3300046530 Bacteria 1531
929 Ga0495587_0153556 3300046536 Bacteria 1312
930 Ga0495609_0113675 3300046538 Bacteria 1167
931 Ga0495621_0002284 3300046539 Bacteria 5135
932 Ga0495621_0030722 3300046539 Bacteria 1839
933 Ga0495597_0012717 3300046542 Bacteria 4054
934 Ga0495633_0002596 3300046558 Bacteria 12647
935 Ga0495633_0003946 3300046558 Bacteria 9655
936 Ga0495633_0013402 3300046558 Bacteria 4322
937 Ga0495633_0029090 3300046558 Bacteria 2688
938 Ga0495668_0000218 3300046616 Bacteria 83540
939 Ga0495668_0023087 3300046616 Bacteria 3551
940 Ga0495668_0169808 3300046616 Bacteria 1195
941 Ga0495668_0246353 3300046616 Bacteria 978
942 Ga0495611_0007098 3300046648 Bacteria 4758
943 Ga0495625_0000496 3300046660 Bacteria 58853
944 Ga0495625_0001071 3300046660 Bacteria 35534
945 Ga0495625_0011582 3300046660 Bacteria 7178
946 Ga0495625_0044610 3300046660 Bacteria 3209
947 Ga0495625_0154925 3300046660 Bacteria 1538
948 Ga0495661_0012693 3300046665 Bacteria 5687
949 Ga0495661_0029644 3300046665 Bacteria 3491
950 Ga0495588_0318398 3300046674 Bacteria 818
951 Ga0495669_0000241 3300046684 Bacteria 32038
952 Ga0495669_0008608 3300046684 Bacteria 4294
953 Ga0495669_0017147 3300046684 Bacteria 3105
954 Ga0495669_0098652 3300046684 Bacteria 1355
955 Ga0495670_0000028 3300046691 Bacteria 90085
956 Ga0495670_0024419 3300046691 Bacteria 2987
957 Ga0495649_0237533 3300046694 Bacteria 939
958 Ga0495600_0049411 3300046809 Bacteria 2744
959 Ga0495660_0118787 3300046810 Bacteria 1340
960 Ga0495660_0142058 3300046810 Bacteria 1193
961 Ga0495683_0010498 3300047323 Bacteria 4890
962 Ga0495687_001043 3300047443 Bacteria 27520
963 Ga0495687_001672 3300047443 Bacteria 19833
964 Ga0495677_0005009 3300047445 Bacteria 5054
965 Ga0495677_0151658 3300047445 Bacteria 892
966 Ga0495681_0000214 3300047470 Bacteria 48192
967 Ga0495681_0025540 3300047470 Bacteria 3088
968 Ga0495686_0001053 3300047472 Bacteria 32974
969 Ga0495686_0002522 3300047472 Bacteria 17141
970 Ga0495686_0004950 3300047472 Bacteria 10718
971 Ga0495686_0083568 3300047472 Bacteria 1947
972 Ga0495686_0099470 3300047472 Bacteria 1756
973 Ga0496100_0005362 3300048903 Bacteria 6896
974 Ga0496100_0132399 3300048903 Bacteria 1758
975 Ga0496101_0001845 3300048904 Bacteria 12772
976 Ga0496101_0020761 3300048904 Bacteria 4505
977 Ga0496101_0141793 3300048904 Bacteria 1832
978 Ga0496101_0265316 3300048904 Bacteria 1340
979 Ga0496102_0000719 3300048905 Bacteria 32658
980 Ga0496102_0000756 3300048905 Bacteria 31601
981 Ga0496102_0004530 3300048905 Bacteria 11741
982 Ga0496102_0357322 3300048905 Bacteria 1375
983 Ga0496102_0583481 3300048905 Bacteria 1041
984 Ga0496103_0000562 3300048906 Bacteria 29450
985 Ga0496103_0002302 3300048906 Bacteria 12068
986 Ga0496103_0007333 3300048906 Bacteria 6572
987 Ga0496103_0014624 3300048906 Bacteria 4663
988 Ga0496103_0070972 3300048906 Bacteria 2179
989 Ga0496103_0423131 3300048906 Bacteria 855
990 Ga0496104_0017339 3300048907 Bacteria 6555
991 Ga0496104_0063254 3300048907 Bacteria 3509
992 Ga0496105_0009443 3300048908 Bacteria 7630
993 Ga0496105_0035375 3300048908 Bacteria 4111
994 Ga0496105_0086958 3300048908 Bacteria 2583
995 Ga0496105_0156845 3300048908 Bacteria 1869
996 Ga0496106_0024920 3300048909 Bacteria 4448
997 Ga0496106_0397289 3300048909 Bacteria 1108
998 Ga0496107_0002051 3300048910 Bacteria 12880
999 Ga0496107_0047010 3300048910 Bacteria 3107
1000 Ga0496107_0165819 3300048910 Bacteria 1638
1001 Ga0496108_0014779 3300048911 Bacteria 6372
1002 Ga0496108_0051888 3300048911 Bacteria 3435
1003 Ga0496109_0030292 3300048912 Bacteria 4850
1004 Ga0496109_0038420 3300048912 Bacteria 4327
1005 Ga0496109_0064818 3300048912 Bacteria 3344
1006 Ga0496109_0071775 3300048912 Bacteria 3180
1007 Ga0496110_0000948 3300048913 Bacteria 20317
1008 Ga0496110_0009431 3300048913 Bacteria 7906
1009 Ga0496110_0029480 3300048913 Bacteria 4724
1010 Ga0496110_0083631 3300048913 Bacteria 2848
1011 Ga0496110_0275824 3300048913 Bacteria 1531
1012 Ga0496110_0471574 3300048913 Bacteria 1144
1013 Ga0496111_0001035 3300048914 Bacteria 15288
1014 Ga0496111_0004529 3300048914 Bacteria 8794
1015 Ga0496111_0022502 3300048914 Bacteria 4414
1016 Ga0496111_0074293 3300048914 Bacteria 2476
1017 Ga0496112_0013316 3300048915 Bacteria 7592
1018 Ga0496112_0554255 3300048915 Bacteria 1083
1019 Ga0496113_0025057 3300048916 Bacteria 4248
1020 Ga0496113_0284930 3300048916 Bacteria 1321
1021 Ga0496114_0022765 3300048917 Bacteria 5107
1022 Ga0496115_0000464 3300048918 Bacteria 32447
1023 Ga0496115_0005489 3300048918 Bacteria 9229
1024 Ga0496116_0002037 3300048919 Bacteria 21676
1025 Ga0496116_0009864 3300048919 Bacteria 8081
1026 Ga0496116_0056694 3300048919 Bacteria 2566
1027 Ga0496117_0000519 3300048920 Bacteria 63633
1028 Ga0496117_0001114 3300048920 Bacteria 40518
1029 Ga0496117_0011627 3300048920 Bacteria 7867
1030 Ga0496117_0021825 3300048920 Bacteria 5163
1031 Ga0496117_0037145 3300048920 Bacteria 3633
1032 Ga0496117_0040426 3300048920 Bacteria 3429
1033 Ga0496118_0000127 3300048921 Bacteria 135377
1034 Ga0496118_0000193 3300048921 Bacteria 107307
1035 Ga0496118_0001703 3300048921 Bacteria 32166
1036 Ga0496118_0004860 3300048921 Bacteria 15648
1037 Ga0496118_0009117 3300048921 Bacteria 10095
1038 Ga0496118_0029470 3300048921 Bacteria 4601
1039 Ga0496119_0027214 3300048922 Bacteria 3937
1040 Ga0496119_0036669 3300048922 Bacteria 3197
1041 Ga0496119_0040560 3300048922 Bacteria 2975
1042 Ga0496120_0049671 3300048923 Bacteria 2406
1043 Ga0496121_0005712 3300048924 Bacteria 15799
1044 Ga0496121_0010096 3300048924 Bacteria 10710
1045 Ga0496121_0051385 3300048924 Bacteria 3472
1046 Ga0496122_0016138 3300048925 Bacteria 7094
1047 Ga0496123_0030686 3300048926 Bacteria 3930
1048 Ga0496124_0000011 3300048927 Bacteria 524145
1049 Ga0496124_0000237 3300048927 Bacteria 107270
1050 Ga0496124_0067342 3300048927 Bacteria 2980
1051 Ga0496125_0001918 3300048928 Bacteria 28461
1052 Ga0496125_0062178 3300048928 Bacteria 2988
1053 Ga0496126_0007282 3300048929 Bacteria 12162
1054 Ga0496126_0008126 3300048929 Bacteria 11358
1055 Ga0496126_0341185 3300048929 Bacteria 1227
1056 Ga0495682_0023253 3300049460 Bacteria 2314
1057 Ga0501290_002973 3300049513 Bacteria 2156
1058 Ga0501290_011399 3300049513 Bacteria 1145
1059 Ga0501292_000040 3300049515 Bacteria 31058
1060 Ga0501043_0099754 3300049579 Bacteria 2282
1061 Ga0501047_0000402 3300049581 Bacteria 48648
1062 Ga0501206_001042 3300049653 Bacteria 3455
1063 Ga0501208_006654 3300049655 Bacteria 1483
1064 Ga0501222_002113 3300049662 Bacteria 2752
1065 Ga0501223_001533 3300049663 Bacteria 5329
1066 Ga0501224_001796 3300049664 Bacteria 2885
1067 Ga0501235_003681 3300049669 Bacteria 3310
1068 Ga0501249_000545 3300049679 Bacteria 9066
1069 Ga0501257_000093 3300049686 Bacteria 21754
1070 Ga0501261_000110 3300049690 Bacteria 12389
1071 Ga0501221_001519 3300049704 Bacteria 3840
1072 Ga0501225_0027884 3300049705 Bacteria 1552
1073 Ga0501245_002143 3300049708 Bacteria 2622
1074 Ga0501080_0971614 3300049742 Bacteria 738
1075 Ga0501279_000008 3300049775 Bacteria 125267
1076 Ga0501280_000233 3300049776 Bacteria 13988
1077 Ga0501280_000772 3300049776 Bacteria 6988
1078 Ga0501281_00064 3300049777 Bacteria 12462
1079 Ga0501282_000614 3300049778 Bacteria 4119
1080 Ga0501204_005049 3300049850 Bacteria 1434
1081 nmdc:mga0qj67_621834_c1 3300050509 Bacteria 863
1082 nmdc:mga08y16_94019_c1 3300050511 Bacteria 3123
1083 nmdc:mga0sz30_41051_c1 3300050516 Bacteria 1945
1084 Ga0500610_0000668 3300053079 Bacteria 10580
1085 Ga0500643_000136 3300053087 Bacteria 74292
1086 Ga0500643_000338 3300053087 Bacteria 37288
1087 Ga0500643_001250 3300053087 Bacteria 15061
1088 Ga0500643_001549 3300053087 Bacteria 13025
1089 Ga0500643_002056 3300053087 Bacteria 10762
1090 Ga0500643_002934 3300053087 Bacteria 8461
1091 Ga0500643_007149 3300053087 Bacteria 4564
1092 Ga0500647_0092524 3300053091 Bacteria 1447
1093 Ga0500651_0042612 3300053093 Bacteria 2860
1094 Ga0500566_0000877 3300053094 Bacteria 17172
1095 Ga0500555_000164 3300053103 Bacteria 30996
1096 Ga0500592_000232 3300053116 Bacteria 10092
1097 Ga0500592_002720 3300053116 Bacteria 2846
1098 Ga0500592_022616 3300053116 Bacteria 1013
1099 Ga0500595_002635 3300053119 Bacteria 8733
1100 Ga0500608_076391 3300053122 Bacteria 1586
1101 Ga0500608_192747 3300053122 Bacteria 850
1102 Ga0500642_0000751 3300053130 Bacteria 9519
1103 Ga0500642_0018625 3300053130 Bacteria 2690
1104 Ga0500655_000159 3300053133 Bacteria 16704
1105 Ga0500658_0002920 3300053134 Bacteria 6563
1106 Ga0500658_0185545 3300053134 Bacteria 948
1107 Ga0500559_0031963 3300053136 Bacteria 2259
1108 Ga0500559_0110284 3300053136 Bacteria 1274
1109 Ga0500564_057764 3300053138 Bacteria 1764
1110 Ga0500568_0015114 3300053139 Bacteria 3462
1111 Ga0500573_0000019 3300053140 Bacteria 173601
1112 Ga0500573_0175726 3300053140 Bacteria 1155
1113 Ga0500577_0032742 3300053142 Bacteria 1831
1114 Ga0500590_005065 3300053148 Bacteria 6310
1115 Ga0500616_0002503 3300053153 Bacteria 15215
1116 Ga0500624_000009 3300053157 Bacteria 178763
1117 Ga0500627_0000091 3300053158 Bacteria 30128
1118 Ga0500636_0319596 3300053177 Bacteria 755
1119 Ga0500570_001921 3300053724 Bacteria 9977
1120 Ga0500625_000011 3300053729 Bacteria 133655
1121 Ga0500645_000237 3300053730 Bacteria 41544
1122 Ga0500645_001144 3300053730 Bacteria 14373
1123 Ga0500645_011613 3300053730 Bacteria 2870
1124 Ga0500645_020770 3300053730 Bacteria 2032
1125 Ga0466962_0036472 3300061719 Bacteria 2353

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013307 Ga0157372_10305248 Ga0157372_103052482 182
2 3300046473 Ga0495582_0443271 Ga0495582_0443271_87_722 192
3 3300005435 Ga0070714_100188223 Ga0070714_1001882233 198
4 3300013105 Ga0157369_10008669 Ga0157369_1000866910 200
5 3300025933 Ga0207706_10022091 Ga0207706_100220913 200
6 3300025945 Ga0207679_10058126 Ga0207679_100581264 200
7 3300037471 Ga0395905_0017316 Ga0395905_0017316_591_1280 201
8 3300031901 Ga0307406_10220312 Ga0307406_102203122 204
9 3300032004 Ga0307414_10070847 Ga0307414_100708472 204
10 3300013306 Ga0163162_10048885 Ga0163162_100488852 205
11 3300041410 Ga0439461_0000202 Ga0439461_0000202_4071_4736 205
12 3300041413 Ga0439465_0000274 Ga0439465_0000274_147_812 205
13 3300041997 Ga0439431_0000103 Ga0439431_0000103_3820_4485 205
14 3300042006 Ga0439432_012147 Ga0439432_012147_141_806 205
15 3300042006 Ga0439432_032372 Ga0439432_032372_53_736 205
16 3300042157 Ga0439458_0000559 Ga0439458_0000559_7419_8147 205
17 3300045049 Ga0466959_0068216 Ga0466959_0068216_1558_2247 205
18 3300045836 Ga0466958_0025243 Ga0466958_0025243_817_1506 205
19 3300046507 Ga0495606_0007942 Ga0495606_0007942_2976_3665 205
20 3300049513 Ga0501290_011399 Ga0501290_011399_328_996 205
21 3300049686 Ga0501257_000093 Ga0501257_000093_11749_12417 205
22 3300049776 Ga0501280_000772 Ga0501280_000772_5480_6148 205
23 3300061719 Ga0466962_0036472 Ga0466962_0036472_274_963 205
24 3300009176 Ga0105242_10258590 Ga0105242_102585902 206
25 3300009177 Ga0105248_10155231 Ga0105248_101552314 206
26 3300014325 Ga0163163_10346614 Ga0163163_103466142 206
27 3300020081 Ga0206354_10580221 Ga0206354_105802214 206
28 3300020082 Ga0206353_11160495 Ga0206353_111604953 206
29 3300037471 Ga0395905_0794686 Ga0395905_0794686_95_763 206
30 3300045976 Ga0466967_0558545 Ga0466967_0558545_231_920 206
31 3300048904 Ga0496101_0020761 Ga0496101_0020761_1932_2621 206
32 3300048917 Ga0496114_0022765 Ga0496114_0022765_4163_4852 206
33 3300050516 nmdc:mga0sz30_41051_c1 nmdc:mga0sz30_41051_c1_590_1270 206
34 3300053087 Ga0500643_001250 Ga0500643_001250_6475_7149 206
35 3300053087 Ga0500643_001549 Ga0500643_001549_7914_8588 206
36 3300031852 Ga0307410_10301796 Ga0307410_103017962 207
37 3300031995 Ga0307409_100484735 Ga0307409_1004847351 207
38 3300032005 Ga0307411_10347093 Ga0307411_103470932 207
39 3300046512 Ga0495610_0132277 Ga0495610_0132277_78_710 207
40 3300037471 Ga0395905_0328782 Ga0395905_0328782_361_1050 208
41 3300039437 Ga0436365_0866041 Ga0436365_0866041_82_750 208
42 3300044693 Ga0466961_0028348 Ga0466961_0028348_1422_2111 208
43 3300045049 Ga0466959_0013667 Ga0466959_0013667_657_1346 208
44 3300049742 Ga0501080_0971614 Ga0501080_0971614_31_720 208
45 3300053130 Ga0500642_0018625 Ga0500642_0018625_2038_2679 208
46 3300003791 Ga0055530_10000072 Ga0055530_1000007244 209
47 3300003794 Ga0055531_10000114 Ga0055531_1000011444 209
48 3300009177 Ga0105248_10374757 Ga0105248_103747572 209
49 3300025298 Ga0209050_1000209 Ga0209050_100020971 209
50 3300025304 Ga0209257_1000027 Ga0209257_1000027631 209
51 3300046530 Ga0495654_0066436 Ga0495654_0066436_182_862 209
52 3300053087 Ga0500643_007149 Ga0500643_007149_1037_1684 209
53 3300053122 Ga0500608_192747 Ga0500608_192747_63_743 209
54 3300053136 Ga0500559_0110284 Ga0500559_0110284_287_967 209
55 3300053138 Ga0500564_057764 Ga0500564_057764_1069_1749 209
56 3300053729 Ga0500625_000011 Ga0500625_000011_2592_3272 209
57 3300003215 JGI25153J46596_10004838 JGI25153J46596_100048387 210
58 3300003773 Ga0055537_1002910 Ga0055537_10029104 210
59 3300003775 Ga0055524_1000118 Ga0055524_100011897 210
60 3300003794 Ga0055531_10001624 Ga0055531_100016244 210
61 3300005262 Ga0065165_1012710 Ga0065165_10127103 210
62 3300009551 Ga0105238_10003703 Ga0105238_1000370310 210
63 3300025263 Ga0209565_1000011 Ga0209565_1000011526 210
64 3300025273 Ga0209673_1000827 Ga0209673_100082710 210
65 3300025298 Ga0209050_1009555 Ga0209050_10095556 210
66 3300025299 Ga0209256_1000016 Ga0209256_100001674 210
67 3300025304 Ga0209257_1001515 Ga0209257_10015156 210
68 3300030733 Ga0314311_1253059 Ga0314311_12530591 210
69 3300037471 Ga0395905_0158282 Ga0395905_0158282_470_1117 210
70 3300039450 Ga0436363_1386082 Ga0436363_1386082_444_1118 210
71 3300041404 Ga0439436_0044005 Ga0439436_0044005_283_996 210
72 3300041406 Ga0439439_0003354 Ga0439439_0003354_1359_2072 210
73 3300041410 Ga0439461_0016751 Ga0439461_0016751_132_845 210
74 3300042121 Ga0450919_005818 Ga0450919_005818_557_1270 210
75 3300042435 Ga0439434_0021611 Ga0439434_0021611_283_996 210
76 3300045976 Ga0466967_0086428 Ga0466967_0086428_199_888 210
77 3300046453 Ga0495627_003594 Ga0495627_003594_5401_6084 210
78 3300046512 Ga0495610_0000146 Ga0495610_0000146_53342_54025 210
79 3300046520 Ga0495637_0001942 Ga0495637_0001942_9505_10188 210
80 3300046558 Ga0495633_0003946 Ga0495633_0003946_310_993 210
81 3300047470 Ga0495681_0000214 Ga0495681_0000214_4755_5438 210
82 3300047472 Ga0495686_0083568 Ga0495686_0083568_1135_1851 210
83 3300048929 Ga0496126_0341185 Ga0496126_0341185_100_744 210
84 3300053087 Ga0500643_002934 Ga0500643_002934_1987_2700 210
85 3300053122 Ga0500608_076391 Ga0500608_076391_91_735 210
86 3300053134 Ga0500658_0002920 Ga0500658_0002920_3061_3774 210
87 3300053139 Ga0500568_0015114 Ga0500568_0015114_172_885 210
88 3300053142 Ga0500577_0032742 Ga0500577_0032742_509_1222 210
89 3300053153 Ga0500616_0002503 Ga0500616_0002503_2760_3404 210
90 3300053157 Ga0500624_000009 Ga0500624_000009_171573_172256 210
91 iso_pu_bacteria 2885429604 2885430514 210
92 3300005355 Ga0070671_100239139 Ga0070671_1002391392 211
93 3300005367 Ga0070667_100674259 Ga0070667_1006742591 211
94 3300005459 Ga0068867_100524361 Ga0068867_1005243612 211
95 3300005617 Ga0068859_100256410 Ga0068859_1002564102 211
96 3300005843 Ga0068860_100347777 Ga0068860_1003477772 211
97 3300006931 Ga0097620_100256395 Ga0097620_1002563952 211
98 3300009177 Ga0105248_10033496 Ga0105248_100334964 211
99 3300013307 Ga0157372_10064804 Ga0157372_100648047 211
100 3300013307 Ga0157372_10510680 Ga0157372_105106802 211
101 3300013308 Ga0157375_10435869 Ga0157375_104358692 211
102 3300017792 Ga0163161_10007048 Ga0163161_100070487 211
103 3300025315 Ga0207697_10045640 Ga0207697_100456402 211
104 3300025931 Ga0207644_10537220 Ga0207644_105372202 211
105 3300025940 Ga0207691_10099573 Ga0207691_100995732 211
106 3300025941 Ga0207711_10088519 Ga0207711_100885191 211
107 3300025960 Ga0207651_10411755 Ga0207651_104117552 211
108 3300025986 Ga0207658_10225527 Ga0207658_102255272 211
109 3300026142 Ga0207698_10207361 Ga0207698_102073611 211
110 3300032004 Ga0307414_10001499 Ga0307414_100014995 211
111 3300048910 Ga0496107_0047010 Ga0496107_0047010_264_968 211
112 3300048913 Ga0496110_0471574 Ga0496110_0471574_153_857 211
113 3300005327 Ga0070658_10192660 Ga0070658_101926601 212
114 3300009545 Ga0105237_10570343 Ga0105237_105703431 212
115 3300028379 Ga0268266_10473503 Ga0268266_104735031 212
116 3300032005 Ga0307411_10060206 Ga0307411_100602062 212
117 3300044735 Ga0466968_0010515 Ga0466968_0010515_1272_1946 212
118 3300053094 Ga0500566_0000877 Ga0500566_0000877_7074_7787 212
119 iso_pu_bacteria 2928526807 2928528963 212
120 3300003215 JGI25153J46596_10000008 JGI25153J46596_10000008186 213
121 3300009551 Ga0105238_10969517 Ga0105238_109695171 213
122 3300021388 Ga0213875_10001461 Ga0213875_100014614 213
123 3300025297 Ga0209758_1000017 Ga0209758_1000017544 213
124 3300037853 Ga0436364_0852694 Ga0436364_0852694_12528_13211 213
125 iso_pu_bacteria 2599185359 2600228189 213
126 iso_pu_bacteria 2818991466 2819716234 213
127 iso_pu_bacteria 2879163058 2879163813 213
128 iso_pu_bacteria 2928968154 2928971198 213
129 3300009177 Ga0105248_10426907 Ga0105248_104269072 214
130 3300025230 Ga0209563_100130 Ga0209563_10013015 214
131 3300047472 Ga0495686_0001053 Ga0495686_0001053_28640_29320 214
132 3300048918 Ga0496115_0000464 Ga0496115_0000464_31021_31695 214
133 3300048922 Ga0496119_0027214 Ga0496119_0027214_1846_2526 214
134 3300005339 Ga0070660_100193300 Ga0070660_1001933002 215
135 3300005563 Ga0068855_100003431 Ga0068855_1000034313 215
136 3300005614 Ga0068856_100063293 Ga0068856_1000632932 215
137 3300005614 Ga0068856_100290640 Ga0068856_1002906403 215
138 3300005616 Ga0068852_100001538 Ga0068852_1000015385 215
139 3300009093 Ga0105240_10009282 Ga0105240_100092822 215
140 3300009148 Ga0105243_10412562 Ga0105243_104125622 215
141 3300009177 Ga0105248_10026331 Ga0105248_100263311 215
142 3300009551 Ga0105238_10154632 Ga0105238_101546322 215
143 3300009551 Ga0105238_10633714 Ga0105238_106337142 215
144 3300010375 Ga0105239_10098131 Ga0105239_100981314 215
145 3300013102 Ga0157371_10128541 Ga0157371_101285412 215
146 3300014325 Ga0163163_11008936 Ga0163163_110089361 215
147 3300014326 Ga0157380_10024926 Ga0157380_100249265 215
148 3300014968 Ga0157379_10181989 Ga0157379_101819892 215
149 3300020070 Ga0206356_10636768 Ga0206356_106367682 215
150 3300021384 Ga0213876_10000714 Ga0213876_100007149 215
151 3300025258 Ga0209129_1003658 Ga0209129_10036585 215
152 3300025298 Ga0209050_1009517 Ga0209050_10095172 215
153 3300025298 Ga0209050_1019060 Ga0209050_10190602 215
154 3300025913 Ga0207695_10007597 Ga0207695_100075972 215
155 3300025919 Ga0207657_10002178 Ga0207657_100021788 215
156 3300025919 Ga0207657_10167232 Ga0207657_101672322 215
157 3300025919 Ga0207657_10382327 Ga0207657_103823271 215
158 3300025924 Ga0207694_10004743 Ga0207694_100047438 215
159 3300025924 Ga0207694_10014424 Ga0207694_100144242 215
160 3300025935 Ga0207709_10614511 Ga0207709_106145111 215
161 3300025940 Ga0207691_10704127 Ga0207691_107041271 215
162 3300025949 Ga0207667_10000651 Ga0207667_1000065133 215
163 3300025961 Ga0207712_10733493 Ga0207712_107334931 215
164 3300026078 Ga0207702_10198470 Ga0207702_101984703 215
165 3300037471 Ga0395905_0044710 Ga0395905_0044710_1916_2623 215
166 3300044735 Ga0466968_0253574 Ga0466968_0253574_26_694 215
167 3300046460 Ga0495638_0032605 Ga0495638_0032605_2536_3213 215
168 3300046506 Ga0495583_0000023 Ga0495583_0000023_250718_251395 215
169 3300046660 Ga0495625_0001071 Ga0495625_0001071_29160_29825 215
170 3300046665 Ga0495661_0012693 Ga0495661_0012693_431_1108 215
171 3300046691 Ga0495670_0024419 Ga0495670_0024419_1674_2351 215
172 3300047472 Ga0495686_0002522 Ga0495686_0002522_13935_14603 215
173 3300047472 Ga0495686_0004950 Ga0495686_0004950_9505_10173 215
174 3300048920 Ga0496117_0037145 Ga0496117_0037145_1961_2644 215
175 3300048921 Ga0496118_0029470 Ga0496118_0029470_2681_3364 215
176 3300050509 nmdc:mga0qj67_621834_c1 nmdc:mga0qj67_621834_c1_89_772 215
177 3300053103 Ga0500555_000164 Ga0500555_000164_28574_29251 215
178 3300053116 Ga0500592_022616 Ga0500592_022616_83_730 215
179 3300053136 Ga0500559_0031963 Ga0500559_0031963_891_1559 215
180 3300053140 Ga0500573_0175726 Ga0500573_0175726_172_831 215
181 3300001979 JGI24740J21852_10030569 JGI24740J21852_100305691 216
182 3300001989 JGI24739J22299_10047732 JGI24739J22299_100477322 216
183 3300002067 JGI24735J21928_10021243 JGI24735J21928_100212432 216
184 3300002067 JGI24735J21928_10023346 JGI24735J21928_100233462 216
185 3300002067 JGI24735J21928_10051268 JGI24735J21928_100512681 216
186 3300005327 Ga0070658_10079969 Ga0070658_100799694 216
187 3300005328 Ga0070676_10217451 Ga0070676_102174513 216
188 3300005329 Ga0070683_100195833 Ga0070683_1001958333 216
189 3300005338 Ga0068868_100119637 Ga0068868_1001196373 216
190 3300005339 Ga0070660_100024707 Ga0070660_1000247075 216
191 3300005345 Ga0070692_10125102 Ga0070692_101251021 216
192 3300005356 Ga0070674_100215623 Ga0070674_1002156232 216
193 3300005366 Ga0070659_100005974 Ga0070659_1000059743 216
194 3300005436 Ga0070713_100502716 Ga0070713_1005027162 216
195 3300005440 Ga0070705_100710137 Ga0070705_1007101371 216
196 3300005455 Ga0070663_100671073 Ga0070663_1006710731 216
197 3300005455 Ga0070663_100695733 Ga0070663_1006957331 216
198 3300005457 Ga0070662_100228129 Ga0070662_1002281292 216
199 3300005458 Ga0070681_10029966 Ga0070681_100299664 216
200 3300005530 Ga0070679_100153616 Ga0070679_1001536164 216
201 3300005535 Ga0070684_100004255 Ga0070684_1000042555 216
202 3300005535 Ga0070684_100143776 Ga0070684_1001437762 216
203 3300005539 Ga0068853_100066503 Ga0068853_1000665032 216
204 3300005539 Ga0068853_100289580 Ga0068853_1002895802 216
205 3300005614 Ga0068856_100042299 Ga0068856_1000422995 216
206 3300009011 Ga0105251_10000342 Ga0105251_1000034245 216
207 3300009092 Ga0105250_10005428 Ga0105250_100054286 216
208 3300009093 Ga0105240_10075745 Ga0105240_100757454 216
209 3300009098 Ga0105245_10001536 Ga0105245_100015369 216
210 3300009098 Ga0105245_10006243 Ga0105245_100062435 216
211 3300009098 Ga0105245_10031992 Ga0105245_100319923 216
212 3300009148 Ga0105243_10000611 Ga0105243_1000061110 216
213 3300009148 Ga0105243_10001363 Ga0105243_1000136312 216
214 3300009174 Ga0105241_10011404 Ga0105241_100114047 216
215 3300009176 Ga0105242_10000818 Ga0105242_1000081810 216
216 3300009176 Ga0105242_10003633 Ga0105242_1000363313 216
217 3300009176 Ga0105242_10719686 Ga0105242_107196862 216
218 3300009177 Ga0105248_10000016 Ga0105248_10000016173 216
219 3300009177 Ga0105248_10014376 Ga0105248_100143765 216
220 3300009177 Ga0105248_10046730 Ga0105248_100467306 216
221 3300009177 Ga0105248_10069459 Ga0105248_100694596 216
222 3300009545 Ga0105237_10030869 Ga0105237_100308694 216
223 3300009545 Ga0105237_10032851 Ga0105237_100328515 216
224 3300009545 Ga0105237_10155275 Ga0105237_101552753 216
225 3300009551 Ga0105238_10020220 Ga0105238_100202203 216
226 3300009551 Ga0105238_10025509 Ga0105238_100255096 216
227 3300009551 Ga0105238_10056843 Ga0105238_100568436 216
228 3300009551 Ga0105238_10067233 Ga0105238_100672333 216
229 3300009553 Ga0105249_10000106 Ga0105249_1000010652 216
230 3300009553 Ga0105249_10005694 Ga0105249_1000569411 216
231 3300009553 Ga0105249_10266691 Ga0105249_102666912 216
232 3300010375 Ga0105239_10070023 Ga0105239_100700233 216
233 3300011119 Ga0105246_10000620 Ga0105246_1000062015 216
234 3300013100 Ga0157373_10028624 Ga0157373_100286246 216
235 3300013100 Ga0157373_10085988 Ga0157373_100859882 216
236 3300013100 Ga0157373_10102585 Ga0157373_101025853 216
237 3300013100 Ga0157373_10136279 Ga0157373_101362792 216
238 3300013100 Ga0157373_10272680 Ga0157373_102726802 216
239 3300013100 Ga0157373_10537277 Ga0157373_105372772 216
240 3300013102 Ga0157371_10000110 Ga0157371_10000110121 216
241 3300013102 Ga0157371_10037024 Ga0157371_100370243 216
242 3300013102 Ga0157371_10040991 Ga0157371_100409912 216
243 3300013104 Ga0157370_10041223 Ga0157370_100412233 216
244 3300013104 Ga0157370_10112118 Ga0157370_101121183 216
245 3300013105 Ga0157369_10002495 Ga0157369_100024953 216
246 3300013105 Ga0157369_10008947 Ga0157369_1000894712 216
247 3300013105 Ga0157369_10009057 Ga0157369_100090573 216
248 3300013105 Ga0157369_10068610 Ga0157369_100686106 216
249 3300013105 Ga0157369_10094805 Ga0157369_100948053 216
250 3300013296 Ga0157374_10006203 Ga0157374_100062036 216
251 3300013296 Ga0157374_10046810 Ga0157374_100468103 216
252 3300013296 Ga0157374_10070052 Ga0157374_100700523 216
253 3300013296 Ga0157374_10090575 Ga0157374_100905756 216
254 3300013297 Ga0157378_10008062 Ga0157378_100080627 216
255 3300013297 Ga0157378_10033143 Ga0157378_100331436 216
256 3300013297 Ga0157378_10042832 Ga0157378_100428325 216
257 3300013297 Ga0157378_10217265 Ga0157378_102172652 216
258 3300013306 Ga0163162_10050115 Ga0163162_100501154 216
259 3300013306 Ga0163162_10081335 Ga0163162_100813353 216
260 3300013306 Ga0163162_10091245 Ga0163162_100912455 216
261 3300013307 Ga0157372_10085245 Ga0157372_100852453 216
262 3300013307 Ga0157372_10107945 Ga0157372_101079453 216
263 3300013307 Ga0157372_10494116 Ga0157372_104941163 216
264 3300013307 Ga0157372_10605423 Ga0157372_106054232 216
265 3300013308 Ga0157375_10004152 Ga0157375_1000415210 216
266 3300013308 Ga0157375_10035911 Ga0157375_100359115 216
267 3300014325 Ga0163163_10000588 Ga0163163_100005883 216
268 3300014325 Ga0163163_10039738 Ga0163163_100397383 216
269 3300014968 Ga0157379_10034380 Ga0157379_100343805 216
270 3300014968 Ga0157379_10154402 Ga0157379_101544021 216
271 3300014969 Ga0157376_10000955 Ga0157376_1000095510 216
272 3300014969 Ga0157376_10001235 Ga0157376_1000123518 216
273 3300025272 Ga0209455_1001814 Ga0209455_10018149 216
274 3300025321 Ga0207656_10029028 Ga0207656_100290284 216
275 3300025903 Ga0207680_10175237 Ga0207680_101752372 216
276 3300025904 Ga0207647_10078400 Ga0207647_100784001 216
277 3300025914 Ga0207671_10254387 Ga0207671_102543872 216
278 3300025932 Ga0207690_10012702 Ga0207690_100127022 216
279 3300025938 Ga0207704_10665084 Ga0207704_106650841 216
280 3300025941 Ga0207711_10002492 Ga0207711_100024926 216
281 3300025986 Ga0207658_10009967 Ga0207658_100099673 216
282 3300026078 Ga0207702_10201102 Ga0207702_102011021 216
283 3300035115 Ga0373941_0085440 Ga0373941_0085440_294_983 216
284 3300035691 Ga0373931_0246318 Ga0373931_0246318_110_799 216
285 3300037312 Ga0395899_0018782 Ga0395899_0018782_1891_2580 216
286 3300037312 Ga0395899_0037136 Ga0395899_0037136_1501_2190 216
287 3300037418 Ga0395900_0000764 Ga0395900_0000764_34725_35414 216
288 3300037418 Ga0395900_0081537 Ga0395900_0081537_2175_2864 216
289 3300037418 Ga0395900_0094288 Ga0395900_0094288_1763_2452 216
290 3300037418 Ga0395900_0178364 Ga0395900_0178364_1033_1722 216
291 3300037418 Ga0395900_0359544 Ga0395900_0359544_678_1367 216
292 3300037418 Ga0395900_0579831 Ga0395900_0579831_149_838 216
293 3300037418 Ga0395900_0630950 Ga0395900_0630950_102_791 216
294 3300037466 Ga0395898_0021463 Ga0395898_0021463_1891_2580 216
295 3300037466 Ga0395898_0028931 Ga0395898_0028931_2230_2919 216
296 3300037466 Ga0395898_0058445 Ga0395898_0058445_1700_2389 216
297 3300037466 Ga0395898_0117307 Ga0395898_0117307_923_1612 216
298 3300037471 Ga0395905_0003045 Ga0395905_0003045_11474_12163 216
299 3300037471 Ga0395905_0004674 Ga0395905_0004674_9266_9955 216
300 3300037471 Ga0395905_0013463 Ga0395905_0013463_3614_4303 216
301 3300037471 Ga0395905_0033153 Ga0395905_0033153_2656_3345 216
302 3300037471 Ga0395905_0043534 Ga0395905_0043534_74_763 216
303 3300037471 Ga0395905_0117126 Ga0395905_0117126_983_1672 216
304 3300037471 Ga0395905_0742484 Ga0395905_0742484_122_811 216
305 3300037471 Ga0395905_0755988 Ga0395905_0755988_49_723 216
306 3300037853 Ga0436364_0612163 Ga0436364_0612163_15746_16435 216
307 3300038443 Ga0395901_0005146 Ga0395901_0005146_8545_9234 216
308 3300038443 Ga0395901_0009829 Ga0395901_0009829_3332_4021 216
309 3300038443 Ga0395901_0118405 Ga0395901_0118405_57_746 216
310 3300038443 Ga0395901_0343089 Ga0395901_0343089_95_784 216
311 3300038443 Ga0395901_0438477 Ga0395901_0438477_241_930 216
312 3300042005 Ga0439448_0013838 Ga0439448_0013838_1739_2410 216
313 3300044693 Ga0466961_0011363 Ga0466961_0011363_1722_2411 216
314 3300044694 Ga0466963_0015006 Ga0466963_0015006_1518_2207 216
315 3300044694 Ga0466963_0024760 Ga0466963_0024760_1928_2617 216
316 3300044694 Ga0466963_0034218 Ga0466963_0034218_285_974 216
317 3300044694 Ga0466963_0459130 Ga0466963_0459130_55_744 216
318 3300044765 Ga0466970_0177239 Ga0466970_0177239_253_942 216
319 3300044842 Ga0466957_0002027 Ga0466957_0002027_2582_3271 216
320 3300044901 Ga0466960_0025899 Ga0466960_0025899_1606_2295 216
321 3300045049 Ga0466959_0033855 Ga0466959_0033855_1091_1780 216
322 3300045836 Ga0466958_0246927 Ga0466958_0246927_83_772 216
323 3300045976 Ga0466967_0015627 Ga0466967_0015627_3116_3805 216
324 3300045976 Ga0466967_0037136 Ga0466967_0037136_2788_3477 216
325 3300045976 Ga0466967_0146406 Ga0466967_0146406_492_1181 216
326 3300045976 Ga0466967_0313871 Ga0466967_0313871_767_1456 216
327 3300045976 Ga0466967_0402204 Ga0466967_0402204_552_1241 216
328 3300046459 Ga0495629_0237250 Ga0495629_0237250_572_1243 216
329 3300046471 Ga0495650_0000428 Ga0495650_0000428_8268_8939 216
330 3300046476 Ga0495662_0063501 Ga0495662_0063501_713_1384 216
331 3300046491 Ga0495584_0162164 Ga0495584_0162164_137_808 216
332 3300046492 Ga0495585_0041703 Ga0495585_0041703_1864_2535 216
333 3300046506 Ga0495583_0001895 Ga0495583_0001895_10335_11006 216
334 3300046506 Ga0495583_0003188 Ga0495583_0003188_11367_12038 216
335 3300046507 Ga0495606_0000383 Ga0495606_0000383_74372_75043 216
336 3300046507 Ga0495606_0031914 Ga0495606_0031914_2343_3014 216
337 3300046513 Ga0495616_0189655 Ga0495616_0189655_144_815 216
338 3300046518 Ga0495631_0001928 Ga0495631_0001928_6051_6722 216
339 3300046522 Ga0495643_0004145 Ga0495643_0004145_4226_4897 216
340 3300046522 Ga0495643_0006878 Ga0495643_0006878_3694_4365 216
341 3300046524 Ga0495648_0001391 Ga0495648_0001391_19476_20147 216
342 3300046536 Ga0495587_0153556 Ga0495587_0153556_343_1014 216
343 3300046538 Ga0495609_0113675 Ga0495609_0113675_337_1008 216
344 3300046539 Ga0495621_0030722 Ga0495621_0030722_863_1552 216
345 3300046558 Ga0495633_0013402 Ga0495633_0013402_2155_2826 216
346 3300046558 Ga0495633_0029090 Ga0495633_0029090_1360_2031 216
347 3300046616 Ga0495668_0000218 Ga0495668_0000218_12650_13321 216
348 3300046616 Ga0495668_0169808 Ga0495668_0169808_511_1182 216
349 3300046648 Ga0495611_0007098 Ga0495611_0007098_292_963 216
350 3300046660 Ga0495625_0000496 Ga0495625_0000496_27601_28272 216
351 3300046660 Ga0495625_0011582 Ga0495625_0011582_69_740 216
352 3300046665 Ga0495661_0029644 Ga0495661_0029644_2058_2729 216
353 3300046674 Ga0495588_0318398 Ga0495588_0318398_84_773 216
354 3300046684 Ga0495669_0000241 Ga0495669_0000241_22868_23539 216
355 3300046684 Ga0495669_0098652 Ga0495669_0098652_170_859 216
356 3300046694 Ga0495649_0237533 Ga0495649_0237533_76_747 216
357 3300046809 Ga0495600_0049411 Ga0495600_0049411_1368_2039 216
358 3300046810 Ga0495660_0142058 Ga0495660_0142058_445_1116 216
359 3300047323 Ga0495683_0010498 Ga0495683_0010498_66_737 216
360 3300047443 Ga0495687_001043 Ga0495687_001043_16395_17066 216
361 3300047443 Ga0495687_001672 Ga0495687_001672_8303_8974 216
362 3300047470 Ga0495681_0025540 Ga0495681_0025540_1223_1894 216
363 3300047472 Ga0495686_0099470 Ga0495686_0099470_523_1194 216
364 3300048903 Ga0496100_0005362 Ga0496100_0005362_3130_3819 216
365 3300048903 Ga0496100_0132399 Ga0496100_0132399_215_904 216
366 3300048904 Ga0496101_0001845 Ga0496101_0001845_8803_9492 216
367 3300048904 Ga0496101_0265316 Ga0496101_0265316_440_1105 216
368 3300048905 Ga0496102_0004530 Ga0496102_0004530_6785_7456 216
369 3300048905 Ga0496102_0357322 Ga0496102_0357322_492_1181 216
370 3300048906 Ga0496103_0002302 Ga0496103_0002302_6664_7335 216
371 3300048906 Ga0496103_0007333 Ga0496103_0007333_4611_5276 216
372 3300048906 Ga0496103_0070972 Ga0496103_0070972_1141_1830 216
373 3300048907 Ga0496104_0017339 Ga0496104_0017339_291_962 216
374 3300048907 Ga0496104_0063254 Ga0496104_0063254_886_1575 216
375 3300048908 Ga0496105_0009443 Ga0496105_0009443_352_1023 216
376 3300048908 Ga0496105_0035375 Ga0496105_0035375_1571_2260 216
377 3300048908 Ga0496105_0086958 Ga0496105_0086958_1320_2009 216
378 3300048909 Ga0496106_0024920 Ga0496106_0024920_476_1165 216
379 3300048909 Ga0496106_0397289 Ga0496106_0397289_334_1023 216
380 3300048910 Ga0496107_0002051 Ga0496107_0002051_8636_9325 216
381 3300048911 Ga0496108_0014779 Ga0496108_0014779_4314_5003 216
382 3300048911 Ga0496108_0051888 Ga0496108_0051888_1229_1918 216
383 3300048912 Ga0496109_0030292 Ga0496109_0030292_3769_4458 216
384 3300048912 Ga0496109_0038420 Ga0496109_0038420_2295_2984 216
385 3300048912 Ga0496109_0071775 Ga0496109_0071775_271_960 216
386 3300048913 Ga0496110_0009431 Ga0496110_0009431_5846_6535 216
387 3300048913 Ga0496110_0029480 Ga0496110_0029480_1896_2585 216
388 3300048913 Ga0496110_0083631 Ga0496110_0083631_444_1115 216
389 3300048914 Ga0496111_0001035 Ga0496111_0001035_7091_7780 216
390 3300048914 Ga0496111_0004529 Ga0496111_0004529_2026_2715 216
391 3300048915 Ga0496112_0013316 Ga0496112_0013316_4481_5170 216
392 3300048916 Ga0496113_0025057 Ga0496113_0025057_121_792 216
393 3300048916 Ga0496113_0284930 Ga0496113_0284930_168_857 216
394 3300048918 Ga0496115_0005489 Ga0496115_0005489_4209_4880 216
395 3300048919 Ga0496116_0009864 Ga0496116_0009864_5909_6580 216
396 3300048920 Ga0496117_0001114 Ga0496117_0001114_35590_36261 216
397 3300048920 Ga0496117_0011627 Ga0496117_0011627_4262_4927 216
398 3300048921 Ga0496118_0000127 Ga0496118_0000127_130421_131092 216
399 3300048921 Ga0496118_0004860 Ga0496118_0004860_10700_11365 216
400 3300048922 Ga0496119_0040560 Ga0496119_0040560_2054_2725 216
401 3300048924 Ga0496121_0010096 Ga0496121_0010096_5764_6435 216
402 3300048925 Ga0496122_0016138 Ga0496122_0016138_5714_6385 216
403 3300048926 Ga0496123_0030686 Ga0496123_0030686_2183_2854 216
404 3300048927 Ga0496124_0000011 Ga0496124_0000011_4658_5329 216
405 3300048928 Ga0496125_0001918 Ga0496125_0001918_22070_22741 216
406 3300048929 Ga0496126_0008126 Ga0496126_0008126_4734_5405 216
407 3300049460 Ga0495682_0023253 Ga0495682_0023253_1335_2006 216
408 3300053079 Ga0500610_0000668 Ga0500610_0000668_4149_4820 216
409 3300053087 Ga0500643_000338 Ga0500643_000338_5257_5907 216
410 3300053119 Ga0500595_002635 Ga0500595_002635_5681_6352 216
411 3300053130 Ga0500642_0000751 Ga0500642_0000751_2319_2990 216
412 3300053140 Ga0500573_0000019 Ga0500573_0000019_8142_8810 216
413 3300053730 Ga0500645_000237 Ga0500645_000237_31793_32464 216
414 3300053730 Ga0500645_001144 Ga0500645_001144_8543_9208 216
415 iso_pu_bacteria 8057101203 8057101643 216
416 3300001989 JGI24739J22299_10001692 JGI24739J22299_100016925 217
417 3300001989 JGI24739J22299_10006535 JGI24739J22299_100065352 217
418 3300001990 JGI24737J22298_10039840 JGI24737J22298_100398402 217
419 3300005290 Ga0065712_10079995 Ga0065712_100799953 217
420 3300005327 Ga0070658_10028040 Ga0070658_100280404 217
421 3300005331 Ga0070670_100002960 Ga0070670_1000029607 217
422 3300005333 Ga0070677_10061237 Ga0070677_100612371 217
423 3300005335 Ga0070666_10012077 Ga0070666_100120774 217
424 3300005344 Ga0070661_100138860 Ga0070661_1001388602 217
425 3300005347 Ga0070668_100399676 Ga0070668_1003996761 217
426 3300005353 Ga0070669_100291587 Ga0070669_1002915872 217
427 3300005354 Ga0070675_100002343 Ga0070675_1000023433 217
428 3300005355 Ga0070671_100014361 Ga0070671_1000143614 217
429 3300005356 Ga0070674_100218977 Ga0070674_1002189773 217
430 3300005366 Ga0070659_100235550 Ga0070659_1002355503 217
431 3300005367 Ga0070667_100033868 Ga0070667_1000338684 217
432 3300005457 Ga0070662_100006250 Ga0070662_1000062503 217
433 3300005457 Ga0070662_100131956 Ga0070662_1001319562 217
434 3300005539 Ga0068853_100016963 Ga0068853_1000169635 217
435 3300005563 Ga0068855_100256310 Ga0068855_1002563103 217
436 3300005834 Ga0068851_10078004 Ga0068851_100780042 217
437 3300009093 Ga0105240_10011291 Ga0105240_100112916 217
438 3300009093 Ga0105240_10040268 Ga0105240_100402686 217
439 3300009093 Ga0105240_10079587 Ga0105240_100795873 217
440 3300009094 Ga0111539_10073522 Ga0111539_100735226 217
441 3300009101 Ga0105247_10155492 Ga0105247_101554922 217
442 3300009177 Ga0105248_10002223 Ga0105248_1000222319 217
443 3300009177 Ga0105248_10065059 Ga0105248_100650592 217
444 3300009545 Ga0105237_10054983 Ga0105237_100549833 217
445 3300009551 Ga0105238_10016971 Ga0105238_100169714 217
446 3300009553 Ga0105249_10000005 Ga0105249_10000005104 217
447 3300013100 Ga0157373_10429189 Ga0157373_104291891 217
448 3300013102 Ga0157371_10152424 Ga0157371_101524242 217
449 3300013104 Ga0157370_10012605 Ga0157370_100126053 217
450 3300013105 Ga0157369_10003524 Ga0157369_1000352414 217
451 3300013296 Ga0157374_11346219 Ga0157374_113462191 217
452 3300013306 Ga0163162_10005086 Ga0163162_100050868 217
453 3300013306 Ga0163162_10250436 Ga0163162_102504362 217
454 3300013307 Ga0157372_10116707 Ga0157372_101167072 217
455 3300013308 Ga0157375_10037485 Ga0157375_100374854 217
456 3300014326 Ga0157380_10001569 Ga0157380_100015694 217
457 3300014968 Ga0157379_10031170 Ga0157379_100311703 217
458 3300025321 Ga0207656_10028661 Ga0207656_100286613 217
459 3300025909 Ga0207705_10042845 Ga0207705_100428454 217
460 3300025914 Ga0207671_10013100 Ga0207671_100131008 217
461 3300025914 Ga0207671_10694554 Ga0207671_106945541 217
462 3300025949 Ga0207667_10367666 Ga0207667_103676663 217
463 3300031456 Ga0307513_10062253 Ga0307513_100622533 217
464 3300042004 Ga0439445_0025915 Ga0439445_0025915_280_957 217
465 3300042006 Ga0439432_030753 Ga0439432_030753_705_1388 217
466 3300042142 Ga0450905_001171 Ga0450905_001171_552_1247 217
467 3300042144 Ga0450889_002955 Ga0450889_002955_350_1045 217
468 3300046460 Ga0495638_0325835 Ga0495638_0325835_110_781 217
469 3300046492 Ga0495585_0039184 Ga0495585_0039184_1078_1761 217
470 3300046506 Ga0495583_0069191 Ga0495583_0069191_679_1350 217
471 3300046520 Ga0495637_0011424 Ga0495637_0011424_2335_3003 217
472 3300046522 Ga0495643_0084923 Ga0495643_0084923_921_1589 217
473 3300046522 Ga0495643_0236448 Ga0495643_0236448_142_813 217
474 3300046525 Ga0495663_0002898 Ga0495663_0002898_1741_2424 217
475 3300046530 Ga0495654_0080270 Ga0495654_0080270_66_734 217
476 3300046539 Ga0495621_0002284 Ga0495621_0002284_2366_3049 217
477 3300046542 Ga0495597_0012717 Ga0495597_0012717_1576_2244 217
478 3300046558 Ga0495633_0002596 Ga0495633_0002596_5879_6562 217
479 3300046616 Ga0495668_0023087 Ga0495668_0023087_730_1398 217
480 3300046616 Ga0495668_0246353 Ga0495668_0246353_195_866 217
481 3300046660 Ga0495625_0154925 Ga0495625_0154925_57_728 217
482 3300046684 Ga0495669_0008608 Ga0495669_0008608_782_1465 217
483 3300046684 Ga0495669_0017147 Ga0495669_0017147_563_1246 217
484 3300046810 Ga0495660_0118787 Ga0495660_0118787_516_1184 217
485 3300047445 Ga0495677_0005009 Ga0495677_0005009_2189_2872 217
486 3300047445 Ga0495677_0151658 Ga0495677_0151658_197_868 217
487 3300048904 Ga0496101_0141793 Ga0496101_0141793_584_1237 217
488 3300048905 Ga0496102_0000756 Ga0496102_0000756_1725_2378 217
489 3300048905 Ga0496102_0583481 Ga0496102_0583481_222_917 217
490 3300048906 Ga0496103_0014624 Ga0496103_0014624_1478_2131 217
491 3300048906 Ga0496103_0423131 Ga0496103_0423131_120_806 217
492 3300048908 Ga0496105_0156845 Ga0496105_0156845_545_1198 217
493 3300048910 Ga0496107_0165819 Ga0496107_0165819_377_1060 217
494 3300048912 Ga0496109_0064818 Ga0496109_0064818_1848_2531 217
495 3300048913 Ga0496110_0000948 Ga0496110_0000948_6571_7254 217
496 3300048913 Ga0496110_0275824 Ga0496110_0275824_548_1201 217
497 3300048914 Ga0496111_0022502 Ga0496111_0022502_1309_1992 217
498 3300048914 Ga0496111_0074293 Ga0496111_0074293_420_1073 217
499 3300048915 Ga0496112_0554255 Ga0496112_0554255_73_768 217
500 3300048919 Ga0496116_0056694 Ga0496116_0056694_440_1093 217
501 3300048920 Ga0496117_0040426 Ga0496117_0040426_2301_2954 217
502 3300048921 Ga0496118_0009117 Ga0496118_0009117_8075_8728 217
503 3300048924 Ga0496121_0005712 Ga0496121_0005712_10332_11021 217
504 3300048924 Ga0496121_0051385 Ga0496121_0051385_712_1365 217
505 3300048929 Ga0496126_0007282 Ga0496126_0007282_9941_10630 217
506 3300049513 Ga0501290_002973 Ga0501290_002973_1259_1918 217
507 3300049515 Ga0501292_000040 Ga0501292_000040_29204_29863 217
508 3300049653 Ga0501206_001042 Ga0501206_001042_57_716 217
509 3300049662 Ga0501222_002113 Ga0501222_002113_308_967 217
510 3300049663 Ga0501223_001533 Ga0501223_001533_470_1129 217
511 3300049664 Ga0501224_001796 Ga0501224_001796_1020_1679 217
512 3300049669 Ga0501235_003681 Ga0501235_003681_668_1327 217
513 3300049690 Ga0501261_000110 Ga0501261_000110_10540_11199 217
514 3300049704 Ga0501221_001519 Ga0501221_001519_463_1122 217
515 3300049705 Ga0501225_0027884 Ga0501225_0027884_547_1206 217
516 3300049708 Ga0501245_002143 Ga0501245_002143_999_1658 217
517 3300049775 Ga0501279_000008 Ga0501279_000008_71101_71760 217
518 3300049776 Ga0501280_000233 Ga0501280_000233_1262_1921 217
519 3300049777 Ga0501281_00064 Ga0501281_00064_1211_1870 217
520 3300049778 Ga0501282_000614 Ga0501282_000614_1255_1914 217
521 3300050511 nmdc:mga08y16_94019_c1 nmdc:mga08y16_94019_c1_2006_2701 217
522 3300053087 Ga0500643_000136 Ga0500643_000136_40502_41170 217
523 3300053087 Ga0500643_002056 Ga0500643_002056_4033_4704 217
524 3300053091 Ga0500647_0092524 Ga0500647_0092524_299_967 217
525 3300053093 Ga0500651_0042612 Ga0500651_0042612_1903_2571 217
526 3300053116 Ga0500592_000232 Ga0500592_000232_5285_5953 217
527 3300053116 Ga0500592_002720 Ga0500592_002720_1033_1704 217
528 3300053133 Ga0500655_000159 Ga0500655_000159_14837_15505 217
529 3300053134 Ga0500658_0185545 Ga0500658_0185545_221_889 217
530 3300053148 Ga0500590_005065 Ga0500590_005065_5166_5834 217
531 3300053158 Ga0500627_0000091 Ga0500627_0000091_29107_29775 217
532 3300053177 Ga0500636_0319596 Ga0500636_0319596_16_684 217
533 3300053724 Ga0500570_001921 Ga0500570_001921_6485_7153 217
534 3300053730 Ga0500645_020770 Ga0500645_020770_18_686 217
535 iso_pu_bacteria 2599185354 2600202819 217
536 iso_pu_bacteria 2643221541 2643730531 217
537 iso_pu_bacteria 2643221606 2644043700 217
538 iso_pu_bacteria 2643221622 2644128132 217
539 iso_pu_bacteria 2643221671 2644393859 217
540 3300002075 JGI24738J21930_10034667 JGI24738J21930_100346672 218
541 3300005367 Ga0070667_100000873 Ga0070667_10000087311 218
542 3300005841 Ga0068863_100053028 Ga0068863_1000530283 218
543 3300005843 Ga0068860_100000834 Ga0068860_1000008345 218
544 3300025986 Ga0207658_10000545 Ga0207658_1000054533 218
545 3300026088 Ga0207641_10001261 Ga0207641_1000126118 218
546 3300028381 Ga0268264_10000277 Ga0268264_1000027711 218
547 3300031911 Ga0307412_10014384 Ga0307412_100143844 218
548 iso_pu_bacteria 2643221605 2644037506 218
549 iso_pu_bacteria 2990265787 2990265880 218
550 iso_pu_bacteria 2993693658 2993696329 218
551 3300005347 Ga0070668_100011256 Ga0070668_1000112565 219
552 3300005367 Ga0070667_100113824 Ga0070667_1001138242 219
553 3300005844 Ga0068862_100009813 Ga0068862_1000098133 219
554 3300025931 Ga0207644_10036676 Ga0207644_100366762 219
555 3300025941 Ga0207711_10371094 Ga0207711_103710942 219
556 3300025972 Ga0207668_10000490 Ga0207668_1000049020 219
557 3300025986 Ga0207658_10009613 Ga0207658_100096136 219
558 3300048920 Ga0496117_0021825 Ga0496117_0021825_2868_3551 219
559 3300048921 Ga0496118_0001703 Ga0496118_0001703_10794_11477 219
560 3300048927 Ga0496124_0067342 Ga0496124_0067342_998_1681 219
561 3300002774 JGI25150J39212_1000855 JGI25150J39212_10008555 220
562 3300003214 JGI25165J46597_1000024 JGI25165J46597_100002414 220
563 3300003215 JGI25153J46596_10000091 JGI25153J46596_1000009110 220
564 3300003215 JGI25153J46596_10000186 JGI25153J46596_100001868 220
565 3300003773 Ga0055537_1001760 Ga0055537_10017602 220
566 3300003791 Ga0055530_10019126 Ga0055530_100191262 220
567 3300003792 Ga0055540_1001847 Ga0055540_10018477 220
568 3300005295 Ga0065707_10082564 Ga0065707_1008256413 220
569 3300005347 Ga0070668_100021509 Ga0070668_1000215093 220
570 3300005539 Ga0068853_100106522 Ga0068853_1001065223 220
571 3300005548 Ga0070665_100000471 Ga0070665_10000047158 220
572 3300005617 Ga0068859_100065318 Ga0068859_1000653183 220
573 3300005719 Ga0068861_100000132 Ga0068861_10000013238 220
574 3300006846 Ga0075430_100038654 Ga0075430_1000386545 220
575 3300006931 Ga0097620_100065319 Ga0097620_1000653193 220
576 3300009177 Ga0105248_10002773 Ga0105248_100027732 220
577 3300013307 Ga0157372_10512443 Ga0157372_105124432 220
578 3300025261 Ga0209233_1000084 Ga0209233_1000084295 220
579 3300025263 Ga0209565_1000170 Ga0209565_100017053 220
580 3300025272 Ga0209455_1009677 Ga0209455_10096773 220
581 3300025273 Ga0209673_1008761 Ga0209673_10087613 220
582 3300025292 Ga0209676_1006991 Ga0209676_10069913 220
583 3300025294 Ga0209025_1000068 Ga0209025_100006853 220
584 3300025295 Ga0209564_1000335 Ga0209564_10003357 220
585 3300025295 Ga0209564_1016363 Ga0209564_10163632 220
586 3300025297 Ga0209758_1000019 Ga0209758_1000019667 220
587 3300025298 Ga0209050_1000001 Ga0209050_10000011881 220
588 3300025298 Ga0209050_1000108 Ga0209050_1000108169 220
589 3300025303 Ga0209051_1000239 Ga0209051_100023941 220
590 3300025304 Ga0209257_1001066 Ga0209257_100106626 220
591 3300025304 Ga0209257_1001071 Ga0209257_100107127 220
592 3300025924 Ga0207694_10512327 Ga0207694_105123271 220
593 3300025941 Ga0207711_10063922 Ga0207711_100639224 220
594 3300025972 Ga0207668_10013664 Ga0207668_100136643 220
595 3300026118 Ga0207675_100000071 Ga0207675_10000007141 220
596 3300028380 Ga0268265_10155686 Ga0268265_101556862 220
597 3300031548 Ga0307408_100375434 Ga0307408_1003754342 220
598 3300031824 Ga0307413_10177020 Ga0307413_101770202 220
599 3300032005 Ga0307411_10070385 Ga0307411_100703852 220
600 3300045051 Ga0451576_0064272 Ga0451576_0064272_1397_2086 220
601 3300046660 Ga0495625_0044610 Ga0495625_0044610_2418_3095 220
602 3300048905 Ga0496102_0000719 Ga0496102_0000719_28105_28806 220
603 3300048906 Ga0496103_0000562 Ga0496103_0000562_24800_25501 220
604 3300048919 Ga0496116_0002037 Ga0496116_0002037_3251_3952 220
605 3300048920 Ga0496117_0000519 Ga0496117_0000519_28071_28772 220
606 3300048921 Ga0496118_0000193 Ga0496118_0000193_28027_28728 220
607 3300048922 Ga0496119_0036669 Ga0496119_0036669_517_1218 220
608 3300048923 Ga0496120_0049671 Ga0496120_0049671_1580_2281 220
609 3300048927 Ga0496124_0000237 Ga0496124_0000237_78580_79281 220
610 3300001915 JGI24741J21665_1001317 JGI24741J21665_10013177 221
611 3300001979 JGI24740J21852_10003058 JGI24740J21852_100030582 221
612 3300001990 JGI24737J22298_10002390 JGI24737J22298_100023907 221
613 3300002067 JGI24735J21928_10014907 JGI24735J21928_100149074 221
614 3300002239 JGI24034J26672_10011930 JGI24034J26672_100119302 221
615 3300003762 Ga0055542_1004222 Ga0055542_10042222 221
616 3300005262 Ga0065165_1002052 Ga0065165_100205217 221
617 3300005289 Ga0065704_10097475 Ga0065704_100974752 221
618 3300005327 Ga0070658_10000181 Ga0070658_100001816 221
619 3300005327 Ga0070658_10001561 Ga0070658_1000156113 221
620 3300005327 Ga0070658_10007616 Ga0070658_100076164 221
621 3300005328 Ga0070676_10005147 Ga0070676_100051479 221
622 3300005328 Ga0070676_10091881 Ga0070676_100918812 221
623 3300005329 Ga0070683_100006563 Ga0070683_10000656310 221
624 3300005329 Ga0070683_100122456 Ga0070683_1001224563 221
625 3300005331 Ga0070670_100000169 Ga0070670_10000016946 221
626 3300005331 Ga0070670_100036176 Ga0070670_1000361766 221
627 3300005334 Ga0068869_100000635 Ga0068869_1000006352 221
628 3300005335 Ga0070666_10004574 Ga0070666_100045748 221
629 3300005336 Ga0070680_100414715 Ga0070680_1004147152 221
630 3300005338 Ga0068868_100000049 Ga0068868_10000004910 221
631 3300005339 Ga0070660_100003617 Ga0070660_1000036178 221
632 3300005339 Ga0070660_100031552 Ga0070660_1000315525 221
633 3300005339 Ga0070660_100045703 Ga0070660_1000457033 221
634 3300005341 Ga0070691_10000763 Ga0070691_1000076314 221
635 3300005344 Ga0070661_100005116 Ga0070661_1000051167 221
636 3300005344 Ga0070661_100015407 Ga0070661_1000154073 221
637 3300005344 Ga0070661_100022812 Ga0070661_1000228125 221
638 3300005344 Ga0070661_100029811 Ga0070661_1000298114 221
639 3300005347 Ga0070668_100002131 Ga0070668_1000021318 221
640 3300005354 Ga0070675_100013583 Ga0070675_1000135832 221
641 3300005355 Ga0070671_100000461 Ga0070671_10000046126 221
642 3300005355 Ga0070671_100020224 Ga0070671_1000202247 221
643 3300005355 Ga0070671_100078984 Ga0070671_1000789843 221
644 3300005355 Ga0070671_100121302 Ga0070671_1001213023 221
645 3300005356 Ga0070674_100032561 Ga0070674_1000325613 221
646 3300005364 Ga0070673_100000006 Ga0070673_100000006195 221
647 3300005364 Ga0070673_100020191 Ga0070673_1000201914 221
648 3300005364 Ga0070673_100024623 Ga0070673_1000246232 221
649 3300005364 Ga0070673_100045414 Ga0070673_1000454142 221
650 3300005366 Ga0070659_100007753 Ga0070659_1000077536 221
651 3300005366 Ga0070659_100031286 Ga0070659_1000312863 221
652 3300005366 Ga0070659_100151979 Ga0070659_1001519791 221
653 3300005367 Ga0070667_100000327 Ga0070667_10000032734 221
654 3300005367 Ga0070667_100022481 Ga0070667_1000224813 221
655 3300005455 Ga0070663_100028223 Ga0070663_1000282234 221
656 3300005455 Ga0070663_100051649 Ga0070663_1000516493 221
657 3300005456 Ga0070678_100000505 Ga0070678_10000050520 221
658 3300005456 Ga0070678_100008600 Ga0070678_1000086006 221
659 3300005456 Ga0070678_100166600 Ga0070678_1001666002 221
660 3300005457 Ga0070662_100005871 Ga0070662_1000058718 221
661 3300005457 Ga0070662_100021277 Ga0070662_1000212775 221
662 3300005458 Ga0070681_10069647 Ga0070681_100696476 221
663 3300005459 Ga0068867_100000001 Ga0068867_100000001440 221
664 3300005459 Ga0068867_100029493 Ga0068867_1000294935 221
665 3300005530 Ga0070679_100033561 Ga0070679_1000335613 221
666 3300005539 Ga0068853_100035156 Ga0068853_1000351563 221
667 3300005539 Ga0068853_100064038 Ga0068853_1000640383 221
668 3300005543 Ga0070672_100006310 Ga0070672_1000063105 221
669 3300005543 Ga0070672_100064036 Ga0070672_1000640362 221
670 3300005543 Ga0070672_100185299 Ga0070672_1001852993 221
671 3300005544 Ga0070686_100046913 Ga0070686_1000469132 221
672 3300005546 Ga0070696_100003877 Ga0070696_10000387712 221
673 3300005548 Ga0070665_100009495 Ga0070665_1000094953 221
674 3300005548 Ga0070665_100069910 Ga0070665_1000699102 221
675 3300005548 Ga0070665_100597007 Ga0070665_1005970072 221
676 3300005563 Ga0068855_100000023 Ga0068855_10000002392 221
677 3300005563 Ga0068855_100058591 Ga0068855_1000585912 221
678 3300005564 Ga0070664_100003267 Ga0070664_10000326711 221
679 3300005564 Ga0070664_100006241 Ga0070664_1000062412 221
680 3300005564 Ga0070664_100081692 Ga0070664_1000816923 221
681 3300005564 Ga0070664_100168737 Ga0070664_1001687372 221
682 3300005577 Ga0068857_100015202 Ga0068857_1000152027 221
683 3300005578 Ga0068854_100000722 Ga0068854_10000072211 221
684 3300005578 Ga0068854_100005206 Ga0068854_1000052065 221
685 3300005578 Ga0068854_100027141 Ga0068854_1000271413 221
686 3300005578 Ga0068854_100100723 Ga0068854_1001007233 221
687 3300005578 Ga0068854_100121256 Ga0068854_1001212563 221
688 3300005614 Ga0068856_100275276 Ga0068856_1002752763 221
689 3300005616 Ga0068852_100021306 Ga0068852_1000213064 221
690 3300005616 Ga0068852_100043422 Ga0068852_1000434223 221
691 3300005616 Ga0068852_100049064 Ga0068852_1000490644 221
692 3300005617 Ga0068859_100014394 Ga0068859_1000143944 221
693 3300005617 Ga0068859_100021440 Ga0068859_1000214405 221
694 3300005617 Ga0068859_100127874 Ga0068859_1001278743 221
695 3300005618 Ga0068864_100000004 Ga0068864_100000004432 221
696 3300005618 Ga0068864_100000078 Ga0068864_10000007860 221
697 3300005618 Ga0068864_100070649 Ga0068864_1000706493 221
698 3300005718 Ga0068866_10001322 Ga0068866_1000132211 221
699 3300005719 Ga0068861_100233353 Ga0068861_1002333533 221
700 3300005834 Ga0068851_10025486 Ga0068851_100254864 221
701 3300005834 Ga0068851_10027636 Ga0068851_100276362 221
702 3300005834 Ga0068851_10090935 Ga0068851_100909353 221
703 3300005841 Ga0068863_100000002 Ga0068863_100000002433 221
704 3300005841 Ga0068863_100001062 Ga0068863_1000010623 221
705 3300005841 Ga0068863_100001939 Ga0068863_10000193913 221
706 3300005841 Ga0068863_100002169 Ga0068863_1000021698 221
707 3300005841 Ga0068863_100076334 Ga0068863_1000763342 221
708 3300005842 Ga0068858_100000832 Ga0068858_10000083216 221
709 3300005842 Ga0068858_100006226 Ga0068858_1000062263 221
710 3300005842 Ga0068858_100180276 Ga0068858_1001802763 221
711 3300005843 Ga0068860_100016501 Ga0068860_1000165014 221
712 3300005843 Ga0068860_100060507 Ga0068860_1000605072 221
713 3300005843 Ga0068860_100076230 Ga0068860_1000762305 221
714 3300005843 Ga0068860_100080027 Ga0068860_1000800273 221
715 3300005844 Ga0068862_100000002 Ga0068862_10000000269 221
716 3300005844 Ga0068862_100007656 Ga0068862_1000076568 221
717 3300005844 Ga0068862_100199992 Ga0068862_1001999922 221
718 3300006175 Ga0070712_100210454 Ga0070712_1002104542 221
719 3300006237 Ga0097621_100002557 Ga0097621_1000025575 221
720 3300006358 Ga0068871_100031090 Ga0068871_1000310905 221
721 3300006881 Ga0068865_100000003 Ga0068865_100000003271 221
722 3300006931 Ga0097620_100014392 Ga0097620_1000143927 221
723 3300006931 Ga0097620_100021440 Ga0097620_1000214406 221
724 3300006931 Ga0097620_100127861 Ga0097620_1001278613 221
725 3300009553 Ga0105249_10166446 Ga0105249_101664463 221
726 3300013296 Ga0157374_10080623 Ga0157374_100806234 221
727 3300020070 Ga0206356_10794718 Ga0206356_107947182 221
728 3300021388 Ga0213875_10002933 Ga0213875_1000293312 221
729 3300025253 Ga0209677_107479 Ga0209677_1074793 221
730 3300025254 Ga0209148_1000171 Ga0209148_100017142 221
731 3300025261 Ga0209233_1018102 Ga0209233_10181022 221
732 3300025304 Ga0209257_1013597 Ga0209257_10135973 221
733 3300025321 Ga0207656_10001422 Ga0207656_100014222 221
734 3300025321 Ga0207656_10039998 Ga0207656_100399983 221
735 3300025321 Ga0207656_10112987 Ga0207656_101129872 221
736 3300025735 Ga0207713_1003473 Ga0207713_100347310 221
737 3300025899 Ga0207642_10007833 Ga0207642_100078334 221
738 3300025900 Ga0207710_10068749 Ga0207710_100687492 221
739 3300025901 Ga0207688_10015331 Ga0207688_100153314 221
740 3300025903 Ga0207680_10002571 Ga0207680_100025715 221
741 3300025904 Ga0207647_10005630 Ga0207647_100056304 221
742 3300025904 Ga0207647_10088179 Ga0207647_100881793 221
743 3300025904 Ga0207647_10117171 Ga0207647_101171712 221
744 3300025907 Ga0207645_10015238 Ga0207645_100152386 221
745 3300025907 Ga0207645_10080062 Ga0207645_100800623 221
746 3300025907 Ga0207645_10086739 Ga0207645_100867393 221
747 3300025907 Ga0207645_10110473 Ga0207645_101104731 221
748 3300025909 Ga0207705_10000121 Ga0207705_1000012190 221
749 3300025909 Ga0207705_10000592 Ga0207705_1000059217 221
750 3300025909 Ga0207705_10017650 Ga0207705_100176503 221
751 3300025909 Ga0207705_10031278 Ga0207705_100312782 221
752 3300025909 Ga0207705_10043256 Ga0207705_100432563 221
753 3300025909 Ga0207705_10079630 Ga0207705_100796303 221
754 3300025911 Ga0207654_10003722 Ga0207654_100037225 221
755 3300025912 Ga0207707_10008275 Ga0207707_100082754 221
756 3300025912 Ga0207707_10344103 Ga0207707_103441031 221
757 3300025913 Ga0207695_10038816 Ga0207695_100388162 221
758 3300025914 Ga0207671_10011623 Ga0207671_100116235 221
759 3300025914 Ga0207671_10175338 Ga0207671_101753383 221
760 3300025915 Ga0207693_10210615 Ga0207693_102106152 221
761 3300025917 Ga0207660_10038492 Ga0207660_100384924 221
762 3300025917 Ga0207660_10161905 Ga0207660_101619051 221
763 3300025917 Ga0207660_10181164 Ga0207660_101811642 221
764 3300025919 Ga0207657_10003582 Ga0207657_100035827 221
765 3300025919 Ga0207657_10008376 Ga0207657_100083767 221
766 3300025919 Ga0207657_10012964 Ga0207657_100129645 221
767 3300025919 Ga0207657_10014496 Ga0207657_100144965 221
768 3300025919 Ga0207657_10035869 Ga0207657_100358695 221
769 3300025919 Ga0207657_10247796 Ga0207657_102477962 221
770 3300025920 Ga0207649_10000475 Ga0207649_100004759 221
771 3300025920 Ga0207649_10006830 Ga0207649_100068305 221
772 3300025920 Ga0207649_10015845 Ga0207649_100158452 221
773 3300025921 Ga0207652_10037349 Ga0207652_100373493 221
774 3300025923 Ga0207681_10054598 Ga0207681_100545985 221
775 3300025923 Ga0207681_10059426 Ga0207681_100594263 221
776 3300025923 Ga0207681_10293046 Ga0207681_102930463 221
777 3300025924 Ga0207694_10009796 Ga0207694_100097967 221
778 3300025924 Ga0207694_10021743 Ga0207694_100217435 221
779 3300025924 Ga0207694_10026198 Ga0207694_100261984 221
780 3300025924 Ga0207694_10053932 Ga0207694_100539323 221
781 3300025924 Ga0207694_10183155 Ga0207694_101831553 221
782 3300025925 Ga0207650_10000294 Ga0207650_1000029417 221
783 3300025925 Ga0207650_10024760 Ga0207650_100247606 221
784 3300025925 Ga0207650_10121113 Ga0207650_101211133 221
785 3300025925 Ga0207650_10287302 Ga0207650_102873022 221
786 3300025926 Ga0207659_10271913 Ga0207659_102719132 221
787 3300025927 Ga0207687_10004504 Ga0207687_100045044 221
788 3300025931 Ga0207644_10000039 Ga0207644_1000003951 221
789 3300025931 Ga0207644_10000214 Ga0207644_1000021416 221
790 3300025931 Ga0207644_10010201 Ga0207644_100102018 221
791 3300025931 Ga0207644_10020550 Ga0207644_100205503 221
792 3300025931 Ga0207644_10022249 Ga0207644_100222495 221
793 3300025931 Ga0207644_10031319 Ga0207644_100313195 221
794 3300025932 Ga0207690_10002990 Ga0207690_100029907 221
795 3300025932 Ga0207690_10007682 Ga0207690_100076826 221
796 3300025932 Ga0207690_10008018 Ga0207690_100080183 221
797 3300025932 Ga0207690_10056672 Ga0207690_100566723 221
798 3300025932 Ga0207690_10107312 Ga0207690_101073123 221
799 3300025933 Ga0207706_10004569 Ga0207706_100045698 221
800 3300025933 Ga0207706_10005341 Ga0207706_1000534111 221
801 3300025933 Ga0207706_10028785 Ga0207706_100287855 221
802 3300025933 Ga0207706_10047492 Ga0207706_100474924 221
803 3300025933 Ga0207706_10062580 Ga0207706_100625803 221
804 3300025934 Ga0207686_10002145 Ga0207686_1000214511 221
805 3300025934 Ga0207686_10013436 Ga0207686_100134367 221
806 3300025935 Ga0207709_10000629 Ga0207709_1000062924 221
807 3300025935 Ga0207709_10000951 Ga0207709_1000095112 221
808 3300025935 Ga0207709_10058533 Ga0207709_100585333 221
809 3300025937 Ga0207669_10000755 Ga0207669_100007552 221
810 3300025937 Ga0207669_10005841 Ga0207669_100058412 221
811 3300025937 Ga0207669_10069602 Ga0207669_100696022 221
812 3300025938 Ga0207704_10000001 Ga0207704_10000001249 221
813 3300025938 Ga0207704_10061836 Ga0207704_100618363 221
814 3300025940 Ga0207691_10003283 Ga0207691_100032835 221
815 3300025941 Ga0207711_10000022 Ga0207711_10000022172 221
816 3300025941 Ga0207711_10000042 Ga0207711_100000428 221
817 3300025941 Ga0207711_10047359 Ga0207711_100473593 221
818 3300025941 Ga0207711_10209286 Ga0207711_102092863 221
819 3300025942 Ga0207689_10001710 Ga0207689_100017109 221
820 3300025942 Ga0207689_10069129 Ga0207689_100691294 221
821 3300025942 Ga0207689_10117639 Ga0207689_101176393 221
822 3300025944 Ga0207661_10228734 Ga0207661_102287342 221
823 3300025944 Ga0207661_10481259 Ga0207661_104812592 221
824 3300025945 Ga0207679_10014116 Ga0207679_100141163 221
825 3300025945 Ga0207679_10014928 Ga0207679_100149285 221
826 3300025945 Ga0207679_10041360 Ga0207679_100413603 221
827 3300025945 Ga0207679_10074849 Ga0207679_100748493 221
828 3300025945 Ga0207679_10303461 Ga0207679_103034611 221
829 3300025949 Ga0207667_10000001 Ga0207667_10000001197 221
830 3300025949 Ga0207667_10000016 Ga0207667_10000016101 221
831 3300025949 Ga0207667_10010455 Ga0207667_100104557 221
832 3300025949 Ga0207667_10021125 Ga0207667_100211257 221
833 3300025960 Ga0207651_10000002 Ga0207651_1000000210 221
834 3300025960 Ga0207651_10003812 Ga0207651_100038126 221
835 3300025960 Ga0207651_10003837 Ga0207651_100038373 221
836 3300025961 Ga0207712_10000224 Ga0207712_1000022442 221
837 3300025961 Ga0207712_10030985 Ga0207712_100309854 221
838 3300025961 Ga0207712_10101759 Ga0207712_101017593 221
839 3300025972 Ga0207668_10000228 Ga0207668_1000022813 221
840 3300025972 Ga0207668_10203323 Ga0207668_102033233 221
841 3300025981 Ga0207640_10000891 Ga0207640_1000089117 221
842 3300025981 Ga0207640_10004646 Ga0207640_100046462 221
843 3300025981 Ga0207640_10005537 Ga0207640_100055376 221
844 3300025981 Ga0207640_10037340 Ga0207640_100373402 221
845 3300025981 Ga0207640_10046863 Ga0207640_100468633 221
846 3300025981 Ga0207640_10095691 Ga0207640_100956912 221
847 3300025981 Ga0207640_10208530 Ga0207640_102085302 221
848 3300025981 Ga0207640_10500198 Ga0207640_105001981 221
849 3300025986 Ga0207658_10000364 Ga0207658_1000036434 221
850 3300026023 Ga0207677_10000030 Ga0207677_10000030129 221
851 3300026023 Ga0207677_10009857 Ga0207677_100098577 221
852 3300026035 Ga0207703_10015254 Ga0207703_100152545 221
853 3300026035 Ga0207703_10054327 Ga0207703_100543274 221
854 3300026041 Ga0207639_10002074 Ga0207639_1000207414 221
855 3300026041 Ga0207639_10008847 Ga0207639_100088472 221
856 3300026041 Ga0207639_10044857 Ga0207639_100448572 221
857 3300026041 Ga0207639_10051972 Ga0207639_100519724 221
858 3300026041 Ga0207639_10095900 Ga0207639_100959003 221
859 3300026067 Ga0207678_10006676 Ga0207678_100066762 221
860 3300026067 Ga0207678_10036870 Ga0207678_100368704 221
861 3300026067 Ga0207678_10067448 Ga0207678_100674482 221
862 3300026067 Ga0207678_10076194 Ga0207678_100761942 221
863 3300026067 Ga0207678_10257733 Ga0207678_102577332 221
864 3300026078 Ga0207702_10016406 Ga0207702_100164062 221
865 3300026078 Ga0207702_10052596 Ga0207702_100525963 221
866 3300026078 Ga0207702_10185626 Ga0207702_101856261 221
867 3300026078 Ga0207702_10449235 Ga0207702_104492352 221
868 3300026088 Ga0207641_10000002 Ga0207641_10000002912 221
869 3300026088 Ga0207641_10000024 Ga0207641_1000002413 221
870 3300026088 Ga0207641_10000626 Ga0207641_1000062631 221
871 3300026088 Ga0207641_10005398 Ga0207641_100053982 221
872 3300026088 Ga0207641_10017421 Ga0207641_100174217 221
873 3300026088 Ga0207641_10173019 Ga0207641_101730193 221
874 3300026089 Ga0207648_10000001 Ga0207648_1000000110 221
875 3300026089 Ga0207648_10003494 Ga0207648_100034945 221
876 3300026095 Ga0207676_10000040 Ga0207676_10000040107 221
877 3300026095 Ga0207676_10006287 Ga0207676_100062876 221
878 3300026095 Ga0207676_10042482 Ga0207676_100424823 221
879 3300026095 Ga0207676_10080658 Ga0207676_100806581 221
880 3300026116 Ga0207674_10003716 Ga0207674_100037169 221
881 3300026116 Ga0207674_10010165 Ga0207674_100101657 221
882 3300026116 Ga0207674_10058492 Ga0207674_100584923 221
883 3300026118 Ga0207675_100275287 Ga0207675_1002752873 221
884 3300026118 Ga0207675_100690505 Ga0207675_1006905051 221
885 3300026121 Ga0207683_10030752 Ga0207683_100307525 221
886 3300026121 Ga0207683_10038419 Ga0207683_100384191 221
887 3300026121 Ga0207683_10059873 Ga0207683_100598733 221
888 3300026121 Ga0207683_10204941 Ga0207683_102049411 221
889 3300026142 Ga0207698_10008400 Ga0207698_100084004 221
890 3300026142 Ga0207698_10009783 Ga0207698_100097832 221
891 3300026142 Ga0207698_10013046 Ga0207698_100130465 221
892 3300026142 Ga0207698_10035886 Ga0207698_100358866 221
893 3300026142 Ga0207698_10064919 Ga0207698_100649191 221
894 3300026142 Ga0207698_10089859 Ga0207698_100898592 221
895 3300026142 Ga0207698_10158574 Ga0207698_101585742 221
896 3300028379 Ga0268266_10398752 Ga0268266_103987522 221
897 3300028379 Ga0268266_10664587 Ga0268266_106645872 221
898 3300028380 Ga0268265_10000003 Ga0268265_1000000378 221
899 3300028380 Ga0268265_10070456 Ga0268265_100704564 221
900 3300028381 Ga0268264_10007584 Ga0268264_100075843 221
901 3300028381 Ga0268264_10017268 Ga0268264_100172688 221
902 3300028381 Ga0268264_10046924 Ga0268264_100469243 221
903 3300028381 Ga0268264_10046935 Ga0268264_100469353 221
904 3300028786 Ga0307517_10017543 Ga0307517_100175432 221
905 3300031824 Ga0307413_10011043 Ga0307413_100110436 221
906 3300031824 Ga0307413_10326141 Ga0307413_103261411 221
907 3300031852 Ga0307410_10051488 Ga0307410_100514882 221
908 3300031852 Ga0307410_10060530 Ga0307410_100605302 221
909 3300031911 Ga0307412_10530911 Ga0307412_105309111 221
910 3300031995 Ga0307409_100048881 Ga0307409_1000488813 221
911 3300031995 Ga0307409_100309460 Ga0307409_1003094602 221
912 3300032002 Ga0307416_101033116 Ga0307416_1010331161 221
913 3300032004 Ga0307414_10025253 Ga0307414_100252533 221
914 3300032004 Ga0307414_10159855 Ga0307414_101598552 221
915 3300032005 Ga0307411_10012651 Ga0307411_100126513 221
916 3300032005 Ga0307411_10101841 Ga0307411_101018412 221
917 3300032005 Ga0307411_10207482 Ga0307411_102074822 221
918 3300032126 Ga0307415_100020974 Ga0307415_1000209742 221
919 3300032126 Ga0307415_100100012 Ga0307415_1001000123 221
920 3300033180 Ga0307510_10219879 Ga0307510_102198792 221
921 3300044658 Ga0466972_0027337 Ga0466972_0027337_469_1173 221
922 3300046691 Ga0495670_0000028 Ga0495670_0000028_46863_47564 221
923 3300049579 Ga0501043_0099754 Ga0501043_0099754_113_790 221
924 3300049581 Ga0501047_0000402 Ga0501047_0000402_13921_14598 221
925 3300001904 JGI24736J21556_1000030 JGI24736J21556_10000303 222
926 3300001915 JGI24741J21665_1004089 JGI24741J21665_10040892 222
927 3300001976 JGI24752J21851_1004310 JGI24752J21851_10043102 222
928 3300001990 JGI24737J22298_10005137 JGI24737J22298_100051372 222
929 3300002067 JGI24735J21928_10000944 JGI24735J21928_100009443 222
930 3300002070 JGI24750J21931_1000713 JGI24750J21931_10007132 222
931 3300002074 JGI24748J21848_1000015 JGI24748J21848_100001582 222
932 3300002075 JGI24738J21930_10000900 JGI24738J21930_100009003 222
933 3300002239 JGI24034J26672_10000006 JGI24034J26672_1000000682 222
934 3300002244 JGI24742J22300_10002123 JGI24742J22300_100021232 222
935 3300002459 JGI24751J29686_10000093 JGI24751J29686_1000009330 222
936 3300002459 JGI24751J29686_10004337 JGI24751J29686_100043372 222
937 3300005295 Ga0065707_10082467 Ga0065707_1008246717 222
938 3300005330 Ga0070690_100000012 Ga0070690_10000001269 222
939 3300005331 Ga0070670_100000005 Ga0070670_100000005113 222
940 3300005331 Ga0070670_100000528 Ga0070670_10000052823 222
941 3300005331 Ga0070670_100049951 Ga0070670_1000499511 222
942 3300005335 Ga0070666_10000014 Ga0070666_10000014130 222
943 3300005339 Ga0070660_100550573 Ga0070660_1005505732 222
944 3300005340 Ga0070689_100029687 Ga0070689_1000296872 222
945 3300005344 Ga0070661_100036547 Ga0070661_1000365474 222
946 3300005345 Ga0070692_10060955 Ga0070692_100609553 222
947 3300005347 Ga0070668_100000007 Ga0070668_100000007146 222
948 3300005347 Ga0070668_100124704 Ga0070668_1001247041 222
949 3300005353 Ga0070669_100000195 Ga0070669_10000019523 222
950 3300005353 Ga0070669_100000351 Ga0070669_1000003519 222
951 3300005353 Ga0070669_100034494 Ga0070669_1000344942 222
952 3300005355 Ga0070671_100000388 Ga0070671_10000038812 222
953 3300005364 Ga0070673_100065042 Ga0070673_1000650422 222
954 3300005365 Ga0070688_100010920 Ga0070688_1000109202 222
955 3300005366 Ga0070659_100059821 Ga0070659_1000598212 222
956 3300005367 Ga0070667_100000003 Ga0070667_100000003251 222
957 3300005367 Ga0070667_100001850 Ga0070667_1000018508 222
958 3300005455 Ga0070663_100016888 Ga0070663_1000168882 222
959 3300005455 Ga0070663_100113967 Ga0070663_1001139672 222
960 3300005466 Ga0070685_10002655 Ga0070685_100026556 222
961 3300005535 Ga0070684_100125792 Ga0070684_1001257922 222
962 3300005539 Ga0068853_100191840 Ga0068853_1001918403 222
963 3300005539 Ga0068853_100261358 Ga0068853_1002613583 222
964 3300005543 Ga0070672_100014230 Ga0070672_1000142304 222
965 3300005544 Ga0070686_100000002 Ga0070686_100000002249 222
966 3300005545 Ga0070695_100011571 Ga0070695_1000115717 222
967 3300005546 Ga0070696_100006531 Ga0070696_1000065319 222
968 3300005548 Ga0070665_100000025 Ga0070665_10000002582 222
969 3300005548 Ga0070665_100050070 Ga0070665_1000500705 222
970 3300005563 Ga0068855_100259344 Ga0068855_1002593443 222
971 3300005564 Ga0070664_100000093 Ga0070664_10000009337 222
972 3300005564 Ga0070664_100062965 Ga0070664_1000629652 222
973 3300005564 Ga0070664_100073476 Ga0070664_1000734762 222
974 3300005577 Ga0068857_100015964 Ga0068857_1000159648 222
975 3300005577 Ga0068857_100288529 Ga0068857_1002885292 222
976 3300005578 Ga0068854_100029193 Ga0068854_1000291936 222
977 3300005578 Ga0068854_100095691 Ga0068854_1000956912 222
978 3300005578 Ga0068854_100164056 Ga0068854_1001640562 222
979 3300005578 Ga0068854_100247681 Ga0068854_1002476813 222
980 3300005614 Ga0068856_100033806 Ga0068856_1000338063 222
981 3300005617 Ga0068859_100007110 Ga0068859_1000071103 222
982 3300005617 Ga0068859_100008939 Ga0068859_10000893910 222
983 3300005617 Ga0068859_100029142 Ga0068859_1000291423 222
984 3300005617 Ga0068859_100358221 Ga0068859_1003582212 222
985 3300005618 Ga0068864_100000011 Ga0068864_100000011112 222
986 3300005618 Ga0068864_100003288 Ga0068864_1000032884 222
987 3300005618 Ga0068864_100012174 Ga0068864_1000121743 222
988 3300005618 Ga0068864_100017806 Ga0068864_1000178067 222
989 3300005719 Ga0068861_100000629 Ga0068861_10000062918 222
990 3300005719 Ga0068861_100017934 Ga0068861_1000179344 222
991 3300005834 Ga0068851_10005578 Ga0068851_100055783 222
992 3300005841 Ga0068863_100000270 Ga0068863_10000027032 222
993 3300005841 Ga0068863_100003398 Ga0068863_1000033985 222
994 3300005841 Ga0068863_100004607 Ga0068863_1000046072 222
995 3300005841 Ga0068863_100017965 Ga0068863_1000179656 222
996 3300005841 Ga0068863_100370262 Ga0068863_1003702622 222
997 3300005842 Ga0068858_100000181 Ga0068858_10000018113 222
998 3300005842 Ga0068858_100006347 Ga0068858_1000063477 222
999 3300005842 Ga0068858_100007133 Ga0068858_10000713312 222
1000 3300005843 Ga0068860_100000001 Ga0068860_100000001639 222
1001 3300005843 Ga0068860_100000045 Ga0068860_10000004520 222
1002 3300005843 Ga0068860_100004334 Ga0068860_1000043344 222
1003 3300005843 Ga0068860_100423460 Ga0068860_1004234602 222
1004 3300005843 Ga0068860_100693098 Ga0068860_1006930981 222
1005 3300005844 Ga0068862_100000011 Ga0068862_100000011124 222
1006 3300005844 Ga0068862_100000032 Ga0068862_1000000323 222
1007 3300005844 Ga0068862_100000048 Ga0068862_10000004881 222
1008 3300005844 Ga0068862_100000989 Ga0068862_10000098911 222
1009 3300006931 Ga0097620_100007111 Ga0097620_1000071113 222
1010 3300006931 Ga0097620_100008939 Ga0097620_1000089392 222
1011 3300006931 Ga0097620_100029143 Ga0097620_1000291433 222
1012 3300006931 Ga0097620_100358208 Ga0097620_1003582082 222
1013 3300009101 Ga0105247_10012347 Ga0105247_100123476 222
1014 3300009177 Ga0105248_10000069 Ga0105248_1000006984 222
1015 3300009177 Ga0105248_10471263 Ga0105248_104712632 222
1016 3300009551 Ga0105238_10367966 Ga0105238_103679661 222
1017 3300009553 Ga0105249_10000017 Ga0105249_10000017269 222
1018 3300014325 Ga0163163_10095415 Ga0163163_100954153 222
1019 3300014326 Ga0157380_10000363 Ga0157380_1000036310 222
1020 3300017792 Ga0163161_10000509 Ga0163161_1000050921 222
1021 3300017792 Ga0163161_10294282 Ga0163161_102942822 222
1022 3300025223 Ga0207672_1001571 Ga0207672_10015712 222
1023 3300025321 Ga0207656_10005083 Ga0207656_100050831 222
1024 3300025900 Ga0207710_10075666 Ga0207710_100756662 222
1025 3300025903 Ga0207680_10000004 Ga0207680_10000004231 222
1026 3300025903 Ga0207680_10009078 Ga0207680_100090784 222
1027 3300025904 Ga0207647_10000805 Ga0207647_100008054 222
1028 3300025904 Ga0207647_10084282 Ga0207647_100842823 222
1029 3300025904 Ga0207647_10251248 Ga0207647_102512481 222
1030 3300025907 Ga0207645_10026774 Ga0207645_100267744 222
1031 3300025909 Ga0207705_10024003 Ga0207705_100240034 222
1032 3300025911 Ga0207654_10011547 Ga0207654_100115473 222
1033 3300025912 Ga0207707_10096899 Ga0207707_100968993 222
1034 3300025913 Ga0207695_10002715 Ga0207695_1000271525 222
1035 3300025913 Ga0207695_10016512 Ga0207695_100165127 222
1036 3300025914 Ga0207671_10001479 Ga0207671_100014794 222
1037 3300025919 Ga0207657_10016571 Ga0207657_100165715 222
1038 3300025919 Ga0207657_10023959 Ga0207657_100239595 222
1039 3300025920 Ga0207649_10153329 Ga0207649_101533292 222
1040 3300025923 Ga0207681_10000001 Ga0207681_10000001547 222
1041 3300025923 Ga0207681_10000038 Ga0207681_10000038126 222
1042 3300025923 Ga0207681_10049750 Ga0207681_100497501 222
1043 3300025923 Ga0207681_10229385 Ga0207681_102293852 222
1044 3300025923 Ga0207681_10250157 Ga0207681_102501572 222
1045 3300025924 Ga0207694_10001050 Ga0207694_1000105019 222
1046 3300025925 Ga0207650_10000018 Ga0207650_10000018113 222
1047 3300025925 Ga0207650_10004568 Ga0207650_100045686 222
1048 3300025925 Ga0207650_10080057 Ga0207650_100800574 222
1049 3300025925 Ga0207650_10200919 Ga0207650_102009193 222
1050 3300025926 Ga0207659_10000922 Ga0207659_1000092211 222
1051 3300025931 Ga0207644_10000197 Ga0207644_1000019732 222
1052 3300025931 Ga0207644_10000863 Ga0207644_100008637 222
1053 3300025931 Ga0207644_10002893 Ga0207644_100028939 222
1054 3300025932 Ga0207690_10363951 Ga0207690_103639511 222
1055 3300025933 Ga0207706_10009419 Ga0207706_100094199 222
1056 3300025933 Ga0207706_10011916 Ga0207706_100119169 222
1057 3300025933 Ga0207706_10051583 Ga0207706_100515833 222
1058 3300025933 Ga0207706_10373486 Ga0207706_103734862 222
1059 3300025936 Ga0207670_10106249 Ga0207670_101062492 222
1060 3300025937 Ga0207669_10209644 Ga0207669_102096443 222
1061 3300025940 Ga0207691_10056417 Ga0207691_100564174 222
1062 3300025941 Ga0207711_10001064 Ga0207711_100010642 222
1063 3300025941 Ga0207711_10012589 Ga0207711_100125892 222
1064 3300025941 Ga0207711_10256413 Ga0207711_102564133 222
1065 3300025945 Ga0207679_10002349 Ga0207679_1000234910 222
1066 3300025945 Ga0207679_10222304 Ga0207679_102223042 222
1067 3300025949 Ga0207667_10000692 Ga0207667_1000069213 222
1068 3300025949 Ga0207667_10172630 Ga0207667_101726303 222
1069 3300025960 Ga0207651_10011490 Ga0207651_100114904 222
1070 3300025961 Ga0207712_10000001 Ga0207712_10000001105 222
1071 3300025961 Ga0207712_10000012 Ga0207712_1000001282 222
1072 3300025961 Ga0207712_10433445 Ga0207712_104334452 222
1073 3300025972 Ga0207668_10000026 Ga0207668_10000026112 222
1074 3300025972 Ga0207668_10014529 Ga0207668_100145291 222
1075 3300025972 Ga0207668_10548058 Ga0207668_105480581 222
1076 3300025981 Ga0207640_10047485 Ga0207640_100474852 222
1077 3300025981 Ga0207640_10086439 Ga0207640_100864392 222
1078 3300025981 Ga0207640_10281484 Ga0207640_102814842 222
1079 3300025986 Ga0207658_10000002 Ga0207658_100000021152 222
1080 3300025986 Ga0207658_10000902 Ga0207658_1000090216 222
1081 3300025986 Ga0207658_10009480 Ga0207658_100094803 222
1082 3300025986 Ga0207658_10049116 Ga0207658_100491165 222
1083 3300026035 Ga0207703_10000135 Ga0207703_1000013551 222
1084 3300026035 Ga0207703_10000404 Ga0207703_1000040412 222
1085 3300026035 Ga0207703_10001087 Ga0207703_1000108721 222
1086 3300026041 Ga0207639_10007490 Ga0207639_100074905 222
1087 3300026041 Ga0207639_10187075 Ga0207639_101870752 222
1088 3300026041 Ga0207639_10254497 Ga0207639_102544972 222
1089 3300026067 Ga0207678_10008727 Ga0207678_100087278 222
1090 3300026067 Ga0207678_10048089 Ga0207678_100480892 222
1091 3300026078 Ga0207702_10000462 Ga0207702_1000046251 222
1092 3300026078 Ga0207702_10414569 Ga0207702_104145692 222
1093 3300026088 Ga0207641_10000033 Ga0207641_1000003335 222
1094 3300026088 Ga0207641_10000277 Ga0207641_1000027717 222
1095 3300026088 Ga0207641_10002117 Ga0207641_100021172 222
1096 3300026088 Ga0207641_10004973 Ga0207641_1000497313 222
1097 3300026088 Ga0207641_10006503 Ga0207641_100065037 222
1098 3300026095 Ga0207676_10000004 Ga0207676_10000004506 222
1099 3300026095 Ga0207676_10000340 Ga0207676_1000034016 222
1100 3300026095 Ga0207676_10000600 Ga0207676_1000060022 222
1101 3300026095 Ga0207676_10002850 Ga0207676_100028503 222
1102 3300026095 Ga0207676_10107993 Ga0207676_101079933 222
1103 3300026116 Ga0207674_10012150 Ga0207674_1001215011 222
1104 3300026116 Ga0207674_10014103 Ga0207674_100141033 222
1105 3300026118 Ga0207675_100000171 Ga0207675_10000017164 222
1106 3300026118 Ga0207675_100004115 Ga0207675_1000041155 222
1107 3300026118 Ga0207675_100074164 Ga0207675_1000741644 222
1108 3300026142 Ga0207698_10172860 Ga0207698_101728602 222
1109 3300028379 Ga0268266_10000028 Ga0268266_10000028301 222
1110 3300028380 Ga0268265_10000002 Ga0268265_10000002564 222
1111 3300028380 Ga0268265_10000071 Ga0268265_10000071148 222
1112 3300028380 Ga0268265_10000081 Ga0268265_10000081106 222
1113 3300028380 Ga0268265_10001985 Ga0268265_100019852 222
1114 3300028381 Ga0268264_10000006 Ga0268264_10000006231 222
1115 3300028381 Ga0268264_10000101 Ga0268264_1000010122 222
1116 3300028381 Ga0268264_10002895 Ga0268264_100028954 222
1117 3300028381 Ga0268264_10513770 Ga0268264_105137702 222
1118 3300028381 Ga0268264_10648904 Ga0268264_106489041 222
1119 3300031456 Ga0307513_10038050 Ga0307513_100380502 222
1120 3300031548 Ga0307408_100159239 Ga0307408_1001592391 222
1121 3300031731 Ga0307405_10010820 Ga0307405_100108204 222
1122 3300031731 Ga0307405_10019377 Ga0307405_100193773 222
1123 3300031852 Ga0307410_10101091 Ga0307410_101010913 222
1124 3300031901 Ga0307406_10107594 Ga0307406_101075941 222
1125 3300031901 Ga0307406_10833827 Ga0307406_108338271 222
1126 3300031903 Ga0307407_10014810 Ga0307407_100148105 222
1127 3300031911 Ga0307412_10119740 Ga0307412_101197403 222
1128 3300031995 Ga0307409_100510853 Ga0307409_1005108531 222
1129 3300032002 Ga0307416_100009723 Ga0307416_1000097237 222
1130 3300032004 Ga0307414_10081762 Ga0307414_100817621 222
1131 3300032005 Ga0307411_10040331 Ga0307411_100403313 222
1132 3300032005 Ga0307411_10252169 Ga0307411_102521692 222
1133 3300032005 Ga0307411_10572468 Ga0307411_105724681 222
1134 3300033180 Ga0307510_10238088 Ga0307510_102380882 222
1135 3300041486 Ga0451807_0150684 Ga0451807_0150684_593_1279 222
1136 3300048928 Ga0496125_0062178 Ga0496125_0062178_564_1250 222
1137 3300049655 Ga0501208_006654 Ga0501208_006654_620_1303 222
1138 3300049679 Ga0501249_000545 Ga0501249_000545_4715_5398 222
1139 3300049850 Ga0501204_005049 Ga0501204_005049_215_898 222
1140 3300053730 Ga0500645_011613 Ga0500645_011613_738_1421 222

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06242

TrcR

Transcriptional cell cycle regulator TrcR

35

173

0.99

Feature Viewer

pLDDT pTM Quality
83.38 0.45 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map