F490686

General Info

Members Datasets Scaffolds Average Seq Length
1139 491 1086 286

Family's Representative Sequence

Representative Sequence 3300049574|Ga0501038_0000630|Ga0501038_0000630_6854_7861
Length 335
Sequence MSCPIVAGVGRRPDIALTVPDAGRWPIAGYSPYKAEDGRRKMDAGMGALANHAFSKMNGIGNEIVVVDLRDSAATVTAEEARAIASPAGVPYDQLMVLQPPLTPRTEAFVRIYNNDGSEANACGNGMRCVARQVFEATGKTVLTFETRAGLLNCWRGSTHGFYTVDMGLPKFDWRDIPLAEEFRDTRYIELQVGPIEKPVLHSPSVVSMGNPHAIFWVDDVNAYDLERFGPLLENHPIFPERANITLAHIVDRDHIVMRTWERGVGLTKACGSAACATAVAAARLKRTNRTVEMLLPGGGLTIEWCEHGDHVMMTGPAVFEYAGRFDPALFTPVA

Samples

Sample ID Description Type Environment
1 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
2 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
3 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
4 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
5 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
6 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
7 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
8 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
9 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
10 2643221651 Afipia sp. Root123D2 Isolate Unclassified
11 2671180139 Chelativorans sp. A52C2 Isolate Unclassified
12 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
13 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
14 2791355199
15 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
16 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
17 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
18 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
19 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
20 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
21 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
22 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
23 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
24 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
25 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
26 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
27 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
28 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
29 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
30 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
31 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
32 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
33 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
34 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
35 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
36 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
37 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
38 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
39 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
40 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
41 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
42 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
43 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
44 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
45 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
46 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
47 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
48 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
49 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
50 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
51 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
52 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
53 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
54 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
55 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
56 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
57 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
58 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
59 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
60 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
61 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
62 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
63 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
64 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
65 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
66 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
67 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
68 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
69 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
70 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
71 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
72 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
73 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
74 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
75 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
76 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
77 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
78 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
79 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
80 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
81 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
82 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
83 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
84 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
85 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
86 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
87 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
88 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
89 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
90 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
91 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
92 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
93 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
94 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
95 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
96 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
97 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
98 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
99 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
100 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
101 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
102 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
103 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
104 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
105 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
106 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
107 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
108 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
109 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
110 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
111 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
112 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
113 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
114 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
115 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
116 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
117 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
118 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
119 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
120 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
121 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
122 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
123 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
124 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
125 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
126 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
127 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
128 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
129 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
130 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
131 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
132 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
133 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
134 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
135 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
136 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
137 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
138 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
139 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
140 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
141 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
142 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
143 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
144 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
145 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
146 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
147 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
148 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
149 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
150 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
151 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
152 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
153 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
154 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
155 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
156 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
157 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
158 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
159 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
160 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
161 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
162 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
163 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
164 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
165 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
166 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
167 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
168 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
169 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
170 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
226 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
227 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
231 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
232 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
233 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
234 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
235 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
236 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
237 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
238 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
239 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
240 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
241 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
242 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
243 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
244 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
245 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
246 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
247 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
248 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
249 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
250 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
251 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
252 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
253 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
254 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
255 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
256 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
257 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
258 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
259 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
260 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
261 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
262 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
263 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
264 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
265 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
266 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
267 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
268 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
269 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
270 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
271 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
272 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
273 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
274 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
275 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
276 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
277 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
278 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
279 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
280 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
281 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
282 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
283 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
284 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
285 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
286 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
287 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
288 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
289 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
290 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
291 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
292 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
293 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
294 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
295 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
296 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
297 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
298 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
299 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
300 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
301 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
302 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
303 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
304 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
305 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
306 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
307 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
308 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
309 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
310 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
311 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
312 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
313 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
314 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
315 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
316 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
317 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
318 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
319 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
320 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
321 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
322 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
323 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
324 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
325 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
326 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
327 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
328 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
329 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
330 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
331 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
332 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
333 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
334 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
335 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
336 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
337 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
338 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
339 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
340 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
341 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
342 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
343 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
344 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
345 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
346 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
347 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
348 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
349 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
350 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
351 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
352 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
353 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
354 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
355 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
356 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
357 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
358 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
359 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
360 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
361 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
362 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
363 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
364 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
365 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
366 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
367 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
368 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
369 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
370 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
371 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
372 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
373 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
374 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
375 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
376 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
377 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
378 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
379 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
380 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
381 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
382 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
383 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
384 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
385 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
386 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
387 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
388 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
389 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
390 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
391 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
392 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
393 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
394 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
395 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
396 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
397 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
398 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
399 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
400 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
401 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
402 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
403 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
404 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
405 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
406 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
407 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
408 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
409 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
410 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
411 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
412 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
413 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
414 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
415 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
416 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
417 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
418 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
419 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
420 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
421 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
422 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
423 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
424 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
425 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
426 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
427 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
428 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
429 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
430 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
431 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
432 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
433 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
434 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
435 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
436 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
437 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
438 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
439 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
440 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
441 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
442 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
443 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
444 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
445 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
446 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
447 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
448 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
449 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
450 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
451 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
452 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
453 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
454 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
455 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
456 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
457 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
458 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
459 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
460 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
461 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
462 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
463 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
464 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
465 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
466 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
467 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
468 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
469 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
470 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
471 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
472 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
473 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
474 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
475 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
476 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
477 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
478 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
479 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
480 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
481 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
482 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
483 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
484 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
485 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
486 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
487 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
488 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
489 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
490 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
491 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.34
Metatranscriptomes 0.09
Isolates 4.57

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.17
Nodule 2.63
Rhizoplane 4.74
Rhizosphere 76.82
Stem 0
Stem Tuber 0
Unclassified 7.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10006878 3300001979 Bacteria 4670
2 JGI24737J22298_10015483 3300001990 Bacteria 2469
3 JGI24744J21845_10026309 3300002077 Bacteria 1130
4 JGI25153J46596_10043278 3300003215 Bacteria 1365
5 JGI25160J50197_1007581 3300003354 Bacteria 4232
6 JGI25404J52841_10001804 3300003659 Bacteria 3886
7 JGI25404J52841_10008798 3300003659 Unclassified 2156
8 JGI25404J52841_10017513 3300003659 Bacteria 1553
9 Ga0070658_10377518 3300005327 Bacteria 1216
10 Ga0070683_100070525 3300005329 Bacteria 3260
11 Ga0070690_100081395 3300005330 Bacteria 2119
12 Ga0070670_100179008 3300005331 Bacteria 1840
13 Ga0068869_100044714 3300005334 Bacteria 3185
14 Ga0070680_100022603 3300005336 Bacteria 5011
15 Ga0070680_100046810 3300005336 Bacteria 3519
16 Ga0070680_100098721 3300005336 Bacteria 2423
17 Ga0070682_100001898 3300005337 Bacteria 11671
18 Ga0068868_100016512 3300005338 Bacteria 5484
19 Ga0070660_100008345 3300005339 Bacteria 7242
20 Ga0070660_100265323 3300005339 Bacteria 1403
21 Ga0070660_100301020 3300005339 Bacteria 1315
22 Ga0070691_10003421 3300005341 Bacteria 7133
23 Ga0070691_10038245 3300005341 Bacteria 2265
24 Ga0070668_100134018 3300005347 Bacteria 1990
25 Ga0070668_100187291 3300005347 Bacteria 1693
26 Ga0070669_100040796 3300005353 Bacteria 3374
27 Ga0070675_100142137 3300005354 Bacteria 2052
28 Ga0070671_100073962 3300005355 Bacteria 2846
29 Ga0070674_100154706 3300005356 Bacteria 1734
30 Ga0070673_100218483 3300005364 Bacteria 1649
31 Ga0070673_100277068 3300005364 Bacteria 1470
32 Ga0070659_100038851 3300005366 Bacteria 3713
33 Ga0070659_100039277 3300005366 Bacteria 3694
34 Ga0070667_100624676 3300005367 Bacteria 994
35 Ga0070667_100660470 3300005367 Bacteria 966
36 Ga0070709_10014835 3300005434 Bacteria 4417
37 Ga0070709_10056369 3300005434 Bacteria 2484
38 Ga0070714_100011934 3300005435 Bacteria 6911
39 Ga0070714_100112182 3300005435 Bacteria 2416
40 Ga0070713_100003576 3300005436 Bacteria 10269
41 Ga0070713_100016739 3300005436 Bacteria 5520
42 Ga0070713_100020074 3300005436 Bacteria 5115
43 Ga0070713_100103980 3300005436 Bacteria 2465
44 Ga0070710_10001532 3300005437 Bacteria 10922
45 Ga0070710_10003996 3300005437 Bacteria 6992
46 Ga0070710_10024153 3300005437 Bacteria 3204
47 Ga0070710_10035594 3300005437 Bacteria 2716
48 Ga0070711_100008302 3300005439 Bacteria 6355
49 Ga0070711_100009673 3300005439 Bacteria 5940
50 Ga0070711_100012351 3300005439 Bacteria 5332
51 Ga0070711_100072636 3300005439 Bacteria 2428
52 Ga0070711_100102931 3300005439 Bacteria 2080
53 Ga0070711_100179985 3300005439 Bacteria 1618
54 Ga0070705_100077274 3300005440 Bacteria 2033
55 Ga0070700_100017526 3300005441 Bacteria 4099
56 Ga0070663_100026672 3300005455 Bacteria 3915
57 Ga0070663_100199834 3300005455 Bacteria 1559
58 Ga0070663_100206617 3300005455 Bacteria 1535
59 Ga0070663_100361217 3300005455 Bacteria 1178
60 Ga0070678_100034660 3300005456 Bacteria 3517
61 Ga0070662_100262216 3300005457 Bacteria 1392
62 Ga0070681_10002937 3300005458 Bacteria 15801
63 Ga0070681_10277524 3300005458 Bacteria 1587
64 Ga0070681_10306009 3300005458 Bacteria 1499
65 Ga0068867_100423905 3300005459 Bacteria 1128
66 Ga0070706_100082929 3300005467 Bacteria 2970
67 Ga0070698_100321192 3300005471 Bacteria 1479
68 Ga0070679_100002400 3300005530 Bacteria 16984
69 Ga0070679_100003447 3300005530 Bacteria 14478
70 Ga0070679_100030485 3300005530 Bacteria 5324
71 Ga0070679_100561122 3300005530 Bacteria 1085
72 Ga0070684_100025298 3300005535 Bacteria 4988
73 Ga0070684_100043767 3300005535 Bacteria 3869
74 Ga0070697_100099077 3300005536 Bacteria 2419
75 Ga0068853_100000639 3300005539 Bacteria 23990
76 Ga0068853_100003310 3300005539 Bacteria 12327
77 Ga0068853_100038170 3300005539 Bacteria 4090
78 Ga0068853_100039338 3300005539 Bacteria 4033
79 Ga0068853_100059209 3300005539 Bacteria 3308
80 Ga0068853_100190008 3300005539 Bacteria 1865
81 Ga0070695_100120591 3300005545 Bacteria 1793
82 Ga0070696_100026887 3300005546 Bacteria 3916
83 Ga0070693_100034913 3300005547 Bacteria 2785
84 Ga0070665_100029471 3300005548 Bacteria 5524
85 Ga0070665_100031667 3300005548 Bacteria 5322
86 Ga0070665_100091913 3300005548 Bacteria 3039
87 Ga0070704_100336465 3300005549 Bacteria 1270
88 Ga0068855_100026317 3300005563 Bacteria 6959
89 Ga0068855_100030888 3300005563 Bacteria 6402
90 Ga0068855_100053234 3300005563 Bacteria 4763
91 Ga0068855_100060155 3300005563 Bacteria 4443
92 Ga0068855_100112279 3300005563 Bacteria 3127
93 Ga0068855_100112294 3300005563 Bacteria 3127
94 Ga0068855_100153539 3300005563 Bacteria 2617
95 Ga0070664_100227804 3300005564 Bacteria 1670
96 Ga0068857_100001037 3300005577 Bacteria 21487
97 Ga0068857_100033794 3300005577 Bacteria 4522
98 Ga0068857_100037870 3300005577 Bacteria 4273
99 Ga0068857_100443105 3300005577 Bacteria 1213
100 Ga0068854_100001597 3300005578 Bacteria 13790
101 Ga0068854_100019432 3300005578 Bacteria 4578
102 Ga0068854_100102280 3300005578 Bacteria 2149
103 Ga0068854_100178383 3300005578 Bacteria 1658
104 Ga0068854_100223513 3300005578 Bacteria 1491
105 Ga0068856_100000883 3300005614 Bacteria 32112
106 Ga0068856_100012184 3300005614 Bacteria 8332
107 Ga0068856_100155809 3300005614 Bacteria 2294
108 Ga0068856_100488926 3300005614 Bacteria 1252
109 Ga0068852_100030003 3300005616 Bacteria 4472
110 Ga0068852_100116544 3300005616 Bacteria 2437
111 Ga0068859_100047861 3300005617 Bacteria 4296
112 Ga0068859_100379973 3300005617 Bacteria 1508
113 Ga0068859_100667026 3300005617 Bacteria 1131
114 Ga0068864_100033808 3300005618 Bacteria 4347
115 Ga0068861_100037920 3300005719 Bacteria 3584
116 Ga0068861_100052285 3300005719 Bacteria 3104
117 Ga0068861_100141285 3300005719 Bacteria 1965
118 Ga0068861_100368396 3300005719 Bacteria 1265
119 Ga0068861_100637789 3300005719 Bacteria 982
120 Ga0068851_10000558 3300005834 Bacteria 16219
121 Ga0068851_10015981 3300005834 Bacteria 3584
122 Ga0068870_10053768 3300005840 Bacteria 2140
123 Ga0068858_100069349 3300005842 Bacteria 3268
124 Ga0068858_100178809 3300005842 Bacteria 2002
125 Ga0068858_100297313 3300005842 Bacteria 1540
126 Ga0068860_100000477 3300005843 Bacteria 49839
127 Ga0068862_100040785 3300005844 Bacteria 3947
128 Ga0068862_100094520 3300005844 Bacteria 2607
129 Ga0068862_100102424 3300005844 Bacteria 2506
130 Ga0081455_10000209 3300005937 Bacteria 74597
131 Ga0081455_10005086 3300005937 Bacteria 14513
132 Ga0081455_10007370 3300005937 Bacteria 11598
133 Ga0081455_10007381 3300005937 Bacteria 11587
134 Ga0081455_10109474 3300005937 Bacteria 2198
135 Ga0081455_10354979 3300005937 Bacteria 1033
136 Ga0081538_10074134 3300005981 Bacteria 1854
137 Ga0081540_1000064 3300005983 Bacteria 119429
138 Ga0081540_1003488 3300005983 Bacteria 12411
139 Ga0081540_1008854 3300005983 Bacteria 6988
140 Ga0081540_1012184 3300005983 Bacteria 5686
141 Ga0081540_1048845 3300005983 Bacteria 2116
142 Ga0081539_10018659 3300005985 Bacteria 4799
143 Ga0070717_10016786 3300006028 Bacteria 5683
144 Ga0070717_10041403 3300006028 Bacteria 3755
145 Ga0070717_10119310 3300006028 Bacteria 2258
146 Ga0070717_10231831 3300006028 Bacteria 1626
147 Ga0075365_10106354 3300006038 Bacteria 1925
148 Ga0075368_10064243 3300006042 Bacteria 1473
149 Ga0075368_10088191 3300006042 Bacteria 1267
150 Ga0075363_100004174 3300006048 Bacteria 6275
151 Ga0075363_100082345 3300006048 Bacteria 1761
152 Ga0075363_100123090 3300006048 Bacteria 1450
153 Ga0075364_10018451 3300006051 Bacteria 4367
154 Ga0075364_10034501 3300006051 Bacteria 3265
155 Ga0075364_10057410 3300006051 Bacteria 2549
156 Ga0075432_10048537 3300006058 Bacteria 1494
157 Ga0070715_10000275 3300006163 Bacteria 12448
158 Ga0070715_10009900 3300006163 Bacteria 3378
159 Ga0070715_10090401 3300006163 Bacteria 1408
160 Ga0070715_10213345 3300006163 Bacteria 988
161 Ga0070716_100007369 3300006173 Bacteria 5411
162 Ga0070716_100218767 3300006173 Bacteria 1278
163 Ga0070716_100227526 3300006173 Bacteria 1257
164 Ga0070712_100002530 3300006175 Bacteria 11286
165 Ga0070712_100034544 3300006175 Bacteria 3427
166 Ga0070712_100065297 3300006175 Bacteria 2583
167 Ga0070712_100102723 3300006175 Bacteria 2118
168 Ga0070712_100146083 3300006175 Bacteria 1810
169 Ga0075362_10020405 3300006177 Bacteria 2768
170 Ga0075362_10041956 3300006177 Bacteria 2020
171 Ga0075367_10005424 3300006178 Bacteria 6332
172 Ga0075367_10049481 3300006178 Bacteria 2478
173 Ga0075367_10110837 3300006178 Bacteria 1684
174 Ga0075369_10009037 3300006186 Bacteria 3857
175 Ga0097621_100339564 3300006237 Bacteria 1334
176 Ga0097621_100451914 3300006237 Bacteria 1158
177 Ga0075370_10022430 3300006353 Bacteria 3468
178 Ga0075370_10102322 3300006353 Bacteria 1659
179 Ga0075428_100003141 3300006844 Bacteria 18043
180 Ga0075428_100128112 3300006844 Bacteria 2761
181 Ga0075428_100532983 3300006844 Bacteria 1256
182 Ga0075431_100000568 3300006847 Bacteria 31187
183 Ga0075431_100001629 3300006847 Bacteria 20981
184 Ga0075431_100266627 3300006847 Bacteria 1737
185 Ga0075433_10004977 3300006852 Bacteria 10404
186 Ga0075433_10045558 3300006852 Bacteria 3813
187 Ga0075433_10250376 3300006852 Bacteria 1572
188 Ga0075434_100028319 3300006871 Bacteria 5503
189 Ga0075434_100040930 3300006871 Bacteria 4588
190 Ga0075434_100056552 3300006871 Bacteria 3898
191 Ga0075434_100072031 3300006871 Bacteria 3448
192 Ga0075429_100003175 3300006880 Bacteria 13972
193 Ga0068865_100292659 3300006881 Bacteria 1300
194 Ga0075436_100068860 3300006914 Bacteria 2445
195 Ga0097620_100047862 3300006931 Bacteria 4296
196 Ga0097620_100379954 3300006931 Bacteria 1508
197 Ga0097620_100666967 3300006931 Bacteria 1131
198 Ga0075435_100051643 3300007076 Bacteria 3312
199 Ga0075435_100076669 3300007076 Bacteria 2740
200 Ga0075435_100078601 3300007076 Bacteria 2706
201 Ga0075435_100518438 3300007076 Bacteria 1031
202 Ga0099794_10001485 3300007265 Bacteria 8212
203 Ga0099794_10036912 3300007265 Bacteria 2312
204 Ga0099795_10080197 3300007788 Bacteria 1247
205 Ga0105240_10002459 3300009093 Bacteria 29768
206 Ga0105240_10062589 3300009093 Bacteria 4632
207 Ga0105240_10087076 3300009093 Bacteria 3825
208 Ga0105240_10170354 3300009093 Bacteria 2579
209 Ga0111539_10001515 3300009094 Bacteria 31011
210 Ga0111539_10066626 3300009094 Bacteria 4253
211 Ga0111539_10091971 3300009094 Bacteria 3564
212 Ga0111539_10246033 3300009094 Bacteria 2082
213 Ga0111539_10254754 3300009094 Bacteria 2044
214 Ga0111539_10311410 3300009094 Bacteria 1832
215 Ga0105245_10189575 3300009098 Bacteria 1969
216 Ga0105247_10265102 3300009101 Bacteria 1179
217 Ga0114129_10000692 3300009147 Bacteria 42533
218 Ga0114129_10065672 3300009147 Bacteria 5063
219 Ga0114129_10092485 3300009147 Bacteria 4190
220 Ga0114129_10126694 3300009147 Bacteria 3510
221 Ga0114129_10293883 3300009147 Bacteria 2167
222 Ga0105243_10377080 3300009148 Bacteria 1311
223 Ga0105241_10000249 3300009174 Bacteria 40643
224 Ga0105241_10109783 3300009174 Bacteria 2206
225 Ga0105242_10099724 3300009176 Bacteria 2459
226 Ga0105248_10156900 3300009177 Bacteria 2568
227 Ga0105248_10385572 3300009177 Bacteria 1578
228 Ga0105237_10067599 3300009545 Bacteria 3567
229 Ga0105237_10133597 3300009545 Bacteria 2476
230 Ga0105237_10168759 3300009545 Bacteria 2188
231 Ga0105237_10286091 3300009545 Bacteria 1651
232 Ga0105238_10001235 3300009551 Bacteria 25716
233 Ga0105238_10014511 3300009551 Bacteria 7966
234 Ga0105238_10038587 3300009551 Bacteria 4850
235 Ga0105249_10044828 3300009553 Bacteria 4021
236 Ga0105249_10746958 3300009553 Bacteria 1040
237 Ga0105249_10840241 3300009553 Bacteria 983
238 Ga0099796_10020835 3300010159 Bacteria 2010
239 Ga0105239_10032291 3300010375 Bacteria 5754
240 Ga0105239_10061707 3300010375 Bacteria 4114
241 Ga0105239_10158333 3300010375 Bacteria 2530
242 Ga0105239_10227921 3300010375 Bacteria 2090
243 Ga0157373_10050479 3300013100 Bacteria 2962
244 Ga0157373_10131755 3300013100 Bacteria 1758
245 Ga0157370_10008510 3300013104 Bacteria 11064
246 Ga0157370_10015855 3300013104 Bacteria 7646
247 Ga0157370_10376246 3300013104 Bacteria 1308
248 Ga0157369_10052065 3300013105 Bacteria 4430
249 Ga0157372_10443094 3300013307 Bacteria 1514
250 Ga0157375_10139921 3300013308 Bacteria 2547
251 Ga0157375_10187578 3300013308 Bacteria 2222
252 Ga0163163_10064343 3300014325 Bacteria 3639
253 Ga0163163_10220639 3300014325 Bacteria 1944
254 Ga0163163_10475090 3300014325 Bacteria 1311
255 Ga0157380_10163035 3300014326 Bacteria 1940
256 Ga0157380_10303924 3300014326 Bacteria 1471
257 Ga0157380_10382047 3300014326 Bacteria 1329
258 Ga0157377_10078649 3300014745 Bacteria 1923
259 Ga0157379_10270345 3300014968 Bacteria 1546
260 Ga0163161_10070039 3300017792 Bacteria 2565
261 Ga0206353_11234579 3300020082 Bacteria 1782
262 Ga0213872_10140105 3300021361 Bacteria 1062
263 Ga0213874_10002095 3300021377 Bacteria 4228
264 Ga0213876_10005453 3300021384 Bacteria 6994
265 Ga0213876_10125669 3300021384 Bacteria 1362
266 Ga0213876_10131901 3300021384 Bacteria 1328
267 Ga0213876_10234387 3300021384 Bacteria 976
268 Ga0213871_10021333 3300021441 Bacteria 1613
269 Ga0209758_1001918 3300025297 Bacteria 22622
270 Ga0209758_1004128 3300025297 Bacteria 12418
271 Ga0209758_1048464 3300025297 Bacteria 1510
272 Ga0207426_1001156 3300025302 Bacteria 23697
273 Ga0207656_10003400 3300025321 Bacteria 5466
274 Ga0207656_10020096 3300025321 Bacteria 2650
275 Ga0207692_10000565 3300025898 Bacteria 13191
276 Ga0207692_10052384 3300025898 Bacteria 2074
277 Ga0207642_10135499 3300025899 Bacteria 1291
278 Ga0207710_10014866 3300025900 Bacteria 3287
279 Ga0207688_10058536 3300025901 Bacteria 2168
280 Ga0207688_10087080 3300025901 Bacteria 1790
281 Ga0207688_10107952 3300025901 Bacteria 1613
282 Ga0207647_10009887 3300025904 Bacteria 6756
283 Ga0207647_10092600 3300025904 Bacteria 1802
284 Ga0207685_10009621 3300025905 Bacteria 2815
285 Ga0207685_10023455 3300025905 Bacteria 2101
286 Ga0207685_10078961 3300025905 Bacteria 1356
287 Ga0207699_10219749 3300025906 Bacteria 1296
288 Ga0207645_10220582 3300025907 Bacteria 1250
289 Ga0207643_10084567 3300025908 Bacteria 1842
290 Ga0207705_10241570 3300025909 Bacteria 1376
291 Ga0207684_10002963 3300025910 Bacteria 16822
292 Ga0207684_10051004 3300025910 Bacteria 3510
293 Ga0207654_10069399 3300025911 Bacteria 2088
294 Ga0207707_10007389 3300025912 Bacteria 9570
295 Ga0207707_10008266 3300025912 Bacteria 9034
296 Ga0207707_10128117 3300025912 Bacteria 2219
297 Ga0207707_10232942 3300025912 Bacteria 1602
298 Ga0207695_10000148 3300025913 Bacteria 208344
299 Ga0207695_10000387 3300025913 Bacteria 99734
300 Ga0207695_10092643 3300025913 Bacteria 3032
301 Ga0207695_10136588 3300025913 Bacteria 2405
302 Ga0207695_10177135 3300025913 Bacteria 2054
303 Ga0207695_10241252 3300025913 Bacteria 1709
304 Ga0207671_10003051 3300025914 Bacteria 17147
305 Ga0207671_10026208 3300025914 Bacteria 4370
306 Ga0207671_10034623 3300025914 Bacteria 3752
307 Ga0207671_10114074 3300025914 Bacteria 2059
308 Ga0207693_10001168 3300025915 Bacteria 23417
309 Ga0207693_10003777 3300025915 Bacteria 12900
310 Ga0207693_10021801 3300025915 Bacteria 5094
311 Ga0207693_10042386 3300025915 Bacteria 3583
312 Ga0207693_10187477 3300025915 Bacteria 1628
313 Ga0207663_10004750 3300025916 Bacteria 6785
314 Ga0207663_10037861 3300025916 Bacteria 2911
315 Ga0207663_10042175 3300025916 Bacteria 2787
316 Ga0207663_10050996 3300025916 Bacteria 2575
317 Ga0207663_10294081 3300025916 Bacteria 1211
318 Ga0207660_10015897 3300025917 Bacteria 4975
319 Ga0207660_10062767 3300025917 Bacteria 2677
320 Ga0207660_10089142 3300025917 Bacteria 2283
321 Ga0207657_10009668 3300025919 Bacteria 9676
322 Ga0207657_10024873 3300025919 Bacteria 5535
323 Ga0207652_10007807 3300025921 Bacteria 8595
324 Ga0207652_10060204 3300025921 Bacteria 3276
325 Ga0207652_10069014 3300025921 Bacteria 3068
326 Ga0207694_10000121 3300025924 Bacteria 83123
327 Ga0207694_10015653 3300025924 Bacteria 5721
328 Ga0207694_10049243 3300025924 Bacteria 3261
329 Ga0207694_10287278 3300025924 Bacteria 1352
330 Ga0207650_10002929 3300025925 Bacteria 11773
331 Ga0207687_10014891 3300025927 Bacteria 5094
332 Ga0207700_10010887 3300025928 Bacteria 5772
333 Ga0207700_10036983 3300025928 Bacteria 3531
334 Ga0207700_10073901 3300025928 Bacteria 2635
335 Ga0207700_10092831 3300025928 Bacteria 2387
336 Ga0207700_10208805 3300025928 Bacteria 1650
337 Ga0207664_10012301 3300025929 Bacteria 6114
338 Ga0207664_10146411 3300025929 Bacteria 2003
339 Ga0207664_10217097 3300025929 Bacteria 1657
340 Ga0207644_10050991 3300025931 Bacteria 2968
341 Ga0207644_10135617 3300025931 Bacteria 1889
342 Ga0207690_10340721 3300025932 Bacteria 1183
343 Ga0207706_10044297 3300025933 Bacteria 3944
344 Ga0207706_10111603 3300025933 Bacteria 2405
345 Ga0207709_10052061 3300025935 Bacteria 2512
346 Ga0207709_10073008 3300025935 Bacteria 2185
347 Ga0207670_10229635 3300025936 Bacteria 1425
348 Ga0207669_10025452 3300025937 Bacteria 3199
349 Ga0207669_10082593 3300025937 Bacteria 2063
350 Ga0207665_10000883 3300025939 Bacteria 20232
351 Ga0207665_10112997 3300025939 Bacteria 1910
352 Ga0207665_10363057 3300025939 Bacteria 1095
353 Ga0207691_10253519 3300025940 Bacteria 1518
354 Ga0207691_10477779 3300025940 Bacteria 1059
355 Ga0207711_10029240 3300025941 Bacteria 4645
356 Ga0207711_10219501 3300025941 Bacteria 1738
357 Ga0207689_10289799 3300025942 Bacteria 1356
358 Ga0207689_10371073 3300025942 Bacteria 1191
359 Ga0207661_10002867 3300025944 Bacteria 11914
360 Ga0207661_10056017 3300025944 Bacteria 3164
361 Ga0207661_10380521 3300025944 Bacteria 1277
362 Ga0207667_10007656 3300025949 Bacteria 12939
363 Ga0207667_10016003 3300025949 Bacteria 8492
364 Ga0207667_10054033 3300025949 Bacteria 4225
365 Ga0207667_10137555 3300025949 Bacteria 2515
366 Ga0207667_10178423 3300025949 Bacteria 2182
367 Ga0207667_10316090 3300025949 Bacteria 1595
368 Ga0207667_10538213 3300025949 Bacteria 1182
369 Ga0207712_10187413 3300025961 Bacteria 1630
370 Ga0207668_10145485 3300025972 Bacteria 1828
371 Ga0207640_10005594 3300025981 Bacteria 6850
372 Ga0207640_10055934 3300025981 Bacteria 2587
373 Ga0207658_10301124 3300025986 Bacteria 1381
374 Ga0207703_10014932 3300026035 Bacteria 6060
375 Ga0207703_10077871 3300026035 Bacteria 2753
376 Ga0207639_10014436 3300026041 Bacteria 5556
377 Ga0207639_10016223 3300026041 Bacteria 5265
378 Ga0207639_10308765 3300026041 Bacteria 1400
379 Ga0207678_10007286 3300026067 Bacteria 9804
380 Ga0207678_10044075 3300026067 Bacteria 3860
381 Ga0207678_10232539 3300026067 Bacteria 1578
382 Ga0207678_10297876 3300026067 Bacteria 1386
383 Ga0207678_10304985 3300026067 Bacteria 1369
384 Ga0207678_10567390 3300026067 Bacteria 993
385 Ga0207708_10172435 3300026075 Bacteria 1714
386 Ga0207708_10419736 3300026075 Bacteria 1109
387 Ga0207702_10000004 3300026078 Bacteria 422182
388 Ga0207702_10000318 3300026078 Bacteria 55209
389 Ga0207702_10051367 3300026078 Bacteria 3483
390 Ga0207702_10055681 3300026078 Bacteria 3355
391 Ga0207702_10325607 3300026078 Bacteria 1465
392 Ga0207648_10120914 3300026089 Bacteria 2303
393 Ga0207676_10088633 3300026095 Bacteria 2533
394 Ga0207676_10205751 3300026095 Bacteria 1742
395 Ga0207674_10005964 3300026116 Bacteria 14418
396 Ga0207674_10006033 3300026116 Bacteria 14333
397 Ga0207674_10012348 3300026116 Bacteria 9549
398 Ga0207674_10079008 3300026116 Bacteria 3295
399 Ga0207674_10122866 3300026116 Bacteria 2562
400 Ga0207675_100026733 3300026118 Bacteria 5371
401 Ga0207675_100044501 3300026118 Bacteria 4149
402 Ga0207675_100051099 3300026118 Bacteria 3857
403 Ga0207675_100175437 3300026118 Bacteria 2050
404 Ga0207675_100237438 3300026118 Bacteria 1760
405 Ga0207683_10028337 3300026121 Bacteria 4842
406 Ga0207683_10066450 3300026121 Bacteria 3180
407 Ga0207683_10360374 3300026121 Bacteria 1335
408 Ga0207698_10013415 3300026142 Bacteria 5406
409 Ga0207698_10329898 3300026142 Bacteria 1433
410 Ga0209179_1016514 3300027512 Bacteria 1386
411 Ga0209588_1053255 3300027671 Bacteria 1309
412 Ga0209813_10013142 3300027866 Bacteria 2204
413 Ga0207428_10002337 3300027907 Bacteria 18975
414 Ga0207428_10046668 3300027907 Bacteria 3483
415 Ga0207428_10311886 3300027907 Bacteria 1163
416 Ga0268266_10001906 3300028379 Bacteria 23472
417 Ga0268266_10649913 3300028379 Bacteria 1015
418 Ga0268265_10122027 3300028380 Bacteria 2148
419 Ga0268264_10000062 3300028381 Bacteria 302110
420 Ga0268264_10470329 3300028381 Bacteria 1221
421 Ga0265337_1001354 3300028556 Bacteria 12087
422 Ga0265334_10089935 3300028573 Bacteria 1121
423 Ga0307517_10000175 3300028786 Bacteria 105567
424 Ga0307515_10099000 3300028794 Bacteria 3544
425 Ga0307515_10236976 3300028794 Bacteria 1604
426 Ga0307511_10054505 3300030521 Bacteria 3151
427 Ga0265330_10038896 3300031235 Bacteria 2114
428 Ga0265325_10025732 3300031241 Bacteria 3193
429 Ga0265340_10017518 3300031247 Bacteria 3706
430 Ga0265339_10000738 3300031249 Bacteria 25301
431 Ga0265339_10117155 3300031249 Bacteria 1373
432 Ga0265331_10171233 3300031250 Bacteria 982
433 Ga0307513_10212321 3300031456 Bacteria 1765
434 Ga0307509_10006160 3300031507 Bacteria 16260
435 Ga0307508_10000045 3300031616 Bacteria 142824
436 Ga0307508_10034088 3300031616 Bacteria 4591
437 Ga0265314_10014911 3300031711 Bacteria 6190
438 Ga0265314_10168340 3300031711 Bacteria 1326
439 Ga0265342_10168724 3300031712 Bacteria 1206
440 Ga0307516_10049470 3300031730 Bacteria 4131
441 Ga0307516_10098273 3300031730 Bacteria 2746
442 Ga0307516_10161987 3300031730 Bacteria 1986
443 Ga0307516_10406943 3300031730 Bacteria 1019
444 Ga0307406_10454913 3300031901 Bacteria 1028
445 Ga0307407_10163740 3300031903 Bacteria 1458
446 Ga0307411_10150769 3300032005 Bacteria 1727
447 Ga0307415_100207760 3300032126 Bacteria 1559
448 Ga0307507_10110502 3300033179 Bacteria 2249
449 Ga0307510_10042915 3300033180 Bacteria 4922
450 Ga0373930_0045829 3300034816 Bacteria 943
451 Ga0373926_0094737 3300035083 Bacteria 1113
452 Ga0373934_0014812 3300035086 Bacteria 2953
453 Ga0373934_0065091 3300035086 Bacteria 1455
454 Ga0373940_0003839 3300035088 Bacteria 3115
455 Ga0373949_0007155 3300035090 Bacteria 2447
456 Ga0373923_0038708 3300035111 Bacteria 1955
457 Ga0373936_0003919 3300035113 Bacteria 5605
458 Ga0373936_0023840 3300035113 Bacteria 2387
459 Ga0373936_0028148 3300035113 Bacteria 2208
460 Ga0373936_0030004 3300035113 Bacteria 2144
461 Ga0373941_0009142 3300035115 Bacteria 2487
462 Ga0373956_0004385 3300035119 Bacteria 5652
463 Ga0373957_0007126 3300035120 Bacteria 3562
464 Ga0373960_0001356 3300035121 Bacteria 5400
465 Ga0373960_0011395 3300035121 Bacteria 2190
466 Ga0373943_0003409 3300035170 Bacteria 7239
467 Ga0373943_0005484 3300035170 Bacteria 5707
468 Ga0373943_0025075 3300035170 Bacteria 2785
469 Ga0373946_0002063 3300035171 Bacteria 7056
470 Ga0373946_0016589 3300035171 Bacteria 2808
471 Ga0373946_0025554 3300035171 Bacteria 2323
472 Ga0373946_0138036 3300035171 Bacteria 1128
473 Ga0373955_0000224 3300035172 Bacteria 23923
474 Ga0373955_0011330 3300035172 Bacteria 4245
475 Ga0373955_0030936 3300035172 Bacteria 2800
476 Ga0373955_0094738 3300035172 Bacteria 1706
477 Ga0373961_0002623 3300035241 Bacteria 4626
478 Ga0373962_0127877 3300035242 Bacteria 815
479 Ga0316574_0014984 3300035398 Bacteria 4490
480 Ga0373924_0011255 3300035410 Bacteria 3318
481 Ga0373931_0002391 3300035691 Bacteria 8312
482 Ga0373931_0006320 3300035691 Bacteria 5528
483 Ga0373931_0029681 3300035691 Bacteria 2809
484 Ga0373935_0000011 3300035692 Bacteria 89873
485 Ga0373935_0014539 3300035692 Bacteria 4749
486 Ga0373935_0097097 3300035692 Bacteria 1937
487 Ga0373935_0219253 3300035692 Bacteria 1321
488 Ga0373927_0001064 3300035695 Bacteria 20972
489 Ga0373927_0003727 3300035695 Bacteria 10831
490 Ga0373927_0004599 3300035695 Bacteria 9620
491 Ga0373927_0048569 3300035695 Bacteria 2745
492 Ga0373927_0114622 3300035695 Bacteria 1757
493 Ga0373927_0201880 3300035695 Bacteria 1305
494 Ga0373933_0000315 3300035724 Bacteria 31397
495 Ga0373933_0000885 3300035724 Bacteria 18316
496 Ga0373933_0009041 3300035724 Bacteria 5435
497 Ga0373933_0012657 3300035724 Bacteria 4662
498 Ga0373933_0146323 3300035724 Bacteria 1494
499 Ga0373933_0171054 3300035724 Bacteria 1382
500 Ga0373947_0006319 3300035725 Bacteria 6885
501 Ga0373947_0021592 3300035725 Bacteria 3727
502 Ga0373947_0236599 3300035725 Bacteria 1204
503 Ga0373937_0000019 3300036401 Bacteria 138568
504 Ga0373937_0008940 3300036401 Bacteria 8693
505 Ga0373937_0017394 3300036401 Bacteria 6403
506 Ga0373937_0022449 3300036401 Bacteria 5674
507 Ga0373937_0029705 3300036401 Bacteria 4952
508 Ga0373937_0099501 3300036401 Bacteria 2697
509 Ga0373937_0211596 3300036401 Bacteria 1824
510 Ga0373937_0214019 3300036401 Bacteria 1814
511 Ga0373937_0288660 3300036401 Bacteria 1550
512 Ga0316584_0012076 3300036712 Bacteria 6083
513 Ga0316584_0034275 3300036712 Bacteria 3764
514 Ga0373925_0000026 3300037068 Bacteria 154713
515 Ga0373925_0007638 3300037068 Bacteria 7875
516 Ga0373925_0012102 3300037068 Bacteria 6246
517 Ga0373925_0054728 3300037068 Bacteria 2985
518 Ga0373925_0079834 3300037068 Bacteria 2486
519 Ga0373925_0106664 3300037068 Bacteria 2160
520 Ga0373925_0107949 3300037068 Bacteria 2147
521 Ga0373925_0297317 3300037068 Bacteria 1303
522 Ga0373925_0384790 3300037068 Bacteria 1143
523 Ga0395899_0006366 3300037312 Bacteria 9143
524 Ga0395900_0009214 3300037418 Bacteria 10119
525 Ga0395900_0030391 3300037418 Bacteria 5547
526 Ga0395900_0089045 3300037418 Bacteria 3173
527 Ga0395900_0183174 3300037418 Bacteria 2127
528 Ga0395898_0041823 3300037466 Bacteria 4524
529 Ga0395898_0063279 3300037466 Bacteria 3590
530 Ga0395898_0085558 3300037466 Bacteria 3039
531 Ga0395898_0134131 3300037466 Bacteria 2371
532 Ga0395905_0070559 3300037471 Bacteria 3274
533 Ga0395905_0096286 3300037471 Bacteria 2779
534 Ga0436364_0004111 3300037853 Bacteria 1822
535 Ga0436364_0452492 3300037853 Bacteria 1408
536 Ga0395901_0021536 3300038443 Bacteria 6606
537 Ga0395901_0077817 3300038443 Bacteria 3462
538 Ga0436365_0172137 3300039437 Bacteria 9592
539 Ga0436365_0734530 3300039437 Bacteria 1401
540 Ga0436365_0903245 3300039437 Bacteria 1963
541 Ga0436365_0992472 3300039437 Bacteria 4820
542 Ga0436365_1607953 3300039437 Bacteria 2022
543 Ga0436360_0831213 3300039438 Bacteria 2465
544 Ga0436361_0000238 3300039447 Bacteria 2150
545 Ga0436361_0274303 3300039447 Bacteria 1172
546 Ga0436361_0416951 3300039447 Bacteria 2702
547 Ga0436361_0642711 3300039447 Bacteria 2476
548 Ga0436361_1209439 3300039447 Bacteria 1251
549 Ga0436363_0407324 3300039450 Bacteria 1418
550 Ga0436363_0576644 3300039450 Bacteria 6088
551 Ga0436362_0233201 3300039453 Bacteria 1686
552 Ga0451789_0781606 3300041443 Bacteria 975
553 Ga0466966_0030392 3300044684 Bacteria 3508
554 Ga0466963_0043770 3300044694 Bacteria 2946
555 Ga0466963_0054350 3300044694 Bacteria 2661
556 Ga0466971_0058502 3300044719 Bacteria 1740
557 Ga0466968_0118017 3300044735 Bacteria 1199
558 Ga0466959_0029672 3300045049 Bacteria 4053
559 Ga0466959_0074305 3300045049 Bacteria 2458
560 Ga0466967_0024550 3300045976 Bacteria 4959
561 Ga0466967_0111496 3300045976 Bacteria 2514
562 Ga0466967_0280836 3300045976 Bacteria 1598
563 Ga0495617_012208 3300046452 Bacteria 2926
564 Ga0495592_0000017 3300046454 Bacteria 142442
565 Ga0495592_0020736 3300046454 Bacteria 5000
566 Ga0495592_0047510 3300046454 Bacteria 3196
567 Ga0495592_0096467 3300046454 Bacteria 2113
568 Ga0495592_0260135 3300046454 Bacteria 1143
569 Ga0495603_0003128 3300046455 Bacteria 9841
570 Ga0495603_0003728 3300046455 Bacteria 9063
571 Ga0495603_0045407 3300046455 Bacteria 2620
572 Ga0495603_0087718 3300046455 Bacteria 1821
573 Ga0495603_0088181 3300046455 Bacteria 1815
574 Ga0495603_0172051 3300046455 Bacteria 1254
575 Ga0495590_0043598 3300046457 Bacteria 1564
576 Ga0495629_0001107 3300046459 Bacteria 21326
577 Ga0495629_0002872 3300046459 Bacteria 13167
578 Ga0495629_0012976 3300046459 Bacteria 6025
579 Ga0495629_0188349 3300046459 Bacteria 1429
580 Ga0495638_0042429 3300046460 Bacteria 2873
581 Ga0495638_0145578 3300046460 Bacteria 1379
582 Ga0495638_0213480 3300046460 Bacteria 1082
583 Ga0495641_0004022 3300046461 Bacteria 10651
584 Ga0495641_0050540 3300046461 Bacteria 1900
585 Ga0495641_0112770 3300046461 Bacteria 1213
586 Ga0495651_0000923 3300046462 Bacteria 22782
587 Ga0495651_0044155 3300046462 Bacteria 3455
588 Ga0495653_0000033 3300046463 Bacteria 131680
589 Ga0495653_0029817 3300046463 Bacteria 4350
590 Ga0495650_0113452 3300046471 Bacteria 1004
591 Ga0495580_0001546 3300046472 Bacteria 20242
592 Ga0495580_0126051 3300046472 Bacteria 1777
593 Ga0495582_0000855 3300046473 Bacteria 16906
594 Ga0495582_0105319 3300046473 Bacteria 1581
595 Ga0495639_0000072 3300046475 Bacteria 46904
596 Ga0495639_0022066 3300046475 Bacteria 2791
597 Ga0495639_0035724 3300046475 Bacteria 2224
598 Ga0495662_0002403 3300046476 Bacteria 9407
599 Ga0495662_0014466 3300046476 Bacteria 3836
600 Ga0495664_0000008 3300046477 Bacteria 307158
601 Ga0495664_0001402 3300046477 Bacteria 12752
602 Ga0495664_0200600 3300046477 Bacteria 1209
603 Ga0495584_0112632 3300046491 Bacteria 1377
604 Ga0495584_0130516 3300046491 Bacteria 1275
605 Ga0495585_0054506 3300046492 Bacteria 2210
606 Ga0495585_0114167 3300046492 Bacteria 1434
607 Ga0495585_0132400 3300046492 Bacteria 1311
608 Ga0495594_0278809 3300046499 Bacteria 952
609 Ga0495607_0108264 3300046501 Bacteria 1477
610 Ga0495606_0000831 3300046507 Bacteria 46699
611 Ga0495608_0000014 3300046511 Bacteria 221042
612 Ga0495608_0020001 3300046511 Bacteria 4603
613 Ga0495608_0035508 3300046511 Bacteria 3362
614 Ga0495610_0062504 3300046512 Bacteria 1766
615 Ga0495616_0063169 3300046513 Bacteria 1811
616 Ga0495618_0000013 3300046514 Bacteria 168671
617 Ga0495618_0035721 3300046514 Bacteria 3120
618 Ga0495628_0000008 3300046516 Bacteria 284313
619 Ga0495628_0003465 3300046516 Bacteria 14119
620 Ga0495628_0086586 3300046516 Bacteria 2429
621 Ga0495630_0000797 3300046517 Bacteria 22206
622 Ga0495630_0003448 3300046517 Bacteria 10991
623 Ga0495630_0096430 3300046517 Bacteria 2236
624 Ga0495632_0083372 3300046519 Bacteria 1522
625 Ga0495637_0022738 3300046520 Bacteria 2857
626 Ga0495644_0027753 3300046523 Bacteria 2144
627 Ga0495644_0075459 3300046523 Bacteria 1269
628 Ga0495648_0003200 3300046524 Bacteria 14540
629 Ga0495648_0063981 3300046524 Bacteria 2169
630 Ga0495663_0030584 3300046525 Bacteria 1596
631 Ga0495666_0008781 3300046526 Bacteria 5064
632 Ga0495642_0059322 3300046528 Bacteria 1586
633 Ga0495652_0000005 3300046529 Bacteria 524368
634 Ga0495652_0069920 3300046529 Bacteria 2936
635 Ga0495652_0100862 3300046529 Bacteria 2341
636 Ga0495654_0073393 3300046530 Bacteria 1618
637 Ga0495665_0000128 3300046531 Bacteria 36043
638 Ga0495665_0070590 3300046531 Bacteria 1841
639 Ga0495665_0071946 3300046531 Bacteria 1821
640 Ga0495665_0095389 3300046531 Bacteria 1562
641 Ga0495640_0000017 3300046533 Bacteria 138688
642 Ga0495640_0010120 3300046533 Bacteria 7310
643 Ga0495640_0011467 3300046533 Bacteria 6821
644 Ga0495640_0047940 3300046533 Bacteria 2955
645 Ga0495587_0000005 3300046536 Bacteria 358412
646 Ga0495587_0018828 3300046536 Bacteria 4280
647 Ga0495587_0062786 3300046536 Bacteria 2174
648 Ga0495598_0080433 3300046537 Bacteria 1044
649 Ga0495621_0089462 3300046539 Bacteria 1159
650 Ga0495645_0000007 3300046543 Bacteria 376299
651 Ga0495645_0010485 3300046543 Bacteria 6499
652 Ga0495645_0014817 3300046543 Bacteria 5539
653 Ga0495622_0005892 3300046557 Bacteria 5692
654 Ga0495622_0017286 3300046557 Bacteria 3358
655 Ga0495633_0116803 3300046558 Bacteria 1236
656 Ga0495667_0000012 3300046559 Bacteria 220967
657 Ga0495667_0007798 3300046559 Bacteria 7249
658 Ga0495667_0050257 3300046559 Bacteria 2753
659 Ga0495656_0002973 3300046615 Bacteria 5691
660 Ga0495656_0015117 3300046615 Bacteria 2907
661 Ga0495668_0050768 3300046616 Bacteria 2298
662 Ga0495634_0000070 3300046642 Bacteria 79664
663 Ga0495634_0021038 3300046642 Bacteria 4619
664 Ga0495634_0035544 3300046642 Bacteria 3411
665 Ga0495634_0099675 3300046642 Bacteria 1878
666 Ga0495625_0163978 3300046660 Bacteria 1487
667 Ga0495625_0189714 3300046660 Bacteria 1362
668 Ga0495625_0206843 3300046660 Bacteria 1292
669 Ga0495635_0000010 3300046663 Bacteria 246385
670 Ga0495635_0000564 3300046663 Bacteria 23651
671 Ga0495635_0001868 3300046663 Bacteria 14260
672 Ga0495635_0168155 3300046663 Bacteria 1491
673 Ga0495659_0006735 3300046664 Bacteria 3630
674 Ga0495661_0040977 3300046665 Bacteria 2868
675 Ga0495661_0147899 3300046665 Bacteria 1271
676 Ga0495588_0031903 3300046674 Bacteria 2654
677 Ga0495657_0000178 3300046675 Bacteria 57139
678 Ga0495657_0008385 3300046675 Bacteria 7909
679 Ga0495657_0104274 3300046675 Bacteria 1803
680 Ga0495599_0000015 3300046678 Bacteria 175055
681 Ga0495599_0020349 3300046678 Bacteria 4132
682 Ga0495623_0000054 3300046679 Bacteria 70217
683 Ga0495623_0025208 3300046679 Bacteria 3830
684 Ga0495623_0067334 3300046679 Bacteria 2235
685 Ga0495646_0000012 3300046680 Bacteria 185805
686 Ga0495646_0003182 3300046680 Bacteria 10197
687 Ga0495646_0024986 3300046680 Bacteria 3759
688 Ga0495646_0033708 3300046680 Bacteria 3183
689 Ga0495647_0001214 3300046681 Bacteria 7949
690 Ga0495647_0015891 3300046681 Bacteria 2643
691 Ga0495658_0000707 3300046683 Bacteria 18088
692 Ga0495658_0061593 3300046683 Bacteria 2154
693 Ga0495658_0163531 3300046683 Bacteria 1374
694 Ga0495669_0146084 3300046684 Bacteria 1118
695 Ga0495613_0001986 3300046689 Bacteria 15542
696 Ga0495613_0064597 3300046689 Bacteria 2676
697 Ga0495613_0067323 3300046689 Bacteria 2614
698 Ga0495613_0116928 3300046689 Bacteria 1917
699 Ga0495613_0350029 3300046689 Bacteria 1015
700 Ga0495624_0004889 3300046690 Bacteria 9730
701 Ga0495624_0049435 3300046690 Bacteria 2667
702 Ga0495670_0030236 3300046691 Bacteria 2690
703 Ga0495671_0072016 3300046692 Bacteria 1697
704 Ga0495600_0000031 3300046809 Bacteria 85535
705 Ga0495600_0017842 3300046809 Bacteria 4517
706 Ga0495600_0095483 3300046809 Bacteria 1938
707 Ga0495581_0000030 3300047315 Bacteria 53487
708 Ga0495581_0156249 3300047315 Bacteria 1333
709 Ga0495581_0197803 3300047315 Bacteria 1176
710 Ga0495581_0253545 3300047315 Bacteria 1029
711 Ga0495604_0000001 3300047317 Bacteria 708627
712 Ga0495604_0006243 3300047317 Bacteria 9452
713 Ga0495604_0071809 3300047317 Bacteria 2617
714 Ga0495604_0217284 3300047317 Bacteria 1318
715 Ga0495604_0239433 3300047317 Bacteria 1242
716 Ga0495636_0033052 3300047318 Bacteria 2123
717 Ga0495636_0119699 3300047318 Bacteria 1164
718 Ga0495674_0000012 3300047319 Bacteria 270651
719 Ga0495674_0001230 3300047319 Bacteria 24837
720 Ga0495674_0024652 3300047319 Bacteria 5522
721 Ga0495674_0085620 3300047319 Bacteria 2699
722 Ga0495674_0133635 3300047319 Bacteria 2089
723 Ga0495672_0010170 3300047320 Bacteria 6724
724 Ga0495672_0077919 3300047320 Bacteria 1856
725 Ga0495672_0078951 3300047320 Bacteria 1839
726 Ga0495672_0102901 3300047320 Bacteria 1546
727 Ga0495672_0135313 3300047320 Bacteria 1293
728 Ga0495672_0160184 3300047320 Bacteria 1158
729 Ga0495676_0063006 3300047321 Bacteria 2892
730 Ga0495676_0162663 3300047321 Bacteria 1578
731 Ga0495676_0300500 3300047321 Bacteria 1082
732 Ga0495680_0003950 3300047322 Bacteria 14337
733 Ga0495680_0015081 3300047322 Bacteria 6673
734 Ga0495680_0081343 3300047322 Bacteria 2446
735 Ga0495680_0083270 3300047322 Bacteria 2412
736 Ga0495680_0192032 3300047322 Bacteria 1469
737 Ga0495675_0005364 3300047444 Bacteria 7811
738 Ga0495675_0013920 3300047444 Bacteria 5087
739 Ga0495675_0044709 3300047444 Bacteria 2821
740 Ga0495673_0030759 3300047469 Bacteria 2519
741 Ga0495684_0000021 3300047471 Bacteria 144901
742 Ga0495684_0006597 3300047471 Bacteria 9001
743 Ga0495684_0042816 3300047471 Bacteria 3467
744 Ga0495686_0045908 3300047472 Bacteria 2763
745 Ga0495593_0000387 3300047673 Bacteria 24410
746 Ga0495593_0000470 3300047673 Bacteria 22684
747 Ga0495593_0003761 3300047673 Bacteria 9064
748 Ga0495602_0000031 3300048088 Bacteria 141518
749 Ga0495602_0096494 3300048088 Bacteria 2438
750 Ga0495602_0182433 3300048088 Bacteria 1617
751 Ga0495614_0049441 3300048089 Bacteria 1803
752 Ga0496100_0268489 3300048903 Bacteria 1268
753 Ga0496100_0404708 3300048903 Bacteria 1040
754 Ga0496100_0561996 3300048903 Bacteria 883
755 Ga0496101_0342882 3300048904 Bacteria 1174
756 Ga0496102_0097615 3300048905 Bacteria 2725
757 Ga0496102_0139695 3300048905 Bacteria 2271
758 Ga0496102_0162570 3300048905 Bacteria 2100
759 Ga0496102_0211652 3300048905 Bacteria 1827
760 Ga0496103_0077661 3300048906 Bacteria 2084
761 Ga0496104_0041991 3300048907 Bacteria 4289
762 Ga0496104_0052663 3300048907 Bacteria 3845
763 Ga0496104_0280762 3300048907 Bacteria 1578
764 Ga0496105_0062063 3300048908 Bacteria 3084
765 Ga0496105_0066881 3300048908 Bacteria 2967
766 Ga0496105_0237832 3300048908 Bacteria 1479
767 Ga0496106_0001644 3300048909 Bacteria 16771
768 Ga0496106_0001943 3300048909 Bacteria 15501
769 Ga0496106_0061971 3300048909 Bacteria 2839
770 Ga0496106_0115487 3300048909 Bacteria 2093
771 Ga0496107_0008009 3300048910 Bacteria 7293
772 Ga0496108_0000927 3300048911 Bacteria 22857
773 Ga0496108_0003076 3300048911 Bacteria 13407
774 Ga0496108_0104573 3300048911 Bacteria 2416
775 Ga0496108_0205946 3300048911 Bacteria 1707
776 Ga0496109_0000229 3300048912 Bacteria 54733
777 Ga0496109_0000404 3300048912 Bacteria 38842
778 Ga0496109_0061506 3300048912 Bacteria 3433
779 Ga0496109_0095536 3300048912 Bacteria 2752
780 Ga0496109_0104428 3300048912 Bacteria 2631
781 Ga0496110_0004921 3300048913 Bacteria 10430
782 Ga0496110_0255688 3300048913 Bacteria 1594
783 Ga0496110_0364261 3300048913 Bacteria 1317
784 Ga0496111_0001539 3300048914 Bacteria 13254
785 Ga0496111_0030535 3300048914 Bacteria 3833
786 Ga0496111_0175050 3300048914 Bacteria 1595
787 Ga0496111_0213341 3300048914 Bacteria 1434
788 Ga0496112_0000018 3300048915 Bacteria 188820
789 Ga0496112_0001343 3300048915 Bacteria 18708
790 Ga0496112_0001354 3300048915 Bacteria 18644
791 Ga0496112_0022495 3300048915 Bacteria 6008
792 Ga0496112_0074138 3300048915 Bacteria 3365
793 Ga0496112_0075729 3300048915 Bacteria 3328
794 Ga0496112_0089343 3300048915 Bacteria 3049
795 Ga0496112_0320058 3300048915 Bacteria 1495
796 Ga0496113_0001624 3300048916 Bacteria 12662
797 Ga0496113_0017066 3300048916 Bacteria 5031
798 Ga0496113_0131252 3300048916 Bacteria 1966
799 Ga0496114_0014977 3300048917 Bacteria 6234
800 Ga0496114_0274275 3300048917 Bacteria 1486
801 Ga0496115_0210589 3300048918 Bacteria 1606
802 Ga0496115_0374258 3300048918 Bacteria 1159
803 Ga0496115_0388261 3300048918 Bacteria 1134
804 Ga0496116_0009681 3300048919 Bacteria 8194
805 Ga0496117_0046301 3300048920 Bacteria 3130
806 Ga0496117_0110810 3300048920 Bacteria 1710
807 Ga0496118_0023464 3300048921 Bacteria 5357
808 Ga0496118_0108992 3300048921 Bacteria 1844
809 Ga0496118_0165108 3300048921 Bacteria 1362
810 Ga0496119_0033208 3300048922 Bacteria 3426
811 Ga0496119_0118990 3300048922 Bacteria 1455
812 Ga0496120_0040754 3300048923 Bacteria 2726
813 Ga0496121_0000278 3300048924 Bacteria 106838
814 Ga0496121_0000654 3300048924 Bacteria 64945
815 Ga0496121_0001257 3300048924 Bacteria 43906
816 Ga0496121_0004075 3300048924 Bacteria 20070
817 Ga0496121_0010674 3300048924 Bacteria 10312
818 Ga0496121_0025719 3300048924 Bacteria 5575
819 Ga0496121_0055934 3300048924 Bacteria 3282
820 Ga0496121_0076724 3300048924 Bacteria 2664
821 Ga0496121_0089434 3300048924 Bacteria 2410
822 Ga0496121_0145334 3300048924 Bacteria 1753
823 Ga0496121_0186152 3300048924 Bacteria 1493
824 Ga0496122_0058926 3300048925 Bacteria 2838
825 Ga0496122_0063658 3300048925 Bacteria 2689
826 Ga0496124_0053161 3300048927 Bacteria 3436
827 Ga0496124_0251121 3300048927 Bacteria 1308
828 Ga0496125_0000869 3300048928 Bacteria 48286
829 Ga0496125_0003929 3300048928 Bacteria 17533
830 Ga0496125_0009814 3300048928 Bacteria 9755
831 Ga0496125_0033842 3300048928 Bacteria 4514
832 Ga0496125_0055518 3300048928 Bacteria 3226
833 Ga0496125_0075698 3300048928 Bacteria 2603
834 Ga0496126_0005056 3300048929 Bacteria 15313
835 Ga0496126_0013259 3300048929 Bacteria 8398
836 Ga0496126_0021739 3300048929 Bacteria 6258
837 Ga0496126_0039419 3300048929 Bacteria 4384
838 Ga0496126_0065601 3300048929 Bacteria 3248
839 Ga0496126_0127720 3300048929 Bacteria 2199
840 Ga0496126_0137045 3300048929 Bacteria 2110
841 Ga0496126_0476798 3300048929 Bacteria 1000
842 Ga0501031_0000207 3300049568 Bacteria 33573
843 Ga0501031_0000674 3300049568 Bacteria 20357
844 Ga0501031_0042550 3300049568 Bacteria 2964
845 Ga0501031_0174922 3300049568 Bacteria 1402
846 Ga0501032_0000252 3300049569 Bacteria 44619
847 Ga0501032_0002975 3300049569 Bacteria 13153
848 Ga0501032_0004147 3300049569 Bacteria 10979
849 Ga0501032_0175449 3300049569 Bacteria 1404
850 Ga0501032_0210542 3300049569 Bacteria 1267
851 Ga0501032_0228662 3300049569 Bacteria 1209
852 Ga0501033_0000082 3300049570 Bacteria 89837
853 Ga0501033_0006748 3300049570 Bacteria 8965
854 Ga0501033_0056363 3300049570 Bacteria 2904
855 Ga0501033_0059881 3300049570 Bacteria 2811
856 Ga0501033_0174315 3300049570 Bacteria 1544
857 Ga0501033_0243491 3300049570 Bacteria 1275
858 Ga0501034_0000198 3300049571 Bacteria 113672
859 Ga0501034_0066295 3300049571 Bacteria 3623
860 Ga0501034_0069806 3300049571 Bacteria 3524
861 Ga0501034_0076480 3300049571 Bacteria 3354
862 Ga0501034_0137996 3300049571 Bacteria 2419
863 Ga0501034_0166621 3300049571 Bacteria 2172
864 Ga0501034_0331406 3300049571 Bacteria 1453
865 Ga0501034_0370474 3300049571 Bacteria 1358
866 Ga0501034_0376168 3300049571 Bacteria 1346
867 Ga0501034_0473470 3300049571 Bacteria 1168
868 Ga0501036_0001281 3300049572 Bacteria 19291
869 Ga0501036_0041485 3300049572 Bacteria 3893
870 Ga0501036_0070087 3300049572 Bacteria 2964
871 Ga0501036_0089653 3300049572 Bacteria 2598
872 Ga0501036_0153984 3300049572 Bacteria 1939
873 Ga0501036_0296825 3300049572 Bacteria 1352
874 Ga0501037_0000050 3300049573 Bacteria 112824
875 Ga0501037_0001896 3300049573 Bacteria 15199
876 Ga0501037_0013075 3300049573 Bacteria 6119
877 Ga0501037_0065242 3300049573 Bacteria 2652
878 Ga0501037_0126416 3300049573 Bacteria 1835
879 Ga0501037_0210375 3300049573 Bacteria 1372
880 Ga0501038_0000538 3300049574 Bacteria 33271
881 Ga0501038_0000630 3300049574 Bacteria 31329
882 Ga0501038_0021325 3300049574 Bacteria 5815
883 Ga0501038_0069455 3300049574 Bacteria 2992
884 Ga0501038_0108190 3300049574 Bacteria 2305
885 Ga0501038_0184478 3300049574 Bacteria 1682
886 Ga0501039_0000366 3300049575 Bacteria 32333
887 Ga0501039_0042730 3300049575 Bacteria 3501
888 Ga0501039_0207574 3300049575 Bacteria 1540
889 Ga0501039_0209073 3300049575 Bacteria 1534
890 Ga0501041_0105409 3300049577 Bacteria 1747
891 Ga0501042_0017539 3300049578 Bacteria 4939
892 Ga0501042_0042451 3300049578 Bacteria 3237
893 Ga0501043_0002344 3300049579 Bacteria 16056
894 Ga0501043_0003664 3300049579 Bacteria 12616
895 Ga0501043_0061870 3300049579 Bacteria 2939
896 Ga0501043_0087805 3300049579 Bacteria 2443
897 Ga0501043_0143520 3300049579 Bacteria 1869
898 Ga0501043_0217731 3300049579 Bacteria 1478
899 Ga0501046_0000434 3300049580 Bacteria 41950
900 Ga0501046_0030471 3300049580 Bacteria 4378
901 Ga0501046_0049305 3300049580 Bacteria 3331
902 Ga0501046_0410447 3300049580 Bacteria 977
903 Ga0501047_0000131 3300049581 Bacteria 91079
904 Ga0501047_0054290 3300049581 Bacteria 3875
905 Ga0501047_0092774 3300049581 Bacteria 2898
906 Ga0501047_0095805 3300049581 Bacteria 2846
907 Ga0501047_0183102 3300049581 Bacteria 1961
908 Ga0501047_0268941 3300049581 Bacteria 1551
909 Ga0501047_0399434 3300049581 Bacteria 1207
910 Ga0501047_0510484 3300049581 Bacteria 1028
911 Ga0501048_0000531 3300049582 Bacteria 26809
912 Ga0501048_0020580 3300049582 Bacteria 4835
913 Ga0501067_0000628 3300049583 Bacteria 18974
914 Ga0501067_0001606 3300049583 Bacteria 12379
915 Ga0501067_0004783 3300049583 Bacteria 7508
916 Ga0501067_0048760 3300049583 Bacteria 2349
917 Ga0501067_0422368 3300049583 Bacteria 744
918 Ga0501068_0011209 3300049584 Bacteria 5054
919 Ga0501069_0001211 3300049585 Bacteria 12577
920 Ga0501069_0256429 3300049585 Bacteria 1021
921 Ga0501070_0005971 3300049586 Bacteria 10376
922 Ga0501070_0039960 3300049586 Bacteria 3912
923 Ga0501070_0117589 3300049586 Bacteria 2196
924 Ga0501070_0260973 3300049586 Bacteria 1416
925 Ga0501070_0473042 3300049586 Bacteria 1009
926 Ga0501071_0051598 3300049587 Bacteria 2965
927 Ga0501072_0000378 3300049588 Bacteria 31856
928 Ga0501072_0203018 3300049588 Bacteria 1580
929 Ga0501073_0029767 3300049589 Bacteria 3902
930 Ga0501073_0095171 3300049589 Bacteria 2069
931 Ga0501073_0103023 3300049589 Bacteria 1981
932 Ga0501074_0003814 3300049590 Bacteria 10720
933 Ga0501074_0018155 3300049590 Bacteria 5109
934 Ga0501074_0018479 3300049590 Bacteria 5065
935 Ga0501074_0070660 3300049590 Bacteria 2510
936 Ga0501074_0231359 3300049590 Bacteria 1316
937 Ga0501075_0103633 3300049591 Bacteria 2162
938 Ga0501076_0015425 3300049592 Bacteria 5773
939 Ga0501077_0015351 3300049593 Bacteria 4822
940 Ga0501077_0134539 3300049593 Bacteria 1568
941 Ga0501079_0001399 3300049741 Bacteria 17010
942 Ga0501079_0003847 3300049741 Bacteria 11077
943 Ga0501080_0009398 3300049742 Bacteria 8917
944 Ga0501080_0064626 3300049742 Bacteria 3403
945 Ga0501081_0001105 3300049743 Bacteria 16197
946 Ga0501083_0000341 3300049744 Bacteria 29641
947 Ga0501083_0060526 3300049744 Bacteria 2529
948 Ga0501035_0000123 3300049822 Bacteria 93734
949 Ga0501035_0005862 3300049822 Bacteria 11577
950 Ga0501035_0093321 3300049822 Bacteria 2648
951 Ga0501035_0173882 3300049822 Bacteria 1859
952 Ga0501035_0180926 3300049822 Bacteria 1816
953 Ga0501035_0206075 3300049822 Bacteria 1684
954 Ga0501044_0000100 3300049823 Bacteria 106729
955 Ga0501044_0039767 3300049823 Bacteria 4904
956 Ga0501044_0113578 3300049823 Bacteria 2715
957 Ga0501044_0195559 3300049823 Bacteria 1983
958 Ga0501044_0214949 3300049823 Bacteria 1875
959 Ga0501044_0253318 3300049823 Bacteria 1701
960 Ga0501044_0281237 3300049823 Bacteria 1597
961 Ga0501045_0009959 3300049824 Bacteria 6649
962 Ga0501045_0022359 3300049824 Bacteria 4528
963 Ga0501045_0022970 3300049824 Bacteria 4470
964 nmdc:mga00v17_257025_c1 3300050491 Bacteria 1133
965 nmdc:mga00v17_63096_c1 3300050491 Bacteria 2281
966 nmdc:mga00v17_90644_c1 3300050491 Bacteria 1920
967 nmdc:mga0yw44_153826_c1 3300050492 Bacteria 1502
968 nmdc:mga0yw44_66131_c1 3300050492 Bacteria 2230
969 nmdc:mga0yw44_73561_c1 3300050492 Bacteria 2126
970 nmdc:mga0k408_130449_c1 3300050493 Bacteria 1492
971 nmdc:mga0k408_63841_c2 3300050493 Bacteria 1500
972 nmdc:mga06z11_177617_c1 3300050494 Bacteria 1226
973 nmdc:mga06z11_3772_c1 3300050494 Bacteria 5895
974 nmdc:mga04h51_11839_c1 3300050495 Bacteria 2433
975 nmdc:mga04h51_42469_c1 3300050495 Bacteria 1491
976 nmdc:mga07m45_119498_c1 3300050496 Bacteria 1522
977 nmdc:mga07m45_143090_c1 3300050496 Bacteria 1385
978 nmdc:mga07m45_215146_c1 3300050496 Bacteria 1118
979 nmdc:mga07m45_3103_c1 3300050496 Bacteria 7739
980 nmdc:mga05p37_255873_c1 3300050507 Bacteria 2098
981 nmdc:mga05p37_427_c1 3300050507 Bacteria 45535
982 nmdc:mga05p37_6551_c1 3300050507 Bacteria 13728
983 nmdc:mga09592_248881_c1 3300050508 Bacteria 1540
984 nmdc:mga09592_2873_c1 3300050508 Bacteria 13959
985 nmdc:mga0qj67_124283_c1 3300050509 Bacteria 2088
986 nmdc:mga0qj67_460427_c1 3300050509 Bacteria 1024
987 nmdc:mga0qj67_51727_c2 3300050509 Bacteria 2120
988 nmdc:mga06r32_109361_c1 3300050510 Bacteria 2718
989 nmdc:mga06r32_2417_c1 3300050510 Bacteria 16706
990 nmdc:mga06r32_306343_c1 3300050510 Bacteria 1574
991 nmdc:mga06r32_6619_c1 3300050510 Bacteria 10413
992 nmdc:mga08y16_102725_c1 3300050511 Bacteria 2976
993 nmdc:mga08y16_199419_c1 3300050511 Bacteria 2074
994 nmdc:mga08y16_263247_c1 3300050511 Bacteria 1781
995 nmdc:mga08y16_42067_c1 3300050511 Bacteria 4785
996 nmdc:mga08y16_90_c1 3300050511 Bacteria 76458
997 nmdc:mga0n895_131467_c1 3300050512 Bacteria 2528
998 nmdc:mga0n895_399422_c1 3300050512 Bacteria 1390
999 nmdc:mga0rr50_195263_c1 3300050513 Bacteria 1661
1000 nmdc:mga0rr50_41439_c1 3300050513 Bacteria 3355
1001 nmdc:mga0rr50_42984_c1 3300050513 Bacteria 3303
1002 nmdc:mga0rr50_99236_c1 3300050513 Bacteria 2284
1003 nmdc:mga08x19_105709_c1 3300050514 Bacteria 1872
1004 nmdc:mga0a205_30941_c1 3300050515 Bacteria 5127
1005 nmdc:mga0a205_3895_c1 3300050515 Bacteria 13360
1006 nmdc:mga0sz30_19967_c1 3300050516 Bacteria 2699
1007 Ga0495601_0000011 3300053077 Bacteria 264937
1008 Ga0495601_0000392 3300053077 Bacteria 23195
1009 Ga0495601_0004077 3300053077 Bacteria 8426
1010 Ga0495601_0006579 3300053077 Bacteria 6798
1011 Ga0495601_0026481 3300053077 Bacteria 3581
1012 Ga0495601_0098431 3300053077 Bacteria 1888
1013 Ga0495612_0000006 3300053078 Bacteria 269278
1014 Ga0495612_0008409 3300053078 Bacteria 4186
1015 Ga0495612_0037724 3300053078 Bacteria 1963
1016 Ga0495612_0062897 3300053078 Bacteria 1539
1017 Ga0500635_0004048 3300053080 Bacteria 3744
1018 Ga0500635_0067662 3300053080 Bacteria 1260
1019 Ga0495655_0058021 3300053083 Bacteria 1047
1020 Ga0495595_0000021 3300053084 Bacteria 115921
1021 Ga0495595_0006005 3300053084 Bacteria 4932
1022 Ga0495595_0020342 3300053084 Bacteria 2888
1023 Ga0495595_0170332 3300053084 Bacteria 1077
1024 Ga0495619_0000013 3300053085 Bacteria 264865
1025 Ga0495619_0017632 3300053085 Bacteria 4523
1026 Ga0495619_0028554 3300053085 Bacteria 3599
1027 Ga0495619_0055926 3300053085 Bacteria 2615
1028 Ga0495619_0113072 3300053085 Bacteria 1856
1029 Ga0500646_0087203 3300053090 Bacteria 961
1030 Ga0500583_0100611 3300053092 Bacteria 1415
1031 Ga0500651_0069761 3300053093 Bacteria 2188
1032 Ga0500651_0128499 3300053093 Bacteria 1534
1033 Ga0500566_0000107 3300053094 Bacteria 42130
1034 Ga0500566_0006857 3300053094 Bacteria 6745
1035 Ga0500566_0016736 3300053094 Bacteria 4304
1036 Ga0500566_0088729 3300053094 Bacteria 1711
1037 Ga0500650_0050150 3300053098 Bacteria 1937
1038 Ga0500650_0146655 3300053098 Bacteria 1093
1039 Ga0500554_005159 3300053102 Bacteria 2824
1040 Ga0500555_057288 3300053103 Bacteria 1055
1041 Ga0500569_001078 3300053109 Bacteria 4973
1042 Ga0500595_001968 3300053119 Bacteria 10552
1043 Ga0500595_002686 3300053119 Bacteria 8636
1044 Ga0500595_007413 3300053119 Bacteria 4553
1045 Ga0500595_019639 3300053119 Bacteria 2449
1046 Ga0500595_026838 3300053119 Bacteria 1979
1047 Ga0500595_041070 3300053119 Bacteria 1488
1048 Ga0500595_042387 3300053119 Bacteria 1456
1049 Ga0500607_069800 3300053121 Bacteria 1817
1050 Ga0500608_000949 3300053122 Bacteria 10352
1051 Ga0500618_005453 3300053125 Bacteria 3865
1052 Ga0500642_0000042 3300053130 Bacteria 86476
1053 Ga0500642_0058519 3300053130 Bacteria 1723
1054 Ga0500559_0000106 3300053136 Bacteria 65670
1055 Ga0500559_0040338 3300053136 Bacteria 2032
1056 Ga0500559_0138116 3300053136 Bacteria 1140
1057 Ga0500559_0172991 3300053136 Bacteria 1016
1058 Ga0500568_0139346 3300053139 Bacteria 899
1059 Ga0500577_0009194 3300053142 Bacteria 2858
1060 Ga0500577_0150528 3300053142 Bacteria 987
1061 Ga0500588_0100585 3300053146 Bacteria 996
1062 Ga0500589_079745 3300053147 Bacteria 1464
1063 Ga0500590_026483 3300053148 Bacteria 3008
1064 Ga0500590_054115 3300053148 Bacteria 2033
1065 Ga0500603_013476 3300053150 Bacteria 1896
1066 Ga0500604_0019202 3300053151 Bacteria 1911
1067 Ga0500604_0044976 3300053151 Bacteria 1346
1068 Ga0500616_0000227 3300053153 Bacteria 88098
1069 Ga0500630_049983 3300053159 Bacteria 2023
1070 Ga0500633_0138491 3300053160 Bacteria 910
1071 Ga0500638_002787 3300053162 Bacteria 6242
1072 Ga0500638_140299 3300053162 Bacteria 1086
1073 Ga0500636_0236835 3300053177 Bacteria 940
1074 Ga0500637_0000180 3300053178 Bacteria 23612
1075 Ga0500637_0011782 3300053178 Bacteria 4534
1076 Ga0500637_0052147 3300053178 Bacteria 2332
1077 Ga0500645_047381 3300053730 Bacteria 1260
1078 Ga0500609_007813 3300053731 Bacteria 1444
1079 Ga0501084_0003563 3300054114 Bacteria 12638
1080 Ga0501084_0019061 3300054114 Bacteria 5714
1081 Ga0501084_0135809 3300054114 Bacteria 2070
1082 Ga0501082_0001776 3300060353 Bacteria 18967
1083 Ga0501082_0014075 3300060353 Bacteria 6880
1084 Ga0501082_0022020 3300060353 Bacteria 5495
1085 Ga0466962_0034341 3300061719 Bacteria 2428
1086 Ga0530510_0151565 3300061734 Bacteria 1712

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049583 Ga0501067_0422368 Ga0501067_0422368_10_729 230
2 3300046460 Ga0495638_0145578 Ga0495638_0145578_16_738 231
3 3300035242 Ga0373962_0127877 Ga0373962_0127877_51_803 240
4 3300049581 Ga0501047_0510484 Ga0501047_0510484_223_1008 252
5 3300009147 Ga0114129_10293883 Ga0114129_102938832 264
6 3300048908 Ga0496105_0237832 Ga0496105_0237832_351_1229 264
7 3300048911 Ga0496108_0205946 Ga0496108_0205946_468_1346 264
8 3300048917 Ga0496114_0014977 Ga0496114_0014977_2337_3215 264
9 3300050510 nmdc:mga06r32_6619_c1 nmdc:mga06r32_6619_c1_465_1310 265
10 3300006871 Ga0075434_100028319 Ga0075434_1000283193 266
11 3300048929 Ga0496126_0127720 Ga0496126_0127720_23_850 267
12 3300050509 nmdc:mga0qj67_124283_c1 nmdc:mga0qj67_124283_c1_1215_2060 267
13 3300046461 Ga0495641_0112770 Ga0495641_0112770_356_1201 268
14 3300049571 Ga0501034_0166621 Ga0501034_0166621_1223_2059 268
15 3300049571 Ga0501034_0376168 Ga0501034_0376168_31_867 268
16 3300049583 Ga0501067_0001606 Ga0501067_0001606_8035_8874 268
17 3300049589 Ga0501073_0095171 Ga0501073_0095171_550_1389 268
18 3300049823 Ga0501044_0195559 Ga0501044_0195559_848_1684 268
19 3300050509 nmdc:mga0qj67_460427_c1 nmdc:mga0qj67_460427_c1_159_1004 268
20 3300005471 Ga0070698_100321192 Ga0070698_1003211922 269
21 3300049580 Ga0501046_0410447 Ga0501046_0410447_32_883 269
22 3300053094 Ga0500566_0088729 Ga0500566_0088729_25_858 269
23 iso_pu_bacteria 2523231067 2523468649 269
24 iso_pu_bacteria 2738543031 2739349855 269
25 3300035398 Ga0316574_0014984 Ga0316574_0014984_3423_4307 271
26 3300036712 Ga0316584_0034275 Ga0316584_0034275_1292_2176 271
27 3300046471 Ga0495650_0113452 Ga0495650_0113452_139_978 271
28 3300046660 Ga0495625_0206843 Ga0495625_0206843_425_1264 271
29 3300047321 Ga0495676_0162663 Ga0495676_0162663_12_851 271
30 3300048903 Ga0496100_0561996 Ga0496100_0561996_14_853 271
31 3300048929 Ga0496126_0137045 Ga0496126_0137045_1239_2078 271
32 3300049571 Ga0501034_0473470 Ga0501034_0473470_312_1151 271
33 3300050491 nmdc:mga00v17_257025_c1 nmdc:mga00v17_257025_c1_15_857 271
34 3300050492 nmdc:mga0yw44_73561_c1 nmdc:mga0yw44_73561_c1_1266_2105 271
35 3300053084 Ga0495595_0170332 Ga0495595_0170332_214_1053 271
36 3300005617 Ga0068859_100379973 Ga0068859_1003799732 272
37 3300005719 Ga0068861_100037920 Ga0068861_1000379203 272
38 3300005844 Ga0068862_100040785 Ga0068862_1000407854 272
39 3300006163 Ga0070715_10009900 Ga0070715_100099003 272
40 3300006178 Ga0075367_10005424 Ga0075367_100054243 272
41 3300006847 Ga0075431_100266627 Ga0075431_1002666272 272
42 3300006871 Ga0075434_100056552 Ga0075434_1000565521 272
43 3300006931 Ga0097620_100379954 Ga0097620_1003799542 272
44 3300007076 Ga0075435_100518438 Ga0075435_1005184381 272
45 3300007788 Ga0099795_10080197 Ga0099795_100801972 272
46 3300009094 Ga0111539_10246033 Ga0111539_102460332 272
47 3300009147 Ga0114129_10126694 Ga0114129_101266944 272
48 3300014326 Ga0157380_10382047 Ga0157380_103820471 272
49 3300025905 Ga0207685_10009621 Ga0207685_100096212 272
50 3300025925 Ga0207650_10002929 Ga0207650_1000292913 272
51 3300026075 Ga0207708_10419736 Ga0207708_104197361 272
52 3300026118 Ga0207675_100044501 Ga0207675_1000445012 272
53 3300048089 Ga0495614_0049441 Ga0495614_0049441_119_997 272
54 3300048903 Ga0496100_0404708 Ga0496100_0404708_50_904 272
55 3300048905 Ga0496102_0211652 Ga0496102_0211652_605_1483 272
56 3300048906 Ga0496103_0077661 Ga0496103_0077661_1138_2016 272
57 3300048907 Ga0496104_0280762 Ga0496104_0280762_260_1138 272
58 3300048908 Ga0496105_0062063 Ga0496105_0062063_1272_2150 272
59 3300048909 Ga0496106_0115487 Ga0496106_0115487_850_1728 272
60 3300048911 Ga0496108_0003076 Ga0496108_0003076_96_974 272
61 3300048912 Ga0496109_0000404 Ga0496109_0000404_35972_36850 272
62 3300048912 Ga0496109_0061506 Ga0496109_0061506_739_1590 272
63 3300048913 Ga0496110_0255688 Ga0496110_0255688_68_946 272
64 3300048914 Ga0496111_0001539 Ga0496111_0001539_11472_12350 272
65 3300048915 Ga0496112_0001354 Ga0496112_0001354_16465_17343 272
66 3300048916 Ga0496113_0001624 Ga0496113_0001624_1974_2852 272
67 3300048916 Ga0496113_0131252 Ga0496113_0131252_892_1743 272
68 3300049573 Ga0501037_0210375 Ga0501037_0210375_266_1147 272
69 3300049583 Ga0501067_0048760 Ga0501067_0048760_1427_2284 272
70 3300049586 Ga0501070_0117589 Ga0501070_0117589_706_1587 272
71 3300050492 nmdc:mga0yw44_66131_c1 nmdc:mga0yw44_66131_c1_69_920 272
72 3300050494 nmdc:mga06z11_3772_c1 nmdc:mga06z11_3772_c1_4815_5666 272
73 3300050507 nmdc:mga05p37_255873_c1 nmdc:mga05p37_255873_c1_565_1443 272
74 3300050508 nmdc:mga09592_248881_c1 nmdc:mga09592_248881_c1_310_1188 272
75 3300003659 JGI25404J52841_10008798 JGI25404J52841_100087982 273
76 3300005341 Ga0070691_10003421 Ga0070691_100034213 273
77 3300005441 Ga0070700_100017526 Ga0070700_1000175262 273
78 3300005455 Ga0070663_100361217 Ga0070663_1003612171 273
79 3300005545 Ga0070695_100120591 Ga0070695_1001205912 273
80 3300005719 Ga0068861_100052285 Ga0068861_1000522852 273
81 3300005937 Ga0081455_10000209 Ga0081455_1000020946 273
82 3300005983 Ga0081540_1000064 Ga0081540_100006422 273
83 3300006051 Ga0075364_10057410 Ga0075364_100574102 273
84 3300006178 Ga0075367_10110837 Ga0075367_101108372 273
85 3300006844 Ga0075428_100128112 Ga0075428_1001281121 273
86 3300006852 Ga0075433_10045558 Ga0075433_100455582 273
87 3300006871 Ga0075434_100072031 Ga0075434_1000720312 273
88 3300009094 Ga0111539_10254754 Ga0111539_102547541 273
89 3300009094 Ga0111539_10311410 Ga0111539_103114102 273
90 3300026067 Ga0207678_10304985 Ga0207678_103049852 273
91 3300026118 Ga0207675_100175437 Ga0207675_1001754372 273
92 3300027866 Ga0209813_10013142 Ga0209813_100131422 273
93 3300035090 Ga0373949_0007155 Ga0373949_0007155_1183_2037 273
94 3300035121 Ga0373960_0011395 Ga0373960_0011395_443_1297 273
95 3300035241 Ga0373961_0002623 Ga0373961_0002623_496_1350 273
96 3300035691 Ga0373931_0002391 Ga0373931_0002391_5904_6758 273
97 3300046491 Ga0495584_0130516 Ga0495584_0130516_194_1066 273
98 3300049570 Ga0501033_0174315 Ga0501033_0174315_178_1056 273
99 3300049571 Ga0501034_0331406 Ga0501034_0331406_361_1239 273
100 3300049579 Ga0501043_0143520 Ga0501043_0143520_568_1479 273
101 3300049581 Ga0501047_0054290 Ga0501047_0054290_268_1146 273
102 3300049586 Ga0501070_0473042 Ga0501070_0473042_15_926 273
103 3300049823 Ga0501044_0281237 Ga0501044_0281237_602_1480 273
104 3300050491 nmdc:mga00v17_90644_c1 nmdc:mga00v17_90644_c1_234_1085 273
105 3300050511 nmdc:mga08y16_102725_c1 nmdc:mga08y16_102725_c1_1980_2852 273
106 3300050512 nmdc:mga0n895_131467_c1 nmdc:mga0n895_131467_c1_1288_2160 273
107 3300050515 nmdc:mga0a205_30941_c1 nmdc:mga0a205_30941_c1_1307_2179 273
108 3300005434 Ga0070709_10014835 Ga0070709_100148354 274
109 3300005435 Ga0070714_100011934 Ga0070714_1000119344 274
110 3300005436 Ga0070713_100016739 Ga0070713_1000167394 274
111 3300005437 Ga0070710_10003996 Ga0070710_100039961 274
112 3300005439 Ga0070711_100102931 Ga0070711_1001029311 274
113 3300005937 Ga0081455_10109474 Ga0081455_101094742 274
114 3300006028 Ga0070717_10041403 Ga0070717_100414031 274
115 3300006163 Ga0070715_10000275 Ga0070715_100002755 274
116 3300006173 Ga0070716_100007369 Ga0070716_1000073691 274
117 3300006175 Ga0070712_100146083 Ga0070712_1001460832 274
118 3300006847 Ga0075431_100001629 Ga0075431_10000162911 274
119 3300025905 Ga0207685_10023455 Ga0207685_100234552 274
120 3300025915 Ga0207693_10001168 Ga0207693_1000116811 274
121 3300025916 Ga0207663_10004750 Ga0207663_100047503 274
122 3300025928 Ga0207700_10092831 Ga0207700_100928312 274
123 3300025929 Ga0207664_10146411 Ga0207664_101464112 274
124 3300025939 Ga0207665_10000883 Ga0207665_100008835 274
125 3300037068 Ga0373925_0079834 Ga0373925_0079834_1311_2207 274
126 3300039437 Ga0436365_0992472 Ga0436365_0992472_2874_3758 274
127 3300039447 Ga0436361_0416951 Ga0436361_0416951_947_1825 274
128 3300046531 Ga0495665_0095389 Ga0495665_0095389_434_1330 274
129 3300046683 Ga0495658_0061593 Ga0495658_0061593_386_1282 274
130 3300047315 Ga0495581_0156249 Ga0495581_0156249_73_969 274
131 iso_pu_bacteria 2671180139 2671694952 274
132 3300005337 Ga0070682_100001898 Ga0070682_1000018983 275
133 3300005341 Ga0070691_10038245 Ga0070691_100382452 275
134 3300005458 Ga0070681_10002937 Ga0070681_100029374 275
135 3300005530 Ga0070679_100003447 Ga0070679_10000344713 275
136 3300005539 Ga0068853_100000639 Ga0068853_1000006398 275
137 3300005547 Ga0070693_100034913 Ga0070693_1000349132 275
138 3300005563 Ga0068855_100030888 Ga0068855_1000308882 275
139 3300005577 Ga0068857_100037870 Ga0068857_1000378703 275
140 3300006852 Ga0075433_10004977 Ga0075433_100049775 275
141 3300006871 Ga0075434_100040930 Ga0075434_1000409303 275
142 3300007076 Ga0075435_100076669 Ga0075435_1000766692 275
143 3300009094 Ga0111539_10066626 Ga0111539_100666263 275
144 3300013100 Ga0157373_10131755 Ga0157373_101317552 275
145 3300013104 Ga0157370_10008510 Ga0157370_100085108 275
146 3300025912 Ga0207707_10008266 Ga0207707_100082663 275
147 3300025917 Ga0207660_10015897 Ga0207660_100158973 275
148 3300025921 Ga0207652_10007807 Ga0207652_1000780710 275
149 3300025949 Ga0207667_10178423 Ga0207667_101784232 275
150 3300026041 Ga0207639_10016223 Ga0207639_100162232 275
151 3300026116 Ga0207674_10079008 Ga0207674_100790083 275
152 3300035088 Ga0373940_0003839 Ga0373940_0003839_1485_2339 275
153 3300035115 Ga0373941_0009142 Ga0373941_0009142_470_1324 275
154 3300035121 Ga0373960_0001356 Ga0373960_0001356_3473_4327 275
155 3300035691 Ga0373931_0029681 Ga0373931_0029681_618_1472 275
156 3300036712 Ga0316584_0012076 Ga0316584_0012076_1603_2478 275
157 3300050511 nmdc:mga08y16_263247_c1 nmdc:mga08y16_263247_c1_493_1347 275
158 3300050513 nmdc:mga0rr50_41439_c1 nmdc:mga0rr50_41439_c1_1045_1899 275
159 3300050515 nmdc:mga0a205_3895_c1 nmdc:mga0a205_3895_c1_9054_9908 275
160 3300005436 Ga0070713_100020074 Ga0070713_1000200744 276
161 3300005439 Ga0070711_100072636 Ga0070711_1000726362 276
162 3300005439 Ga0070711_100179985 Ga0070711_1001799852 276
163 3300005467 Ga0070706_100082929 Ga0070706_1000829292 276
164 3300005564 Ga0070664_100227804 Ga0070664_1002278042 276
165 3300006028 Ga0070717_10016786 Ga0070717_100167862 276
166 3300006173 Ga0070716_100218767 Ga0070716_1002187671 276
167 3300006175 Ga0070712_100065297 Ga0070712_1000652972 276
168 3300009147 Ga0114129_10092485 Ga0114129_100924853 276
169 3300014325 Ga0163163_10220639 Ga0163163_102206392 276
170 3300025910 Ga0207684_10051004 Ga0207684_100510043 276
171 3300025915 Ga0207693_10187477 Ga0207693_101874771 276
172 3300025916 Ga0207663_10294081 Ga0207663_102940812 276
173 3300025928 Ga0207700_10036983 Ga0207700_100369832 276
174 3300025939 Ga0207665_10363057 Ga0207665_103630571 276
175 3300026078 Ga0207702_10055681 Ga0207702_100556813 276
176 3300028556 Ga0265337_1001354 Ga0265337_100135410 276
177 3300031249 Ga0265339_10000738 Ga0265339_1000073821 276
178 3300035086 Ga0373934_0065091 Ga0373934_0065091_112_984 276
179 3300035111 Ga0373923_0038708 Ga0373923_0038708_732_1604 276
180 3300035113 Ga0373936_0003919 Ga0373936_0003919_1597_2469 276
181 3300035113 Ga0373936_0028148 Ga0373936_0028148_1101_1973 276
182 3300035170 Ga0373943_0005484 Ga0373943_0005484_3869_4741 276
183 3300035171 Ga0373946_0002063 Ga0373946_0002063_1925_2797 276
184 3300035172 Ga0373955_0000224 Ga0373955_0000224_1781_2653 276
185 3300035410 Ga0373924_0011255 Ga0373924_0011255_1560_2432 276
186 3300035692 Ga0373935_0000011 Ga0373935_0000011_54330_55202 276
187 3300035695 Ga0373927_0004599 Ga0373927_0004599_6339_7211 276
188 3300035695 Ga0373927_0201880 Ga0373927_0201880_137_1009 276
189 3300035724 Ga0373933_0009041 Ga0373933_0009041_4349_5221 276
190 3300036401 Ga0373937_0000019 Ga0373937_0000019_98580_99452 276
191 3300037068 Ga0373925_0000026 Ga0373925_0000026_146859_147731 276
192 3300039447 Ga0436361_0642711 Ga0436361_0642711_369_1247 276
193 3300046454 Ga0495592_0000017 Ga0495592_0000017_47787_48659 276
194 3300046454 Ga0495592_0260135 Ga0495592_0260135_104_976 276
195 3300046455 Ga0495603_0045407 Ga0495603_0045407_1455_2327 276
196 3300046459 Ga0495629_0002872 Ga0495629_0002872_5952_6824 276
197 3300046462 Ga0495651_0000923 Ga0495651_0000923_3549_4421 276
198 3300046463 Ga0495653_0000033 Ga0495653_0000033_83584_84456 276
199 3300046476 Ga0495662_0014466 Ga0495662_0014466_628_1500 276
200 3300046477 Ga0495664_0000008 Ga0495664_0000008_146865_147737 276
201 3300046511 Ga0495608_0000014 Ga0495608_0000014_83592_84464 276
202 3300046514 Ga0495618_0000013 Ga0495618_0000013_31344_32216 276
203 3300046516 Ga0495628_0000008 Ga0495628_0000008_146850_147722 276
204 3300046517 Ga0495630_0000797 Ga0495630_0000797_17424_18296 276
205 3300046517 Ga0495630_0096430 Ga0495630_0096430_190_1062 276
206 3300046529 Ga0495652_0000005 Ga0495652_0000005_146865_147737 276
207 3300046531 Ga0495665_0071946 Ga0495665_0071946_394_1266 276
208 3300046533 Ga0495640_0000017 Ga0495640_0000017_39230_40102 276
209 3300046533 Ga0495640_0011467 Ga0495640_0011467_237_1109 276
210 3300046536 Ga0495587_0000005 Ga0495587_0000005_210662_211534 276
211 3300046543 Ga0495645_0000007 Ga0495645_0000007_188808_189680 276
212 3300046559 Ga0495667_0000012 Ga0495667_0000012_136498_137370 276
213 3300046642 Ga0495634_0000070 Ga0495634_0000070_30362_31234 276
214 3300046642 Ga0495634_0035544 Ga0495634_0035544_2209_3081 276
215 3300046663 Ga0495635_0000010 Ga0495635_0000010_83618_84490 276
216 3300046675 Ga0495657_0000178 Ga0495657_0000178_9192_10064 276
217 3300046678 Ga0495599_0000015 Ga0495599_0000015_147079_147951 276
218 3300046679 Ga0495623_0000054 Ga0495623_0000054_46638_47510 276
219 3300046680 Ga0495646_0000012 Ga0495646_0000012_48436_49308 276
220 3300046683 Ga0495658_0163531 Ga0495658_0163531_409_1281 276
221 3300046689 Ga0495613_0116928 Ga0495613_0116928_610_1482 276
222 3300046690 Ga0495624_0049435 Ga0495624_0049435_1111_1983 276
223 3300046809 Ga0495600_0000031 Ga0495600_0000031_47217_48089 276
224 3300047317 Ga0495604_0000001 Ga0495604_0000001_136499_137371 276
225 3300047319 Ga0495674_0000012 Ga0495674_0000012_171230_172102 276
226 3300047319 Ga0495674_0024652 Ga0495674_0024652_1516_2388 276
227 3300047322 Ga0495680_0003950 Ga0495680_0003950_174_1046 276
228 3300047444 Ga0495675_0013920 Ga0495675_0013920_2894_3766 276
229 3300047471 Ga0495684_0000021 Ga0495684_0000021_7390_8262 276
230 3300047673 Ga0495593_0000387 Ga0495593_0000387_6544_7416 276
231 3300048088 Ga0495602_0000031 Ga0495602_0000031_136628_137500 276
232 3300048905 Ga0496102_0162570 Ga0496102_0162570_44_916 276
233 3300048912 Ga0496109_0095536 Ga0496109_0095536_1857_2723 276
234 3300048914 Ga0496111_0030535 Ga0496111_0030535_237_1100 276
235 3300048914 Ga0496111_0213341 Ga0496111_0213341_442_1314 276
236 3300048915 Ga0496112_0022495 Ga0496112_0022495_3036_3902 276
237 3300048915 Ga0496112_0074138 Ga0496112_0074138_1709_2575 276
238 3300048918 Ga0496115_0388261 Ga0496115_0388261_20_892 276
239 3300048925 Ga0496122_0063658 Ga0496122_0063658_848_1711 276
240 3300053077 Ga0495601_0000011 Ga0495601_0000011_165513_166385 276
241 3300053077 Ga0495601_0000392 Ga0495601_0000392_16961_17833 276
242 3300053078 Ga0495612_0000006 Ga0495612_0000006_120507_121379 276
243 3300053078 Ga0495612_0037724 Ga0495612_0037724_605_1477 276
244 3300053084 Ga0495595_0000021 Ga0495595_0000021_31465_32337 276
245 3300053085 Ga0495619_0000013 Ga0495619_0000013_165434_166306 276
246 3300053119 Ga0500595_019639 Ga0500595_019639_606_1475 276
247 iso_pu_bacteria 2508501128 2509152157 276
248 iso_pu_bacteria 2513237141 2513888602 276
249 iso_pu_bacteria 2524023205 2524438844 276
250 3300003215 JGI25153J46596_10043278 JGI25153J46596_100432781 277
251 3300005364 Ga0070673_100277068 Ga0070673_1002770682 277
252 3300006914 Ga0075436_100068860 Ga0075436_1000688602 277
253 3300007076 Ga0075435_100051643 Ga0075435_1000516432 277
254 3300007076 Ga0075435_100078601 Ga0075435_1000786012 277
255 3300025297 Ga0209758_1004128 Ga0209758_100412813 277
256 3300025906 Ga0207699_10219749 Ga0207699_102197492 277
257 3300025924 Ga0207694_10049243 Ga0207694_100492433 277
258 3300028379 Ga0268266_10649913 Ga0268266_106499131 277
259 3300031241 Ga0265325_10025732 Ga0265325_100257324 277
260 3300035695 Ga0373927_0048569 Ga0373927_0048569_1490_2362 277
261 3300035724 Ga0373933_0000315 Ga0373933_0000315_8635_9522 277
262 3300035724 Ga0373933_0146323 Ga0373933_0146323_336_1211 277
263 3300036401 Ga0373937_0008940 Ga0373937_0008940_5697_6572 277
264 3300036401 Ga0373937_0288660 Ga0373937_0288660_419_1297 277
265 3300046462 Ga0495651_0044155 Ga0495651_0044155_2360_3247 277
266 3300046477 Ga0495664_0200600 Ga0495664_0200600_28_906 277
267 3300046536 Ga0495587_0018828 Ga0495587_0018828_3004_3891 277
268 3300046559 Ga0495667_0050257 Ga0495667_0050257_112_999 277
269 3300046675 Ga0495657_0008385 Ga0495657_0008385_3501_4388 277
270 3300047317 Ga0495604_0217284 Ga0495604_0217284_399_1277 277
271 3300047322 Ga0495680_0081343 Ga0495680_0081343_1233_2120 277
272 3300048088 Ga0495602_0096494 Ga0495602_0096494_1217_2104 277
273 3300050513 nmdc:mga0rr50_195263_c1 nmdc:mga0rr50_195263_c1_67_945 277
274 3300050513 nmdc:mga0rr50_42984_c1 nmdc:mga0rr50_42984_c1_711_1571 277
275 3300050514 nmdc:mga08x19_105709_c1 nmdc:mga08x19_105709_c1_669_1529 277
276 3300053077 Ga0495601_0004077 Ga0495601_0004077_5900_6787 277
277 3300053078 Ga0495612_0008409 Ga0495612_0008409_1560_2447 277
278 3300053084 Ga0495595_0006005 Ga0495595_0006005_83_958 277
279 3300053084 Ga0495595_0020342 Ga0495595_0020342_1662_2549 277
280 3300053085 Ga0495619_0055926 Ga0495619_0055926_1569_2444 277
281 3300053085 Ga0495619_0113072 Ga0495619_0113072_59_946 277
282 3300003659 JGI25404J52841_10001804 JGI25404J52841_100018041 278
283 3300005983 Ga0081540_1012184 Ga0081540_10121843 278
284 3300006175 Ga0070712_100002530 Ga0070712_10000253012 278
285 3300021377 Ga0213874_10002095 Ga0213874_100020954 278
286 3300025915 Ga0207693_10003777 Ga0207693_1000377713 278
287 3300031730 Ga0307516_10098273 Ga0307516_100982731 278
288 3300035170 Ga0373943_0003409 Ga0373943_0003409_5403_6275 278
289 3300035171 Ga0373946_0016589 Ga0373946_0016589_475_1347 278
290 3300035171 Ga0373946_0138036 Ga0373946_0138036_188_1066 278
291 3300035172 Ga0373955_0011330 Ga0373955_0011330_2564_3436 278
292 3300035692 Ga0373935_0014539 Ga0373935_0014539_105_977 278
293 3300035695 Ga0373927_0001064 Ga0373927_0001064_2536_3408 278
294 3300035725 Ga0373947_0006319 Ga0373947_0006319_4313_5185 278
295 3300036401 Ga0373937_0029705 Ga0373937_0029705_925_1797 278
296 3300036401 Ga0373937_0099501 Ga0373937_0099501_637_1509 278
297 3300037068 Ga0373925_0007638 Ga0373925_0007638_3776_4648 278
298 3300037853 Ga0436364_0004111 Ga0436364_0004111_490_1356 278
299 3300039450 Ga0436363_0576644 Ga0436363_0576644_2117_2998 278
300 3300046454 Ga0495592_0020736 Ga0495592_0020736_2798_3670 278
301 3300046455 Ga0495603_0003128 Ga0495603_0003128_1721_2593 278
302 3300046459 Ga0495629_0001107 Ga0495629_0001107_10055_10927 278
303 3300046461 Ga0495641_0004022 Ga0495641_0004022_4699_5571 278
304 3300046472 Ga0495580_0001546 Ga0495580_0001546_1719_2591 278
305 3300046473 Ga0495582_0000855 Ga0495582_0000855_13974_14846 278
306 3300046475 Ga0495639_0000072 Ga0495639_0000072_42886_43758 278
307 3300046476 Ga0495662_0002403 Ga0495662_0002403_59_931 278
308 3300046477 Ga0495664_0001402 Ga0495664_0001402_4309_5181 278
309 3300046499 Ga0495594_0278809 Ga0495594_0278809_52_924 278
310 3300046517 Ga0495630_0003448 Ga0495630_0003448_1533_2405 278
311 3300046526 Ga0495666_0008781 Ga0495666_0008781_406_1278 278
312 3300046529 Ga0495652_0100862 Ga0495652_0100862_1269_2141 278
313 3300046531 Ga0495665_0000128 Ga0495665_0000128_21277_22149 278
314 3300046533 Ga0495640_0047940 Ga0495640_0047940_1273_2145 278
315 3300046557 Ga0495622_0005892 Ga0495622_0005892_681_1553 278
316 3300046663 Ga0495635_0000564 Ga0495635_0000564_10127_10999 278
317 3300046674 Ga0495588_0031903 Ga0495588_0031903_1023_1895 278
318 3300046680 Ga0495646_0003182 Ga0495646_0003182_9256_10128 278
319 3300046681 Ga0495647_0001214 Ga0495647_0001214_5564_6436 278
320 3300046683 Ga0495658_0000707 Ga0495658_0000707_9462_10334 278
321 3300046689 Ga0495613_0001986 Ga0495613_0001986_10127_10999 278
322 3300046690 Ga0495624_0004889 Ga0495624_0004889_362_1234 278
323 3300047315 Ga0495581_0000030 Ga0495581_0000030_45239_46111 278
324 3300047319 Ga0495674_0001230 Ga0495674_0001230_22312_23184 278
325 3300047321 Ga0495676_0063006 Ga0495676_0063006_609_1481 278
326 3300047673 Ga0495593_0000470 Ga0495593_0000470_18666_19538 278
327 3300049571 Ga0501034_0069806 Ga0501034_0069806_1558_2418 278
328 3300049587 Ga0501071_0051598 Ga0501071_0051598_186_1061 278
329 3300049592 Ga0501076_0015425 Ga0501076_0015425_2144_3019 278
330 3300049593 Ga0501077_0015351 Ga0501077_0015351_1282_2157 278
331 3300049741 Ga0501079_0003847 Ga0501079_0003847_4458_5333 278
332 3300049743 Ga0501081_0001105 Ga0501081_0001105_10337_11212 278
333 3300053077 Ga0495601_0098431 Ga0495601_0098431_881_1753 278
334 3300053085 Ga0495619_0017632 Ga0495619_0017632_2556_3428 278
335 3300054114 Ga0501084_0003563 Ga0501084_0003563_10325_11200 278
336 3300060353 Ga0501082_0014075 Ga0501082_0014075_4967_5842 278
337 3300061734 Ga0530510_0151565 Ga0530510_0151565_820_1695 278
338 iso_pu_bacteria 2513237101 2513695264 278
339 iso_pu_bacteria 2513237139 2513873373 278
340 iso_pu_bacteria 2513237161 2514014703 278
341 iso_pu_bacteria 2602042107 2603858355 278
342 iso_pu_bacteria 2617270735 2617352084 278
343 iso_pu_bacteria 2643221651 2644291070 278
344 iso_pu_bacteria 2721755755 2723841793 278
345 iso_pu_bacteria 2791355199 2793078332 278
346 iso_pu_bacteria 2802429603 2805920721 278
347 iso_pu_bacteria 2824600985 2824609015 278
348 iso_pu_bacteria 2824609381 2824617719 278
349 iso_pu_bacteria 2824653114 2824661008 278
350 iso_pu_bacteria 2824696289 2824702630 278
351 iso_pu_bacteria 2824773399 2824780868 278
352 iso_pu_bacteria 2838122688 2838124672 278
353 iso_pu_bacteria 2841941048 2841945364 278
354 iso_pu_bacteria 2841949485 2841952149 278
355 iso_pu_bacteria 2841966195 2841970463 278
356 iso_pu_bacteria 2841974524 2841981711 278
357 iso_pu_bacteria 2841983080 2841984992 278
358 iso_pu_bacteria 2847939898 2847942315 278
359 iso_pu_bacteria 2857524615 2857526545 278
360 iso_pu_bacteria 2876808645 2876814212 278
361 iso_pu_bacteria 2879110137 2879113337 278
362 iso_pu_bacteria 2885366525 2885369359 278
363 iso_pu_bacteria 2888419890 2888420148 278
364 iso_pu_bacteria 2889033259 2889035328 278
365 iso_pu_bacteria 2893066018 2893067207 278
366 iso_pu_bacteria 2904690495 2904691029 278
367 iso_pu_bacteria 2906626472 2906628533 278
368 iso_pu_bacteria 2908756301 2908757087 278
369 iso_pu_bacteria 2919073203 2919073635 278
370 iso_pu_bacteria 2922361189 2922363183 278
371 iso_pu_bacteria 2922386360 2922388512 278
372 iso_pu_bacteria 2922393267 2922400051 278
373 iso_pu_bacteria 2935608549 2935615545 278
374 iso_pu_bacteria 2935819856 2935825654 278
375 iso_pu_bacteria 2935847175 2935853418 278
376 iso_pu_bacteria 2935959822 2935966745 278
377 iso_pu_bacteria 2936055302 2936060254 278
378 iso_pu_bacteria 3005506211 3005509005 278
379 iso_pu_bacteria 8006964411 8006967612 278
380 iso_pu_bacteria 8006984368 8006991082 278
381 iso_pu_bacteria 8006994254 8007000411 278
382 iso_pu_bacteria 8016583857 8016586268 278
383 iso_pu_bacteria 8056689827 8056691120 278
384 3300005347 Ga0070668_100187291 Ga0070668_1001872911 279
385 3300005937 Ga0081455_10005086 Ga0081455_100050862 279
386 3300006048 Ga0075363_100123090 Ga0075363_1001230901 279
387 3300006177 Ga0075362_10041956 Ga0075362_100419562 279
388 3300006844 Ga0075428_100003141 Ga0075428_10000314118 279
389 3300006847 Ga0075431_100000568 Ga0075431_10000056811 279
390 3300006880 Ga0075429_100003175 Ga0075429_1000031756 279
391 3300006881 Ga0068865_100292659 Ga0068865_1002926592 279
392 3300009094 Ga0111539_10001515 Ga0111539_100015156 279
393 3300009147 Ga0114129_10000692 Ga0114129_1000069243 279
394 3300009147 Ga0114129_10065672 Ga0114129_100656722 279
395 3300009553 Ga0105249_10746958 Ga0105249_107469582 279
396 3300014326 Ga0157380_10303924 Ga0157380_103039241 279
397 3300025899 Ga0207642_10135499 Ga0207642_101354992 279
398 3300025901 Ga0207688_10087080 Ga0207688_100870802 279
399 3300025942 Ga0207689_10289799 Ga0207689_102897992 279
400 3300026089 Ga0207648_10120914 Ga0207648_101209143 279
401 3300027907 Ga0207428_10002337 Ga0207428_1000233713 279
402 3300035171 Ga0373946_0025554 Ga0373946_0025554_104_982 279
403 3300037068 Ga0373925_0107949 Ga0373925_0107949_1115_1993 279
404 3300037418 Ga0395900_0030391 Ga0395900_0030391_3953_4843 279
405 3300037418 Ga0395900_0089045 Ga0395900_0089045_1329_2207 279
406 3300037466 Ga0395898_0041823 Ga0395898_0041823_932_1810 279
407 3300037466 Ga0395898_0063279 Ga0395898_0063279_706_1593 279
408 3300037466 Ga0395898_0134131 Ga0395898_0134131_856_1725 279
409 3300038443 Ga0395901_0021536 Ga0395901_0021536_3461_4339 279
410 3300046455 Ga0495603_0088181 Ga0495603_0088181_340_1218 279
411 3300046475 Ga0495639_0035724 Ga0495639_0035724_987_1865 279
412 3300046491 Ga0495584_0112632 Ga0495584_0112632_129_1007 279
413 3300046492 Ga0495585_0114167 Ga0495585_0114167_356_1234 279
414 3300046513 Ga0495616_0063169 Ga0495616_0063169_796_1668 279
415 3300046537 Ga0495598_0080433 Ga0495598_0080433_140_1018 279
416 3300046681 Ga0495647_0015891 Ga0495647_0015891_764_1642 279
417 3300046684 Ga0495669_0146084 Ga0495669_0146084_29_907 279
418 3300047321 Ga0495676_0300500 Ga0495676_0300500_111_989 279
419 3300048918 Ga0496115_0210589 Ga0496115_0210589_690_1556 279
420 3300049569 Ga0501032_0004147 Ga0501032_0004147_3100_3969 279
421 3300049571 Ga0501034_0076480 Ga0501034_0076480_1431_2300 279
422 3300049585 Ga0501069_0256429 Ga0501069_0256429_119_988 279
423 3300050507 nmdc:mga05p37_427_c1 nmdc:mga05p37_427_c1_39974_40852 279
424 3300050507 nmdc:mga05p37_6551_c1 nmdc:mga05p37_6551_c1_10708_11586 279
425 3300050508 nmdc:mga09592_2873_c1 nmdc:mga09592_2873_c1_2703_3581 279
426 3300050509 nmdc:mga0qj67_51727_c2 nmdc:mga0qj67_51727_c2_1057_1935 279
427 3300050510 nmdc:mga06r32_109361_c1 nmdc:mga06r32_109361_c1_487_1365 279
428 3300050510 nmdc:mga06r32_2417_c1 nmdc:mga06r32_2417_c1_8086_8964 279
429 3300050511 nmdc:mga08y16_90_c1 nmdc:mga08y16_90_c1_50610_51488 279
430 3300053077 Ga0495601_0026481 Ga0495601_0026481_70_945 279
431 3300053136 Ga0500559_0172991 Ga0500559_0172991_44_907 279
432 3300053151 Ga0500604_0044976 Ga0500604_0044976_20_892 279
433 iso_pu_bacteria 2917554339 2917554972 279
434 3300005336 Ga0070680_100046810 Ga0070680_1000468104 280
435 3300005434 Ga0070709_10056369 Ga0070709_100563692 280
436 3300005436 Ga0070713_100003576 Ga0070713_1000035762 280
437 3300005436 Ga0070713_100103980 Ga0070713_1001039801 280
438 3300005437 Ga0070710_10001532 Ga0070710_100015327 280
439 3300005437 Ga0070710_10024153 Ga0070710_100241534 280
440 3300005437 Ga0070710_10035594 Ga0070710_100355942 280
441 3300005439 Ga0070711_100009673 Ga0070711_1000096732 280
442 3300005439 Ga0070711_100012351 Ga0070711_1000123515 280
443 3300005535 Ga0070684_100025298 Ga0070684_1000252982 280
444 3300005563 Ga0068855_100153539 Ga0068855_1001535393 280
445 3300005614 Ga0068856_100000883 Ga0068856_10000088310 280
446 3300005618 Ga0068864_100033808 Ga0068864_1000338084 280
447 3300005843 Ga0068860_100000477 Ga0068860_10000047739 280
448 3300006028 Ga0070717_10119310 Ga0070717_101193102 280
449 3300006028 Ga0070717_10231831 Ga0070717_102318312 280
450 3300006051 Ga0075364_10034501 Ga0075364_100345013 280
451 3300006163 Ga0070715_10213345 Ga0070715_102133452 280
452 3300006173 Ga0070716_100227526 Ga0070716_1002275262 280
453 3300006175 Ga0070712_100034544 Ga0070712_1000345443 280
454 3300006178 Ga0075367_10049481 Ga0075367_100494812 280
455 3300009093 Ga0105240_10062589 Ga0105240_100625894 280
456 3300009545 Ga0105237_10067599 Ga0105237_100675994 280
457 3300009545 Ga0105237_10133597 Ga0105237_101335972 280
458 3300010375 Ga0105239_10227921 Ga0105239_102279212 280
459 3300013105 Ga0157369_10052065 Ga0157369_100520654 280
460 3300020082 Ga0206353_11234579 Ga0206353_112345792 280
461 3300021361 Ga0213872_10140105 Ga0213872_101401052 280
462 3300021384 Ga0213876_10005453 Ga0213876_100054531 280
463 3300021384 Ga0213876_10125669 Ga0213876_101256691 280
464 3300021384 Ga0213876_10131901 Ga0213876_101319012 280
465 3300021384 Ga0213876_10234387 Ga0213876_102343871 280
466 3300021441 Ga0213871_10021333 Ga0213871_100213332 280
467 3300025898 Ga0207692_10000565 Ga0207692_100005652 280
468 3300025898 Ga0207692_10052384 Ga0207692_100523842 280
469 3300025904 Ga0207647_10092600 Ga0207647_100926002 280
470 3300025912 Ga0207707_10128117 Ga0207707_101281171 280
471 3300025913 Ga0207695_10092643 Ga0207695_100926432 280
472 3300025913 Ga0207695_10241252 Ga0207695_102412521 280
473 3300025914 Ga0207671_10034623 Ga0207671_100346233 280
474 3300025914 Ga0207671_10114074 Ga0207671_101140742 280
475 3300025915 Ga0207693_10021801 Ga0207693_100218012 280
476 3300025916 Ga0207663_10042175 Ga0207663_100421752 280
477 3300025916 Ga0207663_10050996 Ga0207663_100509962 280
478 3300025928 Ga0207700_10010887 Ga0207700_100108872 280
479 3300025928 Ga0207700_10073901 Ga0207700_100739011 280
480 3300025929 Ga0207664_10012301 Ga0207664_100123012 280
481 3300025939 Ga0207665_10112997 Ga0207665_101129972 280
482 3300025944 Ga0207661_10002867 Ga0207661_1000286712 280
483 3300025944 Ga0207661_10380521 Ga0207661_103805211 280
484 3300025949 Ga0207667_10538213 Ga0207667_105382132 280
485 3300026067 Ga0207678_10567390 Ga0207678_105673901 280
486 3300026078 Ga0207702_10000318 Ga0207702_100003189 280
487 3300028381 Ga0268264_10000062 Ga0268264_10000062236 280
488 3300030521 Ga0307511_10054505 Ga0307511_100545051 280
489 3300031507 Ga0307509_10006160 Ga0307509_1000616016 280
490 3300031616 Ga0307508_10000045 Ga0307508_1000004538 280
491 3300031901 Ga0307406_10454913 Ga0307406_104549131 280
492 3300033179 Ga0307507_10110502 Ga0307507_101105022 280
493 3300035113 Ga0373936_0030004 Ga0373936_0030004_1050_1919 280
494 3300035172 Ga0373955_0030936 Ga0373955_0030936_501_1394 280
495 3300035692 Ga0373935_0097097 Ga0373935_0097097_284_1150 280
496 3300035724 Ga0373933_0000885 Ga0373933_0000885_7315_8181 280
497 3300035725 Ga0373947_0236599 Ga0373947_0236599_50_916 280
498 3300036401 Ga0373937_0022449 Ga0373937_0022449_1553_2419 280
499 3300037068 Ga0373925_0054728 Ga0373925_0054728_1861_2727 280
500 3300037312 Ga0395899_0006366 Ga0395899_0006366_1609_2499 280
501 3300037418 Ga0395900_0009214 Ga0395900_0009214_5579_6445 280
502 3300037853 Ga0436364_0452492 Ga0436364_0452492_85_951 280
503 3300038443 Ga0395901_0077817 Ga0395901_0077817_2532_3398 280
504 3300039437 Ga0436365_0172137 Ga0436365_0172137_1834_2706 280
505 3300039437 Ga0436365_0734530 Ga0436365_0734530_91_957 280
506 3300039437 Ga0436365_0903245 Ga0436365_0903245_753_1619 280
507 3300039437 Ga0436365_1607953 Ga0436365_1607953_366_1232 280
508 3300039438 Ga0436360_0831213 Ga0436360_0831213_263_1129 280
509 3300039447 Ga0436361_0000238 Ga0436361_0000238_144_1010 280
510 3300039447 Ga0436361_0274303 Ga0436361_0274303_42_920 280
511 3300039447 Ga0436361_1209439 Ga0436361_1209439_327_1193 280
512 3300039453 Ga0436362_0233201 Ga0436362_0233201_698_1564 280
513 3300044694 Ga0466963_0043770 Ga0466963_0043770_494_1384 280
514 3300044694 Ga0466963_0054350 Ga0466963_0054350_412_1278 280
515 3300044719 Ga0466971_0058502 Ga0466971_0058502_164_1030 280
516 3300044735 Ga0466968_0118017 Ga0466968_0118017_307_1173 280
517 3300045049 Ga0466959_0074305 Ga0466959_0074305_115_981 280
518 3300045976 Ga0466967_0111496 Ga0466967_0111496_322_1188 280
519 3300045976 Ga0466967_0280836 Ga0466967_0280836_347_1237 280
520 3300048909 Ga0496106_0001644 Ga0496106_0001644_3327_4208 280
521 3300048920 Ga0496117_0046301 Ga0496117_0046301_963_1844 280
522 3300048921 Ga0496118_0023464 Ga0496118_0023464_3482_4363 280
523 3300048924 Ga0496121_0001257 Ga0496121_0001257_163_1044 280
524 3300048924 Ga0496121_0010674 Ga0496121_0010674_5274_6140 280
525 3300048928 Ga0496125_0033842 Ga0496125_0033842_2759_3625 280
526 3300048928 Ga0496125_0075698 Ga0496125_0075698_193_1074 280
527 3300049590 Ga0501074_0018479 Ga0501074_0018479_1316_2182 280
528 3300049590 Ga0501074_0231359 Ga0501074_0231359_46_930 280
529 3300049591 Ga0501075_0103633 Ga0501075_0103633_209_1093 280
530 3300049593 Ga0501077_0134539 Ga0501077_0134539_389_1273 280
531 3300049742 Ga0501080_0064626 Ga0501080_0064626_872_1738 280
532 3300049823 Ga0501044_0253318 Ga0501044_0253318_601_1467 280
533 3300049824 Ga0501045_0022970 Ga0501045_0022970_544_1428 280
534 3300050491 nmdc:mga00v17_63096_c1 nmdc:mga00v17_63096_c1_872_1738 280
535 3300050510 nmdc:mga06r32_306343_c1 nmdc:mga06r32_306343_c1_644_1522 280
536 3300053077 Ga0495601_0006579 Ga0495601_0006579_2131_2997 280
537 3300053080 Ga0500635_0004048 Ga0500635_0004048_450_1328 280
538 3300053080 Ga0500635_0067662 Ga0500635_0067662_308_1174 280
539 3300053094 Ga0500566_0000107 Ga0500566_0000107_6514_7380 280
540 3300053119 Ga0500595_041070 Ga0500595_041070_582_1448 280
541 3300053136 Ga0500559_0040338 Ga0500559_0040338_37_918 280
542 3300053136 Ga0500559_0138116 Ga0500559_0138116_132_1010 280
543 3300053159 Ga0500630_049983 Ga0500630_049983_903_1769 280
544 3300053162 Ga0500638_140299 Ga0500638_140299_77_943 280
545 3300053177 Ga0500636_0236835 Ga0500636_0236835_22_888 280
546 3300053178 Ga0500637_0052147 Ga0500637_0052147_103_969 280
547 3300061719 Ga0466962_0034341 Ga0466962_0034341_990_1856 280
548 3300005366 Ga0070659_100038851 Ga0070659_1000388514 281
549 3300005536 Ga0070697_100099077 Ga0070697_1000990772 281
550 3300005563 Ga0068855_100112279 Ga0068855_1001122792 281
551 3300005578 Ga0068854_100178383 Ga0068854_1001783831 281
552 3300005614 Ga0068856_100488926 Ga0068856_1004889261 281
553 3300005616 Ga0068852_100116544 Ga0068852_1001165442 281
554 3300005937 Ga0081455_10354979 Ga0081455_103549791 281
555 3300006163 Ga0070715_10090401 Ga0070715_100904012 281
556 3300006175 Ga0070712_100102723 Ga0070712_1001027232 281
557 3300006852 Ga0075433_10250376 Ga0075433_102503761 281
558 3300007265 Ga0099794_10001485 Ga0099794_100014855 281
559 3300014325 Ga0163163_10475090 Ga0163163_104750901 281
560 3300025905 Ga0207685_10078961 Ga0207685_100789612 281
561 3300025910 Ga0207684_10002963 Ga0207684_1000296316 281
562 3300025915 Ga0207693_10042386 Ga0207693_100423862 281
563 3300025917 Ga0207660_10089142 Ga0207660_100891422 281
564 3300025928 Ga0207700_10208805 Ga0207700_102088051 281
565 3300031235 Ga0265330_10038896 Ga0265330_100388962 281
566 3300031247 Ga0265340_10017518 Ga0265340_100175183 281
567 3300031249 Ga0265339_10117155 Ga0265339_101171551 281
568 3300031250 Ga0265331_10171233 Ga0265331_101712331 281
569 3300031711 Ga0265314_10168340 Ga0265314_101683402 281
570 3300036401 Ga0373937_0214019 Ga0373937_0214019_137_1006 281
571 3300037068 Ga0373925_0012102 Ga0373925_0012102_2031_2900 281
572 3300039450 Ga0436363_0407324 Ga0436363_0407324_364_1236 281
573 3300046507 Ga0495606_0000831 Ga0495606_0000831_1338_2210 281
574 3300047322 Ga0495680_0192032 Ga0495680_0192032_553_1425 281
575 3300048913 Ga0496110_0004921 Ga0496110_0004921_6515_7393 281
576 3300048915 Ga0496112_0075729 Ga0496112_0075729_184_1062 281
577 3300048915 Ga0496112_0089343 Ga0496112_0089343_1994_2863 281
578 3300050512 nmdc:mga0n895_399422_c1 nmdc:mga0n895_399422_c1_46_924 281
579 3300001979 JGI24740J21852_10006878 JGI24740J21852_100068785 282
580 3300001990 JGI24737J22298_10015483 JGI24737J22298_100154833 282
581 3300002077 JGI24744J21845_10026309 JGI24744J21845_100263091 282
582 3300003354 JGI25160J50197_1007581 JGI25160J50197_10075813 282
583 3300003659 JGI25404J52841_10017513 JGI25404J52841_100175132 282
584 3300005327 Ga0070658_10377518 Ga0070658_103775181 282
585 3300005329 Ga0070683_100070525 Ga0070683_1000705252 282
586 3300005330 Ga0070690_100081395 Ga0070690_1000813952 282
587 3300005331 Ga0070670_100179008 Ga0070670_1001790082 282
588 3300005334 Ga0068869_100044714 Ga0068869_1000447143 282
589 3300005336 Ga0070680_100022603 Ga0070680_1000226032 282
590 3300005336 Ga0070680_100098721 Ga0070680_1000987212 282
591 3300005338 Ga0068868_100016512 Ga0068868_1000165127 282
592 3300005339 Ga0070660_100008345 Ga0070660_1000083456 282
593 3300005339 Ga0070660_100265323 Ga0070660_1002653231 282
594 3300005339 Ga0070660_100301020 Ga0070660_1003010202 282
595 3300005347 Ga0070668_100134018 Ga0070668_1001340182 282
596 3300005353 Ga0070669_100040796 Ga0070669_1000407962 282
597 3300005354 Ga0070675_100142137 Ga0070675_1001421374 282
598 3300005355 Ga0070671_100073962 Ga0070671_1000739622 282
599 3300005356 Ga0070674_100154706 Ga0070674_1001547062 282
600 3300005364 Ga0070673_100218483 Ga0070673_1002184833 282
601 3300005366 Ga0070659_100039277 Ga0070659_1000392773 282
602 3300005367 Ga0070667_100624676 Ga0070667_1006246761 282
603 3300005367 Ga0070667_100660470 Ga0070667_1006604701 282
604 3300005435 Ga0070714_100112182 Ga0070714_1001121822 282
605 3300005439 Ga0070711_100008302 Ga0070711_1000083027 282
606 3300005440 Ga0070705_100077274 Ga0070705_1000772744 282
607 3300005455 Ga0070663_100026672 Ga0070663_1000266722 282
608 3300005455 Ga0070663_100199834 Ga0070663_1001998342 282
609 3300005455 Ga0070663_100206617 Ga0070663_1002066173 282
610 3300005456 Ga0070678_100034660 Ga0070678_1000346604 282
611 3300005457 Ga0070662_100262216 Ga0070662_1002622161 282
612 3300005458 Ga0070681_10277524 Ga0070681_102775242 282
613 3300005458 Ga0070681_10306009 Ga0070681_103060091 282
614 3300005459 Ga0068867_100423905 Ga0068867_1004239052 282
615 3300005530 Ga0070679_100002400 Ga0070679_1000024006 282
616 3300005530 Ga0070679_100030485 Ga0070679_1000304852 282
617 3300005530 Ga0070679_100561122 Ga0070679_1005611221 282
618 3300005535 Ga0070684_100043767 Ga0070684_1000437672 282
619 3300005539 Ga0068853_100003310 Ga0068853_10000331013 282
620 3300005539 Ga0068853_100038170 Ga0068853_1000381704 282
621 3300005539 Ga0068853_100039338 Ga0068853_1000393384 282
622 3300005539 Ga0068853_100059209 Ga0068853_1000592091 282
623 3300005539 Ga0068853_100190008 Ga0068853_1001900082 282
624 3300005546 Ga0070696_100026887 Ga0070696_1000268874 282
625 3300005548 Ga0070665_100029471 Ga0070665_1000294715 282
626 3300005548 Ga0070665_100031667 Ga0070665_1000316675 282
627 3300005548 Ga0070665_100091913 Ga0070665_1000919132 282
628 3300005549 Ga0070704_100336465 Ga0070704_1003364652 282
629 3300005563 Ga0068855_100026317 Ga0068855_1000263176 282
630 3300005563 Ga0068855_100053234 Ga0068855_1000532343 282
631 3300005563 Ga0068855_100060155 Ga0068855_1000601555 282
632 3300005563 Ga0068855_100112294 Ga0068855_1001122943 282
633 3300005577 Ga0068857_100001037 Ga0068857_1000010378 282
634 3300005577 Ga0068857_100033794 Ga0068857_1000337945 282
635 3300005577 Ga0068857_100443105 Ga0068857_1004431052 282
636 3300005578 Ga0068854_100001597 Ga0068854_1000015974 282
637 3300005578 Ga0068854_100019432 Ga0068854_1000194322 282
638 3300005578 Ga0068854_100102280 Ga0068854_1001022803 282
639 3300005578 Ga0068854_100223513 Ga0068854_1002235132 282
640 3300005614 Ga0068856_100012184 Ga0068856_1000121849 282
641 3300005614 Ga0068856_100155809 Ga0068856_1001558092 282
642 3300005616 Ga0068852_100030003 Ga0068852_1000300035 282
643 3300005617 Ga0068859_100047861 Ga0068859_1000478615 282
644 3300005617 Ga0068859_100667026 Ga0068859_1006670262 282
645 3300005719 Ga0068861_100141285 Ga0068861_1001412851 282
646 3300005719 Ga0068861_100368396 Ga0068861_1003683961 282
647 3300005719 Ga0068861_100637789 Ga0068861_1006377892 282
648 3300005834 Ga0068851_10000558 Ga0068851_100005586 282
649 3300005834 Ga0068851_10015981 Ga0068851_100159812 282
650 3300005840 Ga0068870_10053768 Ga0068870_100537683 282
651 3300005842 Ga0068858_100069349 Ga0068858_1000693492 282
652 3300005842 Ga0068858_100178809 Ga0068858_1001788092 282
653 3300005842 Ga0068858_100297313 Ga0068858_1002973132 282
654 3300005844 Ga0068862_100094520 Ga0068862_1000945203 282
655 3300005844 Ga0068862_100102424 Ga0068862_1001024241 282
656 3300005937 Ga0081455_10007370 Ga0081455_100073708 282
657 3300005937 Ga0081455_10007381 Ga0081455_1000738112 282
658 3300005981 Ga0081538_10074134 Ga0081538_100741342 282
659 3300005983 Ga0081540_1003488 Ga0081540_100348811 282
660 3300005983 Ga0081540_1008854 Ga0081540_10088544 282
661 3300005983 Ga0081540_1048845 Ga0081540_10488452 282
662 3300005985 Ga0081539_10018659 Ga0081539_100186595 282
663 3300006038 Ga0075365_10106354 Ga0075365_101063542 282
664 3300006042 Ga0075368_10064243 Ga0075368_100642432 282
665 3300006042 Ga0075368_10088191 Ga0075368_100881911 282
666 3300006048 Ga0075363_100004174 Ga0075363_1000041744 282
667 3300006048 Ga0075363_100082345 Ga0075363_1000823452 282
668 3300006051 Ga0075364_10018451 Ga0075364_100184515 282
669 3300006058 Ga0075432_10048537 Ga0075432_100485371 282
670 3300006177 Ga0075362_10020405 Ga0075362_100204053 282
671 3300006186 Ga0075369_10009037 Ga0075369_100090372 282
672 3300006237 Ga0097621_100339564 Ga0097621_1003395642 282
673 3300006237 Ga0097621_100451914 Ga0097621_1004519141 282
674 3300006353 Ga0075370_10022430 Ga0075370_100224302 282
675 3300006353 Ga0075370_10102322 Ga0075370_101023222 282
676 3300006844 Ga0075428_100532983 Ga0075428_1005329831 282
677 3300006931 Ga0097620_100047862 Ga0097620_1000478622 282
678 3300006931 Ga0097620_100666967 Ga0097620_1006669672 282
679 3300007265 Ga0099794_10036912 Ga0099794_100369123 282
680 3300009093 Ga0105240_10002459 Ga0105240_1000245917 282
681 3300009093 Ga0105240_10087076 Ga0105240_100870763 282
682 3300009093 Ga0105240_10170354 Ga0105240_101703542 282
683 3300009094 Ga0111539_10091971 Ga0111539_100919712 282
684 3300009098 Ga0105245_10189575 Ga0105245_101895752 282
685 3300009101 Ga0105247_10265102 Ga0105247_102651021 282
686 3300009148 Ga0105243_10377080 Ga0105243_103770801 282
687 3300009174 Ga0105241_10000249 Ga0105241_1000024913 282
688 3300009174 Ga0105241_10109783 Ga0105241_101097833 282
689 3300009176 Ga0105242_10099724 Ga0105242_100997243 282
690 3300009177 Ga0105248_10156900 Ga0105248_101569002 282
691 3300009177 Ga0105248_10385572 Ga0105248_103855722 282
692 3300009545 Ga0105237_10168759 Ga0105237_101687592 282
693 3300009545 Ga0105237_10286091 Ga0105237_102860912 282
694 3300009551 Ga0105238_10001235 Ga0105238_100012354 282
695 3300009551 Ga0105238_10014511 Ga0105238_100145113 282
696 3300009551 Ga0105238_10038587 Ga0105238_100385875 282
697 3300009553 Ga0105249_10044828 Ga0105249_100448283 282
698 3300009553 Ga0105249_10840241 Ga0105249_108402411 282
699 3300010159 Ga0099796_10020835 Ga0099796_100208352 282
700 3300010375 Ga0105239_10032291 Ga0105239_100322916 282
701 3300010375 Ga0105239_10061707 Ga0105239_100617073 282
702 3300010375 Ga0105239_10158333 Ga0105239_101583332 282
703 3300013100 Ga0157373_10050479 Ga0157373_100504794 282
704 3300013104 Ga0157370_10015855 Ga0157370_100158557 282
705 3300013104 Ga0157370_10376246 Ga0157370_103762461 282
706 3300013307 Ga0157372_10443094 Ga0157372_104430942 282
707 3300013308 Ga0157375_10139921 Ga0157375_101399211 282
708 3300013308 Ga0157375_10187578 Ga0157375_101875782 282
709 3300014325 Ga0163163_10064343 Ga0163163_100643434 282
710 3300014326 Ga0157380_10163035 Ga0157380_101630352 282
711 3300014745 Ga0157377_10078649 Ga0157377_100786492 282
712 3300014968 Ga0157379_10270345 Ga0157379_102703452 282
713 3300017792 Ga0163161_10070039 Ga0163161_100700391 282
714 3300025297 Ga0209758_1001918 Ga0209758_100191816 282
715 3300025297 Ga0209758_1048464 Ga0209758_10484641 282
716 3300025302 Ga0207426_1001156 Ga0207426_10011562 282
717 3300025321 Ga0207656_10003400 Ga0207656_100034001 282
718 3300025321 Ga0207656_10020096 Ga0207656_100200962 282
719 3300025900 Ga0207710_10014866 Ga0207710_100148662 282
720 3300025901 Ga0207688_10058536 Ga0207688_100585362 282
721 3300025901 Ga0207688_10107952 Ga0207688_101079522 282
722 3300025904 Ga0207647_10009887 Ga0207647_100098877 282
723 3300025907 Ga0207645_10220582 Ga0207645_102205821 282
724 3300025908 Ga0207643_10084567 Ga0207643_100845672 282
725 3300025909 Ga0207705_10241570 Ga0207705_102415702 282
726 3300025911 Ga0207654_10069399 Ga0207654_100693992 282
727 3300025912 Ga0207707_10007389 Ga0207707_1000738910 282
728 3300025912 Ga0207707_10232942 Ga0207707_102329421 282
729 3300025913 Ga0207695_10000148 Ga0207695_10000148109 282
730 3300025913 Ga0207695_10000387 Ga0207695_1000038724 282
731 3300025913 Ga0207695_10136588 Ga0207695_101365882 282
732 3300025913 Ga0207695_10177135 Ga0207695_101771352 282
733 3300025914 Ga0207671_10003051 Ga0207671_100030516 282
734 3300025914 Ga0207671_10026208 Ga0207671_100262082 282
735 3300025916 Ga0207663_10037861 Ga0207663_100378613 282
736 3300025917 Ga0207660_10062767 Ga0207660_100627672 282
737 3300025919 Ga0207657_10009668 Ga0207657_100096685 282
738 3300025919 Ga0207657_10024873 Ga0207657_100248735 282
739 3300025921 Ga0207652_10060204 Ga0207652_100602041 282
740 3300025921 Ga0207652_10069014 Ga0207652_100690142 282
741 3300025924 Ga0207694_10000121 Ga0207694_1000012136 282
742 3300025924 Ga0207694_10015653 Ga0207694_100156533 282
743 3300025924 Ga0207694_10287278 Ga0207694_102872781 282
744 3300025927 Ga0207687_10014891 Ga0207687_100148915 282
745 3300025929 Ga0207664_10217097 Ga0207664_102170972 282
746 3300025931 Ga0207644_10050991 Ga0207644_100509914 282
747 3300025931 Ga0207644_10135617 Ga0207644_101356172 282
748 3300025932 Ga0207690_10340721 Ga0207690_103407213 282
749 3300025933 Ga0207706_10044297 Ga0207706_100442973 282
750 3300025933 Ga0207706_10111603 Ga0207706_101116031 282
751 3300025935 Ga0207709_10052061 Ga0207709_100520612 282
752 3300025935 Ga0207709_10073008 Ga0207709_100730082 282
753 3300025936 Ga0207670_10229635 Ga0207670_102296352 282
754 3300025937 Ga0207669_10025452 Ga0207669_100254522 282
755 3300025937 Ga0207669_10082593 Ga0207669_100825932 282
756 3300025940 Ga0207691_10253519 Ga0207691_102535192 282
757 3300025940 Ga0207691_10477779 Ga0207691_104777791 282
758 3300025941 Ga0207711_10029240 Ga0207711_100292405 282
759 3300025941 Ga0207711_10219501 Ga0207711_102195012 282
760 3300025942 Ga0207689_10371073 Ga0207689_103710732 282
761 3300025944 Ga0207661_10056017 Ga0207661_100560172 282
762 3300025949 Ga0207667_10007656 Ga0207667_1000765615 282
763 3300025949 Ga0207667_10016003 Ga0207667_100160035 282
764 3300025949 Ga0207667_10054033 Ga0207667_100540333 282
765 3300025949 Ga0207667_10137555 Ga0207667_101375552 282
766 3300025949 Ga0207667_10316090 Ga0207667_103160901 282
767 3300025961 Ga0207712_10187413 Ga0207712_101874132 282
768 3300025972 Ga0207668_10145485 Ga0207668_101454851 282
769 3300025981 Ga0207640_10005594 Ga0207640_100055945 282
770 3300025981 Ga0207640_10055934 Ga0207640_100559341 282
771 3300025986 Ga0207658_10301124 Ga0207658_103011241 282
772 3300026035 Ga0207703_10014932 Ga0207703_100149324 282
773 3300026035 Ga0207703_10077871 Ga0207703_100778713 282
774 3300026041 Ga0207639_10014436 Ga0207639_100144364 282
775 3300026041 Ga0207639_10308765 Ga0207639_103087652 282
776 3300026067 Ga0207678_10007286 Ga0207678_100072862 282
777 3300026067 Ga0207678_10044075 Ga0207678_100440752 282
778 3300026067 Ga0207678_10232539 Ga0207678_102325392 282
779 3300026067 Ga0207678_10297876 Ga0207678_102978762 282
780 3300026075 Ga0207708_10172435 Ga0207708_101724352 282
781 3300026078 Ga0207702_10000004 Ga0207702_10000004116 282
782 3300026078 Ga0207702_10051367 Ga0207702_100513673 282
783 3300026078 Ga0207702_10325607 Ga0207702_103256072 282
784 3300026095 Ga0207676_10088633 Ga0207676_100886332 282
785 3300026095 Ga0207676_10205751 Ga0207676_102057511 282
786 3300026116 Ga0207674_10005964 Ga0207674_1000596411 282
787 3300026116 Ga0207674_10006033 Ga0207674_100060339 282
788 3300026116 Ga0207674_10012348 Ga0207674_100123484 282
789 3300026116 Ga0207674_10122866 Ga0207674_101228663 282
790 3300026118 Ga0207675_100026733 Ga0207675_1000267334 282
791 3300026118 Ga0207675_100051099 Ga0207675_1000510992 282
792 3300026118 Ga0207675_100237438 Ga0207675_1002374382 282
793 3300026121 Ga0207683_10028337 Ga0207683_100283373 282
794 3300026121 Ga0207683_10066450 Ga0207683_100664502 282
795 3300026121 Ga0207683_10360374 Ga0207683_103603742 282
796 3300026142 Ga0207698_10013415 Ga0207698_100134152 282
797 3300026142 Ga0207698_10329898 Ga0207698_103298982 282
798 3300027512 Ga0209179_1016514 Ga0209179_10165142 282
799 3300027671 Ga0209588_1053255 Ga0209588_10532552 282
800 3300027907 Ga0207428_10046668 Ga0207428_100466682 282
801 3300027907 Ga0207428_10311886 Ga0207428_103118861 282
802 3300028379 Ga0268266_10001906 Ga0268266_100019061 282
803 3300028380 Ga0268265_10122027 Ga0268265_101220272 282
804 3300028381 Ga0268264_10470329 Ga0268264_104703291 282
805 3300028573 Ga0265334_10089935 Ga0265334_100899351 282
806 3300028786 Ga0307517_10000175 Ga0307517_10000175109 282
807 3300028794 Ga0307515_10099000 Ga0307515_100990001 282
808 3300028794 Ga0307515_10236976 Ga0307515_102369762 282
809 3300031456 Ga0307513_10212321 Ga0307513_102123211 282
810 3300031616 Ga0307508_10034088 Ga0307508_100340886 282
811 3300031711 Ga0265314_10014911 Ga0265314_100149116 282
812 3300031712 Ga0265342_10168724 Ga0265342_101687242 282
813 3300031730 Ga0307516_10049470 Ga0307516_100494704 282
814 3300031730 Ga0307516_10161987 Ga0307516_101619872 282
815 3300031730 Ga0307516_10406943 Ga0307516_104069431 282
816 3300031903 Ga0307407_10163740 Ga0307407_101637401 282
817 3300032005 Ga0307411_10150769 Ga0307411_101507692 282
818 3300032126 Ga0307415_100207760 Ga0307415_1002077601 282
819 3300033180 Ga0307510_10042915 Ga0307510_100429152 282
820 3300034816 Ga0373930_0045829 Ga0373930_0045829_41_913 282
821 3300035083 Ga0373926_0094737 Ga0373926_0094737_49_921 282
822 3300035086 Ga0373934_0014812 Ga0373934_0014812_1991_2863 282
823 3300035113 Ga0373936_0023840 Ga0373936_0023840_777_1655 282
824 3300035119 Ga0373956_0004385 Ga0373956_0004385_3720_4592 282
825 3300035120 Ga0373957_0007126 Ga0373957_0007126_2151_3023 282
826 3300035170 Ga0373943_0025075 Ga0373943_0025075_1309_2181 282
827 3300035172 Ga0373955_0094738 Ga0373955_0094738_32_904 282
828 3300035691 Ga0373931_0006320 Ga0373931_0006320_4140_5012 282
829 3300035692 Ga0373935_0219253 Ga0373935_0219253_369_1241 282
830 3300035695 Ga0373927_0003727 Ga0373927_0003727_6691_7563 282
831 3300035695 Ga0373927_0114622 Ga0373927_0114622_146_1018 282
832 3300035724 Ga0373933_0012657 Ga0373933_0012657_1398_2270 282
833 3300035724 Ga0373933_0171054 Ga0373933_0171054_386_1258 282
834 3300035725 Ga0373947_0021592 Ga0373947_0021592_418_1290 282
835 3300036401 Ga0373937_0017394 Ga0373937_0017394_1237_2109 282
836 3300036401 Ga0373937_0211596 Ga0373937_0211596_361_1233 282
837 3300037068 Ga0373925_0106664 Ga0373925_0106664_990_1862 282
838 3300037068 Ga0373925_0297317 Ga0373925_0297317_302_1174 282
839 3300037068 Ga0373925_0384790 Ga0373925_0384790_169_1041 282
840 3300037418 Ga0395900_0183174 Ga0395900_0183174_985_1863 282
841 3300037466 Ga0395898_0085558 Ga0395898_0085558_1626_2498 282
842 3300037471 Ga0395905_0070559 Ga0395905_0070559_453_1325 282
843 3300037471 Ga0395905_0096286 Ga0395905_0096286_1088_1960 282
844 3300041443 Ga0451789_0781606 Ga0451789_0781606_79_951 282
845 3300044684 Ga0466966_0030392 Ga0466966_0030392_2445_3329 282
846 3300045049 Ga0466959_0029672 Ga0466959_0029672_946_1830 282
847 3300045976 Ga0466967_0024550 Ga0466967_0024550_2670_3542 282
848 3300046452 Ga0495617_012208 Ga0495617_012208_1773_2645 282
849 3300046454 Ga0495592_0047510 Ga0495592_0047510_558_1430 282
850 3300046454 Ga0495592_0096467 Ga0495592_0096467_950_1822 282
851 3300046455 Ga0495603_0003728 Ga0495603_0003728_4763_5635 282
852 3300046455 Ga0495603_0087718 Ga0495603_0087718_283_1155 282
853 3300046455 Ga0495603_0172051 Ga0495603_0172051_75_947 282
854 3300046457 Ga0495590_0043598 Ga0495590_0043598_569_1441 282
855 3300046459 Ga0495629_0012976 Ga0495629_0012976_4080_4952 282
856 3300046459 Ga0495629_0188349 Ga0495629_0188349_273_1145 282
857 3300046460 Ga0495638_0042429 Ga0495638_0042429_588_1460 282
858 3300046460 Ga0495638_0213480 Ga0495638_0213480_74_946 282
859 3300046461 Ga0495641_0050540 Ga0495641_0050540_176_1048 282
860 3300046463 Ga0495653_0029817 Ga0495653_0029817_1632_2504 282
861 3300046472 Ga0495580_0126051 Ga0495580_0126051_384_1256 282
862 3300046473 Ga0495582_0105319 Ga0495582_0105319_567_1439 282
863 3300046475 Ga0495639_0022066 Ga0495639_0022066_819_1706 282
864 3300046492 Ga0495585_0054506 Ga0495585_0054506_100_987 282
865 3300046492 Ga0495585_0132400 Ga0495585_0132400_351_1223 282
866 3300046501 Ga0495607_0108264 Ga0495607_0108264_307_1179 282
867 3300046511 Ga0495608_0020001 Ga0495608_0020001_2580_3452 282
868 3300046511 Ga0495608_0035508 Ga0495608_0035508_477_1349 282
869 3300046512 Ga0495610_0062504 Ga0495610_0062504_130_1002 282
870 3300046514 Ga0495618_0035721 Ga0495618_0035721_600_1472 282
871 3300046516 Ga0495628_0003465 Ga0495628_0003465_258_1130 282
872 3300046516 Ga0495628_0086586 Ga0495628_0086586_685_1557 282
873 3300046519 Ga0495632_0083372 Ga0495632_0083372_600_1472 282
874 3300046520 Ga0495637_0022738 Ga0495637_0022738_326_1198 282
875 3300046523 Ga0495644_0027753 Ga0495644_0027753_434_1321 282
876 3300046523 Ga0495644_0075459 Ga0495644_0075459_161_1033 282
877 3300046524 Ga0495648_0003200 Ga0495648_0003200_1345_2217 282
878 3300046524 Ga0495648_0063981 Ga0495648_0063981_14_886 282
879 3300046525 Ga0495663_0030584 Ga0495663_0030584_534_1406 282
880 3300046528 Ga0495642_0059322 Ga0495642_0059322_385_1257 282
881 3300046529 Ga0495652_0069920 Ga0495652_0069920_289_1161 282
882 3300046530 Ga0495654_0073393 Ga0495654_0073393_343_1215 282
883 3300046531 Ga0495665_0070590 Ga0495665_0070590_780_1652 282
884 3300046533 Ga0495640_0010120 Ga0495640_0010120_5707_6579 282
885 3300046536 Ga0495587_0062786 Ga0495587_0062786_1030_1902 282
886 3300046539 Ga0495621_0089462 Ga0495621_0089462_204_1076 282
887 3300046543 Ga0495645_0010485 Ga0495645_0010485_418_1290 282
888 3300046543 Ga0495645_0014817 Ga0495645_0014817_2559_3431 282
889 3300046557 Ga0495622_0017286 Ga0495622_0017286_157_1029 282
890 3300046558 Ga0495633_0116803 Ga0495633_0116803_231_1118 282
891 3300046559 Ga0495667_0007798 Ga0495667_0007798_1967_2839 282
892 3300046615 Ga0495656_0002973 Ga0495656_0002973_1052_1924 282
893 3300046615 Ga0495656_0015117 Ga0495656_0015117_1063_1950 282
894 3300046616 Ga0495668_0050768 Ga0495668_0050768_1090_1968 282
895 3300046642 Ga0495634_0021038 Ga0495634_0021038_1797_2669 282
896 3300046642 Ga0495634_0099675 Ga0495634_0099675_136_1008 282
897 3300046660 Ga0495625_0163978 Ga0495625_0163978_35_907 282
898 3300046660 Ga0495625_0189714 Ga0495625_0189714_264_1136 282
899 3300046663 Ga0495635_0001868 Ga0495635_0001868_10797_11669 282
900 3300046663 Ga0495635_0168155 Ga0495635_0168155_213_1085 282
901 3300046664 Ga0495659_0006735 Ga0495659_0006735_168_1040 282
902 3300046665 Ga0495661_0040977 Ga0495661_0040977_487_1359 282
903 3300046665 Ga0495661_0147899 Ga0495661_0147899_334_1206 282
904 3300046675 Ga0495657_0104274 Ga0495657_0104274_635_1507 282
905 3300046678 Ga0495599_0020349 Ga0495599_0020349_56_928 282
906 3300046679 Ga0495623_0025208 Ga0495623_0025208_1051_1923 282
907 3300046679 Ga0495623_0067334 Ga0495623_0067334_1048_1920 282
908 3300046680 Ga0495646_0024986 Ga0495646_0024986_491_1363 282
909 3300046680 Ga0495646_0033708 Ga0495646_0033708_1959_2831 282
910 3300046689 Ga0495613_0064597 Ga0495613_0064597_818_1690 282
911 3300046689 Ga0495613_0067323 Ga0495613_0067323_1494_2366 282
912 3300046689 Ga0495613_0350029 Ga0495613_0350029_132_1004 282
913 3300046691 Ga0495670_0030236 Ga0495670_0030236_1247_2134 282
914 3300046692 Ga0495671_0072016 Ga0495671_0072016_776_1648 282
915 3300046809 Ga0495600_0017842 Ga0495600_0017842_1137_2009 282
916 3300046809 Ga0495600_0095483 Ga0495600_0095483_344_1216 282
917 3300047315 Ga0495581_0197803 Ga0495581_0197803_20_892 282
918 3300047315 Ga0495581_0253545 Ga0495581_0253545_100_987 282
919 3300047317 Ga0495604_0006243 Ga0495604_0006243_262_1134 282
920 3300047317 Ga0495604_0071809 Ga0495604_0071809_907_1779 282
921 3300047317 Ga0495604_0239433 Ga0495604_0239433_282_1154 282
922 3300047318 Ga0495636_0033052 Ga0495636_0033052_835_1707 282
923 3300047318 Ga0495636_0119699 Ga0495636_0119699_130_1017 282
924 3300047319 Ga0495674_0085620 Ga0495674_0085620_737_1609 282
925 3300047319 Ga0495674_0133635 Ga0495674_0133635_190_1062 282
926 3300047320 Ga0495672_0010170 Ga0495672_0010170_4654_5526 282
927 3300047320 Ga0495672_0077919 Ga0495672_0077919_534_1406 282
928 3300047320 Ga0495672_0078951 Ga0495672_0078951_952_1824 282
929 3300047320 Ga0495672_0102901 Ga0495672_0102901_573_1445 282
930 3300047320 Ga0495672_0135313 Ga0495672_0135313_16_894 282
931 3300047320 Ga0495672_0160184 Ga0495672_0160184_100_972 282
932 3300047322 Ga0495680_0015081 Ga0495680_0015081_2818_3690 282
933 3300047322 Ga0495680_0083270 Ga0495680_0083270_585_1457 282
934 3300047444 Ga0495675_0005364 Ga0495675_0005364_6581_7453 282
935 3300047444 Ga0495675_0044709 Ga0495675_0044709_565_1437 282
936 3300047469 Ga0495673_0030759 Ga0495673_0030759_307_1179 282
937 3300047471 Ga0495684_0006597 Ga0495684_0006597_5251_6123 282
938 3300047471 Ga0495684_0042816 Ga0495684_0042816_1587_2459 282
939 3300047472 Ga0495686_0045908 Ga0495686_0045908_439_1311 282
940 3300047673 Ga0495593_0003761 Ga0495593_0003761_657_1529 282
941 3300048088 Ga0495602_0182433 Ga0495602_0182433_119_991 282
942 3300048903 Ga0496100_0268489 Ga0496100_0268489_330_1202 282
943 3300048904 Ga0496101_0342882 Ga0496101_0342882_222_1094 282
944 3300048905 Ga0496102_0097615 Ga0496102_0097615_411_1283 282
945 3300048905 Ga0496102_0139695 Ga0496102_0139695_523_1395 282
946 3300048907 Ga0496104_0041991 Ga0496104_0041991_911_1783 282
947 3300048907 Ga0496104_0052663 Ga0496104_0052663_1641_2513 282
948 3300048908 Ga0496105_0066881 Ga0496105_0066881_2037_2909 282
949 3300048909 Ga0496106_0001943 Ga0496106_0001943_1942_2814 282
950 3300048909 Ga0496106_0061971 Ga0496106_0061971_493_1365 282
951 3300048910 Ga0496107_0008009 Ga0496107_0008009_365_1237 282
952 3300048911 Ga0496108_0000927 Ga0496108_0000927_13351_14223 282
953 3300048911 Ga0496108_0104573 Ga0496108_0104573_177_1049 282
954 3300048912 Ga0496109_0000229 Ga0496109_0000229_9870_10742 282
955 3300048912 Ga0496109_0104428 Ga0496109_0104428_839_1711 282
956 3300048913 Ga0496110_0364261 Ga0496110_0364261_215_1087 282
957 3300048914 Ga0496111_0175050 Ga0496111_0175050_86_958 282
958 3300048915 Ga0496112_0000018 Ga0496112_0000018_75713_76585 282
959 3300048915 Ga0496112_0001343 Ga0496112_0001343_8729_9601 282
960 3300048915 Ga0496112_0320058 Ga0496112_0320058_53_925 282
961 3300048916 Ga0496113_0017066 Ga0496113_0017066_54_926 282
962 3300048917 Ga0496114_0274275 Ga0496114_0274275_84_956 282
963 3300048918 Ga0496115_0374258 Ga0496115_0374258_117_989 282
964 3300048919 Ga0496116_0009681 Ga0496116_0009681_7074_7946 282
965 3300048920 Ga0496117_0110810 Ga0496117_0110810_21_893 282
966 3300048921 Ga0496118_0108992 Ga0496118_0108992_787_1659 282
967 3300048921 Ga0496118_0165108 Ga0496118_0165108_141_1028 282
968 3300048922 Ga0496119_0033208 Ga0496119_0033208_2168_3040 282
969 3300048922 Ga0496119_0118990 Ga0496119_0118990_495_1367 282
970 3300048923 Ga0496120_0040754 Ga0496120_0040754_51_923 282
971 3300048924 Ga0496121_0000278 Ga0496121_0000278_24330_25202 282
972 3300048924 Ga0496121_0000654 Ga0496121_0000654_12394_13272 282
973 3300048924 Ga0496121_0004075 Ga0496121_0004075_13242_14114 282
974 3300048924 Ga0496121_0025719 Ga0496121_0025719_2080_2952 282
975 3300048924 Ga0496121_0055934 Ga0496121_0055934_548_1420 282
976 3300048924 Ga0496121_0076724 Ga0496121_0076724_837_1709 282
977 3300048924 Ga0496121_0089434 Ga0496121_0089434_819_1706 282
978 3300048924 Ga0496121_0145334 Ga0496121_0145334_764_1636 282
979 3300048924 Ga0496121_0186152 Ga0496121_0186152_523_1395 282
980 3300048925 Ga0496122_0058926 Ga0496122_0058926_1745_2617 282
981 3300048927 Ga0496124_0053161 Ga0496124_0053161_1149_2021 282
982 3300048927 Ga0496124_0251121 Ga0496124_0251121_302_1174 282
983 3300048928 Ga0496125_0000869 Ga0496125_0000869_12105_12977 282
984 3300048928 Ga0496125_0003929 Ga0496125_0003929_7495_8367 282
985 3300048928 Ga0496125_0009814 Ga0496125_0009814_7360_8232 282
986 3300048928 Ga0496125_0055518 Ga0496125_0055518_1321_2196 282
987 3300048929 Ga0496126_0005056 Ga0496126_0005056_5449_6321 282
988 3300048929 Ga0496126_0013259 Ga0496126_0013259_3772_4644 282
989 3300048929 Ga0496126_0021739 Ga0496126_0021739_2233_3105 282
990 3300048929 Ga0496126_0039419 Ga0496126_0039419_2842_3729 282
991 3300048929 Ga0496126_0065601 Ga0496126_0065601_1054_1932 282
992 3300048929 Ga0496126_0476798 Ga0496126_0476798_90_962 282
993 3300049568 Ga0501031_0000207 Ga0501031_0000207_20809_21681 282
994 3300049568 Ga0501031_0000674 Ga0501031_0000674_2486_3358 282
995 3300049568 Ga0501031_0042550 Ga0501031_0042550_2057_2941 282
996 3300049568 Ga0501031_0174922 Ga0501031_0174922_431_1303 282
997 3300049569 Ga0501032_0000252 Ga0501032_0000252_40710_41582 282
998 3300049569 Ga0501032_0002975 Ga0501032_0002975_11485_12357 282
999 3300049569 Ga0501032_0175449 Ga0501032_0175449_16_900 282
1000 3300049569 Ga0501032_0210542 Ga0501032_0210542_208_1080 282
1001 3300049569 Ga0501032_0228662 Ga0501032_0228662_24_908 282
1002 3300049570 Ga0501033_0000082 Ga0501033_0000082_26309_27181 282
1003 3300049570 Ga0501033_0006748 Ga0501033_0006748_17_889 282
1004 3300049570 Ga0501033_0056363 Ga0501033_0056363_380_1252 282
1005 3300049570 Ga0501033_0059881 Ga0501033_0059881_1809_2693 282
1006 3300049570 Ga0501033_0243491 Ga0501033_0243491_24_908 282
1007 3300049571 Ga0501034_0000198 Ga0501034_0000198_15592_16464 282
1008 3300049571 Ga0501034_0066295 Ga0501034_0066295_130_1014 282
1009 3300049571 Ga0501034_0137996 Ga0501034_0137996_730_1602 282
1010 3300049571 Ga0501034_0370474 Ga0501034_0370474_365_1237 282
1011 3300049572 Ga0501036_0001281 Ga0501036_0001281_15382_16254 282
1012 3300049572 Ga0501036_0041485 Ga0501036_0041485_553_1425 282
1013 3300049572 Ga0501036_0070087 Ga0501036_0070087_24_908 282
1014 3300049572 Ga0501036_0089653 Ga0501036_0089653_1354_2235 282
1015 3300049572 Ga0501036_0153984 Ga0501036_0153984_146_1030 282
1016 3300049572 Ga0501036_0296825 Ga0501036_0296825_281_1153 282
1017 3300049573 Ga0501037_0000050 Ga0501037_0000050_17109_17981 282
1018 3300049573 Ga0501037_0001896 Ga0501037_0001896_10373_11245 282
1019 3300049573 Ga0501037_0013075 Ga0501037_0013075_3114_3992 282
1020 3300049573 Ga0501037_0065242 Ga0501037_0065242_35_919 282
1021 3300049573 Ga0501037_0126416 Ga0501037_0126416_848_1720 282
1022 3300049574 Ga0501038_0000538 Ga0501038_0000538_15592_16464 282
1023 3300049574 Ga0501038_0000630 Ga0501038_0000630_6854_7861 282
1024 3300049574 Ga0501038_0021325 Ga0501038_0021325_3393_4265 282
1025 3300049574 Ga0501038_0069455 Ga0501038_0069455_17_889 282
1026 3300049574 Ga0501038_0108190 Ga0501038_0108190_885_1769 282
1027 3300049574 Ga0501038_0184478 Ga0501038_0184478_447_1331 282
1028 3300049575 Ga0501039_0000366 Ga0501039_0000366_5955_6827 282
1029 3300049575 Ga0501039_0042730 Ga0501039_0042730_561_1445 282
1030 3300049575 Ga0501039_0207574 Ga0501039_0207574_451_1323 282
1031 3300049575 Ga0501039_0209073 Ga0501039_0209073_228_1100 282
1032 3300049577 Ga0501041_0105409 Ga0501041_0105409_97_969 282
1033 3300049578 Ga0501042_0017539 Ga0501042_0017539_3971_4843 282
1034 3300049578 Ga0501042_0042451 Ga0501042_0042451_2277_3161 282
1035 3300049579 Ga0501043_0002344 Ga0501043_0002344_11491_12363 282
1036 3300049579 Ga0501043_0003664 Ga0501043_0003664_10456_11328 282
1037 3300049579 Ga0501043_0061870 Ga0501043_0061870_775_1659 282
1038 3300049579 Ga0501043_0087805 Ga0501043_0087805_679_1563 282
1039 3300049579 Ga0501043_0217731 Ga0501043_0217731_389_1261 282
1040 3300049580 Ga0501046_0000434 Ga0501046_0000434_1950_2822 282
1041 3300049580 Ga0501046_0030471 Ga0501046_0030471_3330_4214 282
1042 3300049580 Ga0501046_0049305 Ga0501046_0049305_55_927 282
1043 3300049581 Ga0501047_0000131 Ga0501047_0000131_33981_34853 282
1044 3300049581 Ga0501047_0092774 Ga0501047_0092774_1989_2861 282
1045 3300049581 Ga0501047_0095805 Ga0501047_0095805_1776_2663 282
1046 3300049581 Ga0501047_0183102 Ga0501047_0183102_481_1365 282
1047 3300049581 Ga0501047_0268941 Ga0501047_0268941_646_1518 282
1048 3300049581 Ga0501047_0399434 Ga0501047_0399434_107_991 282
1049 3300049582 Ga0501048_0000531 Ga0501048_0000531_19942_20814 282
1050 3300049582 Ga0501048_0020580 Ga0501048_0020580_476_1360 282
1051 3300049583 Ga0501067_0000628 Ga0501067_0000628_769_1641 282
1052 3300049583 Ga0501067_0004783 Ga0501067_0004783_5813_6697 282
1053 3300049584 Ga0501068_0011209 Ga0501068_0011209_489_1361 282
1054 3300049585 Ga0501069_0001211 Ga0501069_0001211_5190_6062 282
1055 3300049586 Ga0501070_0005971 Ga0501070_0005971_7324_8196 282
1056 3300049586 Ga0501070_0039960 Ga0501070_0039960_617_1501 282
1057 3300049586 Ga0501070_0260973 Ga0501070_0260973_79_951 282
1058 3300049588 Ga0501072_0000378 Ga0501072_0000378_12061_12933 282
1059 3300049588 Ga0501072_0203018 Ga0501072_0203018_485_1369 282
1060 3300049589 Ga0501073_0029767 Ga0501073_0029767_218_1090 282
1061 3300049589 Ga0501073_0103023 Ga0501073_0103023_916_1788 282
1062 3300049590 Ga0501074_0003814 Ga0501074_0003814_9750_10622 282
1063 3300049590 Ga0501074_0018155 Ga0501074_0018155_1883_2767 282
1064 3300049590 Ga0501074_0070660 Ga0501074_0070660_511_1383 282
1065 3300049741 Ga0501079_0001399 Ga0501079_0001399_14684_15556 282
1066 3300049742 Ga0501080_0009398 Ga0501080_0009398_7102_7974 282
1067 3300049744 Ga0501083_0000341 Ga0501083_0000341_19338_20210 282
1068 3300049744 Ga0501083_0060526 Ga0501083_0060526_68_952 282
1069 3300049822 Ga0501035_0000123 Ga0501035_0000123_81635_82507 282
1070 3300049822 Ga0501035_0005862 Ga0501035_0005862_6540_7412 282
1071 3300049822 Ga0501035_0093321 Ga0501035_0093321_288_1172 282
1072 3300049822 Ga0501035_0173882 Ga0501035_0173882_474_1346 282
1073 3300049822 Ga0501035_0180926 Ga0501035_0180926_47_931 282
1074 3300049822 Ga0501035_0206075 Ga0501035_0206075_415_1287 282
1075 3300049823 Ga0501044_0000100 Ga0501044_0000100_67743_68615 282
1076 3300049823 Ga0501044_0039767 Ga0501044_0039767_963_1847 282
1077 3300049823 Ga0501044_0113578 Ga0501044_0113578_637_1509 282
1078 3300049823 Ga0501044_0214949 Ga0501044_0214949_846_1718 282
1079 3300049824 Ga0501045_0009959 Ga0501045_0009959_2623_3507 282
1080 3300049824 Ga0501045_0022359 Ga0501045_0022359_3478_4350 282
1081 3300050492 nmdc:mga0yw44_153826_c1 nmdc:mga0yw44_153826_c1_232_1104 282
1082 3300050493 nmdc:mga0k408_130449_c1 nmdc:mga0k408_130449_c1_454_1326 282
1083 3300050493 nmdc:mga0k408_63841_c2 nmdc:mga0k408_63841_c2_19_891 282
1084 3300050494 nmdc:mga06z11_177617_c1 nmdc:mga06z11_177617_c1_61_933 282
1085 3300050495 nmdc:mga04h51_11839_c1 nmdc:mga04h51_11839_c1_1176_2048 282
1086 3300050495 nmdc:mga04h51_42469_c1 nmdc:mga04h51_42469_c1_240_1112 282
1087 3300050496 nmdc:mga07m45_119498_c1 nmdc:mga07m45_119498_c1_46_918 282
1088 3300050496 nmdc:mga07m45_143090_c1 nmdc:mga07m45_143090_c1_245_1120 282
1089 3300050496 nmdc:mga07m45_215146_c1 nmdc:mga07m45_215146_c1_141_1013 282
1090 3300050496 nmdc:mga07m45_3103_c1 nmdc:mga07m45_3103_c1_2833_3705 282
1091 3300050511 nmdc:mga08y16_199419_c1 nmdc:mga08y16_199419_c1_1180_2052 282
1092 3300050511 nmdc:mga08y16_42067_c1 nmdc:mga08y16_42067_c1_2648_3520 282
1093 3300050513 nmdc:mga0rr50_99236_c1 nmdc:mga0rr50_99236_c1_216_1088 282
1094 3300050516 nmdc:mga0sz30_19967_c1 nmdc:mga0sz30_19967_c1_445_1320 282
1095 3300053078 Ga0495612_0062897 Ga0495612_0062897_211_1083 282
1096 3300053083 Ga0495655_0058021 Ga0495655_0058021_23_895 282
1097 3300053085 Ga0495619_0028554 Ga0495619_0028554_1245_2117 282
1098 3300053090 Ga0500646_0087203 Ga0500646_0087203_41_913 282
1099 3300053092 Ga0500583_0100611 Ga0500583_0100611_339_1211 282
1100 3300053093 Ga0500651_0069761 Ga0500651_0069761_10_882 282
1101 3300053093 Ga0500651_0128499 Ga0500651_0128499_89_961 282
1102 3300053094 Ga0500566_0006857 Ga0500566_0006857_2892_3764 282
1103 3300053094 Ga0500566_0016736 Ga0500566_0016736_483_1355 282
1104 3300053098 Ga0500650_0050150 Ga0500650_0050150_391_1263 282
1105 3300053098 Ga0500650_0146655 Ga0500650_0146655_71_958 282
1106 3300053102 Ga0500554_005159 Ga0500554_005159_1739_2611 282
1107 3300053103 Ga0500555_057288 Ga0500555_057288_129_1001 282
1108 3300053109 Ga0500569_001078 Ga0500569_001078_884_1756 282
1109 3300053119 Ga0500595_001968 Ga0500595_001968_5341_6228 282
1110 3300053119 Ga0500595_002686 Ga0500595_002686_69_941 282
1111 3300053119 Ga0500595_007413 Ga0500595_007413_1587_2459 282
1112 3300053119 Ga0500595_026838 Ga0500595_026838_1034_1906 282
1113 3300053119 Ga0500595_042387 Ga0500595_042387_190_1077 282
1114 3300053121 Ga0500607_069800 Ga0500607_069800_65_937 282
1115 3300053122 Ga0500608_000949 Ga0500608_000949_6097_6969 282
1116 3300053125 Ga0500618_005453 Ga0500618_005453_115_987 282
1117 3300053130 Ga0500642_0000042 Ga0500642_0000042_43821_44699 282
1118 3300053130 Ga0500642_0058519 Ga0500642_0058519_175_1062 282
1119 3300053136 Ga0500559_0000106 Ga0500559_0000106_50022_50894 282
1120 3300053139 Ga0500568_0139346 Ga0500568_0139346_14_886 282
1121 3300053142 Ga0500577_0009194 Ga0500577_0009194_1812_2684 282
1122 3300053142 Ga0500577_0150528 Ga0500577_0150528_44_916 282
1123 3300053146 Ga0500588_0100585 Ga0500588_0100585_23_910 282
1124 3300053147 Ga0500589_079745 Ga0500589_079745_418_1290 282
1125 3300053148 Ga0500590_026483 Ga0500590_026483_1006_1878 282
1126 3300053148 Ga0500590_054115 Ga0500590_054115_975_1847 282
1127 3300053150 Ga0500603_013476 Ga0500603_013476_29_901 282
1128 3300053151 Ga0500604_0019202 Ga0500604_0019202_824_1696 282
1129 3300053153 Ga0500616_0000227 Ga0500616_0000227_44900_45772 282
1130 3300053160 Ga0500633_0138491 Ga0500633_0138491_17_889 282
1131 3300053162 Ga0500638_002787 Ga0500638_002787_990_1862 282
1132 3300053178 Ga0500637_0000180 Ga0500637_0000180_8732_9604 282
1133 3300053178 Ga0500637_0011782 Ga0500637_0011782_2300_3172 282
1134 3300053730 Ga0500645_047381 Ga0500645_047381_59_931 282
1135 3300053731 Ga0500609_007813 Ga0500609_007813_494_1366 282
1136 3300054114 Ga0501084_0019061 Ga0501084_0019061_4731_5603 282
1137 3300054114 Ga0501084_0135809 Ga0501084_0135809_693_1577 282
1138 3300060353 Ga0501082_0001776 Ga0501082_0001776_5253_6125 282
1139 3300060353 Ga0501082_0022020 Ga0501082_0022020_4117_5001 282

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01678

DAP_epimerase

Diaminopimelate epimerase

205

321

0.97

PF01678

DAP_epimerase

Diaminopimelate epimerase

54

172

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ejx-assembly5.cif.gz_D crystal structure of diaminopimelate epimerase from arabidopsis thaliana in complex with ll-azidap 0.9157 7 271
7vdy-assembly1.cif.gz_B crystal structure of o-ureidoserine racemase 0.8742 5 273
3ejx-assembly5.cif.gz_D crystal structure of diaminopimelate epimerase from arabidopsis thaliana in complex with ll-azidap 0.8595 7 271
7vdy-assembly1.cif.gz_B crystal structure of o-ureidoserine racemase 0.8422 5 273
5ha4-assembly1.cif.gz_A structure of a diaminopimelate epimerase from acinetobacter baumannii 0.8335 7 278
ID Description Score Start End Superfamily
af_Q55GS8_377_492_3.10.310.10 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.9433 158 261 3.10.310.10
af_P0A6K1_1_112_3.10.310.10 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.8992 9 113 3.10.310.10
3ejxD01 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.8852 7 122 3.10.310.10
2q9jA01 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.8824 8 113 3.10.310.10
3ejxA01 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.8791 7 108 3.10.310.10
ID Description Score Start End GO Terms
AF-Q1QHJ3-F1-model_v4 Diaminopimelate epimerase (DAP epimerase) (EC 5.1.1.7) (PLP-independent amino acid racemase) 0.9887 1 282 GO:0005829
GO:0008837
GO:0009089
AF-Q1QHJ3-F1-model_v4 Diaminopimelate epimerase (DAP epimerase) (EC 5.1.1.7) (PLP-independent amino acid racemase) 0.9852 1 282 GO:0005829
GO:0008837
GO:0009089
AF-A4YKA5-F1-model_v4 Diaminopimelate epimerase (DAP epimerase) (EC 5.1.1.7) (PLP-independent amino acid racemase) 0.9773 1 282 GO:0005829
GO:0008837
GO:0009089
AF-Q13DT7-F1-model_v4 Diaminopimelate epimerase (DAP epimerase) (EC 5.1.1.7) (PLP-independent amino acid racemase) 0.9764 1 281 GO:0005829
GO:0008837
GO:0009089
AF-A4YKA5-F1-model_v4 Diaminopimelate epimerase (DAP epimerase) (EC 5.1.1.7) (PLP-independent amino acid racemase) 0.9739 1 282 GO:0005829
GO:0008837
GO:0009089

Feature Viewer

pLDDT pTM Quality
91.14 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map