F490686
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1139 | 491 | 1086 | 286 |
Family's Representative Sequence
| Representative Sequence | 3300049574|Ga0501038_0000630|Ga0501038_0000630_6854_7861 |
| Length | 335 |
| Sequence | MSCPIVAGVGRRPDIALTVPDAGRWPIAGYSPYKAEDGRRKMDAGMGALANHAFSKMNGIGNEIVVVDLRDSAATVTAEEARAIASPAGVPYDQLMVLQPPLTPRTEAFVRIYNNDGSEANACGNGMRCVARQVFEATGKTVLTFETRAGLLNCWRGSTHGFYTVDMGLPKFDWRDIPLAEEFRDTRYIELQVGPIEKPVLHSPSVVSMGNPHAIFWVDDVNAYDLERFGPLLENHPIFPERANITLAHIVDRDHIVMRTWERGVGLTKACGSAACATAVAAARLKRTNRTVEMLLPGGGLTIEWCEHGDHVMMTGPAVFEYAGRFDPALFTPVA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 2 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 3 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 4 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 5 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 6 | 2523231067 | Pleomorphomonas oryzae DSM 16300 | Isolate | Unclassified |
| 7 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 8 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 9 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 10 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 11 | 2671180139 | Chelativorans sp. A52C2 | Isolate | Unclassified |
| 12 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 13 | 2738543031 | Pleomorphomonas sp. CF100 | Isolate | Unclassified |
| 14 | 2791355199 | |||
| 15 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 16 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 17 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 18 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 19 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 20 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 21 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 22 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 23 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 24 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 25 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 26 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 27 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 28 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 29 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 30 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 31 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 32 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 33 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 34 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 35 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 36 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 37 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 38 | 2917554339 | Chthonobacter rhizosphaerae yh7-1 | Isolate | Rhizosphere |
| 39 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 40 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 41 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 42 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 43 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 44 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 45 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 46 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 47 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 48 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 49 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 50 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 51 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 52 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 53 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 54 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 55 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 58 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 60 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 61 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 62 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 63 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 65 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 74 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 76 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 77 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 80 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 84 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 85 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 86 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 87 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 88 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 89 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 90 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 91 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 92 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 96 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 97 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 99 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 100 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 101 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 102 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 103 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 104 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 105 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 106 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 107 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 108 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 109 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 110 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 111 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 112 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 113 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 114 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 115 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 116 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 117 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 118 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 119 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 120 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 121 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 122 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 123 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 124 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 125 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 126 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 128 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 129 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 130 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 131 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 132 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 133 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 134 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 135 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 137 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 138 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 139 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 146 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 147 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 148 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 149 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 150 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 151 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 152 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 153 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 164 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 165 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 166 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 167 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 168 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 169 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 170 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 226 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 227 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 231 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 232 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 233 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 234 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 235 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 236 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 237 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 238 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 239 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 240 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 241 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 242 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 243 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 244 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 245 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 246 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 247 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 248 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 249 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 250 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 251 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 252 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 253 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 254 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 255 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 256 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 257 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 258 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 259 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 260 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 261 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 262 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 263 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 264 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 265 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 266 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 267 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 268 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 269 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 270 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 271 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 272 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 273 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 274 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 275 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 276 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 277 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 278 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 279 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 280 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 281 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 282 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 283 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 284 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 285 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 286 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 287 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 288 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 289 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 290 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 291 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 292 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 293 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 294 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 295 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 296 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 375 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 376 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 377 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 378 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 379 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 380 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 381 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 382 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 383 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 384 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 385 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 386 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 387 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 388 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 389 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 390 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 391 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 392 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 393 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 394 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 395 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 396 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 397 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 398 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 399 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 400 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 401 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 402 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 403 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 404 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 405 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 406 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 407 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 408 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 409 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 410 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 411 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 412 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 413 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 414 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 415 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 416 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 417 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 418 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 419 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 420 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 421 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 422 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 423 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 424 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 425 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 426 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 427 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 428 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 429 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 430 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 431 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 432 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 433 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 434 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 435 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 436 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 437 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 438 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 439 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 440 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 441 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 442 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 443 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 444 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 445 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 446 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 447 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 448 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 449 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 450 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 451 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 452 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 453 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 454 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 455 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 456 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 457 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 458 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 459 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 460 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 461 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 462 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 463 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 464 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 465 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 466 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 467 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 468 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 469 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 470 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 471 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 472 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 473 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 474 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 475 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 476 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 477 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 478 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 479 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 480 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 481 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 482 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 483 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 484 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 485 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 486 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 487 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 488 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 489 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 490 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 491 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.34 |
| Metatranscriptomes | 0.09 |
| Isolates | 4.57 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.17 |
| Nodule | 2.63 |
| Rhizoplane | 4.74 |
| Rhizosphere | 76.82 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.64 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10006878 | 3300001979 | Bacteria | 4670 |
| 2 | JGI24737J22298_10015483 | 3300001990 | Bacteria | 2469 |
| 3 | JGI24744J21845_10026309 | 3300002077 | Bacteria | 1130 |
| 4 | JGI25153J46596_10043278 | 3300003215 | Bacteria | 1365 |
| 5 | JGI25160J50197_1007581 | 3300003354 | Bacteria | 4232 |
| 6 | JGI25404J52841_10001804 | 3300003659 | Bacteria | 3886 |
| 7 | JGI25404J52841_10008798 | 3300003659 | Unclassified | 2156 |
| 8 | JGI25404J52841_10017513 | 3300003659 | Bacteria | 1553 |
| 9 | Ga0070658_10377518 | 3300005327 | Bacteria | 1216 |
| 10 | Ga0070683_100070525 | 3300005329 | Bacteria | 3260 |
| 11 | Ga0070690_100081395 | 3300005330 | Bacteria | 2119 |
| 12 | Ga0070670_100179008 | 3300005331 | Bacteria | 1840 |
| 13 | Ga0068869_100044714 | 3300005334 | Bacteria | 3185 |
| 14 | Ga0070680_100022603 | 3300005336 | Bacteria | 5011 |
| 15 | Ga0070680_100046810 | 3300005336 | Bacteria | 3519 |
| 16 | Ga0070680_100098721 | 3300005336 | Bacteria | 2423 |
| 17 | Ga0070682_100001898 | 3300005337 | Bacteria | 11671 |
| 18 | Ga0068868_100016512 | 3300005338 | Bacteria | 5484 |
| 19 | Ga0070660_100008345 | 3300005339 | Bacteria | 7242 |
| 20 | Ga0070660_100265323 | 3300005339 | Bacteria | 1403 |
| 21 | Ga0070660_100301020 | 3300005339 | Bacteria | 1315 |
| 22 | Ga0070691_10003421 | 3300005341 | Bacteria | 7133 |
| 23 | Ga0070691_10038245 | 3300005341 | Bacteria | 2265 |
| 24 | Ga0070668_100134018 | 3300005347 | Bacteria | 1990 |
| 25 | Ga0070668_100187291 | 3300005347 | Bacteria | 1693 |
| 26 | Ga0070669_100040796 | 3300005353 | Bacteria | 3374 |
| 27 | Ga0070675_100142137 | 3300005354 | Bacteria | 2052 |
| 28 | Ga0070671_100073962 | 3300005355 | Bacteria | 2846 |
| 29 | Ga0070674_100154706 | 3300005356 | Bacteria | 1734 |
| 30 | Ga0070673_100218483 | 3300005364 | Bacteria | 1649 |
| 31 | Ga0070673_100277068 | 3300005364 | Bacteria | 1470 |
| 32 | Ga0070659_100038851 | 3300005366 | Bacteria | 3713 |
| 33 | Ga0070659_100039277 | 3300005366 | Bacteria | 3694 |
| 34 | Ga0070667_100624676 | 3300005367 | Bacteria | 994 |
| 35 | Ga0070667_100660470 | 3300005367 | Bacteria | 966 |
| 36 | Ga0070709_10014835 | 3300005434 | Bacteria | 4417 |
| 37 | Ga0070709_10056369 | 3300005434 | Bacteria | 2484 |
| 38 | Ga0070714_100011934 | 3300005435 | Bacteria | 6911 |
| 39 | Ga0070714_100112182 | 3300005435 | Bacteria | 2416 |
| 40 | Ga0070713_100003576 | 3300005436 | Bacteria | 10269 |
| 41 | Ga0070713_100016739 | 3300005436 | Bacteria | 5520 |
| 42 | Ga0070713_100020074 | 3300005436 | Bacteria | 5115 |
| 43 | Ga0070713_100103980 | 3300005436 | Bacteria | 2465 |
| 44 | Ga0070710_10001532 | 3300005437 | Bacteria | 10922 |
| 45 | Ga0070710_10003996 | 3300005437 | Bacteria | 6992 |
| 46 | Ga0070710_10024153 | 3300005437 | Bacteria | 3204 |
| 47 | Ga0070710_10035594 | 3300005437 | Bacteria | 2716 |
| 48 | Ga0070711_100008302 | 3300005439 | Bacteria | 6355 |
| 49 | Ga0070711_100009673 | 3300005439 | Bacteria | 5940 |
| 50 | Ga0070711_100012351 | 3300005439 | Bacteria | 5332 |
| 51 | Ga0070711_100072636 | 3300005439 | Bacteria | 2428 |
| 52 | Ga0070711_100102931 | 3300005439 | Bacteria | 2080 |
| 53 | Ga0070711_100179985 | 3300005439 | Bacteria | 1618 |
| 54 | Ga0070705_100077274 | 3300005440 | Bacteria | 2033 |
| 55 | Ga0070700_100017526 | 3300005441 | Bacteria | 4099 |
| 56 | Ga0070663_100026672 | 3300005455 | Bacteria | 3915 |
| 57 | Ga0070663_100199834 | 3300005455 | Bacteria | 1559 |
| 58 | Ga0070663_100206617 | 3300005455 | Bacteria | 1535 |
| 59 | Ga0070663_100361217 | 3300005455 | Bacteria | 1178 |
| 60 | Ga0070678_100034660 | 3300005456 | Bacteria | 3517 |
| 61 | Ga0070662_100262216 | 3300005457 | Bacteria | 1392 |
| 62 | Ga0070681_10002937 | 3300005458 | Bacteria | 15801 |
| 63 | Ga0070681_10277524 | 3300005458 | Bacteria | 1587 |
| 64 | Ga0070681_10306009 | 3300005458 | Bacteria | 1499 |
| 65 | Ga0068867_100423905 | 3300005459 | Bacteria | 1128 |
| 66 | Ga0070706_100082929 | 3300005467 | Bacteria | 2970 |
| 67 | Ga0070698_100321192 | 3300005471 | Bacteria | 1479 |
| 68 | Ga0070679_100002400 | 3300005530 | Bacteria | 16984 |
| 69 | Ga0070679_100003447 | 3300005530 | Bacteria | 14478 |
| 70 | Ga0070679_100030485 | 3300005530 | Bacteria | 5324 |
| 71 | Ga0070679_100561122 | 3300005530 | Bacteria | 1085 |
| 72 | Ga0070684_100025298 | 3300005535 | Bacteria | 4988 |
| 73 | Ga0070684_100043767 | 3300005535 | Bacteria | 3869 |
| 74 | Ga0070697_100099077 | 3300005536 | Bacteria | 2419 |
| 75 | Ga0068853_100000639 | 3300005539 | Bacteria | 23990 |
| 76 | Ga0068853_100003310 | 3300005539 | Bacteria | 12327 |
| 77 | Ga0068853_100038170 | 3300005539 | Bacteria | 4090 |
| 78 | Ga0068853_100039338 | 3300005539 | Bacteria | 4033 |
| 79 | Ga0068853_100059209 | 3300005539 | Bacteria | 3308 |
| 80 | Ga0068853_100190008 | 3300005539 | Bacteria | 1865 |
| 81 | Ga0070695_100120591 | 3300005545 | Bacteria | 1793 |
| 82 | Ga0070696_100026887 | 3300005546 | Bacteria | 3916 |
| 83 | Ga0070693_100034913 | 3300005547 | Bacteria | 2785 |
| 84 | Ga0070665_100029471 | 3300005548 | Bacteria | 5524 |
| 85 | Ga0070665_100031667 | 3300005548 | Bacteria | 5322 |
| 86 | Ga0070665_100091913 | 3300005548 | Bacteria | 3039 |
| 87 | Ga0070704_100336465 | 3300005549 | Bacteria | 1270 |
| 88 | Ga0068855_100026317 | 3300005563 | Bacteria | 6959 |
| 89 | Ga0068855_100030888 | 3300005563 | Bacteria | 6402 |
| 90 | Ga0068855_100053234 | 3300005563 | Bacteria | 4763 |
| 91 | Ga0068855_100060155 | 3300005563 | Bacteria | 4443 |
| 92 | Ga0068855_100112279 | 3300005563 | Bacteria | 3127 |
| 93 | Ga0068855_100112294 | 3300005563 | Bacteria | 3127 |
| 94 | Ga0068855_100153539 | 3300005563 | Bacteria | 2617 |
| 95 | Ga0070664_100227804 | 3300005564 | Bacteria | 1670 |
| 96 | Ga0068857_100001037 | 3300005577 | Bacteria | 21487 |
| 97 | Ga0068857_100033794 | 3300005577 | Bacteria | 4522 |
| 98 | Ga0068857_100037870 | 3300005577 | Bacteria | 4273 |
| 99 | Ga0068857_100443105 | 3300005577 | Bacteria | 1213 |
| 100 | Ga0068854_100001597 | 3300005578 | Bacteria | 13790 |
| 101 | Ga0068854_100019432 | 3300005578 | Bacteria | 4578 |
| 102 | Ga0068854_100102280 | 3300005578 | Bacteria | 2149 |
| 103 | Ga0068854_100178383 | 3300005578 | Bacteria | 1658 |
| 104 | Ga0068854_100223513 | 3300005578 | Bacteria | 1491 |
| 105 | Ga0068856_100000883 | 3300005614 | Bacteria | 32112 |
| 106 | Ga0068856_100012184 | 3300005614 | Bacteria | 8332 |
| 107 | Ga0068856_100155809 | 3300005614 | Bacteria | 2294 |
| 108 | Ga0068856_100488926 | 3300005614 | Bacteria | 1252 |
| 109 | Ga0068852_100030003 | 3300005616 | Bacteria | 4472 |
| 110 | Ga0068852_100116544 | 3300005616 | Bacteria | 2437 |
| 111 | Ga0068859_100047861 | 3300005617 | Bacteria | 4296 |
| 112 | Ga0068859_100379973 | 3300005617 | Bacteria | 1508 |
| 113 | Ga0068859_100667026 | 3300005617 | Bacteria | 1131 |
| 114 | Ga0068864_100033808 | 3300005618 | Bacteria | 4347 |
| 115 | Ga0068861_100037920 | 3300005719 | Bacteria | 3584 |
| 116 | Ga0068861_100052285 | 3300005719 | Bacteria | 3104 |
| 117 | Ga0068861_100141285 | 3300005719 | Bacteria | 1965 |
| 118 | Ga0068861_100368396 | 3300005719 | Bacteria | 1265 |
| 119 | Ga0068861_100637789 | 3300005719 | Bacteria | 982 |
| 120 | Ga0068851_10000558 | 3300005834 | Bacteria | 16219 |
| 121 | Ga0068851_10015981 | 3300005834 | Bacteria | 3584 |
| 122 | Ga0068870_10053768 | 3300005840 | Bacteria | 2140 |
| 123 | Ga0068858_100069349 | 3300005842 | Bacteria | 3268 |
| 124 | Ga0068858_100178809 | 3300005842 | Bacteria | 2002 |
| 125 | Ga0068858_100297313 | 3300005842 | Bacteria | 1540 |
| 126 | Ga0068860_100000477 | 3300005843 | Bacteria | 49839 |
| 127 | Ga0068862_100040785 | 3300005844 | Bacteria | 3947 |
| 128 | Ga0068862_100094520 | 3300005844 | Bacteria | 2607 |
| 129 | Ga0068862_100102424 | 3300005844 | Bacteria | 2506 |
| 130 | Ga0081455_10000209 | 3300005937 | Bacteria | 74597 |
| 131 | Ga0081455_10005086 | 3300005937 | Bacteria | 14513 |
| 132 | Ga0081455_10007370 | 3300005937 | Bacteria | 11598 |
| 133 | Ga0081455_10007381 | 3300005937 | Bacteria | 11587 |
| 134 | Ga0081455_10109474 | 3300005937 | Bacteria | 2198 |
| 135 | Ga0081455_10354979 | 3300005937 | Bacteria | 1033 |
| 136 | Ga0081538_10074134 | 3300005981 | Bacteria | 1854 |
| 137 | Ga0081540_1000064 | 3300005983 | Bacteria | 119429 |
| 138 | Ga0081540_1003488 | 3300005983 | Bacteria | 12411 |
| 139 | Ga0081540_1008854 | 3300005983 | Bacteria | 6988 |
| 140 | Ga0081540_1012184 | 3300005983 | Bacteria | 5686 |
| 141 | Ga0081540_1048845 | 3300005983 | Bacteria | 2116 |
| 142 | Ga0081539_10018659 | 3300005985 | Bacteria | 4799 |
| 143 | Ga0070717_10016786 | 3300006028 | Bacteria | 5683 |
| 144 | Ga0070717_10041403 | 3300006028 | Bacteria | 3755 |
| 145 | Ga0070717_10119310 | 3300006028 | Bacteria | 2258 |
| 146 | Ga0070717_10231831 | 3300006028 | Bacteria | 1626 |
| 147 | Ga0075365_10106354 | 3300006038 | Bacteria | 1925 |
| 148 | Ga0075368_10064243 | 3300006042 | Bacteria | 1473 |
| 149 | Ga0075368_10088191 | 3300006042 | Bacteria | 1267 |
| 150 | Ga0075363_100004174 | 3300006048 | Bacteria | 6275 |
| 151 | Ga0075363_100082345 | 3300006048 | Bacteria | 1761 |
| 152 | Ga0075363_100123090 | 3300006048 | Bacteria | 1450 |
| 153 | Ga0075364_10018451 | 3300006051 | Bacteria | 4367 |
| 154 | Ga0075364_10034501 | 3300006051 | Bacteria | 3265 |
| 155 | Ga0075364_10057410 | 3300006051 | Bacteria | 2549 |
| 156 | Ga0075432_10048537 | 3300006058 | Bacteria | 1494 |
| 157 | Ga0070715_10000275 | 3300006163 | Bacteria | 12448 |
| 158 | Ga0070715_10009900 | 3300006163 | Bacteria | 3378 |
| 159 | Ga0070715_10090401 | 3300006163 | Bacteria | 1408 |
| 160 | Ga0070715_10213345 | 3300006163 | Bacteria | 988 |
| 161 | Ga0070716_100007369 | 3300006173 | Bacteria | 5411 |
| 162 | Ga0070716_100218767 | 3300006173 | Bacteria | 1278 |
| 163 | Ga0070716_100227526 | 3300006173 | Bacteria | 1257 |
| 164 | Ga0070712_100002530 | 3300006175 | Bacteria | 11286 |
| 165 | Ga0070712_100034544 | 3300006175 | Bacteria | 3427 |
| 166 | Ga0070712_100065297 | 3300006175 | Bacteria | 2583 |
| 167 | Ga0070712_100102723 | 3300006175 | Bacteria | 2118 |
| 168 | Ga0070712_100146083 | 3300006175 | Bacteria | 1810 |
| 169 | Ga0075362_10020405 | 3300006177 | Bacteria | 2768 |
| 170 | Ga0075362_10041956 | 3300006177 | Bacteria | 2020 |
| 171 | Ga0075367_10005424 | 3300006178 | Bacteria | 6332 |
| 172 | Ga0075367_10049481 | 3300006178 | Bacteria | 2478 |
| 173 | Ga0075367_10110837 | 3300006178 | Bacteria | 1684 |
| 174 | Ga0075369_10009037 | 3300006186 | Bacteria | 3857 |
| 175 | Ga0097621_100339564 | 3300006237 | Bacteria | 1334 |
| 176 | Ga0097621_100451914 | 3300006237 | Bacteria | 1158 |
| 177 | Ga0075370_10022430 | 3300006353 | Bacteria | 3468 |
| 178 | Ga0075370_10102322 | 3300006353 | Bacteria | 1659 |
| 179 | Ga0075428_100003141 | 3300006844 | Bacteria | 18043 |
| 180 | Ga0075428_100128112 | 3300006844 | Bacteria | 2761 |
| 181 | Ga0075428_100532983 | 3300006844 | Bacteria | 1256 |
| 182 | Ga0075431_100000568 | 3300006847 | Bacteria | 31187 |
| 183 | Ga0075431_100001629 | 3300006847 | Bacteria | 20981 |
| 184 | Ga0075431_100266627 | 3300006847 | Bacteria | 1737 |
| 185 | Ga0075433_10004977 | 3300006852 | Bacteria | 10404 |
| 186 | Ga0075433_10045558 | 3300006852 | Bacteria | 3813 |
| 187 | Ga0075433_10250376 | 3300006852 | Bacteria | 1572 |
| 188 | Ga0075434_100028319 | 3300006871 | Bacteria | 5503 |
| 189 | Ga0075434_100040930 | 3300006871 | Bacteria | 4588 |
| 190 | Ga0075434_100056552 | 3300006871 | Bacteria | 3898 |
| 191 | Ga0075434_100072031 | 3300006871 | Bacteria | 3448 |
| 192 | Ga0075429_100003175 | 3300006880 | Bacteria | 13972 |
| 193 | Ga0068865_100292659 | 3300006881 | Bacteria | 1300 |
| 194 | Ga0075436_100068860 | 3300006914 | Bacteria | 2445 |
| 195 | Ga0097620_100047862 | 3300006931 | Bacteria | 4296 |
| 196 | Ga0097620_100379954 | 3300006931 | Bacteria | 1508 |
| 197 | Ga0097620_100666967 | 3300006931 | Bacteria | 1131 |
| 198 | Ga0075435_100051643 | 3300007076 | Bacteria | 3312 |
| 199 | Ga0075435_100076669 | 3300007076 | Bacteria | 2740 |
| 200 | Ga0075435_100078601 | 3300007076 | Bacteria | 2706 |
| 201 | Ga0075435_100518438 | 3300007076 | Bacteria | 1031 |
| 202 | Ga0099794_10001485 | 3300007265 | Bacteria | 8212 |
| 203 | Ga0099794_10036912 | 3300007265 | Bacteria | 2312 |
| 204 | Ga0099795_10080197 | 3300007788 | Bacteria | 1247 |
| 205 | Ga0105240_10002459 | 3300009093 | Bacteria | 29768 |
| 206 | Ga0105240_10062589 | 3300009093 | Bacteria | 4632 |
| 207 | Ga0105240_10087076 | 3300009093 | Bacteria | 3825 |
| 208 | Ga0105240_10170354 | 3300009093 | Bacteria | 2579 |
| 209 | Ga0111539_10001515 | 3300009094 | Bacteria | 31011 |
| 210 | Ga0111539_10066626 | 3300009094 | Bacteria | 4253 |
| 211 | Ga0111539_10091971 | 3300009094 | Bacteria | 3564 |
| 212 | Ga0111539_10246033 | 3300009094 | Bacteria | 2082 |
| 213 | Ga0111539_10254754 | 3300009094 | Bacteria | 2044 |
| 214 | Ga0111539_10311410 | 3300009094 | Bacteria | 1832 |
| 215 | Ga0105245_10189575 | 3300009098 | Bacteria | 1969 |
| 216 | Ga0105247_10265102 | 3300009101 | Bacteria | 1179 |
| 217 | Ga0114129_10000692 | 3300009147 | Bacteria | 42533 |
| 218 | Ga0114129_10065672 | 3300009147 | Bacteria | 5063 |
| 219 | Ga0114129_10092485 | 3300009147 | Bacteria | 4190 |
| 220 | Ga0114129_10126694 | 3300009147 | Bacteria | 3510 |
| 221 | Ga0114129_10293883 | 3300009147 | Bacteria | 2167 |
| 222 | Ga0105243_10377080 | 3300009148 | Bacteria | 1311 |
| 223 | Ga0105241_10000249 | 3300009174 | Bacteria | 40643 |
| 224 | Ga0105241_10109783 | 3300009174 | Bacteria | 2206 |
| 225 | Ga0105242_10099724 | 3300009176 | Bacteria | 2459 |
| 226 | Ga0105248_10156900 | 3300009177 | Bacteria | 2568 |
| 227 | Ga0105248_10385572 | 3300009177 | Bacteria | 1578 |
| 228 | Ga0105237_10067599 | 3300009545 | Bacteria | 3567 |
| 229 | Ga0105237_10133597 | 3300009545 | Bacteria | 2476 |
| 230 | Ga0105237_10168759 | 3300009545 | Bacteria | 2188 |
| 231 | Ga0105237_10286091 | 3300009545 | Bacteria | 1651 |
| 232 | Ga0105238_10001235 | 3300009551 | Bacteria | 25716 |
| 233 | Ga0105238_10014511 | 3300009551 | Bacteria | 7966 |
| 234 | Ga0105238_10038587 | 3300009551 | Bacteria | 4850 |
| 235 | Ga0105249_10044828 | 3300009553 | Bacteria | 4021 |
| 236 | Ga0105249_10746958 | 3300009553 | Bacteria | 1040 |
| 237 | Ga0105249_10840241 | 3300009553 | Bacteria | 983 |
| 238 | Ga0099796_10020835 | 3300010159 | Bacteria | 2010 |
| 239 | Ga0105239_10032291 | 3300010375 | Bacteria | 5754 |
| 240 | Ga0105239_10061707 | 3300010375 | Bacteria | 4114 |
| 241 | Ga0105239_10158333 | 3300010375 | Bacteria | 2530 |
| 242 | Ga0105239_10227921 | 3300010375 | Bacteria | 2090 |
| 243 | Ga0157373_10050479 | 3300013100 | Bacteria | 2962 |
| 244 | Ga0157373_10131755 | 3300013100 | Bacteria | 1758 |
| 245 | Ga0157370_10008510 | 3300013104 | Bacteria | 11064 |
| 246 | Ga0157370_10015855 | 3300013104 | Bacteria | 7646 |
| 247 | Ga0157370_10376246 | 3300013104 | Bacteria | 1308 |
| 248 | Ga0157369_10052065 | 3300013105 | Bacteria | 4430 |
| 249 | Ga0157372_10443094 | 3300013307 | Bacteria | 1514 |
| 250 | Ga0157375_10139921 | 3300013308 | Bacteria | 2547 |
| 251 | Ga0157375_10187578 | 3300013308 | Bacteria | 2222 |
| 252 | Ga0163163_10064343 | 3300014325 | Bacteria | 3639 |
| 253 | Ga0163163_10220639 | 3300014325 | Bacteria | 1944 |
| 254 | Ga0163163_10475090 | 3300014325 | Bacteria | 1311 |
| 255 | Ga0157380_10163035 | 3300014326 | Bacteria | 1940 |
| 256 | Ga0157380_10303924 | 3300014326 | Bacteria | 1471 |
| 257 | Ga0157380_10382047 | 3300014326 | Bacteria | 1329 |
| 258 | Ga0157377_10078649 | 3300014745 | Bacteria | 1923 |
| 259 | Ga0157379_10270345 | 3300014968 | Bacteria | 1546 |
| 260 | Ga0163161_10070039 | 3300017792 | Bacteria | 2565 |
| 261 | Ga0206353_11234579 | 3300020082 | Bacteria | 1782 |
| 262 | Ga0213872_10140105 | 3300021361 | Bacteria | 1062 |
| 263 | Ga0213874_10002095 | 3300021377 | Bacteria | 4228 |
| 264 | Ga0213876_10005453 | 3300021384 | Bacteria | 6994 |
| 265 | Ga0213876_10125669 | 3300021384 | Bacteria | 1362 |
| 266 | Ga0213876_10131901 | 3300021384 | Bacteria | 1328 |
| 267 | Ga0213876_10234387 | 3300021384 | Bacteria | 976 |
| 268 | Ga0213871_10021333 | 3300021441 | Bacteria | 1613 |
| 269 | Ga0209758_1001918 | 3300025297 | Bacteria | 22622 |
| 270 | Ga0209758_1004128 | 3300025297 | Bacteria | 12418 |
| 271 | Ga0209758_1048464 | 3300025297 | Bacteria | 1510 |
| 272 | Ga0207426_1001156 | 3300025302 | Bacteria | 23697 |
| 273 | Ga0207656_10003400 | 3300025321 | Bacteria | 5466 |
| 274 | Ga0207656_10020096 | 3300025321 | Bacteria | 2650 |
| 275 | Ga0207692_10000565 | 3300025898 | Bacteria | 13191 |
| 276 | Ga0207692_10052384 | 3300025898 | Bacteria | 2074 |
| 277 | Ga0207642_10135499 | 3300025899 | Bacteria | 1291 |
| 278 | Ga0207710_10014866 | 3300025900 | Bacteria | 3287 |
| 279 | Ga0207688_10058536 | 3300025901 | Bacteria | 2168 |
| 280 | Ga0207688_10087080 | 3300025901 | Bacteria | 1790 |
| 281 | Ga0207688_10107952 | 3300025901 | Bacteria | 1613 |
| 282 | Ga0207647_10009887 | 3300025904 | Bacteria | 6756 |
| 283 | Ga0207647_10092600 | 3300025904 | Bacteria | 1802 |
| 284 | Ga0207685_10009621 | 3300025905 | Bacteria | 2815 |
| 285 | Ga0207685_10023455 | 3300025905 | Bacteria | 2101 |
| 286 | Ga0207685_10078961 | 3300025905 | Bacteria | 1356 |
| 287 | Ga0207699_10219749 | 3300025906 | Bacteria | 1296 |
| 288 | Ga0207645_10220582 | 3300025907 | Bacteria | 1250 |
| 289 | Ga0207643_10084567 | 3300025908 | Bacteria | 1842 |
| 290 | Ga0207705_10241570 | 3300025909 | Bacteria | 1376 |
| 291 | Ga0207684_10002963 | 3300025910 | Bacteria | 16822 |
| 292 | Ga0207684_10051004 | 3300025910 | Bacteria | 3510 |
| 293 | Ga0207654_10069399 | 3300025911 | Bacteria | 2088 |
| 294 | Ga0207707_10007389 | 3300025912 | Bacteria | 9570 |
| 295 | Ga0207707_10008266 | 3300025912 | Bacteria | 9034 |
| 296 | Ga0207707_10128117 | 3300025912 | Bacteria | 2219 |
| 297 | Ga0207707_10232942 | 3300025912 | Bacteria | 1602 |
| 298 | Ga0207695_10000148 | 3300025913 | Bacteria | 208344 |
| 299 | Ga0207695_10000387 | 3300025913 | Bacteria | 99734 |
| 300 | Ga0207695_10092643 | 3300025913 | Bacteria | 3032 |
| 301 | Ga0207695_10136588 | 3300025913 | Bacteria | 2405 |
| 302 | Ga0207695_10177135 | 3300025913 | Bacteria | 2054 |
| 303 | Ga0207695_10241252 | 3300025913 | Bacteria | 1709 |
| 304 | Ga0207671_10003051 | 3300025914 | Bacteria | 17147 |
| 305 | Ga0207671_10026208 | 3300025914 | Bacteria | 4370 |
| 306 | Ga0207671_10034623 | 3300025914 | Bacteria | 3752 |
| 307 | Ga0207671_10114074 | 3300025914 | Bacteria | 2059 |
| 308 | Ga0207693_10001168 | 3300025915 | Bacteria | 23417 |
| 309 | Ga0207693_10003777 | 3300025915 | Bacteria | 12900 |
| 310 | Ga0207693_10021801 | 3300025915 | Bacteria | 5094 |
| 311 | Ga0207693_10042386 | 3300025915 | Bacteria | 3583 |
| 312 | Ga0207693_10187477 | 3300025915 | Bacteria | 1628 |
| 313 | Ga0207663_10004750 | 3300025916 | Bacteria | 6785 |
| 314 | Ga0207663_10037861 | 3300025916 | Bacteria | 2911 |
| 315 | Ga0207663_10042175 | 3300025916 | Bacteria | 2787 |
| 316 | Ga0207663_10050996 | 3300025916 | Bacteria | 2575 |
| 317 | Ga0207663_10294081 | 3300025916 | Bacteria | 1211 |
| 318 | Ga0207660_10015897 | 3300025917 | Bacteria | 4975 |
| 319 | Ga0207660_10062767 | 3300025917 | Bacteria | 2677 |
| 320 | Ga0207660_10089142 | 3300025917 | Bacteria | 2283 |
| 321 | Ga0207657_10009668 | 3300025919 | Bacteria | 9676 |
| 322 | Ga0207657_10024873 | 3300025919 | Bacteria | 5535 |
| 323 | Ga0207652_10007807 | 3300025921 | Bacteria | 8595 |
| 324 | Ga0207652_10060204 | 3300025921 | Bacteria | 3276 |
| 325 | Ga0207652_10069014 | 3300025921 | Bacteria | 3068 |
| 326 | Ga0207694_10000121 | 3300025924 | Bacteria | 83123 |
| 327 | Ga0207694_10015653 | 3300025924 | Bacteria | 5721 |
| 328 | Ga0207694_10049243 | 3300025924 | Bacteria | 3261 |
| 329 | Ga0207694_10287278 | 3300025924 | Bacteria | 1352 |
| 330 | Ga0207650_10002929 | 3300025925 | Bacteria | 11773 |
| 331 | Ga0207687_10014891 | 3300025927 | Bacteria | 5094 |
| 332 | Ga0207700_10010887 | 3300025928 | Bacteria | 5772 |
| 333 | Ga0207700_10036983 | 3300025928 | Bacteria | 3531 |
| 334 | Ga0207700_10073901 | 3300025928 | Bacteria | 2635 |
| 335 | Ga0207700_10092831 | 3300025928 | Bacteria | 2387 |
| 336 | Ga0207700_10208805 | 3300025928 | Bacteria | 1650 |
| 337 | Ga0207664_10012301 | 3300025929 | Bacteria | 6114 |
| 338 | Ga0207664_10146411 | 3300025929 | Bacteria | 2003 |
| 339 | Ga0207664_10217097 | 3300025929 | Bacteria | 1657 |
| 340 | Ga0207644_10050991 | 3300025931 | Bacteria | 2968 |
| 341 | Ga0207644_10135617 | 3300025931 | Bacteria | 1889 |
| 342 | Ga0207690_10340721 | 3300025932 | Bacteria | 1183 |
| 343 | Ga0207706_10044297 | 3300025933 | Bacteria | 3944 |
| 344 | Ga0207706_10111603 | 3300025933 | Bacteria | 2405 |
| 345 | Ga0207709_10052061 | 3300025935 | Bacteria | 2512 |
| 346 | Ga0207709_10073008 | 3300025935 | Bacteria | 2185 |
| 347 | Ga0207670_10229635 | 3300025936 | Bacteria | 1425 |
| 348 | Ga0207669_10025452 | 3300025937 | Bacteria | 3199 |
| 349 | Ga0207669_10082593 | 3300025937 | Bacteria | 2063 |
| 350 | Ga0207665_10000883 | 3300025939 | Bacteria | 20232 |
| 351 | Ga0207665_10112997 | 3300025939 | Bacteria | 1910 |
| 352 | Ga0207665_10363057 | 3300025939 | Bacteria | 1095 |
| 353 | Ga0207691_10253519 | 3300025940 | Bacteria | 1518 |
| 354 | Ga0207691_10477779 | 3300025940 | Bacteria | 1059 |
| 355 | Ga0207711_10029240 | 3300025941 | Bacteria | 4645 |
| 356 | Ga0207711_10219501 | 3300025941 | Bacteria | 1738 |
| 357 | Ga0207689_10289799 | 3300025942 | Bacteria | 1356 |
| 358 | Ga0207689_10371073 | 3300025942 | Bacteria | 1191 |
| 359 | Ga0207661_10002867 | 3300025944 | Bacteria | 11914 |
| 360 | Ga0207661_10056017 | 3300025944 | Bacteria | 3164 |
| 361 | Ga0207661_10380521 | 3300025944 | Bacteria | 1277 |
| 362 | Ga0207667_10007656 | 3300025949 | Bacteria | 12939 |
| 363 | Ga0207667_10016003 | 3300025949 | Bacteria | 8492 |
| 364 | Ga0207667_10054033 | 3300025949 | Bacteria | 4225 |
| 365 | Ga0207667_10137555 | 3300025949 | Bacteria | 2515 |
| 366 | Ga0207667_10178423 | 3300025949 | Bacteria | 2182 |
| 367 | Ga0207667_10316090 | 3300025949 | Bacteria | 1595 |
| 368 | Ga0207667_10538213 | 3300025949 | Bacteria | 1182 |
| 369 | Ga0207712_10187413 | 3300025961 | Bacteria | 1630 |
| 370 | Ga0207668_10145485 | 3300025972 | Bacteria | 1828 |
| 371 | Ga0207640_10005594 | 3300025981 | Bacteria | 6850 |
| 372 | Ga0207640_10055934 | 3300025981 | Bacteria | 2587 |
| 373 | Ga0207658_10301124 | 3300025986 | Bacteria | 1381 |
| 374 | Ga0207703_10014932 | 3300026035 | Bacteria | 6060 |
| 375 | Ga0207703_10077871 | 3300026035 | Bacteria | 2753 |
| 376 | Ga0207639_10014436 | 3300026041 | Bacteria | 5556 |
| 377 | Ga0207639_10016223 | 3300026041 | Bacteria | 5265 |
| 378 | Ga0207639_10308765 | 3300026041 | Bacteria | 1400 |
| 379 | Ga0207678_10007286 | 3300026067 | Bacteria | 9804 |
| 380 | Ga0207678_10044075 | 3300026067 | Bacteria | 3860 |
| 381 | Ga0207678_10232539 | 3300026067 | Bacteria | 1578 |
| 382 | Ga0207678_10297876 | 3300026067 | Bacteria | 1386 |
| 383 | Ga0207678_10304985 | 3300026067 | Bacteria | 1369 |
| 384 | Ga0207678_10567390 | 3300026067 | Bacteria | 993 |
| 385 | Ga0207708_10172435 | 3300026075 | Bacteria | 1714 |
| 386 | Ga0207708_10419736 | 3300026075 | Bacteria | 1109 |
| 387 | Ga0207702_10000004 | 3300026078 | Bacteria | 422182 |
| 388 | Ga0207702_10000318 | 3300026078 | Bacteria | 55209 |
| 389 | Ga0207702_10051367 | 3300026078 | Bacteria | 3483 |
| 390 | Ga0207702_10055681 | 3300026078 | Bacteria | 3355 |
| 391 | Ga0207702_10325607 | 3300026078 | Bacteria | 1465 |
| 392 | Ga0207648_10120914 | 3300026089 | Bacteria | 2303 |
| 393 | Ga0207676_10088633 | 3300026095 | Bacteria | 2533 |
| 394 | Ga0207676_10205751 | 3300026095 | Bacteria | 1742 |
| 395 | Ga0207674_10005964 | 3300026116 | Bacteria | 14418 |
| 396 | Ga0207674_10006033 | 3300026116 | Bacteria | 14333 |
| 397 | Ga0207674_10012348 | 3300026116 | Bacteria | 9549 |
| 398 | Ga0207674_10079008 | 3300026116 | Bacteria | 3295 |
| 399 | Ga0207674_10122866 | 3300026116 | Bacteria | 2562 |
| 400 | Ga0207675_100026733 | 3300026118 | Bacteria | 5371 |
| 401 | Ga0207675_100044501 | 3300026118 | Bacteria | 4149 |
| 402 | Ga0207675_100051099 | 3300026118 | Bacteria | 3857 |
| 403 | Ga0207675_100175437 | 3300026118 | Bacteria | 2050 |
| 404 | Ga0207675_100237438 | 3300026118 | Bacteria | 1760 |
| 405 | Ga0207683_10028337 | 3300026121 | Bacteria | 4842 |
| 406 | Ga0207683_10066450 | 3300026121 | Bacteria | 3180 |
| 407 | Ga0207683_10360374 | 3300026121 | Bacteria | 1335 |
| 408 | Ga0207698_10013415 | 3300026142 | Bacteria | 5406 |
| 409 | Ga0207698_10329898 | 3300026142 | Bacteria | 1433 |
| 410 | Ga0209179_1016514 | 3300027512 | Bacteria | 1386 |
| 411 | Ga0209588_1053255 | 3300027671 | Bacteria | 1309 |
| 412 | Ga0209813_10013142 | 3300027866 | Bacteria | 2204 |
| 413 | Ga0207428_10002337 | 3300027907 | Bacteria | 18975 |
| 414 | Ga0207428_10046668 | 3300027907 | Bacteria | 3483 |
| 415 | Ga0207428_10311886 | 3300027907 | Bacteria | 1163 |
| 416 | Ga0268266_10001906 | 3300028379 | Bacteria | 23472 |
| 417 | Ga0268266_10649913 | 3300028379 | Bacteria | 1015 |
| 418 | Ga0268265_10122027 | 3300028380 | Bacteria | 2148 |
| 419 | Ga0268264_10000062 | 3300028381 | Bacteria | 302110 |
| 420 | Ga0268264_10470329 | 3300028381 | Bacteria | 1221 |
| 421 | Ga0265337_1001354 | 3300028556 | Bacteria | 12087 |
| 422 | Ga0265334_10089935 | 3300028573 | Bacteria | 1121 |
| 423 | Ga0307517_10000175 | 3300028786 | Bacteria | 105567 |
| 424 | Ga0307515_10099000 | 3300028794 | Bacteria | 3544 |
| 425 | Ga0307515_10236976 | 3300028794 | Bacteria | 1604 |
| 426 | Ga0307511_10054505 | 3300030521 | Bacteria | 3151 |
| 427 | Ga0265330_10038896 | 3300031235 | Bacteria | 2114 |
| 428 | Ga0265325_10025732 | 3300031241 | Bacteria | 3193 |
| 429 | Ga0265340_10017518 | 3300031247 | Bacteria | 3706 |
| 430 | Ga0265339_10000738 | 3300031249 | Bacteria | 25301 |
| 431 | Ga0265339_10117155 | 3300031249 | Bacteria | 1373 |
| 432 | Ga0265331_10171233 | 3300031250 | Bacteria | 982 |
| 433 | Ga0307513_10212321 | 3300031456 | Bacteria | 1765 |
| 434 | Ga0307509_10006160 | 3300031507 | Bacteria | 16260 |
| 435 | Ga0307508_10000045 | 3300031616 | Bacteria | 142824 |
| 436 | Ga0307508_10034088 | 3300031616 | Bacteria | 4591 |
| 437 | Ga0265314_10014911 | 3300031711 | Bacteria | 6190 |
| 438 | Ga0265314_10168340 | 3300031711 | Bacteria | 1326 |
| 439 | Ga0265342_10168724 | 3300031712 | Bacteria | 1206 |
| 440 | Ga0307516_10049470 | 3300031730 | Bacteria | 4131 |
| 441 | Ga0307516_10098273 | 3300031730 | Bacteria | 2746 |
| 442 | Ga0307516_10161987 | 3300031730 | Bacteria | 1986 |
| 443 | Ga0307516_10406943 | 3300031730 | Bacteria | 1019 |
| 444 | Ga0307406_10454913 | 3300031901 | Bacteria | 1028 |
| 445 | Ga0307407_10163740 | 3300031903 | Bacteria | 1458 |
| 446 | Ga0307411_10150769 | 3300032005 | Bacteria | 1727 |
| 447 | Ga0307415_100207760 | 3300032126 | Bacteria | 1559 |
| 448 | Ga0307507_10110502 | 3300033179 | Bacteria | 2249 |
| 449 | Ga0307510_10042915 | 3300033180 | Bacteria | 4922 |
| 450 | Ga0373930_0045829 | 3300034816 | Bacteria | 943 |
| 451 | Ga0373926_0094737 | 3300035083 | Bacteria | 1113 |
| 452 | Ga0373934_0014812 | 3300035086 | Bacteria | 2953 |
| 453 | Ga0373934_0065091 | 3300035086 | Bacteria | 1455 |
| 454 | Ga0373940_0003839 | 3300035088 | Bacteria | 3115 |
| 455 | Ga0373949_0007155 | 3300035090 | Bacteria | 2447 |
| 456 | Ga0373923_0038708 | 3300035111 | Bacteria | 1955 |
| 457 | Ga0373936_0003919 | 3300035113 | Bacteria | 5605 |
| 458 | Ga0373936_0023840 | 3300035113 | Bacteria | 2387 |
| 459 | Ga0373936_0028148 | 3300035113 | Bacteria | 2208 |
| 460 | Ga0373936_0030004 | 3300035113 | Bacteria | 2144 |
| 461 | Ga0373941_0009142 | 3300035115 | Bacteria | 2487 |
| 462 | Ga0373956_0004385 | 3300035119 | Bacteria | 5652 |
| 463 | Ga0373957_0007126 | 3300035120 | Bacteria | 3562 |
| 464 | Ga0373960_0001356 | 3300035121 | Bacteria | 5400 |
| 465 | Ga0373960_0011395 | 3300035121 | Bacteria | 2190 |
| 466 | Ga0373943_0003409 | 3300035170 | Bacteria | 7239 |
| 467 | Ga0373943_0005484 | 3300035170 | Bacteria | 5707 |
| 468 | Ga0373943_0025075 | 3300035170 | Bacteria | 2785 |
| 469 | Ga0373946_0002063 | 3300035171 | Bacteria | 7056 |
| 470 | Ga0373946_0016589 | 3300035171 | Bacteria | 2808 |
| 471 | Ga0373946_0025554 | 3300035171 | Bacteria | 2323 |
| 472 | Ga0373946_0138036 | 3300035171 | Bacteria | 1128 |
| 473 | Ga0373955_0000224 | 3300035172 | Bacteria | 23923 |
| 474 | Ga0373955_0011330 | 3300035172 | Bacteria | 4245 |
| 475 | Ga0373955_0030936 | 3300035172 | Bacteria | 2800 |
| 476 | Ga0373955_0094738 | 3300035172 | Bacteria | 1706 |
| 477 | Ga0373961_0002623 | 3300035241 | Bacteria | 4626 |
| 478 | Ga0373962_0127877 | 3300035242 | Bacteria | 815 |
| 479 | Ga0316574_0014984 | 3300035398 | Bacteria | 4490 |
| 480 | Ga0373924_0011255 | 3300035410 | Bacteria | 3318 |
| 481 | Ga0373931_0002391 | 3300035691 | Bacteria | 8312 |
| 482 | Ga0373931_0006320 | 3300035691 | Bacteria | 5528 |
| 483 | Ga0373931_0029681 | 3300035691 | Bacteria | 2809 |
| 484 | Ga0373935_0000011 | 3300035692 | Bacteria | 89873 |
| 485 | Ga0373935_0014539 | 3300035692 | Bacteria | 4749 |
| 486 | Ga0373935_0097097 | 3300035692 | Bacteria | 1937 |
| 487 | Ga0373935_0219253 | 3300035692 | Bacteria | 1321 |
| 488 | Ga0373927_0001064 | 3300035695 | Bacteria | 20972 |
| 489 | Ga0373927_0003727 | 3300035695 | Bacteria | 10831 |
| 490 | Ga0373927_0004599 | 3300035695 | Bacteria | 9620 |
| 491 | Ga0373927_0048569 | 3300035695 | Bacteria | 2745 |
| 492 | Ga0373927_0114622 | 3300035695 | Bacteria | 1757 |
| 493 | Ga0373927_0201880 | 3300035695 | Bacteria | 1305 |
| 494 | Ga0373933_0000315 | 3300035724 | Bacteria | 31397 |
| 495 | Ga0373933_0000885 | 3300035724 | Bacteria | 18316 |
| 496 | Ga0373933_0009041 | 3300035724 | Bacteria | 5435 |
| 497 | Ga0373933_0012657 | 3300035724 | Bacteria | 4662 |
| 498 | Ga0373933_0146323 | 3300035724 | Bacteria | 1494 |
| 499 | Ga0373933_0171054 | 3300035724 | Bacteria | 1382 |
| 500 | Ga0373947_0006319 | 3300035725 | Bacteria | 6885 |
| 501 | Ga0373947_0021592 | 3300035725 | Bacteria | 3727 |
| 502 | Ga0373947_0236599 | 3300035725 | Bacteria | 1204 |
| 503 | Ga0373937_0000019 | 3300036401 | Bacteria | 138568 |
| 504 | Ga0373937_0008940 | 3300036401 | Bacteria | 8693 |
| 505 | Ga0373937_0017394 | 3300036401 | Bacteria | 6403 |
| 506 | Ga0373937_0022449 | 3300036401 | Bacteria | 5674 |
| 507 | Ga0373937_0029705 | 3300036401 | Bacteria | 4952 |
| 508 | Ga0373937_0099501 | 3300036401 | Bacteria | 2697 |
| 509 | Ga0373937_0211596 | 3300036401 | Bacteria | 1824 |
| 510 | Ga0373937_0214019 | 3300036401 | Bacteria | 1814 |
| 511 | Ga0373937_0288660 | 3300036401 | Bacteria | 1550 |
| 512 | Ga0316584_0012076 | 3300036712 | Bacteria | 6083 |
| 513 | Ga0316584_0034275 | 3300036712 | Bacteria | 3764 |
| 514 | Ga0373925_0000026 | 3300037068 | Bacteria | 154713 |
| 515 | Ga0373925_0007638 | 3300037068 | Bacteria | 7875 |
| 516 | Ga0373925_0012102 | 3300037068 | Bacteria | 6246 |
| 517 | Ga0373925_0054728 | 3300037068 | Bacteria | 2985 |
| 518 | Ga0373925_0079834 | 3300037068 | Bacteria | 2486 |
| 519 | Ga0373925_0106664 | 3300037068 | Bacteria | 2160 |
| 520 | Ga0373925_0107949 | 3300037068 | Bacteria | 2147 |
| 521 | Ga0373925_0297317 | 3300037068 | Bacteria | 1303 |
| 522 | Ga0373925_0384790 | 3300037068 | Bacteria | 1143 |
| 523 | Ga0395899_0006366 | 3300037312 | Bacteria | 9143 |
| 524 | Ga0395900_0009214 | 3300037418 | Bacteria | 10119 |
| 525 | Ga0395900_0030391 | 3300037418 | Bacteria | 5547 |
| 526 | Ga0395900_0089045 | 3300037418 | Bacteria | 3173 |
| 527 | Ga0395900_0183174 | 3300037418 | Bacteria | 2127 |
| 528 | Ga0395898_0041823 | 3300037466 | Bacteria | 4524 |
| 529 | Ga0395898_0063279 | 3300037466 | Bacteria | 3590 |
| 530 | Ga0395898_0085558 | 3300037466 | Bacteria | 3039 |
| 531 | Ga0395898_0134131 | 3300037466 | Bacteria | 2371 |
| 532 | Ga0395905_0070559 | 3300037471 | Bacteria | 3274 |
| 533 | Ga0395905_0096286 | 3300037471 | Bacteria | 2779 |
| 534 | Ga0436364_0004111 | 3300037853 | Bacteria | 1822 |
| 535 | Ga0436364_0452492 | 3300037853 | Bacteria | 1408 |
| 536 | Ga0395901_0021536 | 3300038443 | Bacteria | 6606 |
| 537 | Ga0395901_0077817 | 3300038443 | Bacteria | 3462 |
| 538 | Ga0436365_0172137 | 3300039437 | Bacteria | 9592 |
| 539 | Ga0436365_0734530 | 3300039437 | Bacteria | 1401 |
| 540 | Ga0436365_0903245 | 3300039437 | Bacteria | 1963 |
| 541 | Ga0436365_0992472 | 3300039437 | Bacteria | 4820 |
| 542 | Ga0436365_1607953 | 3300039437 | Bacteria | 2022 |
| 543 | Ga0436360_0831213 | 3300039438 | Bacteria | 2465 |
| 544 | Ga0436361_0000238 | 3300039447 | Bacteria | 2150 |
| 545 | Ga0436361_0274303 | 3300039447 | Bacteria | 1172 |
| 546 | Ga0436361_0416951 | 3300039447 | Bacteria | 2702 |
| 547 | Ga0436361_0642711 | 3300039447 | Bacteria | 2476 |
| 548 | Ga0436361_1209439 | 3300039447 | Bacteria | 1251 |
| 549 | Ga0436363_0407324 | 3300039450 | Bacteria | 1418 |
| 550 | Ga0436363_0576644 | 3300039450 | Bacteria | 6088 |
| 551 | Ga0436362_0233201 | 3300039453 | Bacteria | 1686 |
| 552 | Ga0451789_0781606 | 3300041443 | Bacteria | 975 |
| 553 | Ga0466966_0030392 | 3300044684 | Bacteria | 3508 |
| 554 | Ga0466963_0043770 | 3300044694 | Bacteria | 2946 |
| 555 | Ga0466963_0054350 | 3300044694 | Bacteria | 2661 |
| 556 | Ga0466971_0058502 | 3300044719 | Bacteria | 1740 |
| 557 | Ga0466968_0118017 | 3300044735 | Bacteria | 1199 |
| 558 | Ga0466959_0029672 | 3300045049 | Bacteria | 4053 |
| 559 | Ga0466959_0074305 | 3300045049 | Bacteria | 2458 |
| 560 | Ga0466967_0024550 | 3300045976 | Bacteria | 4959 |
| 561 | Ga0466967_0111496 | 3300045976 | Bacteria | 2514 |
| 562 | Ga0466967_0280836 | 3300045976 | Bacteria | 1598 |
| 563 | Ga0495617_012208 | 3300046452 | Bacteria | 2926 |
| 564 | Ga0495592_0000017 | 3300046454 | Bacteria | 142442 |
| 565 | Ga0495592_0020736 | 3300046454 | Bacteria | 5000 |
| 566 | Ga0495592_0047510 | 3300046454 | Bacteria | 3196 |
| 567 | Ga0495592_0096467 | 3300046454 | Bacteria | 2113 |
| 568 | Ga0495592_0260135 | 3300046454 | Bacteria | 1143 |
| 569 | Ga0495603_0003128 | 3300046455 | Bacteria | 9841 |
| 570 | Ga0495603_0003728 | 3300046455 | Bacteria | 9063 |
| 571 | Ga0495603_0045407 | 3300046455 | Bacteria | 2620 |
| 572 | Ga0495603_0087718 | 3300046455 | Bacteria | 1821 |
| 573 | Ga0495603_0088181 | 3300046455 | Bacteria | 1815 |
| 574 | Ga0495603_0172051 | 3300046455 | Bacteria | 1254 |
| 575 | Ga0495590_0043598 | 3300046457 | Bacteria | 1564 |
| 576 | Ga0495629_0001107 | 3300046459 | Bacteria | 21326 |
| 577 | Ga0495629_0002872 | 3300046459 | Bacteria | 13167 |
| 578 | Ga0495629_0012976 | 3300046459 | Bacteria | 6025 |
| 579 | Ga0495629_0188349 | 3300046459 | Bacteria | 1429 |
| 580 | Ga0495638_0042429 | 3300046460 | Bacteria | 2873 |
| 581 | Ga0495638_0145578 | 3300046460 | Bacteria | 1379 |
| 582 | Ga0495638_0213480 | 3300046460 | Bacteria | 1082 |
| 583 | Ga0495641_0004022 | 3300046461 | Bacteria | 10651 |
| 584 | Ga0495641_0050540 | 3300046461 | Bacteria | 1900 |
| 585 | Ga0495641_0112770 | 3300046461 | Bacteria | 1213 |
| 586 | Ga0495651_0000923 | 3300046462 | Bacteria | 22782 |
| 587 | Ga0495651_0044155 | 3300046462 | Bacteria | 3455 |
| 588 | Ga0495653_0000033 | 3300046463 | Bacteria | 131680 |
| 589 | Ga0495653_0029817 | 3300046463 | Bacteria | 4350 |
| 590 | Ga0495650_0113452 | 3300046471 | Bacteria | 1004 |
| 591 | Ga0495580_0001546 | 3300046472 | Bacteria | 20242 |
| 592 | Ga0495580_0126051 | 3300046472 | Bacteria | 1777 |
| 593 | Ga0495582_0000855 | 3300046473 | Bacteria | 16906 |
| 594 | Ga0495582_0105319 | 3300046473 | Bacteria | 1581 |
| 595 | Ga0495639_0000072 | 3300046475 | Bacteria | 46904 |
| 596 | Ga0495639_0022066 | 3300046475 | Bacteria | 2791 |
| 597 | Ga0495639_0035724 | 3300046475 | Bacteria | 2224 |
| 598 | Ga0495662_0002403 | 3300046476 | Bacteria | 9407 |
| 599 | Ga0495662_0014466 | 3300046476 | Bacteria | 3836 |
| 600 | Ga0495664_0000008 | 3300046477 | Bacteria | 307158 |
| 601 | Ga0495664_0001402 | 3300046477 | Bacteria | 12752 |
| 602 | Ga0495664_0200600 | 3300046477 | Bacteria | 1209 |
| 603 | Ga0495584_0112632 | 3300046491 | Bacteria | 1377 |
| 604 | Ga0495584_0130516 | 3300046491 | Bacteria | 1275 |
| 605 | Ga0495585_0054506 | 3300046492 | Bacteria | 2210 |
| 606 | Ga0495585_0114167 | 3300046492 | Bacteria | 1434 |
| 607 | Ga0495585_0132400 | 3300046492 | Bacteria | 1311 |
| 608 | Ga0495594_0278809 | 3300046499 | Bacteria | 952 |
| 609 | Ga0495607_0108264 | 3300046501 | Bacteria | 1477 |
| 610 | Ga0495606_0000831 | 3300046507 | Bacteria | 46699 |
| 611 | Ga0495608_0000014 | 3300046511 | Bacteria | 221042 |
| 612 | Ga0495608_0020001 | 3300046511 | Bacteria | 4603 |
| 613 | Ga0495608_0035508 | 3300046511 | Bacteria | 3362 |
| 614 | Ga0495610_0062504 | 3300046512 | Bacteria | 1766 |
| 615 | Ga0495616_0063169 | 3300046513 | Bacteria | 1811 |
| 616 | Ga0495618_0000013 | 3300046514 | Bacteria | 168671 |
| 617 | Ga0495618_0035721 | 3300046514 | Bacteria | 3120 |
| 618 | Ga0495628_0000008 | 3300046516 | Bacteria | 284313 |
| 619 | Ga0495628_0003465 | 3300046516 | Bacteria | 14119 |
| 620 | Ga0495628_0086586 | 3300046516 | Bacteria | 2429 |
| 621 | Ga0495630_0000797 | 3300046517 | Bacteria | 22206 |
| 622 | Ga0495630_0003448 | 3300046517 | Bacteria | 10991 |
| 623 | Ga0495630_0096430 | 3300046517 | Bacteria | 2236 |
| 624 | Ga0495632_0083372 | 3300046519 | Bacteria | 1522 |
| 625 | Ga0495637_0022738 | 3300046520 | Bacteria | 2857 |
| 626 | Ga0495644_0027753 | 3300046523 | Bacteria | 2144 |
| 627 | Ga0495644_0075459 | 3300046523 | Bacteria | 1269 |
| 628 | Ga0495648_0003200 | 3300046524 | Bacteria | 14540 |
| 629 | Ga0495648_0063981 | 3300046524 | Bacteria | 2169 |
| 630 | Ga0495663_0030584 | 3300046525 | Bacteria | 1596 |
| 631 | Ga0495666_0008781 | 3300046526 | Bacteria | 5064 |
| 632 | Ga0495642_0059322 | 3300046528 | Bacteria | 1586 |
| 633 | Ga0495652_0000005 | 3300046529 | Bacteria | 524368 |
| 634 | Ga0495652_0069920 | 3300046529 | Bacteria | 2936 |
| 635 | Ga0495652_0100862 | 3300046529 | Bacteria | 2341 |
| 636 | Ga0495654_0073393 | 3300046530 | Bacteria | 1618 |
| 637 | Ga0495665_0000128 | 3300046531 | Bacteria | 36043 |
| 638 | Ga0495665_0070590 | 3300046531 | Bacteria | 1841 |
| 639 | Ga0495665_0071946 | 3300046531 | Bacteria | 1821 |
| 640 | Ga0495665_0095389 | 3300046531 | Bacteria | 1562 |
| 641 | Ga0495640_0000017 | 3300046533 | Bacteria | 138688 |
| 642 | Ga0495640_0010120 | 3300046533 | Bacteria | 7310 |
| 643 | Ga0495640_0011467 | 3300046533 | Bacteria | 6821 |
| 644 | Ga0495640_0047940 | 3300046533 | Bacteria | 2955 |
| 645 | Ga0495587_0000005 | 3300046536 | Bacteria | 358412 |
| 646 | Ga0495587_0018828 | 3300046536 | Bacteria | 4280 |
| 647 | Ga0495587_0062786 | 3300046536 | Bacteria | 2174 |
| 648 | Ga0495598_0080433 | 3300046537 | Bacteria | 1044 |
| 649 | Ga0495621_0089462 | 3300046539 | Bacteria | 1159 |
| 650 | Ga0495645_0000007 | 3300046543 | Bacteria | 376299 |
| 651 | Ga0495645_0010485 | 3300046543 | Bacteria | 6499 |
| 652 | Ga0495645_0014817 | 3300046543 | Bacteria | 5539 |
| 653 | Ga0495622_0005892 | 3300046557 | Bacteria | 5692 |
| 654 | Ga0495622_0017286 | 3300046557 | Bacteria | 3358 |
| 655 | Ga0495633_0116803 | 3300046558 | Bacteria | 1236 |
| 656 | Ga0495667_0000012 | 3300046559 | Bacteria | 220967 |
| 657 | Ga0495667_0007798 | 3300046559 | Bacteria | 7249 |
| 658 | Ga0495667_0050257 | 3300046559 | Bacteria | 2753 |
| 659 | Ga0495656_0002973 | 3300046615 | Bacteria | 5691 |
| 660 | Ga0495656_0015117 | 3300046615 | Bacteria | 2907 |
| 661 | Ga0495668_0050768 | 3300046616 | Bacteria | 2298 |
| 662 | Ga0495634_0000070 | 3300046642 | Bacteria | 79664 |
| 663 | Ga0495634_0021038 | 3300046642 | Bacteria | 4619 |
| 664 | Ga0495634_0035544 | 3300046642 | Bacteria | 3411 |
| 665 | Ga0495634_0099675 | 3300046642 | Bacteria | 1878 |
| 666 | Ga0495625_0163978 | 3300046660 | Bacteria | 1487 |
| 667 | Ga0495625_0189714 | 3300046660 | Bacteria | 1362 |
| 668 | Ga0495625_0206843 | 3300046660 | Bacteria | 1292 |
| 669 | Ga0495635_0000010 | 3300046663 | Bacteria | 246385 |
| 670 | Ga0495635_0000564 | 3300046663 | Bacteria | 23651 |
| 671 | Ga0495635_0001868 | 3300046663 | Bacteria | 14260 |
| 672 | Ga0495635_0168155 | 3300046663 | Bacteria | 1491 |
| 673 | Ga0495659_0006735 | 3300046664 | Bacteria | 3630 |
| 674 | Ga0495661_0040977 | 3300046665 | Bacteria | 2868 |
| 675 | Ga0495661_0147899 | 3300046665 | Bacteria | 1271 |
| 676 | Ga0495588_0031903 | 3300046674 | Bacteria | 2654 |
| 677 | Ga0495657_0000178 | 3300046675 | Bacteria | 57139 |
| 678 | Ga0495657_0008385 | 3300046675 | Bacteria | 7909 |
| 679 | Ga0495657_0104274 | 3300046675 | Bacteria | 1803 |
| 680 | Ga0495599_0000015 | 3300046678 | Bacteria | 175055 |
| 681 | Ga0495599_0020349 | 3300046678 | Bacteria | 4132 |
| 682 | Ga0495623_0000054 | 3300046679 | Bacteria | 70217 |
| 683 | Ga0495623_0025208 | 3300046679 | Bacteria | 3830 |
| 684 | Ga0495623_0067334 | 3300046679 | Bacteria | 2235 |
| 685 | Ga0495646_0000012 | 3300046680 | Bacteria | 185805 |
| 686 | Ga0495646_0003182 | 3300046680 | Bacteria | 10197 |
| 687 | Ga0495646_0024986 | 3300046680 | Bacteria | 3759 |
| 688 | Ga0495646_0033708 | 3300046680 | Bacteria | 3183 |
| 689 | Ga0495647_0001214 | 3300046681 | Bacteria | 7949 |
| 690 | Ga0495647_0015891 | 3300046681 | Bacteria | 2643 |
| 691 | Ga0495658_0000707 | 3300046683 | Bacteria | 18088 |
| 692 | Ga0495658_0061593 | 3300046683 | Bacteria | 2154 |
| 693 | Ga0495658_0163531 | 3300046683 | Bacteria | 1374 |
| 694 | Ga0495669_0146084 | 3300046684 | Bacteria | 1118 |
| 695 | Ga0495613_0001986 | 3300046689 | Bacteria | 15542 |
| 696 | Ga0495613_0064597 | 3300046689 | Bacteria | 2676 |
| 697 | Ga0495613_0067323 | 3300046689 | Bacteria | 2614 |
| 698 | Ga0495613_0116928 | 3300046689 | Bacteria | 1917 |
| 699 | Ga0495613_0350029 | 3300046689 | Bacteria | 1015 |
| 700 | Ga0495624_0004889 | 3300046690 | Bacteria | 9730 |
| 701 | Ga0495624_0049435 | 3300046690 | Bacteria | 2667 |
| 702 | Ga0495670_0030236 | 3300046691 | Bacteria | 2690 |
| 703 | Ga0495671_0072016 | 3300046692 | Bacteria | 1697 |
| 704 | Ga0495600_0000031 | 3300046809 | Bacteria | 85535 |
| 705 | Ga0495600_0017842 | 3300046809 | Bacteria | 4517 |
| 706 | Ga0495600_0095483 | 3300046809 | Bacteria | 1938 |
| 707 | Ga0495581_0000030 | 3300047315 | Bacteria | 53487 |
| 708 | Ga0495581_0156249 | 3300047315 | Bacteria | 1333 |
| 709 | Ga0495581_0197803 | 3300047315 | Bacteria | 1176 |
| 710 | Ga0495581_0253545 | 3300047315 | Bacteria | 1029 |
| 711 | Ga0495604_0000001 | 3300047317 | Bacteria | 708627 |
| 712 | Ga0495604_0006243 | 3300047317 | Bacteria | 9452 |
| 713 | Ga0495604_0071809 | 3300047317 | Bacteria | 2617 |
| 714 | Ga0495604_0217284 | 3300047317 | Bacteria | 1318 |
| 715 | Ga0495604_0239433 | 3300047317 | Bacteria | 1242 |
| 716 | Ga0495636_0033052 | 3300047318 | Bacteria | 2123 |
| 717 | Ga0495636_0119699 | 3300047318 | Bacteria | 1164 |
| 718 | Ga0495674_0000012 | 3300047319 | Bacteria | 270651 |
| 719 | Ga0495674_0001230 | 3300047319 | Bacteria | 24837 |
| 720 | Ga0495674_0024652 | 3300047319 | Bacteria | 5522 |
| 721 | Ga0495674_0085620 | 3300047319 | Bacteria | 2699 |
| 722 | Ga0495674_0133635 | 3300047319 | Bacteria | 2089 |
| 723 | Ga0495672_0010170 | 3300047320 | Bacteria | 6724 |
| 724 | Ga0495672_0077919 | 3300047320 | Bacteria | 1856 |
| 725 | Ga0495672_0078951 | 3300047320 | Bacteria | 1839 |
| 726 | Ga0495672_0102901 | 3300047320 | Bacteria | 1546 |
| 727 | Ga0495672_0135313 | 3300047320 | Bacteria | 1293 |
| 728 | Ga0495672_0160184 | 3300047320 | Bacteria | 1158 |
| 729 | Ga0495676_0063006 | 3300047321 | Bacteria | 2892 |
| 730 | Ga0495676_0162663 | 3300047321 | Bacteria | 1578 |
| 731 | Ga0495676_0300500 | 3300047321 | Bacteria | 1082 |
| 732 | Ga0495680_0003950 | 3300047322 | Bacteria | 14337 |
| 733 | Ga0495680_0015081 | 3300047322 | Bacteria | 6673 |
| 734 | Ga0495680_0081343 | 3300047322 | Bacteria | 2446 |
| 735 | Ga0495680_0083270 | 3300047322 | Bacteria | 2412 |
| 736 | Ga0495680_0192032 | 3300047322 | Bacteria | 1469 |
| 737 | Ga0495675_0005364 | 3300047444 | Bacteria | 7811 |
| 738 | Ga0495675_0013920 | 3300047444 | Bacteria | 5087 |
| 739 | Ga0495675_0044709 | 3300047444 | Bacteria | 2821 |
| 740 | Ga0495673_0030759 | 3300047469 | Bacteria | 2519 |
| 741 | Ga0495684_0000021 | 3300047471 | Bacteria | 144901 |
| 742 | Ga0495684_0006597 | 3300047471 | Bacteria | 9001 |
| 743 | Ga0495684_0042816 | 3300047471 | Bacteria | 3467 |
| 744 | Ga0495686_0045908 | 3300047472 | Bacteria | 2763 |
| 745 | Ga0495593_0000387 | 3300047673 | Bacteria | 24410 |
| 746 | Ga0495593_0000470 | 3300047673 | Bacteria | 22684 |
| 747 | Ga0495593_0003761 | 3300047673 | Bacteria | 9064 |
| 748 | Ga0495602_0000031 | 3300048088 | Bacteria | 141518 |
| 749 | Ga0495602_0096494 | 3300048088 | Bacteria | 2438 |
| 750 | Ga0495602_0182433 | 3300048088 | Bacteria | 1617 |
| 751 | Ga0495614_0049441 | 3300048089 | Bacteria | 1803 |
| 752 | Ga0496100_0268489 | 3300048903 | Bacteria | 1268 |
| 753 | Ga0496100_0404708 | 3300048903 | Bacteria | 1040 |
| 754 | Ga0496100_0561996 | 3300048903 | Bacteria | 883 |
| 755 | Ga0496101_0342882 | 3300048904 | Bacteria | 1174 |
| 756 | Ga0496102_0097615 | 3300048905 | Bacteria | 2725 |
| 757 | Ga0496102_0139695 | 3300048905 | Bacteria | 2271 |
| 758 | Ga0496102_0162570 | 3300048905 | Bacteria | 2100 |
| 759 | Ga0496102_0211652 | 3300048905 | Bacteria | 1827 |
| 760 | Ga0496103_0077661 | 3300048906 | Bacteria | 2084 |
| 761 | Ga0496104_0041991 | 3300048907 | Bacteria | 4289 |
| 762 | Ga0496104_0052663 | 3300048907 | Bacteria | 3845 |
| 763 | Ga0496104_0280762 | 3300048907 | Bacteria | 1578 |
| 764 | Ga0496105_0062063 | 3300048908 | Bacteria | 3084 |
| 765 | Ga0496105_0066881 | 3300048908 | Bacteria | 2967 |
| 766 | Ga0496105_0237832 | 3300048908 | Bacteria | 1479 |
| 767 | Ga0496106_0001644 | 3300048909 | Bacteria | 16771 |
| 768 | Ga0496106_0001943 | 3300048909 | Bacteria | 15501 |
| 769 | Ga0496106_0061971 | 3300048909 | Bacteria | 2839 |
| 770 | Ga0496106_0115487 | 3300048909 | Bacteria | 2093 |
| 771 | Ga0496107_0008009 | 3300048910 | Bacteria | 7293 |
| 772 | Ga0496108_0000927 | 3300048911 | Bacteria | 22857 |
| 773 | Ga0496108_0003076 | 3300048911 | Bacteria | 13407 |
| 774 | Ga0496108_0104573 | 3300048911 | Bacteria | 2416 |
| 775 | Ga0496108_0205946 | 3300048911 | Bacteria | 1707 |
| 776 | Ga0496109_0000229 | 3300048912 | Bacteria | 54733 |
| 777 | Ga0496109_0000404 | 3300048912 | Bacteria | 38842 |
| 778 | Ga0496109_0061506 | 3300048912 | Bacteria | 3433 |
| 779 | Ga0496109_0095536 | 3300048912 | Bacteria | 2752 |
| 780 | Ga0496109_0104428 | 3300048912 | Bacteria | 2631 |
| 781 | Ga0496110_0004921 | 3300048913 | Bacteria | 10430 |
| 782 | Ga0496110_0255688 | 3300048913 | Bacteria | 1594 |
| 783 | Ga0496110_0364261 | 3300048913 | Bacteria | 1317 |
| 784 | Ga0496111_0001539 | 3300048914 | Bacteria | 13254 |
| 785 | Ga0496111_0030535 | 3300048914 | Bacteria | 3833 |
| 786 | Ga0496111_0175050 | 3300048914 | Bacteria | 1595 |
| 787 | Ga0496111_0213341 | 3300048914 | Bacteria | 1434 |
| 788 | Ga0496112_0000018 | 3300048915 | Bacteria | 188820 |
| 789 | Ga0496112_0001343 | 3300048915 | Bacteria | 18708 |
| 790 | Ga0496112_0001354 | 3300048915 | Bacteria | 18644 |
| 791 | Ga0496112_0022495 | 3300048915 | Bacteria | 6008 |
| 792 | Ga0496112_0074138 | 3300048915 | Bacteria | 3365 |
| 793 | Ga0496112_0075729 | 3300048915 | Bacteria | 3328 |
| 794 | Ga0496112_0089343 | 3300048915 | Bacteria | 3049 |
| 795 | Ga0496112_0320058 | 3300048915 | Bacteria | 1495 |
| 796 | Ga0496113_0001624 | 3300048916 | Bacteria | 12662 |
| 797 | Ga0496113_0017066 | 3300048916 | Bacteria | 5031 |
| 798 | Ga0496113_0131252 | 3300048916 | Bacteria | 1966 |
| 799 | Ga0496114_0014977 | 3300048917 | Bacteria | 6234 |
| 800 | Ga0496114_0274275 | 3300048917 | Bacteria | 1486 |
| 801 | Ga0496115_0210589 | 3300048918 | Bacteria | 1606 |
| 802 | Ga0496115_0374258 | 3300048918 | Bacteria | 1159 |
| 803 | Ga0496115_0388261 | 3300048918 | Bacteria | 1134 |
| 804 | Ga0496116_0009681 | 3300048919 | Bacteria | 8194 |
| 805 | Ga0496117_0046301 | 3300048920 | Bacteria | 3130 |
| 806 | Ga0496117_0110810 | 3300048920 | Bacteria | 1710 |
| 807 | Ga0496118_0023464 | 3300048921 | Bacteria | 5357 |
| 808 | Ga0496118_0108992 | 3300048921 | Bacteria | 1844 |
| 809 | Ga0496118_0165108 | 3300048921 | Bacteria | 1362 |
| 810 | Ga0496119_0033208 | 3300048922 | Bacteria | 3426 |
| 811 | Ga0496119_0118990 | 3300048922 | Bacteria | 1455 |
| 812 | Ga0496120_0040754 | 3300048923 | Bacteria | 2726 |
| 813 | Ga0496121_0000278 | 3300048924 | Bacteria | 106838 |
| 814 | Ga0496121_0000654 | 3300048924 | Bacteria | 64945 |
| 815 | Ga0496121_0001257 | 3300048924 | Bacteria | 43906 |
| 816 | Ga0496121_0004075 | 3300048924 | Bacteria | 20070 |
| 817 | Ga0496121_0010674 | 3300048924 | Bacteria | 10312 |
| 818 | Ga0496121_0025719 | 3300048924 | Bacteria | 5575 |
| 819 | Ga0496121_0055934 | 3300048924 | Bacteria | 3282 |
| 820 | Ga0496121_0076724 | 3300048924 | Bacteria | 2664 |
| 821 | Ga0496121_0089434 | 3300048924 | Bacteria | 2410 |
| 822 | Ga0496121_0145334 | 3300048924 | Bacteria | 1753 |
| 823 | Ga0496121_0186152 | 3300048924 | Bacteria | 1493 |
| 824 | Ga0496122_0058926 | 3300048925 | Bacteria | 2838 |
| 825 | Ga0496122_0063658 | 3300048925 | Bacteria | 2689 |
| 826 | Ga0496124_0053161 | 3300048927 | Bacteria | 3436 |
| 827 | Ga0496124_0251121 | 3300048927 | Bacteria | 1308 |
| 828 | Ga0496125_0000869 | 3300048928 | Bacteria | 48286 |
| 829 | Ga0496125_0003929 | 3300048928 | Bacteria | 17533 |
| 830 | Ga0496125_0009814 | 3300048928 | Bacteria | 9755 |
| 831 | Ga0496125_0033842 | 3300048928 | Bacteria | 4514 |
| 832 | Ga0496125_0055518 | 3300048928 | Bacteria | 3226 |
| 833 | Ga0496125_0075698 | 3300048928 | Bacteria | 2603 |
| 834 | Ga0496126_0005056 | 3300048929 | Bacteria | 15313 |
| 835 | Ga0496126_0013259 | 3300048929 | Bacteria | 8398 |
| 836 | Ga0496126_0021739 | 3300048929 | Bacteria | 6258 |
| 837 | Ga0496126_0039419 | 3300048929 | Bacteria | 4384 |
| 838 | Ga0496126_0065601 | 3300048929 | Bacteria | 3248 |
| 839 | Ga0496126_0127720 | 3300048929 | Bacteria | 2199 |
| 840 | Ga0496126_0137045 | 3300048929 | Bacteria | 2110 |
| 841 | Ga0496126_0476798 | 3300048929 | Bacteria | 1000 |
| 842 | Ga0501031_0000207 | 3300049568 | Bacteria | 33573 |
| 843 | Ga0501031_0000674 | 3300049568 | Bacteria | 20357 |
| 844 | Ga0501031_0042550 | 3300049568 | Bacteria | 2964 |
| 845 | Ga0501031_0174922 | 3300049568 | Bacteria | 1402 |
| 846 | Ga0501032_0000252 | 3300049569 | Bacteria | 44619 |
| 847 | Ga0501032_0002975 | 3300049569 | Bacteria | 13153 |
| 848 | Ga0501032_0004147 | 3300049569 | Bacteria | 10979 |
| 849 | Ga0501032_0175449 | 3300049569 | Bacteria | 1404 |
| 850 | Ga0501032_0210542 | 3300049569 | Bacteria | 1267 |
| 851 | Ga0501032_0228662 | 3300049569 | Bacteria | 1209 |
| 852 | Ga0501033_0000082 | 3300049570 | Bacteria | 89837 |
| 853 | Ga0501033_0006748 | 3300049570 | Bacteria | 8965 |
| 854 | Ga0501033_0056363 | 3300049570 | Bacteria | 2904 |
| 855 | Ga0501033_0059881 | 3300049570 | Bacteria | 2811 |
| 856 | Ga0501033_0174315 | 3300049570 | Bacteria | 1544 |
| 857 | Ga0501033_0243491 | 3300049570 | Bacteria | 1275 |
| 858 | Ga0501034_0000198 | 3300049571 | Bacteria | 113672 |
| 859 | Ga0501034_0066295 | 3300049571 | Bacteria | 3623 |
| 860 | Ga0501034_0069806 | 3300049571 | Bacteria | 3524 |
| 861 | Ga0501034_0076480 | 3300049571 | Bacteria | 3354 |
| 862 | Ga0501034_0137996 | 3300049571 | Bacteria | 2419 |
| 863 | Ga0501034_0166621 | 3300049571 | Bacteria | 2172 |
| 864 | Ga0501034_0331406 | 3300049571 | Bacteria | 1453 |
| 865 | Ga0501034_0370474 | 3300049571 | Bacteria | 1358 |
| 866 | Ga0501034_0376168 | 3300049571 | Bacteria | 1346 |
| 867 | Ga0501034_0473470 | 3300049571 | Bacteria | 1168 |
| 868 | Ga0501036_0001281 | 3300049572 | Bacteria | 19291 |
| 869 | Ga0501036_0041485 | 3300049572 | Bacteria | 3893 |
| 870 | Ga0501036_0070087 | 3300049572 | Bacteria | 2964 |
| 871 | Ga0501036_0089653 | 3300049572 | Bacteria | 2598 |
| 872 | Ga0501036_0153984 | 3300049572 | Bacteria | 1939 |
| 873 | Ga0501036_0296825 | 3300049572 | Bacteria | 1352 |
| 874 | Ga0501037_0000050 | 3300049573 | Bacteria | 112824 |
| 875 | Ga0501037_0001896 | 3300049573 | Bacteria | 15199 |
| 876 | Ga0501037_0013075 | 3300049573 | Bacteria | 6119 |
| 877 | Ga0501037_0065242 | 3300049573 | Bacteria | 2652 |
| 878 | Ga0501037_0126416 | 3300049573 | Bacteria | 1835 |
| 879 | Ga0501037_0210375 | 3300049573 | Bacteria | 1372 |
| 880 | Ga0501038_0000538 | 3300049574 | Bacteria | 33271 |
| 881 | Ga0501038_0000630 | 3300049574 | Bacteria | 31329 |
| 882 | Ga0501038_0021325 | 3300049574 | Bacteria | 5815 |
| 883 | Ga0501038_0069455 | 3300049574 | Bacteria | 2992 |
| 884 | Ga0501038_0108190 | 3300049574 | Bacteria | 2305 |
| 885 | Ga0501038_0184478 | 3300049574 | Bacteria | 1682 |
| 886 | Ga0501039_0000366 | 3300049575 | Bacteria | 32333 |
| 887 | Ga0501039_0042730 | 3300049575 | Bacteria | 3501 |
| 888 | Ga0501039_0207574 | 3300049575 | Bacteria | 1540 |
| 889 | Ga0501039_0209073 | 3300049575 | Bacteria | 1534 |
| 890 | Ga0501041_0105409 | 3300049577 | Bacteria | 1747 |
| 891 | Ga0501042_0017539 | 3300049578 | Bacteria | 4939 |
| 892 | Ga0501042_0042451 | 3300049578 | Bacteria | 3237 |
| 893 | Ga0501043_0002344 | 3300049579 | Bacteria | 16056 |
| 894 | Ga0501043_0003664 | 3300049579 | Bacteria | 12616 |
| 895 | Ga0501043_0061870 | 3300049579 | Bacteria | 2939 |
| 896 | Ga0501043_0087805 | 3300049579 | Bacteria | 2443 |
| 897 | Ga0501043_0143520 | 3300049579 | Bacteria | 1869 |
| 898 | Ga0501043_0217731 | 3300049579 | Bacteria | 1478 |
| 899 | Ga0501046_0000434 | 3300049580 | Bacteria | 41950 |
| 900 | Ga0501046_0030471 | 3300049580 | Bacteria | 4378 |
| 901 | Ga0501046_0049305 | 3300049580 | Bacteria | 3331 |
| 902 | Ga0501046_0410447 | 3300049580 | Bacteria | 977 |
| 903 | Ga0501047_0000131 | 3300049581 | Bacteria | 91079 |
| 904 | Ga0501047_0054290 | 3300049581 | Bacteria | 3875 |
| 905 | Ga0501047_0092774 | 3300049581 | Bacteria | 2898 |
| 906 | Ga0501047_0095805 | 3300049581 | Bacteria | 2846 |
| 907 | Ga0501047_0183102 | 3300049581 | Bacteria | 1961 |
| 908 | Ga0501047_0268941 | 3300049581 | Bacteria | 1551 |
| 909 | Ga0501047_0399434 | 3300049581 | Bacteria | 1207 |
| 910 | Ga0501047_0510484 | 3300049581 | Bacteria | 1028 |
| 911 | Ga0501048_0000531 | 3300049582 | Bacteria | 26809 |
| 912 | Ga0501048_0020580 | 3300049582 | Bacteria | 4835 |
| 913 | Ga0501067_0000628 | 3300049583 | Bacteria | 18974 |
| 914 | Ga0501067_0001606 | 3300049583 | Bacteria | 12379 |
| 915 | Ga0501067_0004783 | 3300049583 | Bacteria | 7508 |
| 916 | Ga0501067_0048760 | 3300049583 | Bacteria | 2349 |
| 917 | Ga0501067_0422368 | 3300049583 | Bacteria | 744 |
| 918 | Ga0501068_0011209 | 3300049584 | Bacteria | 5054 |
| 919 | Ga0501069_0001211 | 3300049585 | Bacteria | 12577 |
| 920 | Ga0501069_0256429 | 3300049585 | Bacteria | 1021 |
| 921 | Ga0501070_0005971 | 3300049586 | Bacteria | 10376 |
| 922 | Ga0501070_0039960 | 3300049586 | Bacteria | 3912 |
| 923 | Ga0501070_0117589 | 3300049586 | Bacteria | 2196 |
| 924 | Ga0501070_0260973 | 3300049586 | Bacteria | 1416 |
| 925 | Ga0501070_0473042 | 3300049586 | Bacteria | 1009 |
| 926 | Ga0501071_0051598 | 3300049587 | Bacteria | 2965 |
| 927 | Ga0501072_0000378 | 3300049588 | Bacteria | 31856 |
| 928 | Ga0501072_0203018 | 3300049588 | Bacteria | 1580 |
| 929 | Ga0501073_0029767 | 3300049589 | Bacteria | 3902 |
| 930 | Ga0501073_0095171 | 3300049589 | Bacteria | 2069 |
| 931 | Ga0501073_0103023 | 3300049589 | Bacteria | 1981 |
| 932 | Ga0501074_0003814 | 3300049590 | Bacteria | 10720 |
| 933 | Ga0501074_0018155 | 3300049590 | Bacteria | 5109 |
| 934 | Ga0501074_0018479 | 3300049590 | Bacteria | 5065 |
| 935 | Ga0501074_0070660 | 3300049590 | Bacteria | 2510 |
| 936 | Ga0501074_0231359 | 3300049590 | Bacteria | 1316 |
| 937 | Ga0501075_0103633 | 3300049591 | Bacteria | 2162 |
| 938 | Ga0501076_0015425 | 3300049592 | Bacteria | 5773 |
| 939 | Ga0501077_0015351 | 3300049593 | Bacteria | 4822 |
| 940 | Ga0501077_0134539 | 3300049593 | Bacteria | 1568 |
| 941 | Ga0501079_0001399 | 3300049741 | Bacteria | 17010 |
| 942 | Ga0501079_0003847 | 3300049741 | Bacteria | 11077 |
| 943 | Ga0501080_0009398 | 3300049742 | Bacteria | 8917 |
| 944 | Ga0501080_0064626 | 3300049742 | Bacteria | 3403 |
| 945 | Ga0501081_0001105 | 3300049743 | Bacteria | 16197 |
| 946 | Ga0501083_0000341 | 3300049744 | Bacteria | 29641 |
| 947 | Ga0501083_0060526 | 3300049744 | Bacteria | 2529 |
| 948 | Ga0501035_0000123 | 3300049822 | Bacteria | 93734 |
| 949 | Ga0501035_0005862 | 3300049822 | Bacteria | 11577 |
| 950 | Ga0501035_0093321 | 3300049822 | Bacteria | 2648 |
| 951 | Ga0501035_0173882 | 3300049822 | Bacteria | 1859 |
| 952 | Ga0501035_0180926 | 3300049822 | Bacteria | 1816 |
| 953 | Ga0501035_0206075 | 3300049822 | Bacteria | 1684 |
| 954 | Ga0501044_0000100 | 3300049823 | Bacteria | 106729 |
| 955 | Ga0501044_0039767 | 3300049823 | Bacteria | 4904 |
| 956 | Ga0501044_0113578 | 3300049823 | Bacteria | 2715 |
| 957 | Ga0501044_0195559 | 3300049823 | Bacteria | 1983 |
| 958 | Ga0501044_0214949 | 3300049823 | Bacteria | 1875 |
| 959 | Ga0501044_0253318 | 3300049823 | Bacteria | 1701 |
| 960 | Ga0501044_0281237 | 3300049823 | Bacteria | 1597 |
| 961 | Ga0501045_0009959 | 3300049824 | Bacteria | 6649 |
| 962 | Ga0501045_0022359 | 3300049824 | Bacteria | 4528 |
| 963 | Ga0501045_0022970 | 3300049824 | Bacteria | 4470 |
| 964 | nmdc:mga00v17_257025_c1 | 3300050491 | Bacteria | 1133 |
| 965 | nmdc:mga00v17_63096_c1 | 3300050491 | Bacteria | 2281 |
| 966 | nmdc:mga00v17_90644_c1 | 3300050491 | Bacteria | 1920 |
| 967 | nmdc:mga0yw44_153826_c1 | 3300050492 | Bacteria | 1502 |
| 968 | nmdc:mga0yw44_66131_c1 | 3300050492 | Bacteria | 2230 |
| 969 | nmdc:mga0yw44_73561_c1 | 3300050492 | Bacteria | 2126 |
| 970 | nmdc:mga0k408_130449_c1 | 3300050493 | Bacteria | 1492 |
| 971 | nmdc:mga0k408_63841_c2 | 3300050493 | Bacteria | 1500 |
| 972 | nmdc:mga06z11_177617_c1 | 3300050494 | Bacteria | 1226 |
| 973 | nmdc:mga06z11_3772_c1 | 3300050494 | Bacteria | 5895 |
| 974 | nmdc:mga04h51_11839_c1 | 3300050495 | Bacteria | 2433 |
| 975 | nmdc:mga04h51_42469_c1 | 3300050495 | Bacteria | 1491 |
| 976 | nmdc:mga07m45_119498_c1 | 3300050496 | Bacteria | 1522 |
| 977 | nmdc:mga07m45_143090_c1 | 3300050496 | Bacteria | 1385 |
| 978 | nmdc:mga07m45_215146_c1 | 3300050496 | Bacteria | 1118 |
| 979 | nmdc:mga07m45_3103_c1 | 3300050496 | Bacteria | 7739 |
| 980 | nmdc:mga05p37_255873_c1 | 3300050507 | Bacteria | 2098 |
| 981 | nmdc:mga05p37_427_c1 | 3300050507 | Bacteria | 45535 |
| 982 | nmdc:mga05p37_6551_c1 | 3300050507 | Bacteria | 13728 |
| 983 | nmdc:mga09592_248881_c1 | 3300050508 | Bacteria | 1540 |
| 984 | nmdc:mga09592_2873_c1 | 3300050508 | Bacteria | 13959 |
| 985 | nmdc:mga0qj67_124283_c1 | 3300050509 | Bacteria | 2088 |
| 986 | nmdc:mga0qj67_460427_c1 | 3300050509 | Bacteria | 1024 |
| 987 | nmdc:mga0qj67_51727_c2 | 3300050509 | Bacteria | 2120 |
| 988 | nmdc:mga06r32_109361_c1 | 3300050510 | Bacteria | 2718 |
| 989 | nmdc:mga06r32_2417_c1 | 3300050510 | Bacteria | 16706 |
| 990 | nmdc:mga06r32_306343_c1 | 3300050510 | Bacteria | 1574 |
| 991 | nmdc:mga06r32_6619_c1 | 3300050510 | Bacteria | 10413 |
| 992 | nmdc:mga08y16_102725_c1 | 3300050511 | Bacteria | 2976 |
| 993 | nmdc:mga08y16_199419_c1 | 3300050511 | Bacteria | 2074 |
| 994 | nmdc:mga08y16_263247_c1 | 3300050511 | Bacteria | 1781 |
| 995 | nmdc:mga08y16_42067_c1 | 3300050511 | Bacteria | 4785 |
| 996 | nmdc:mga08y16_90_c1 | 3300050511 | Bacteria | 76458 |
| 997 | nmdc:mga0n895_131467_c1 | 3300050512 | Bacteria | 2528 |
| 998 | nmdc:mga0n895_399422_c1 | 3300050512 | Bacteria | 1390 |
| 999 | nmdc:mga0rr50_195263_c1 | 3300050513 | Bacteria | 1661 |
| 1000 | nmdc:mga0rr50_41439_c1 | 3300050513 | Bacteria | 3355 |
| 1001 | nmdc:mga0rr50_42984_c1 | 3300050513 | Bacteria | 3303 |
| 1002 | nmdc:mga0rr50_99236_c1 | 3300050513 | Bacteria | 2284 |
| 1003 | nmdc:mga08x19_105709_c1 | 3300050514 | Bacteria | 1872 |
| 1004 | nmdc:mga0a205_30941_c1 | 3300050515 | Bacteria | 5127 |
| 1005 | nmdc:mga0a205_3895_c1 | 3300050515 | Bacteria | 13360 |
| 1006 | nmdc:mga0sz30_19967_c1 | 3300050516 | Bacteria | 2699 |
| 1007 | Ga0495601_0000011 | 3300053077 | Bacteria | 264937 |
| 1008 | Ga0495601_0000392 | 3300053077 | Bacteria | 23195 |
| 1009 | Ga0495601_0004077 | 3300053077 | Bacteria | 8426 |
| 1010 | Ga0495601_0006579 | 3300053077 | Bacteria | 6798 |
| 1011 | Ga0495601_0026481 | 3300053077 | Bacteria | 3581 |
| 1012 | Ga0495601_0098431 | 3300053077 | Bacteria | 1888 |
| 1013 | Ga0495612_0000006 | 3300053078 | Bacteria | 269278 |
| 1014 | Ga0495612_0008409 | 3300053078 | Bacteria | 4186 |
| 1015 | Ga0495612_0037724 | 3300053078 | Bacteria | 1963 |
| 1016 | Ga0495612_0062897 | 3300053078 | Bacteria | 1539 |
| 1017 | Ga0500635_0004048 | 3300053080 | Bacteria | 3744 |
| 1018 | Ga0500635_0067662 | 3300053080 | Bacteria | 1260 |
| 1019 | Ga0495655_0058021 | 3300053083 | Bacteria | 1047 |
| 1020 | Ga0495595_0000021 | 3300053084 | Bacteria | 115921 |
| 1021 | Ga0495595_0006005 | 3300053084 | Bacteria | 4932 |
| 1022 | Ga0495595_0020342 | 3300053084 | Bacteria | 2888 |
| 1023 | Ga0495595_0170332 | 3300053084 | Bacteria | 1077 |
| 1024 | Ga0495619_0000013 | 3300053085 | Bacteria | 264865 |
| 1025 | Ga0495619_0017632 | 3300053085 | Bacteria | 4523 |
| 1026 | Ga0495619_0028554 | 3300053085 | Bacteria | 3599 |
| 1027 | Ga0495619_0055926 | 3300053085 | Bacteria | 2615 |
| 1028 | Ga0495619_0113072 | 3300053085 | Bacteria | 1856 |
| 1029 | Ga0500646_0087203 | 3300053090 | Bacteria | 961 |
| 1030 | Ga0500583_0100611 | 3300053092 | Bacteria | 1415 |
| 1031 | Ga0500651_0069761 | 3300053093 | Bacteria | 2188 |
| 1032 | Ga0500651_0128499 | 3300053093 | Bacteria | 1534 |
| 1033 | Ga0500566_0000107 | 3300053094 | Bacteria | 42130 |
| 1034 | Ga0500566_0006857 | 3300053094 | Bacteria | 6745 |
| 1035 | Ga0500566_0016736 | 3300053094 | Bacteria | 4304 |
| 1036 | Ga0500566_0088729 | 3300053094 | Bacteria | 1711 |
| 1037 | Ga0500650_0050150 | 3300053098 | Bacteria | 1937 |
| 1038 | Ga0500650_0146655 | 3300053098 | Bacteria | 1093 |
| 1039 | Ga0500554_005159 | 3300053102 | Bacteria | 2824 |
| 1040 | Ga0500555_057288 | 3300053103 | Bacteria | 1055 |
| 1041 | Ga0500569_001078 | 3300053109 | Bacteria | 4973 |
| 1042 | Ga0500595_001968 | 3300053119 | Bacteria | 10552 |
| 1043 | Ga0500595_002686 | 3300053119 | Bacteria | 8636 |
| 1044 | Ga0500595_007413 | 3300053119 | Bacteria | 4553 |
| 1045 | Ga0500595_019639 | 3300053119 | Bacteria | 2449 |
| 1046 | Ga0500595_026838 | 3300053119 | Bacteria | 1979 |
| 1047 | Ga0500595_041070 | 3300053119 | Bacteria | 1488 |
| 1048 | Ga0500595_042387 | 3300053119 | Bacteria | 1456 |
| 1049 | Ga0500607_069800 | 3300053121 | Bacteria | 1817 |
| 1050 | Ga0500608_000949 | 3300053122 | Bacteria | 10352 |
| 1051 | Ga0500618_005453 | 3300053125 | Bacteria | 3865 |
| 1052 | Ga0500642_0000042 | 3300053130 | Bacteria | 86476 |
| 1053 | Ga0500642_0058519 | 3300053130 | Bacteria | 1723 |
| 1054 | Ga0500559_0000106 | 3300053136 | Bacteria | 65670 |
| 1055 | Ga0500559_0040338 | 3300053136 | Bacteria | 2032 |
| 1056 | Ga0500559_0138116 | 3300053136 | Bacteria | 1140 |
| 1057 | Ga0500559_0172991 | 3300053136 | Bacteria | 1016 |
| 1058 | Ga0500568_0139346 | 3300053139 | Bacteria | 899 |
| 1059 | Ga0500577_0009194 | 3300053142 | Bacteria | 2858 |
| 1060 | Ga0500577_0150528 | 3300053142 | Bacteria | 987 |
| 1061 | Ga0500588_0100585 | 3300053146 | Bacteria | 996 |
| 1062 | Ga0500589_079745 | 3300053147 | Bacteria | 1464 |
| 1063 | Ga0500590_026483 | 3300053148 | Bacteria | 3008 |
| 1064 | Ga0500590_054115 | 3300053148 | Bacteria | 2033 |
| 1065 | Ga0500603_013476 | 3300053150 | Bacteria | 1896 |
| 1066 | Ga0500604_0019202 | 3300053151 | Bacteria | 1911 |
| 1067 | Ga0500604_0044976 | 3300053151 | Bacteria | 1346 |
| 1068 | Ga0500616_0000227 | 3300053153 | Bacteria | 88098 |
| 1069 | Ga0500630_049983 | 3300053159 | Bacteria | 2023 |
| 1070 | Ga0500633_0138491 | 3300053160 | Bacteria | 910 |
| 1071 | Ga0500638_002787 | 3300053162 | Bacteria | 6242 |
| 1072 | Ga0500638_140299 | 3300053162 | Bacteria | 1086 |
| 1073 | Ga0500636_0236835 | 3300053177 | Bacteria | 940 |
| 1074 | Ga0500637_0000180 | 3300053178 | Bacteria | 23612 |
| 1075 | Ga0500637_0011782 | 3300053178 | Bacteria | 4534 |
| 1076 | Ga0500637_0052147 | 3300053178 | Bacteria | 2332 |
| 1077 | Ga0500645_047381 | 3300053730 | Bacteria | 1260 |
| 1078 | Ga0500609_007813 | 3300053731 | Bacteria | 1444 |
| 1079 | Ga0501084_0003563 | 3300054114 | Bacteria | 12638 |
| 1080 | Ga0501084_0019061 | 3300054114 | Bacteria | 5714 |
| 1081 | Ga0501084_0135809 | 3300054114 | Bacteria | 2070 |
| 1082 | Ga0501082_0001776 | 3300060353 | Bacteria | 18967 |
| 1083 | Ga0501082_0014075 | 3300060353 | Bacteria | 6880 |
| 1084 | Ga0501082_0022020 | 3300060353 | Bacteria | 5495 |
| 1085 | Ga0466962_0034341 | 3300061719 | Bacteria | 2428 |
| 1086 | Ga0530510_0151565 | 3300061734 | Bacteria | 1712 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049583 | Ga0501067_0422368 | Ga0501067_0422368_10_729 | 230 |
| 2 | 3300046460 | Ga0495638_0145578 | Ga0495638_0145578_16_738 | 231 |
| 3 | 3300035242 | Ga0373962_0127877 | Ga0373962_0127877_51_803 | 240 |
| 4 | 3300049581 | Ga0501047_0510484 | Ga0501047_0510484_223_1008 | 252 |
| 5 | 3300009147 | Ga0114129_10293883 | Ga0114129_102938832 | 264 |
| 6 | 3300048908 | Ga0496105_0237832 | Ga0496105_0237832_351_1229 | 264 |
| 7 | 3300048911 | Ga0496108_0205946 | Ga0496108_0205946_468_1346 | 264 |
| 8 | 3300048917 | Ga0496114_0014977 | Ga0496114_0014977_2337_3215 | 264 |
| 9 | 3300050510 | nmdc:mga06r32_6619_c1 | nmdc:mga06r32_6619_c1_465_1310 | 265 |
| 10 | 3300006871 | Ga0075434_100028319 | Ga0075434_1000283193 | 266 |
| 11 | 3300048929 | Ga0496126_0127720 | Ga0496126_0127720_23_850 | 267 |
| 12 | 3300050509 | nmdc:mga0qj67_124283_c1 | nmdc:mga0qj67_124283_c1_1215_2060 | 267 |
| 13 | 3300046461 | Ga0495641_0112770 | Ga0495641_0112770_356_1201 | 268 |
| 14 | 3300049571 | Ga0501034_0166621 | Ga0501034_0166621_1223_2059 | 268 |
| 15 | 3300049571 | Ga0501034_0376168 | Ga0501034_0376168_31_867 | 268 |
| 16 | 3300049583 | Ga0501067_0001606 | Ga0501067_0001606_8035_8874 | 268 |
| 17 | 3300049589 | Ga0501073_0095171 | Ga0501073_0095171_550_1389 | 268 |
| 18 | 3300049823 | Ga0501044_0195559 | Ga0501044_0195559_848_1684 | 268 |
| 19 | 3300050509 | nmdc:mga0qj67_460427_c1 | nmdc:mga0qj67_460427_c1_159_1004 | 268 |
| 20 | 3300005471 | Ga0070698_100321192 | Ga0070698_1003211922 | 269 |
| 21 | 3300049580 | Ga0501046_0410447 | Ga0501046_0410447_32_883 | 269 |
| 22 | 3300053094 | Ga0500566_0088729 | Ga0500566_0088729_25_858 | 269 |
| 23 | iso_pu_bacteria | 2523231067 | 2523468649 | 269 |
| 24 | iso_pu_bacteria | 2738543031 | 2739349855 | 269 |
| 25 | 3300035398 | Ga0316574_0014984 | Ga0316574_0014984_3423_4307 | 271 |
| 26 | 3300036712 | Ga0316584_0034275 | Ga0316584_0034275_1292_2176 | 271 |
| 27 | 3300046471 | Ga0495650_0113452 | Ga0495650_0113452_139_978 | 271 |
| 28 | 3300046660 | Ga0495625_0206843 | Ga0495625_0206843_425_1264 | 271 |
| 29 | 3300047321 | Ga0495676_0162663 | Ga0495676_0162663_12_851 | 271 |
| 30 | 3300048903 | Ga0496100_0561996 | Ga0496100_0561996_14_853 | 271 |
| 31 | 3300048929 | Ga0496126_0137045 | Ga0496126_0137045_1239_2078 | 271 |
| 32 | 3300049571 | Ga0501034_0473470 | Ga0501034_0473470_312_1151 | 271 |
| 33 | 3300050491 | nmdc:mga00v17_257025_c1 | nmdc:mga00v17_257025_c1_15_857 | 271 |
| 34 | 3300050492 | nmdc:mga0yw44_73561_c1 | nmdc:mga0yw44_73561_c1_1266_2105 | 271 |
| 35 | 3300053084 | Ga0495595_0170332 | Ga0495595_0170332_214_1053 | 271 |
| 36 | 3300005617 | Ga0068859_100379973 | Ga0068859_1003799732 | 272 |
| 37 | 3300005719 | Ga0068861_100037920 | Ga0068861_1000379203 | 272 |
| 38 | 3300005844 | Ga0068862_100040785 | Ga0068862_1000407854 | 272 |
| 39 | 3300006163 | Ga0070715_10009900 | Ga0070715_100099003 | 272 |
| 40 | 3300006178 | Ga0075367_10005424 | Ga0075367_100054243 | 272 |
| 41 | 3300006847 | Ga0075431_100266627 | Ga0075431_1002666272 | 272 |
| 42 | 3300006871 | Ga0075434_100056552 | Ga0075434_1000565521 | 272 |
| 43 | 3300006931 | Ga0097620_100379954 | Ga0097620_1003799542 | 272 |
| 44 | 3300007076 | Ga0075435_100518438 | Ga0075435_1005184381 | 272 |
| 45 | 3300007788 | Ga0099795_10080197 | Ga0099795_100801972 | 272 |
| 46 | 3300009094 | Ga0111539_10246033 | Ga0111539_102460332 | 272 |
| 47 | 3300009147 | Ga0114129_10126694 | Ga0114129_101266944 | 272 |
| 48 | 3300014326 | Ga0157380_10382047 | Ga0157380_103820471 | 272 |
| 49 | 3300025905 | Ga0207685_10009621 | Ga0207685_100096212 | 272 |
| 50 | 3300025925 | Ga0207650_10002929 | Ga0207650_1000292913 | 272 |
| 51 | 3300026075 | Ga0207708_10419736 | Ga0207708_104197361 | 272 |
| 52 | 3300026118 | Ga0207675_100044501 | Ga0207675_1000445012 | 272 |
| 53 | 3300048089 | Ga0495614_0049441 | Ga0495614_0049441_119_997 | 272 |
| 54 | 3300048903 | Ga0496100_0404708 | Ga0496100_0404708_50_904 | 272 |
| 55 | 3300048905 | Ga0496102_0211652 | Ga0496102_0211652_605_1483 | 272 |
| 56 | 3300048906 | Ga0496103_0077661 | Ga0496103_0077661_1138_2016 | 272 |
| 57 | 3300048907 | Ga0496104_0280762 | Ga0496104_0280762_260_1138 | 272 |
| 58 | 3300048908 | Ga0496105_0062063 | Ga0496105_0062063_1272_2150 | 272 |
| 59 | 3300048909 | Ga0496106_0115487 | Ga0496106_0115487_850_1728 | 272 |
| 60 | 3300048911 | Ga0496108_0003076 | Ga0496108_0003076_96_974 | 272 |
| 61 | 3300048912 | Ga0496109_0000404 | Ga0496109_0000404_35972_36850 | 272 |
| 62 | 3300048912 | Ga0496109_0061506 | Ga0496109_0061506_739_1590 | 272 |
| 63 | 3300048913 | Ga0496110_0255688 | Ga0496110_0255688_68_946 | 272 |
| 64 | 3300048914 | Ga0496111_0001539 | Ga0496111_0001539_11472_12350 | 272 |
| 65 | 3300048915 | Ga0496112_0001354 | Ga0496112_0001354_16465_17343 | 272 |
| 66 | 3300048916 | Ga0496113_0001624 | Ga0496113_0001624_1974_2852 | 272 |
| 67 | 3300048916 | Ga0496113_0131252 | Ga0496113_0131252_892_1743 | 272 |
| 68 | 3300049573 | Ga0501037_0210375 | Ga0501037_0210375_266_1147 | 272 |
| 69 | 3300049583 | Ga0501067_0048760 | Ga0501067_0048760_1427_2284 | 272 |
| 70 | 3300049586 | Ga0501070_0117589 | Ga0501070_0117589_706_1587 | 272 |
| 71 | 3300050492 | nmdc:mga0yw44_66131_c1 | nmdc:mga0yw44_66131_c1_69_920 | 272 |
| 72 | 3300050494 | nmdc:mga06z11_3772_c1 | nmdc:mga06z11_3772_c1_4815_5666 | 272 |
| 73 | 3300050507 | nmdc:mga05p37_255873_c1 | nmdc:mga05p37_255873_c1_565_1443 | 272 |
| 74 | 3300050508 | nmdc:mga09592_248881_c1 | nmdc:mga09592_248881_c1_310_1188 | 272 |
| 75 | 3300003659 | JGI25404J52841_10008798 | JGI25404J52841_100087982 | 273 |
| 76 | 3300005341 | Ga0070691_10003421 | Ga0070691_100034213 | 273 |
| 77 | 3300005441 | Ga0070700_100017526 | Ga0070700_1000175262 | 273 |
| 78 | 3300005455 | Ga0070663_100361217 | Ga0070663_1003612171 | 273 |
| 79 | 3300005545 | Ga0070695_100120591 | Ga0070695_1001205912 | 273 |
| 80 | 3300005719 | Ga0068861_100052285 | Ga0068861_1000522852 | 273 |
| 81 | 3300005937 | Ga0081455_10000209 | Ga0081455_1000020946 | 273 |
| 82 | 3300005983 | Ga0081540_1000064 | Ga0081540_100006422 | 273 |
| 83 | 3300006051 | Ga0075364_10057410 | Ga0075364_100574102 | 273 |
| 84 | 3300006178 | Ga0075367_10110837 | Ga0075367_101108372 | 273 |
| 85 | 3300006844 | Ga0075428_100128112 | Ga0075428_1001281121 | 273 |
| 86 | 3300006852 | Ga0075433_10045558 | Ga0075433_100455582 | 273 |
| 87 | 3300006871 | Ga0075434_100072031 | Ga0075434_1000720312 | 273 |
| 88 | 3300009094 | Ga0111539_10254754 | Ga0111539_102547541 | 273 |
| 89 | 3300009094 | Ga0111539_10311410 | Ga0111539_103114102 | 273 |
| 90 | 3300026067 | Ga0207678_10304985 | Ga0207678_103049852 | 273 |
| 91 | 3300026118 | Ga0207675_100175437 | Ga0207675_1001754372 | 273 |
| 92 | 3300027866 | Ga0209813_10013142 | Ga0209813_100131422 | 273 |
| 93 | 3300035090 | Ga0373949_0007155 | Ga0373949_0007155_1183_2037 | 273 |
| 94 | 3300035121 | Ga0373960_0011395 | Ga0373960_0011395_443_1297 | 273 |
| 95 | 3300035241 | Ga0373961_0002623 | Ga0373961_0002623_496_1350 | 273 |
| 96 | 3300035691 | Ga0373931_0002391 | Ga0373931_0002391_5904_6758 | 273 |
| 97 | 3300046491 | Ga0495584_0130516 | Ga0495584_0130516_194_1066 | 273 |
| 98 | 3300049570 | Ga0501033_0174315 | Ga0501033_0174315_178_1056 | 273 |
| 99 | 3300049571 | Ga0501034_0331406 | Ga0501034_0331406_361_1239 | 273 |
| 100 | 3300049579 | Ga0501043_0143520 | Ga0501043_0143520_568_1479 | 273 |
| 101 | 3300049581 | Ga0501047_0054290 | Ga0501047_0054290_268_1146 | 273 |
| 102 | 3300049586 | Ga0501070_0473042 | Ga0501070_0473042_15_926 | 273 |
| 103 | 3300049823 | Ga0501044_0281237 | Ga0501044_0281237_602_1480 | 273 |
| 104 | 3300050491 | nmdc:mga00v17_90644_c1 | nmdc:mga00v17_90644_c1_234_1085 | 273 |
| 105 | 3300050511 | nmdc:mga08y16_102725_c1 | nmdc:mga08y16_102725_c1_1980_2852 | 273 |
| 106 | 3300050512 | nmdc:mga0n895_131467_c1 | nmdc:mga0n895_131467_c1_1288_2160 | 273 |
| 107 | 3300050515 | nmdc:mga0a205_30941_c1 | nmdc:mga0a205_30941_c1_1307_2179 | 273 |
| 108 | 3300005434 | Ga0070709_10014835 | Ga0070709_100148354 | 274 |
| 109 | 3300005435 | Ga0070714_100011934 | Ga0070714_1000119344 | 274 |
| 110 | 3300005436 | Ga0070713_100016739 | Ga0070713_1000167394 | 274 |
| 111 | 3300005437 | Ga0070710_10003996 | Ga0070710_100039961 | 274 |
| 112 | 3300005439 | Ga0070711_100102931 | Ga0070711_1001029311 | 274 |
| 113 | 3300005937 | Ga0081455_10109474 | Ga0081455_101094742 | 274 |
| 114 | 3300006028 | Ga0070717_10041403 | Ga0070717_100414031 | 274 |
| 115 | 3300006163 | Ga0070715_10000275 | Ga0070715_100002755 | 274 |
| 116 | 3300006173 | Ga0070716_100007369 | Ga0070716_1000073691 | 274 |
| 117 | 3300006175 | Ga0070712_100146083 | Ga0070712_1001460832 | 274 |
| 118 | 3300006847 | Ga0075431_100001629 | Ga0075431_10000162911 | 274 |
| 119 | 3300025905 | Ga0207685_10023455 | Ga0207685_100234552 | 274 |
| 120 | 3300025915 | Ga0207693_10001168 | Ga0207693_1000116811 | 274 |
| 121 | 3300025916 | Ga0207663_10004750 | Ga0207663_100047503 | 274 |
| 122 | 3300025928 | Ga0207700_10092831 | Ga0207700_100928312 | 274 |
| 123 | 3300025929 | Ga0207664_10146411 | Ga0207664_101464112 | 274 |
| 124 | 3300025939 | Ga0207665_10000883 | Ga0207665_100008835 | 274 |
| 125 | 3300037068 | Ga0373925_0079834 | Ga0373925_0079834_1311_2207 | 274 |
| 126 | 3300039437 | Ga0436365_0992472 | Ga0436365_0992472_2874_3758 | 274 |
| 127 | 3300039447 | Ga0436361_0416951 | Ga0436361_0416951_947_1825 | 274 |
| 128 | 3300046531 | Ga0495665_0095389 | Ga0495665_0095389_434_1330 | 274 |
| 129 | 3300046683 | Ga0495658_0061593 | Ga0495658_0061593_386_1282 | 274 |
| 130 | 3300047315 | Ga0495581_0156249 | Ga0495581_0156249_73_969 | 274 |
| 131 | iso_pu_bacteria | 2671180139 | 2671694952 | 274 |
| 132 | 3300005337 | Ga0070682_100001898 | Ga0070682_1000018983 | 275 |
| 133 | 3300005341 | Ga0070691_10038245 | Ga0070691_100382452 | 275 |
| 134 | 3300005458 | Ga0070681_10002937 | Ga0070681_100029374 | 275 |
| 135 | 3300005530 | Ga0070679_100003447 | Ga0070679_10000344713 | 275 |
| 136 | 3300005539 | Ga0068853_100000639 | Ga0068853_1000006398 | 275 |
| 137 | 3300005547 | Ga0070693_100034913 | Ga0070693_1000349132 | 275 |
| 138 | 3300005563 | Ga0068855_100030888 | Ga0068855_1000308882 | 275 |
| 139 | 3300005577 | Ga0068857_100037870 | Ga0068857_1000378703 | 275 |
| 140 | 3300006852 | Ga0075433_10004977 | Ga0075433_100049775 | 275 |
| 141 | 3300006871 | Ga0075434_100040930 | Ga0075434_1000409303 | 275 |
| 142 | 3300007076 | Ga0075435_100076669 | Ga0075435_1000766692 | 275 |
| 143 | 3300009094 | Ga0111539_10066626 | Ga0111539_100666263 | 275 |
| 144 | 3300013100 | Ga0157373_10131755 | Ga0157373_101317552 | 275 |
| 145 | 3300013104 | Ga0157370_10008510 | Ga0157370_100085108 | 275 |
| 146 | 3300025912 | Ga0207707_10008266 | Ga0207707_100082663 | 275 |
| 147 | 3300025917 | Ga0207660_10015897 | Ga0207660_100158973 | 275 |
| 148 | 3300025921 | Ga0207652_10007807 | Ga0207652_1000780710 | 275 |
| 149 | 3300025949 | Ga0207667_10178423 | Ga0207667_101784232 | 275 |
| 150 | 3300026041 | Ga0207639_10016223 | Ga0207639_100162232 | 275 |
| 151 | 3300026116 | Ga0207674_10079008 | Ga0207674_100790083 | 275 |
| 152 | 3300035088 | Ga0373940_0003839 | Ga0373940_0003839_1485_2339 | 275 |
| 153 | 3300035115 | Ga0373941_0009142 | Ga0373941_0009142_470_1324 | 275 |
| 154 | 3300035121 | Ga0373960_0001356 | Ga0373960_0001356_3473_4327 | 275 |
| 155 | 3300035691 | Ga0373931_0029681 | Ga0373931_0029681_618_1472 | 275 |
| 156 | 3300036712 | Ga0316584_0012076 | Ga0316584_0012076_1603_2478 | 275 |
| 157 | 3300050511 | nmdc:mga08y16_263247_c1 | nmdc:mga08y16_263247_c1_493_1347 | 275 |
| 158 | 3300050513 | nmdc:mga0rr50_41439_c1 | nmdc:mga0rr50_41439_c1_1045_1899 | 275 |
| 159 | 3300050515 | nmdc:mga0a205_3895_c1 | nmdc:mga0a205_3895_c1_9054_9908 | 275 |
| 160 | 3300005436 | Ga0070713_100020074 | Ga0070713_1000200744 | 276 |
| 161 | 3300005439 | Ga0070711_100072636 | Ga0070711_1000726362 | 276 |
| 162 | 3300005439 | Ga0070711_100179985 | Ga0070711_1001799852 | 276 |
| 163 | 3300005467 | Ga0070706_100082929 | Ga0070706_1000829292 | 276 |
| 164 | 3300005564 | Ga0070664_100227804 | Ga0070664_1002278042 | 276 |
| 165 | 3300006028 | Ga0070717_10016786 | Ga0070717_100167862 | 276 |
| 166 | 3300006173 | Ga0070716_100218767 | Ga0070716_1002187671 | 276 |
| 167 | 3300006175 | Ga0070712_100065297 | Ga0070712_1000652972 | 276 |
| 168 | 3300009147 | Ga0114129_10092485 | Ga0114129_100924853 | 276 |
| 169 | 3300014325 | Ga0163163_10220639 | Ga0163163_102206392 | 276 |
| 170 | 3300025910 | Ga0207684_10051004 | Ga0207684_100510043 | 276 |
| 171 | 3300025915 | Ga0207693_10187477 | Ga0207693_101874771 | 276 |
| 172 | 3300025916 | Ga0207663_10294081 | Ga0207663_102940812 | 276 |
| 173 | 3300025928 | Ga0207700_10036983 | Ga0207700_100369832 | 276 |
| 174 | 3300025939 | Ga0207665_10363057 | Ga0207665_103630571 | 276 |
| 175 | 3300026078 | Ga0207702_10055681 | Ga0207702_100556813 | 276 |
| 176 | 3300028556 | Ga0265337_1001354 | Ga0265337_100135410 | 276 |
| 177 | 3300031249 | Ga0265339_10000738 | Ga0265339_1000073821 | 276 |
| 178 | 3300035086 | Ga0373934_0065091 | Ga0373934_0065091_112_984 | 276 |
| 179 | 3300035111 | Ga0373923_0038708 | Ga0373923_0038708_732_1604 | 276 |
| 180 | 3300035113 | Ga0373936_0003919 | Ga0373936_0003919_1597_2469 | 276 |
| 181 | 3300035113 | Ga0373936_0028148 | Ga0373936_0028148_1101_1973 | 276 |
| 182 | 3300035170 | Ga0373943_0005484 | Ga0373943_0005484_3869_4741 | 276 |
| 183 | 3300035171 | Ga0373946_0002063 | Ga0373946_0002063_1925_2797 | 276 |
| 184 | 3300035172 | Ga0373955_0000224 | Ga0373955_0000224_1781_2653 | 276 |
| 185 | 3300035410 | Ga0373924_0011255 | Ga0373924_0011255_1560_2432 | 276 |
| 186 | 3300035692 | Ga0373935_0000011 | Ga0373935_0000011_54330_55202 | 276 |
| 187 | 3300035695 | Ga0373927_0004599 | Ga0373927_0004599_6339_7211 | 276 |
| 188 | 3300035695 | Ga0373927_0201880 | Ga0373927_0201880_137_1009 | 276 |
| 189 | 3300035724 | Ga0373933_0009041 | Ga0373933_0009041_4349_5221 | 276 |
| 190 | 3300036401 | Ga0373937_0000019 | Ga0373937_0000019_98580_99452 | 276 |
| 191 | 3300037068 | Ga0373925_0000026 | Ga0373925_0000026_146859_147731 | 276 |
| 192 | 3300039447 | Ga0436361_0642711 | Ga0436361_0642711_369_1247 | 276 |
| 193 | 3300046454 | Ga0495592_0000017 | Ga0495592_0000017_47787_48659 | 276 |
| 194 | 3300046454 | Ga0495592_0260135 | Ga0495592_0260135_104_976 | 276 |
| 195 | 3300046455 | Ga0495603_0045407 | Ga0495603_0045407_1455_2327 | 276 |
| 196 | 3300046459 | Ga0495629_0002872 | Ga0495629_0002872_5952_6824 | 276 |
| 197 | 3300046462 | Ga0495651_0000923 | Ga0495651_0000923_3549_4421 | 276 |
| 198 | 3300046463 | Ga0495653_0000033 | Ga0495653_0000033_83584_84456 | 276 |
| 199 | 3300046476 | Ga0495662_0014466 | Ga0495662_0014466_628_1500 | 276 |
| 200 | 3300046477 | Ga0495664_0000008 | Ga0495664_0000008_146865_147737 | 276 |
| 201 | 3300046511 | Ga0495608_0000014 | Ga0495608_0000014_83592_84464 | 276 |
| 202 | 3300046514 | Ga0495618_0000013 | Ga0495618_0000013_31344_32216 | 276 |
| 203 | 3300046516 | Ga0495628_0000008 | Ga0495628_0000008_146850_147722 | 276 |
| 204 | 3300046517 | Ga0495630_0000797 | Ga0495630_0000797_17424_18296 | 276 |
| 205 | 3300046517 | Ga0495630_0096430 | Ga0495630_0096430_190_1062 | 276 |
| 206 | 3300046529 | Ga0495652_0000005 | Ga0495652_0000005_146865_147737 | 276 |
| 207 | 3300046531 | Ga0495665_0071946 | Ga0495665_0071946_394_1266 | 276 |
| 208 | 3300046533 | Ga0495640_0000017 | Ga0495640_0000017_39230_40102 | 276 |
| 209 | 3300046533 | Ga0495640_0011467 | Ga0495640_0011467_237_1109 | 276 |
| 210 | 3300046536 | Ga0495587_0000005 | Ga0495587_0000005_210662_211534 | 276 |
| 211 | 3300046543 | Ga0495645_0000007 | Ga0495645_0000007_188808_189680 | 276 |
| 212 | 3300046559 | Ga0495667_0000012 | Ga0495667_0000012_136498_137370 | 276 |
| 213 | 3300046642 | Ga0495634_0000070 | Ga0495634_0000070_30362_31234 | 276 |
| 214 | 3300046642 | Ga0495634_0035544 | Ga0495634_0035544_2209_3081 | 276 |
| 215 | 3300046663 | Ga0495635_0000010 | Ga0495635_0000010_83618_84490 | 276 |
| 216 | 3300046675 | Ga0495657_0000178 | Ga0495657_0000178_9192_10064 | 276 |
| 217 | 3300046678 | Ga0495599_0000015 | Ga0495599_0000015_147079_147951 | 276 |
| 218 | 3300046679 | Ga0495623_0000054 | Ga0495623_0000054_46638_47510 | 276 |
| 219 | 3300046680 | Ga0495646_0000012 | Ga0495646_0000012_48436_49308 | 276 |
| 220 | 3300046683 | Ga0495658_0163531 | Ga0495658_0163531_409_1281 | 276 |
| 221 | 3300046689 | Ga0495613_0116928 | Ga0495613_0116928_610_1482 | 276 |
| 222 | 3300046690 | Ga0495624_0049435 | Ga0495624_0049435_1111_1983 | 276 |
| 223 | 3300046809 | Ga0495600_0000031 | Ga0495600_0000031_47217_48089 | 276 |
| 224 | 3300047317 | Ga0495604_0000001 | Ga0495604_0000001_136499_137371 | 276 |
| 225 | 3300047319 | Ga0495674_0000012 | Ga0495674_0000012_171230_172102 | 276 |
| 226 | 3300047319 | Ga0495674_0024652 | Ga0495674_0024652_1516_2388 | 276 |
| 227 | 3300047322 | Ga0495680_0003950 | Ga0495680_0003950_174_1046 | 276 |
| 228 | 3300047444 | Ga0495675_0013920 | Ga0495675_0013920_2894_3766 | 276 |
| 229 | 3300047471 | Ga0495684_0000021 | Ga0495684_0000021_7390_8262 | 276 |
| 230 | 3300047673 | Ga0495593_0000387 | Ga0495593_0000387_6544_7416 | 276 |
| 231 | 3300048088 | Ga0495602_0000031 | Ga0495602_0000031_136628_137500 | 276 |
| 232 | 3300048905 | Ga0496102_0162570 | Ga0496102_0162570_44_916 | 276 |
| 233 | 3300048912 | Ga0496109_0095536 | Ga0496109_0095536_1857_2723 | 276 |
| 234 | 3300048914 | Ga0496111_0030535 | Ga0496111_0030535_237_1100 | 276 |
| 235 | 3300048914 | Ga0496111_0213341 | Ga0496111_0213341_442_1314 | 276 |
| 236 | 3300048915 | Ga0496112_0022495 | Ga0496112_0022495_3036_3902 | 276 |
| 237 | 3300048915 | Ga0496112_0074138 | Ga0496112_0074138_1709_2575 | 276 |
| 238 | 3300048918 | Ga0496115_0388261 | Ga0496115_0388261_20_892 | 276 |
| 239 | 3300048925 | Ga0496122_0063658 | Ga0496122_0063658_848_1711 | 276 |
| 240 | 3300053077 | Ga0495601_0000011 | Ga0495601_0000011_165513_166385 | 276 |
| 241 | 3300053077 | Ga0495601_0000392 | Ga0495601_0000392_16961_17833 | 276 |
| 242 | 3300053078 | Ga0495612_0000006 | Ga0495612_0000006_120507_121379 | 276 |
| 243 | 3300053078 | Ga0495612_0037724 | Ga0495612_0037724_605_1477 | 276 |
| 244 | 3300053084 | Ga0495595_0000021 | Ga0495595_0000021_31465_32337 | 276 |
| 245 | 3300053085 | Ga0495619_0000013 | Ga0495619_0000013_165434_166306 | 276 |
| 246 | 3300053119 | Ga0500595_019639 | Ga0500595_019639_606_1475 | 276 |
| 247 | iso_pu_bacteria | 2508501128 | 2509152157 | 276 |
| 248 | iso_pu_bacteria | 2513237141 | 2513888602 | 276 |
| 249 | iso_pu_bacteria | 2524023205 | 2524438844 | 276 |
| 250 | 3300003215 | JGI25153J46596_10043278 | JGI25153J46596_100432781 | 277 |
| 251 | 3300005364 | Ga0070673_100277068 | Ga0070673_1002770682 | 277 |
| 252 | 3300006914 | Ga0075436_100068860 | Ga0075436_1000688602 | 277 |
| 253 | 3300007076 | Ga0075435_100051643 | Ga0075435_1000516432 | 277 |
| 254 | 3300007076 | Ga0075435_100078601 | Ga0075435_1000786012 | 277 |
| 255 | 3300025297 | Ga0209758_1004128 | Ga0209758_100412813 | 277 |
| 256 | 3300025906 | Ga0207699_10219749 | Ga0207699_102197492 | 277 |
| 257 | 3300025924 | Ga0207694_10049243 | Ga0207694_100492433 | 277 |
| 258 | 3300028379 | Ga0268266_10649913 | Ga0268266_106499131 | 277 |
| 259 | 3300031241 | Ga0265325_10025732 | Ga0265325_100257324 | 277 |
| 260 | 3300035695 | Ga0373927_0048569 | Ga0373927_0048569_1490_2362 | 277 |
| 261 | 3300035724 | Ga0373933_0000315 | Ga0373933_0000315_8635_9522 | 277 |
| 262 | 3300035724 | Ga0373933_0146323 | Ga0373933_0146323_336_1211 | 277 |
| 263 | 3300036401 | Ga0373937_0008940 | Ga0373937_0008940_5697_6572 | 277 |
| 264 | 3300036401 | Ga0373937_0288660 | Ga0373937_0288660_419_1297 | 277 |
| 265 | 3300046462 | Ga0495651_0044155 | Ga0495651_0044155_2360_3247 | 277 |
| 266 | 3300046477 | Ga0495664_0200600 | Ga0495664_0200600_28_906 | 277 |
| 267 | 3300046536 | Ga0495587_0018828 | Ga0495587_0018828_3004_3891 | 277 |
| 268 | 3300046559 | Ga0495667_0050257 | Ga0495667_0050257_112_999 | 277 |
| 269 | 3300046675 | Ga0495657_0008385 | Ga0495657_0008385_3501_4388 | 277 |
| 270 | 3300047317 | Ga0495604_0217284 | Ga0495604_0217284_399_1277 | 277 |
| 271 | 3300047322 | Ga0495680_0081343 | Ga0495680_0081343_1233_2120 | 277 |
| 272 | 3300048088 | Ga0495602_0096494 | Ga0495602_0096494_1217_2104 | 277 |
| 273 | 3300050513 | nmdc:mga0rr50_195263_c1 | nmdc:mga0rr50_195263_c1_67_945 | 277 |
| 274 | 3300050513 | nmdc:mga0rr50_42984_c1 | nmdc:mga0rr50_42984_c1_711_1571 | 277 |
| 275 | 3300050514 | nmdc:mga08x19_105709_c1 | nmdc:mga08x19_105709_c1_669_1529 | 277 |
| 276 | 3300053077 | Ga0495601_0004077 | Ga0495601_0004077_5900_6787 | 277 |
| 277 | 3300053078 | Ga0495612_0008409 | Ga0495612_0008409_1560_2447 | 277 |
| 278 | 3300053084 | Ga0495595_0006005 | Ga0495595_0006005_83_958 | 277 |
| 279 | 3300053084 | Ga0495595_0020342 | Ga0495595_0020342_1662_2549 | 277 |
| 280 | 3300053085 | Ga0495619_0055926 | Ga0495619_0055926_1569_2444 | 277 |
| 281 | 3300053085 | Ga0495619_0113072 | Ga0495619_0113072_59_946 | 277 |
| 282 | 3300003659 | JGI25404J52841_10001804 | JGI25404J52841_100018041 | 278 |
| 283 | 3300005983 | Ga0081540_1012184 | Ga0081540_10121843 | 278 |
| 284 | 3300006175 | Ga0070712_100002530 | Ga0070712_10000253012 | 278 |
| 285 | 3300021377 | Ga0213874_10002095 | Ga0213874_100020954 | 278 |
| 286 | 3300025915 | Ga0207693_10003777 | Ga0207693_1000377713 | 278 |
| 287 | 3300031730 | Ga0307516_10098273 | Ga0307516_100982731 | 278 |
| 288 | 3300035170 | Ga0373943_0003409 | Ga0373943_0003409_5403_6275 | 278 |
| 289 | 3300035171 | Ga0373946_0016589 | Ga0373946_0016589_475_1347 | 278 |
| 290 | 3300035171 | Ga0373946_0138036 | Ga0373946_0138036_188_1066 | 278 |
| 291 | 3300035172 | Ga0373955_0011330 | Ga0373955_0011330_2564_3436 | 278 |
| 292 | 3300035692 | Ga0373935_0014539 | Ga0373935_0014539_105_977 | 278 |
| 293 | 3300035695 | Ga0373927_0001064 | Ga0373927_0001064_2536_3408 | 278 |
| 294 | 3300035725 | Ga0373947_0006319 | Ga0373947_0006319_4313_5185 | 278 |
| 295 | 3300036401 | Ga0373937_0029705 | Ga0373937_0029705_925_1797 | 278 |
| 296 | 3300036401 | Ga0373937_0099501 | Ga0373937_0099501_637_1509 | 278 |
| 297 | 3300037068 | Ga0373925_0007638 | Ga0373925_0007638_3776_4648 | 278 |
| 298 | 3300037853 | Ga0436364_0004111 | Ga0436364_0004111_490_1356 | 278 |
| 299 | 3300039450 | Ga0436363_0576644 | Ga0436363_0576644_2117_2998 | 278 |
| 300 | 3300046454 | Ga0495592_0020736 | Ga0495592_0020736_2798_3670 | 278 |
| 301 | 3300046455 | Ga0495603_0003128 | Ga0495603_0003128_1721_2593 | 278 |
| 302 | 3300046459 | Ga0495629_0001107 | Ga0495629_0001107_10055_10927 | 278 |
| 303 | 3300046461 | Ga0495641_0004022 | Ga0495641_0004022_4699_5571 | 278 |
| 304 | 3300046472 | Ga0495580_0001546 | Ga0495580_0001546_1719_2591 | 278 |
| 305 | 3300046473 | Ga0495582_0000855 | Ga0495582_0000855_13974_14846 | 278 |
| 306 | 3300046475 | Ga0495639_0000072 | Ga0495639_0000072_42886_43758 | 278 |
| 307 | 3300046476 | Ga0495662_0002403 | Ga0495662_0002403_59_931 | 278 |
| 308 | 3300046477 | Ga0495664_0001402 | Ga0495664_0001402_4309_5181 | 278 |
| 309 | 3300046499 | Ga0495594_0278809 | Ga0495594_0278809_52_924 | 278 |
| 310 | 3300046517 | Ga0495630_0003448 | Ga0495630_0003448_1533_2405 | 278 |
| 311 | 3300046526 | Ga0495666_0008781 | Ga0495666_0008781_406_1278 | 278 |
| 312 | 3300046529 | Ga0495652_0100862 | Ga0495652_0100862_1269_2141 | 278 |
| 313 | 3300046531 | Ga0495665_0000128 | Ga0495665_0000128_21277_22149 | 278 |
| 314 | 3300046533 | Ga0495640_0047940 | Ga0495640_0047940_1273_2145 | 278 |
| 315 | 3300046557 | Ga0495622_0005892 | Ga0495622_0005892_681_1553 | 278 |
| 316 | 3300046663 | Ga0495635_0000564 | Ga0495635_0000564_10127_10999 | 278 |
| 317 | 3300046674 | Ga0495588_0031903 | Ga0495588_0031903_1023_1895 | 278 |
| 318 | 3300046680 | Ga0495646_0003182 | Ga0495646_0003182_9256_10128 | 278 |
| 319 | 3300046681 | Ga0495647_0001214 | Ga0495647_0001214_5564_6436 | 278 |
| 320 | 3300046683 | Ga0495658_0000707 | Ga0495658_0000707_9462_10334 | 278 |
| 321 | 3300046689 | Ga0495613_0001986 | Ga0495613_0001986_10127_10999 | 278 |
| 322 | 3300046690 | Ga0495624_0004889 | Ga0495624_0004889_362_1234 | 278 |
| 323 | 3300047315 | Ga0495581_0000030 | Ga0495581_0000030_45239_46111 | 278 |
| 324 | 3300047319 | Ga0495674_0001230 | Ga0495674_0001230_22312_23184 | 278 |
| 325 | 3300047321 | Ga0495676_0063006 | Ga0495676_0063006_609_1481 | 278 |
| 326 | 3300047673 | Ga0495593_0000470 | Ga0495593_0000470_18666_19538 | 278 |
| 327 | 3300049571 | Ga0501034_0069806 | Ga0501034_0069806_1558_2418 | 278 |
| 328 | 3300049587 | Ga0501071_0051598 | Ga0501071_0051598_186_1061 | 278 |
| 329 | 3300049592 | Ga0501076_0015425 | Ga0501076_0015425_2144_3019 | 278 |
| 330 | 3300049593 | Ga0501077_0015351 | Ga0501077_0015351_1282_2157 | 278 |
| 331 | 3300049741 | Ga0501079_0003847 | Ga0501079_0003847_4458_5333 | 278 |
| 332 | 3300049743 | Ga0501081_0001105 | Ga0501081_0001105_10337_11212 | 278 |
| 333 | 3300053077 | Ga0495601_0098431 | Ga0495601_0098431_881_1753 | 278 |
| 334 | 3300053085 | Ga0495619_0017632 | Ga0495619_0017632_2556_3428 | 278 |
| 335 | 3300054114 | Ga0501084_0003563 | Ga0501084_0003563_10325_11200 | 278 |
| 336 | 3300060353 | Ga0501082_0014075 | Ga0501082_0014075_4967_5842 | 278 |
| 337 | 3300061734 | Ga0530510_0151565 | Ga0530510_0151565_820_1695 | 278 |
| 338 | iso_pu_bacteria | 2513237101 | 2513695264 | 278 |
| 339 | iso_pu_bacteria | 2513237139 | 2513873373 | 278 |
| 340 | iso_pu_bacteria | 2513237161 | 2514014703 | 278 |
| 341 | iso_pu_bacteria | 2602042107 | 2603858355 | 278 |
| 342 | iso_pu_bacteria | 2617270735 | 2617352084 | 278 |
| 343 | iso_pu_bacteria | 2643221651 | 2644291070 | 278 |
| 344 | iso_pu_bacteria | 2721755755 | 2723841793 | 278 |
| 345 | iso_pu_bacteria | 2791355199 | 2793078332 | 278 |
| 346 | iso_pu_bacteria | 2802429603 | 2805920721 | 278 |
| 347 | iso_pu_bacteria | 2824600985 | 2824609015 | 278 |
| 348 | iso_pu_bacteria | 2824609381 | 2824617719 | 278 |
| 349 | iso_pu_bacteria | 2824653114 | 2824661008 | 278 |
| 350 | iso_pu_bacteria | 2824696289 | 2824702630 | 278 |
| 351 | iso_pu_bacteria | 2824773399 | 2824780868 | 278 |
| 352 | iso_pu_bacteria | 2838122688 | 2838124672 | 278 |
| 353 | iso_pu_bacteria | 2841941048 | 2841945364 | 278 |
| 354 | iso_pu_bacteria | 2841949485 | 2841952149 | 278 |
| 355 | iso_pu_bacteria | 2841966195 | 2841970463 | 278 |
| 356 | iso_pu_bacteria | 2841974524 | 2841981711 | 278 |
| 357 | iso_pu_bacteria | 2841983080 | 2841984992 | 278 |
| 358 | iso_pu_bacteria | 2847939898 | 2847942315 | 278 |
| 359 | iso_pu_bacteria | 2857524615 | 2857526545 | 278 |
| 360 | iso_pu_bacteria | 2876808645 | 2876814212 | 278 |
| 361 | iso_pu_bacteria | 2879110137 | 2879113337 | 278 |
| 362 | iso_pu_bacteria | 2885366525 | 2885369359 | 278 |
| 363 | iso_pu_bacteria | 2888419890 | 2888420148 | 278 |
| 364 | iso_pu_bacteria | 2889033259 | 2889035328 | 278 |
| 365 | iso_pu_bacteria | 2893066018 | 2893067207 | 278 |
| 366 | iso_pu_bacteria | 2904690495 | 2904691029 | 278 |
| 367 | iso_pu_bacteria | 2906626472 | 2906628533 | 278 |
| 368 | iso_pu_bacteria | 2908756301 | 2908757087 | 278 |
| 369 | iso_pu_bacteria | 2919073203 | 2919073635 | 278 |
| 370 | iso_pu_bacteria | 2922361189 | 2922363183 | 278 |
| 371 | iso_pu_bacteria | 2922386360 | 2922388512 | 278 |
| 372 | iso_pu_bacteria | 2922393267 | 2922400051 | 278 |
| 373 | iso_pu_bacteria | 2935608549 | 2935615545 | 278 |
| 374 | iso_pu_bacteria | 2935819856 | 2935825654 | 278 |
| 375 | iso_pu_bacteria | 2935847175 | 2935853418 | 278 |
| 376 | iso_pu_bacteria | 2935959822 | 2935966745 | 278 |
| 377 | iso_pu_bacteria | 2936055302 | 2936060254 | 278 |
| 378 | iso_pu_bacteria | 3005506211 | 3005509005 | 278 |
| 379 | iso_pu_bacteria | 8006964411 | 8006967612 | 278 |
| 380 | iso_pu_bacteria | 8006984368 | 8006991082 | 278 |
| 381 | iso_pu_bacteria | 8006994254 | 8007000411 | 278 |
| 382 | iso_pu_bacteria | 8016583857 | 8016586268 | 278 |
| 383 | iso_pu_bacteria | 8056689827 | 8056691120 | 278 |
| 384 | 3300005347 | Ga0070668_100187291 | Ga0070668_1001872911 | 279 |
| 385 | 3300005937 | Ga0081455_10005086 | Ga0081455_100050862 | 279 |
| 386 | 3300006048 | Ga0075363_100123090 | Ga0075363_1001230901 | 279 |
| 387 | 3300006177 | Ga0075362_10041956 | Ga0075362_100419562 | 279 |
| 388 | 3300006844 | Ga0075428_100003141 | Ga0075428_10000314118 | 279 |
| 389 | 3300006847 | Ga0075431_100000568 | Ga0075431_10000056811 | 279 |
| 390 | 3300006880 | Ga0075429_100003175 | Ga0075429_1000031756 | 279 |
| 391 | 3300006881 | Ga0068865_100292659 | Ga0068865_1002926592 | 279 |
| 392 | 3300009094 | Ga0111539_10001515 | Ga0111539_100015156 | 279 |
| 393 | 3300009147 | Ga0114129_10000692 | Ga0114129_1000069243 | 279 |
| 394 | 3300009147 | Ga0114129_10065672 | Ga0114129_100656722 | 279 |
| 395 | 3300009553 | Ga0105249_10746958 | Ga0105249_107469582 | 279 |
| 396 | 3300014326 | Ga0157380_10303924 | Ga0157380_103039241 | 279 |
| 397 | 3300025899 | Ga0207642_10135499 | Ga0207642_101354992 | 279 |
| 398 | 3300025901 | Ga0207688_10087080 | Ga0207688_100870802 | 279 |
| 399 | 3300025942 | Ga0207689_10289799 | Ga0207689_102897992 | 279 |
| 400 | 3300026089 | Ga0207648_10120914 | Ga0207648_101209143 | 279 |
| 401 | 3300027907 | Ga0207428_10002337 | Ga0207428_1000233713 | 279 |
| 402 | 3300035171 | Ga0373946_0025554 | Ga0373946_0025554_104_982 | 279 |
| 403 | 3300037068 | Ga0373925_0107949 | Ga0373925_0107949_1115_1993 | 279 |
| 404 | 3300037418 | Ga0395900_0030391 | Ga0395900_0030391_3953_4843 | 279 |
| 405 | 3300037418 | Ga0395900_0089045 | Ga0395900_0089045_1329_2207 | 279 |
| 406 | 3300037466 | Ga0395898_0041823 | Ga0395898_0041823_932_1810 | 279 |
| 407 | 3300037466 | Ga0395898_0063279 | Ga0395898_0063279_706_1593 | 279 |
| 408 | 3300037466 | Ga0395898_0134131 | Ga0395898_0134131_856_1725 | 279 |
| 409 | 3300038443 | Ga0395901_0021536 | Ga0395901_0021536_3461_4339 | 279 |
| 410 | 3300046455 | Ga0495603_0088181 | Ga0495603_0088181_340_1218 | 279 |
| 411 | 3300046475 | Ga0495639_0035724 | Ga0495639_0035724_987_1865 | 279 |
| 412 | 3300046491 | Ga0495584_0112632 | Ga0495584_0112632_129_1007 | 279 |
| 413 | 3300046492 | Ga0495585_0114167 | Ga0495585_0114167_356_1234 | 279 |
| 414 | 3300046513 | Ga0495616_0063169 | Ga0495616_0063169_796_1668 | 279 |
| 415 | 3300046537 | Ga0495598_0080433 | Ga0495598_0080433_140_1018 | 279 |
| 416 | 3300046681 | Ga0495647_0015891 | Ga0495647_0015891_764_1642 | 279 |
| 417 | 3300046684 | Ga0495669_0146084 | Ga0495669_0146084_29_907 | 279 |
| 418 | 3300047321 | Ga0495676_0300500 | Ga0495676_0300500_111_989 | 279 |
| 419 | 3300048918 | Ga0496115_0210589 | Ga0496115_0210589_690_1556 | 279 |
| 420 | 3300049569 | Ga0501032_0004147 | Ga0501032_0004147_3100_3969 | 279 |
| 421 | 3300049571 | Ga0501034_0076480 | Ga0501034_0076480_1431_2300 | 279 |
| 422 | 3300049585 | Ga0501069_0256429 | Ga0501069_0256429_119_988 | 279 |
| 423 | 3300050507 | nmdc:mga05p37_427_c1 | nmdc:mga05p37_427_c1_39974_40852 | 279 |
| 424 | 3300050507 | nmdc:mga05p37_6551_c1 | nmdc:mga05p37_6551_c1_10708_11586 | 279 |
| 425 | 3300050508 | nmdc:mga09592_2873_c1 | nmdc:mga09592_2873_c1_2703_3581 | 279 |
| 426 | 3300050509 | nmdc:mga0qj67_51727_c2 | nmdc:mga0qj67_51727_c2_1057_1935 | 279 |
| 427 | 3300050510 | nmdc:mga06r32_109361_c1 | nmdc:mga06r32_109361_c1_487_1365 | 279 |
| 428 | 3300050510 | nmdc:mga06r32_2417_c1 | nmdc:mga06r32_2417_c1_8086_8964 | 279 |
| 429 | 3300050511 | nmdc:mga08y16_90_c1 | nmdc:mga08y16_90_c1_50610_51488 | 279 |
| 430 | 3300053077 | Ga0495601_0026481 | Ga0495601_0026481_70_945 | 279 |
| 431 | 3300053136 | Ga0500559_0172991 | Ga0500559_0172991_44_907 | 279 |
| 432 | 3300053151 | Ga0500604_0044976 | Ga0500604_0044976_20_892 | 279 |
| 433 | iso_pu_bacteria | 2917554339 | 2917554972 | 279 |
| 434 | 3300005336 | Ga0070680_100046810 | Ga0070680_1000468104 | 280 |
| 435 | 3300005434 | Ga0070709_10056369 | Ga0070709_100563692 | 280 |
| 436 | 3300005436 | Ga0070713_100003576 | Ga0070713_1000035762 | 280 |
| 437 | 3300005436 | Ga0070713_100103980 | Ga0070713_1001039801 | 280 |
| 438 | 3300005437 | Ga0070710_10001532 | Ga0070710_100015327 | 280 |
| 439 | 3300005437 | Ga0070710_10024153 | Ga0070710_100241534 | 280 |
| 440 | 3300005437 | Ga0070710_10035594 | Ga0070710_100355942 | 280 |
| 441 | 3300005439 | Ga0070711_100009673 | Ga0070711_1000096732 | 280 |
| 442 | 3300005439 | Ga0070711_100012351 | Ga0070711_1000123515 | 280 |
| 443 | 3300005535 | Ga0070684_100025298 | Ga0070684_1000252982 | 280 |
| 444 | 3300005563 | Ga0068855_100153539 | Ga0068855_1001535393 | 280 |
| 445 | 3300005614 | Ga0068856_100000883 | Ga0068856_10000088310 | 280 |
| 446 | 3300005618 | Ga0068864_100033808 | Ga0068864_1000338084 | 280 |
| 447 | 3300005843 | Ga0068860_100000477 | Ga0068860_10000047739 | 280 |
| 448 | 3300006028 | Ga0070717_10119310 | Ga0070717_101193102 | 280 |
| 449 | 3300006028 | Ga0070717_10231831 | Ga0070717_102318312 | 280 |
| 450 | 3300006051 | Ga0075364_10034501 | Ga0075364_100345013 | 280 |
| 451 | 3300006163 | Ga0070715_10213345 | Ga0070715_102133452 | 280 |
| 452 | 3300006173 | Ga0070716_100227526 | Ga0070716_1002275262 | 280 |
| 453 | 3300006175 | Ga0070712_100034544 | Ga0070712_1000345443 | 280 |
| 454 | 3300006178 | Ga0075367_10049481 | Ga0075367_100494812 | 280 |
| 455 | 3300009093 | Ga0105240_10062589 | Ga0105240_100625894 | 280 |
| 456 | 3300009545 | Ga0105237_10067599 | Ga0105237_100675994 | 280 |
| 457 | 3300009545 | Ga0105237_10133597 | Ga0105237_101335972 | 280 |
| 458 | 3300010375 | Ga0105239_10227921 | Ga0105239_102279212 | 280 |
| 459 | 3300013105 | Ga0157369_10052065 | Ga0157369_100520654 | 280 |
| 460 | 3300020082 | Ga0206353_11234579 | Ga0206353_112345792 | 280 |
| 461 | 3300021361 | Ga0213872_10140105 | Ga0213872_101401052 | 280 |
| 462 | 3300021384 | Ga0213876_10005453 | Ga0213876_100054531 | 280 |
| 463 | 3300021384 | Ga0213876_10125669 | Ga0213876_101256691 | 280 |
| 464 | 3300021384 | Ga0213876_10131901 | Ga0213876_101319012 | 280 |
| 465 | 3300021384 | Ga0213876_10234387 | Ga0213876_102343871 | 280 |
| 466 | 3300021441 | Ga0213871_10021333 | Ga0213871_100213332 | 280 |
| 467 | 3300025898 | Ga0207692_10000565 | Ga0207692_100005652 | 280 |
| 468 | 3300025898 | Ga0207692_10052384 | Ga0207692_100523842 | 280 |
| 469 | 3300025904 | Ga0207647_10092600 | Ga0207647_100926002 | 280 |
| 470 | 3300025912 | Ga0207707_10128117 | Ga0207707_101281171 | 280 |
| 471 | 3300025913 | Ga0207695_10092643 | Ga0207695_100926432 | 280 |
| 472 | 3300025913 | Ga0207695_10241252 | Ga0207695_102412521 | 280 |
| 473 | 3300025914 | Ga0207671_10034623 | Ga0207671_100346233 | 280 |
| 474 | 3300025914 | Ga0207671_10114074 | Ga0207671_101140742 | 280 |
| 475 | 3300025915 | Ga0207693_10021801 | Ga0207693_100218012 | 280 |
| 476 | 3300025916 | Ga0207663_10042175 | Ga0207663_100421752 | 280 |
| 477 | 3300025916 | Ga0207663_10050996 | Ga0207663_100509962 | 280 |
| 478 | 3300025928 | Ga0207700_10010887 | Ga0207700_100108872 | 280 |
| 479 | 3300025928 | Ga0207700_10073901 | Ga0207700_100739011 | 280 |
| 480 | 3300025929 | Ga0207664_10012301 | Ga0207664_100123012 | 280 |
| 481 | 3300025939 | Ga0207665_10112997 | Ga0207665_101129972 | 280 |
| 482 | 3300025944 | Ga0207661_10002867 | Ga0207661_1000286712 | 280 |
| 483 | 3300025944 | Ga0207661_10380521 | Ga0207661_103805211 | 280 |
| 484 | 3300025949 | Ga0207667_10538213 | Ga0207667_105382132 | 280 |
| 485 | 3300026067 | Ga0207678_10567390 | Ga0207678_105673901 | 280 |
| 486 | 3300026078 | Ga0207702_10000318 | Ga0207702_100003189 | 280 |
| 487 | 3300028381 | Ga0268264_10000062 | Ga0268264_10000062236 | 280 |
| 488 | 3300030521 | Ga0307511_10054505 | Ga0307511_100545051 | 280 |
| 489 | 3300031507 | Ga0307509_10006160 | Ga0307509_1000616016 | 280 |
| 490 | 3300031616 | Ga0307508_10000045 | Ga0307508_1000004538 | 280 |
| 491 | 3300031901 | Ga0307406_10454913 | Ga0307406_104549131 | 280 |
| 492 | 3300033179 | Ga0307507_10110502 | Ga0307507_101105022 | 280 |
| 493 | 3300035113 | Ga0373936_0030004 | Ga0373936_0030004_1050_1919 | 280 |
| 494 | 3300035172 | Ga0373955_0030936 | Ga0373955_0030936_501_1394 | 280 |
| 495 | 3300035692 | Ga0373935_0097097 | Ga0373935_0097097_284_1150 | 280 |
| 496 | 3300035724 | Ga0373933_0000885 | Ga0373933_0000885_7315_8181 | 280 |
| 497 | 3300035725 | Ga0373947_0236599 | Ga0373947_0236599_50_916 | 280 |
| 498 | 3300036401 | Ga0373937_0022449 | Ga0373937_0022449_1553_2419 | 280 |
| 499 | 3300037068 | Ga0373925_0054728 | Ga0373925_0054728_1861_2727 | 280 |
| 500 | 3300037312 | Ga0395899_0006366 | Ga0395899_0006366_1609_2499 | 280 |
| 501 | 3300037418 | Ga0395900_0009214 | Ga0395900_0009214_5579_6445 | 280 |
| 502 | 3300037853 | Ga0436364_0452492 | Ga0436364_0452492_85_951 | 280 |
| 503 | 3300038443 | Ga0395901_0077817 | Ga0395901_0077817_2532_3398 | 280 |
| 504 | 3300039437 | Ga0436365_0172137 | Ga0436365_0172137_1834_2706 | 280 |
| 505 | 3300039437 | Ga0436365_0734530 | Ga0436365_0734530_91_957 | 280 |
| 506 | 3300039437 | Ga0436365_0903245 | Ga0436365_0903245_753_1619 | 280 |
| 507 | 3300039437 | Ga0436365_1607953 | Ga0436365_1607953_366_1232 | 280 |
| 508 | 3300039438 | Ga0436360_0831213 | Ga0436360_0831213_263_1129 | 280 |
| 509 | 3300039447 | Ga0436361_0000238 | Ga0436361_0000238_144_1010 | 280 |
| 510 | 3300039447 | Ga0436361_0274303 | Ga0436361_0274303_42_920 | 280 |
| 511 | 3300039447 | Ga0436361_1209439 | Ga0436361_1209439_327_1193 | 280 |
| 512 | 3300039453 | Ga0436362_0233201 | Ga0436362_0233201_698_1564 | 280 |
| 513 | 3300044694 | Ga0466963_0043770 | Ga0466963_0043770_494_1384 | 280 |
| 514 | 3300044694 | Ga0466963_0054350 | Ga0466963_0054350_412_1278 | 280 |
| 515 | 3300044719 | Ga0466971_0058502 | Ga0466971_0058502_164_1030 | 280 |
| 516 | 3300044735 | Ga0466968_0118017 | Ga0466968_0118017_307_1173 | 280 |
| 517 | 3300045049 | Ga0466959_0074305 | Ga0466959_0074305_115_981 | 280 |
| 518 | 3300045976 | Ga0466967_0111496 | Ga0466967_0111496_322_1188 | 280 |
| 519 | 3300045976 | Ga0466967_0280836 | Ga0466967_0280836_347_1237 | 280 |
| 520 | 3300048909 | Ga0496106_0001644 | Ga0496106_0001644_3327_4208 | 280 |
| 521 | 3300048920 | Ga0496117_0046301 | Ga0496117_0046301_963_1844 | 280 |
| 522 | 3300048921 | Ga0496118_0023464 | Ga0496118_0023464_3482_4363 | 280 |
| 523 | 3300048924 | Ga0496121_0001257 | Ga0496121_0001257_163_1044 | 280 |
| 524 | 3300048924 | Ga0496121_0010674 | Ga0496121_0010674_5274_6140 | 280 |
| 525 | 3300048928 | Ga0496125_0033842 | Ga0496125_0033842_2759_3625 | 280 |
| 526 | 3300048928 | Ga0496125_0075698 | Ga0496125_0075698_193_1074 | 280 |
| 527 | 3300049590 | Ga0501074_0018479 | Ga0501074_0018479_1316_2182 | 280 |
| 528 | 3300049590 | Ga0501074_0231359 | Ga0501074_0231359_46_930 | 280 |
| 529 | 3300049591 | Ga0501075_0103633 | Ga0501075_0103633_209_1093 | 280 |
| 530 | 3300049593 | Ga0501077_0134539 | Ga0501077_0134539_389_1273 | 280 |
| 531 | 3300049742 | Ga0501080_0064626 | Ga0501080_0064626_872_1738 | 280 |
| 532 | 3300049823 | Ga0501044_0253318 | Ga0501044_0253318_601_1467 | 280 |
| 533 | 3300049824 | Ga0501045_0022970 | Ga0501045_0022970_544_1428 | 280 |
| 534 | 3300050491 | nmdc:mga00v17_63096_c1 | nmdc:mga00v17_63096_c1_872_1738 | 280 |
| 535 | 3300050510 | nmdc:mga06r32_306343_c1 | nmdc:mga06r32_306343_c1_644_1522 | 280 |
| 536 | 3300053077 | Ga0495601_0006579 | Ga0495601_0006579_2131_2997 | 280 |
| 537 | 3300053080 | Ga0500635_0004048 | Ga0500635_0004048_450_1328 | 280 |
| 538 | 3300053080 | Ga0500635_0067662 | Ga0500635_0067662_308_1174 | 280 |
| 539 | 3300053094 | Ga0500566_0000107 | Ga0500566_0000107_6514_7380 | 280 |
| 540 | 3300053119 | Ga0500595_041070 | Ga0500595_041070_582_1448 | 280 |
| 541 | 3300053136 | Ga0500559_0040338 | Ga0500559_0040338_37_918 | 280 |
| 542 | 3300053136 | Ga0500559_0138116 | Ga0500559_0138116_132_1010 | 280 |
| 543 | 3300053159 | Ga0500630_049983 | Ga0500630_049983_903_1769 | 280 |
| 544 | 3300053162 | Ga0500638_140299 | Ga0500638_140299_77_943 | 280 |
| 545 | 3300053177 | Ga0500636_0236835 | Ga0500636_0236835_22_888 | 280 |
| 546 | 3300053178 | Ga0500637_0052147 | Ga0500637_0052147_103_969 | 280 |
| 547 | 3300061719 | Ga0466962_0034341 | Ga0466962_0034341_990_1856 | 280 |
| 548 | 3300005366 | Ga0070659_100038851 | Ga0070659_1000388514 | 281 |
| 549 | 3300005536 | Ga0070697_100099077 | Ga0070697_1000990772 | 281 |
| 550 | 3300005563 | Ga0068855_100112279 | Ga0068855_1001122792 | 281 |
| 551 | 3300005578 | Ga0068854_100178383 | Ga0068854_1001783831 | 281 |
| 552 | 3300005614 | Ga0068856_100488926 | Ga0068856_1004889261 | 281 |
| 553 | 3300005616 | Ga0068852_100116544 | Ga0068852_1001165442 | 281 |
| 554 | 3300005937 | Ga0081455_10354979 | Ga0081455_103549791 | 281 |
| 555 | 3300006163 | Ga0070715_10090401 | Ga0070715_100904012 | 281 |
| 556 | 3300006175 | Ga0070712_100102723 | Ga0070712_1001027232 | 281 |
| 557 | 3300006852 | Ga0075433_10250376 | Ga0075433_102503761 | 281 |
| 558 | 3300007265 | Ga0099794_10001485 | Ga0099794_100014855 | 281 |
| 559 | 3300014325 | Ga0163163_10475090 | Ga0163163_104750901 | 281 |
| 560 | 3300025905 | Ga0207685_10078961 | Ga0207685_100789612 | 281 |
| 561 | 3300025910 | Ga0207684_10002963 | Ga0207684_1000296316 | 281 |
| 562 | 3300025915 | Ga0207693_10042386 | Ga0207693_100423862 | 281 |
| 563 | 3300025917 | Ga0207660_10089142 | Ga0207660_100891422 | 281 |
| 564 | 3300025928 | Ga0207700_10208805 | Ga0207700_102088051 | 281 |
| 565 | 3300031235 | Ga0265330_10038896 | Ga0265330_100388962 | 281 |
| 566 | 3300031247 | Ga0265340_10017518 | Ga0265340_100175183 | 281 |
| 567 | 3300031249 | Ga0265339_10117155 | Ga0265339_101171551 | 281 |
| 568 | 3300031250 | Ga0265331_10171233 | Ga0265331_101712331 | 281 |
| 569 | 3300031711 | Ga0265314_10168340 | Ga0265314_101683402 | 281 |
| 570 | 3300036401 | Ga0373937_0214019 | Ga0373937_0214019_137_1006 | 281 |
| 571 | 3300037068 | Ga0373925_0012102 | Ga0373925_0012102_2031_2900 | 281 |
| 572 | 3300039450 | Ga0436363_0407324 | Ga0436363_0407324_364_1236 | 281 |
| 573 | 3300046507 | Ga0495606_0000831 | Ga0495606_0000831_1338_2210 | 281 |
| 574 | 3300047322 | Ga0495680_0192032 | Ga0495680_0192032_553_1425 | 281 |
| 575 | 3300048913 | Ga0496110_0004921 | Ga0496110_0004921_6515_7393 | 281 |
| 576 | 3300048915 | Ga0496112_0075729 | Ga0496112_0075729_184_1062 | 281 |
| 577 | 3300048915 | Ga0496112_0089343 | Ga0496112_0089343_1994_2863 | 281 |
| 578 | 3300050512 | nmdc:mga0n895_399422_c1 | nmdc:mga0n895_399422_c1_46_924 | 281 |
| 579 | 3300001979 | JGI24740J21852_10006878 | JGI24740J21852_100068785 | 282 |
| 580 | 3300001990 | JGI24737J22298_10015483 | JGI24737J22298_100154833 | 282 |
| 581 | 3300002077 | JGI24744J21845_10026309 | JGI24744J21845_100263091 | 282 |
| 582 | 3300003354 | JGI25160J50197_1007581 | JGI25160J50197_10075813 | 282 |
| 583 | 3300003659 | JGI25404J52841_10017513 | JGI25404J52841_100175132 | 282 |
| 584 | 3300005327 | Ga0070658_10377518 | Ga0070658_103775181 | 282 |
| 585 | 3300005329 | Ga0070683_100070525 | Ga0070683_1000705252 | 282 |
| 586 | 3300005330 | Ga0070690_100081395 | Ga0070690_1000813952 | 282 |
| 587 | 3300005331 | Ga0070670_100179008 | Ga0070670_1001790082 | 282 |
| 588 | 3300005334 | Ga0068869_100044714 | Ga0068869_1000447143 | 282 |
| 589 | 3300005336 | Ga0070680_100022603 | Ga0070680_1000226032 | 282 |
| 590 | 3300005336 | Ga0070680_100098721 | Ga0070680_1000987212 | 282 |
| 591 | 3300005338 | Ga0068868_100016512 | Ga0068868_1000165127 | 282 |
| 592 | 3300005339 | Ga0070660_100008345 | Ga0070660_1000083456 | 282 |
| 593 | 3300005339 | Ga0070660_100265323 | Ga0070660_1002653231 | 282 |
| 594 | 3300005339 | Ga0070660_100301020 | Ga0070660_1003010202 | 282 |
| 595 | 3300005347 | Ga0070668_100134018 | Ga0070668_1001340182 | 282 |
| 596 | 3300005353 | Ga0070669_100040796 | Ga0070669_1000407962 | 282 |
| 597 | 3300005354 | Ga0070675_100142137 | Ga0070675_1001421374 | 282 |
| 598 | 3300005355 | Ga0070671_100073962 | Ga0070671_1000739622 | 282 |
| 599 | 3300005356 | Ga0070674_100154706 | Ga0070674_1001547062 | 282 |
| 600 | 3300005364 | Ga0070673_100218483 | Ga0070673_1002184833 | 282 |
| 601 | 3300005366 | Ga0070659_100039277 | Ga0070659_1000392773 | 282 |
| 602 | 3300005367 | Ga0070667_100624676 | Ga0070667_1006246761 | 282 |
| 603 | 3300005367 | Ga0070667_100660470 | Ga0070667_1006604701 | 282 |
| 604 | 3300005435 | Ga0070714_100112182 | Ga0070714_1001121822 | 282 |
| 605 | 3300005439 | Ga0070711_100008302 | Ga0070711_1000083027 | 282 |
| 606 | 3300005440 | Ga0070705_100077274 | Ga0070705_1000772744 | 282 |
| 607 | 3300005455 | Ga0070663_100026672 | Ga0070663_1000266722 | 282 |
| 608 | 3300005455 | Ga0070663_100199834 | Ga0070663_1001998342 | 282 |
| 609 | 3300005455 | Ga0070663_100206617 | Ga0070663_1002066173 | 282 |
| 610 | 3300005456 | Ga0070678_100034660 | Ga0070678_1000346604 | 282 |
| 611 | 3300005457 | Ga0070662_100262216 | Ga0070662_1002622161 | 282 |
| 612 | 3300005458 | Ga0070681_10277524 | Ga0070681_102775242 | 282 |
| 613 | 3300005458 | Ga0070681_10306009 | Ga0070681_103060091 | 282 |
| 614 | 3300005459 | Ga0068867_100423905 | Ga0068867_1004239052 | 282 |
| 615 | 3300005530 | Ga0070679_100002400 | Ga0070679_1000024006 | 282 |
| 616 | 3300005530 | Ga0070679_100030485 | Ga0070679_1000304852 | 282 |
| 617 | 3300005530 | Ga0070679_100561122 | Ga0070679_1005611221 | 282 |
| 618 | 3300005535 | Ga0070684_100043767 | Ga0070684_1000437672 | 282 |
| 619 | 3300005539 | Ga0068853_100003310 | Ga0068853_10000331013 | 282 |
| 620 | 3300005539 | Ga0068853_100038170 | Ga0068853_1000381704 | 282 |
| 621 | 3300005539 | Ga0068853_100039338 | Ga0068853_1000393384 | 282 |
| 622 | 3300005539 | Ga0068853_100059209 | Ga0068853_1000592091 | 282 |
| 623 | 3300005539 | Ga0068853_100190008 | Ga0068853_1001900082 | 282 |
| 624 | 3300005546 | Ga0070696_100026887 | Ga0070696_1000268874 | 282 |
| 625 | 3300005548 | Ga0070665_100029471 | Ga0070665_1000294715 | 282 |
| 626 | 3300005548 | Ga0070665_100031667 | Ga0070665_1000316675 | 282 |
| 627 | 3300005548 | Ga0070665_100091913 | Ga0070665_1000919132 | 282 |
| 628 | 3300005549 | Ga0070704_100336465 | Ga0070704_1003364652 | 282 |
| 629 | 3300005563 | Ga0068855_100026317 | Ga0068855_1000263176 | 282 |
| 630 | 3300005563 | Ga0068855_100053234 | Ga0068855_1000532343 | 282 |
| 631 | 3300005563 | Ga0068855_100060155 | Ga0068855_1000601555 | 282 |
| 632 | 3300005563 | Ga0068855_100112294 | Ga0068855_1001122943 | 282 |
| 633 | 3300005577 | Ga0068857_100001037 | Ga0068857_1000010378 | 282 |
| 634 | 3300005577 | Ga0068857_100033794 | Ga0068857_1000337945 | 282 |
| 635 | 3300005577 | Ga0068857_100443105 | Ga0068857_1004431052 | 282 |
| 636 | 3300005578 | Ga0068854_100001597 | Ga0068854_1000015974 | 282 |
| 637 | 3300005578 | Ga0068854_100019432 | Ga0068854_1000194322 | 282 |
| 638 | 3300005578 | Ga0068854_100102280 | Ga0068854_1001022803 | 282 |
| 639 | 3300005578 | Ga0068854_100223513 | Ga0068854_1002235132 | 282 |
| 640 | 3300005614 | Ga0068856_100012184 | Ga0068856_1000121849 | 282 |
| 641 | 3300005614 | Ga0068856_100155809 | Ga0068856_1001558092 | 282 |
| 642 | 3300005616 | Ga0068852_100030003 | Ga0068852_1000300035 | 282 |
| 643 | 3300005617 | Ga0068859_100047861 | Ga0068859_1000478615 | 282 |
| 644 | 3300005617 | Ga0068859_100667026 | Ga0068859_1006670262 | 282 |
| 645 | 3300005719 | Ga0068861_100141285 | Ga0068861_1001412851 | 282 |
| 646 | 3300005719 | Ga0068861_100368396 | Ga0068861_1003683961 | 282 |
| 647 | 3300005719 | Ga0068861_100637789 | Ga0068861_1006377892 | 282 |
| 648 | 3300005834 | Ga0068851_10000558 | Ga0068851_100005586 | 282 |
| 649 | 3300005834 | Ga0068851_10015981 | Ga0068851_100159812 | 282 |
| 650 | 3300005840 | Ga0068870_10053768 | Ga0068870_100537683 | 282 |
| 651 | 3300005842 | Ga0068858_100069349 | Ga0068858_1000693492 | 282 |
| 652 | 3300005842 | Ga0068858_100178809 | Ga0068858_1001788092 | 282 |
| 653 | 3300005842 | Ga0068858_100297313 | Ga0068858_1002973132 | 282 |
| 654 | 3300005844 | Ga0068862_100094520 | Ga0068862_1000945203 | 282 |
| 655 | 3300005844 | Ga0068862_100102424 | Ga0068862_1001024241 | 282 |
| 656 | 3300005937 | Ga0081455_10007370 | Ga0081455_100073708 | 282 |
| 657 | 3300005937 | Ga0081455_10007381 | Ga0081455_1000738112 | 282 |
| 658 | 3300005981 | Ga0081538_10074134 | Ga0081538_100741342 | 282 |
| 659 | 3300005983 | Ga0081540_1003488 | Ga0081540_100348811 | 282 |
| 660 | 3300005983 | Ga0081540_1008854 | Ga0081540_10088544 | 282 |
| 661 | 3300005983 | Ga0081540_1048845 | Ga0081540_10488452 | 282 |
| 662 | 3300005985 | Ga0081539_10018659 | Ga0081539_100186595 | 282 |
| 663 | 3300006038 | Ga0075365_10106354 | Ga0075365_101063542 | 282 |
| 664 | 3300006042 | Ga0075368_10064243 | Ga0075368_100642432 | 282 |
| 665 | 3300006042 | Ga0075368_10088191 | Ga0075368_100881911 | 282 |
| 666 | 3300006048 | Ga0075363_100004174 | Ga0075363_1000041744 | 282 |
| 667 | 3300006048 | Ga0075363_100082345 | Ga0075363_1000823452 | 282 |
| 668 | 3300006051 | Ga0075364_10018451 | Ga0075364_100184515 | 282 |
| 669 | 3300006058 | Ga0075432_10048537 | Ga0075432_100485371 | 282 |
| 670 | 3300006177 | Ga0075362_10020405 | Ga0075362_100204053 | 282 |
| 671 | 3300006186 | Ga0075369_10009037 | Ga0075369_100090372 | 282 |
| 672 | 3300006237 | Ga0097621_100339564 | Ga0097621_1003395642 | 282 |
| 673 | 3300006237 | Ga0097621_100451914 | Ga0097621_1004519141 | 282 |
| 674 | 3300006353 | Ga0075370_10022430 | Ga0075370_100224302 | 282 |
| 675 | 3300006353 | Ga0075370_10102322 | Ga0075370_101023222 | 282 |
| 676 | 3300006844 | Ga0075428_100532983 | Ga0075428_1005329831 | 282 |
| 677 | 3300006931 | Ga0097620_100047862 | Ga0097620_1000478622 | 282 |
| 678 | 3300006931 | Ga0097620_100666967 | Ga0097620_1006669672 | 282 |
| 679 | 3300007265 | Ga0099794_10036912 | Ga0099794_100369123 | 282 |
| 680 | 3300009093 | Ga0105240_10002459 | Ga0105240_1000245917 | 282 |
| 681 | 3300009093 | Ga0105240_10087076 | Ga0105240_100870763 | 282 |
| 682 | 3300009093 | Ga0105240_10170354 | Ga0105240_101703542 | 282 |
| 683 | 3300009094 | Ga0111539_10091971 | Ga0111539_100919712 | 282 |
| 684 | 3300009098 | Ga0105245_10189575 | Ga0105245_101895752 | 282 |
| 685 | 3300009101 | Ga0105247_10265102 | Ga0105247_102651021 | 282 |
| 686 | 3300009148 | Ga0105243_10377080 | Ga0105243_103770801 | 282 |
| 687 | 3300009174 | Ga0105241_10000249 | Ga0105241_1000024913 | 282 |
| 688 | 3300009174 | Ga0105241_10109783 | Ga0105241_101097833 | 282 |
| 689 | 3300009176 | Ga0105242_10099724 | Ga0105242_100997243 | 282 |
| 690 | 3300009177 | Ga0105248_10156900 | Ga0105248_101569002 | 282 |
| 691 | 3300009177 | Ga0105248_10385572 | Ga0105248_103855722 | 282 |
| 692 | 3300009545 | Ga0105237_10168759 | Ga0105237_101687592 | 282 |
| 693 | 3300009545 | Ga0105237_10286091 | Ga0105237_102860912 | 282 |
| 694 | 3300009551 | Ga0105238_10001235 | Ga0105238_100012354 | 282 |
| 695 | 3300009551 | Ga0105238_10014511 | Ga0105238_100145113 | 282 |
| 696 | 3300009551 | Ga0105238_10038587 | Ga0105238_100385875 | 282 |
| 697 | 3300009553 | Ga0105249_10044828 | Ga0105249_100448283 | 282 |
| 698 | 3300009553 | Ga0105249_10840241 | Ga0105249_108402411 | 282 |
| 699 | 3300010159 | Ga0099796_10020835 | Ga0099796_100208352 | 282 |
| 700 | 3300010375 | Ga0105239_10032291 | Ga0105239_100322916 | 282 |
| 701 | 3300010375 | Ga0105239_10061707 | Ga0105239_100617073 | 282 |
| 702 | 3300010375 | Ga0105239_10158333 | Ga0105239_101583332 | 282 |
| 703 | 3300013100 | Ga0157373_10050479 | Ga0157373_100504794 | 282 |
| 704 | 3300013104 | Ga0157370_10015855 | Ga0157370_100158557 | 282 |
| 705 | 3300013104 | Ga0157370_10376246 | Ga0157370_103762461 | 282 |
| 706 | 3300013307 | Ga0157372_10443094 | Ga0157372_104430942 | 282 |
| 707 | 3300013308 | Ga0157375_10139921 | Ga0157375_101399211 | 282 |
| 708 | 3300013308 | Ga0157375_10187578 | Ga0157375_101875782 | 282 |
| 709 | 3300014325 | Ga0163163_10064343 | Ga0163163_100643434 | 282 |
| 710 | 3300014326 | Ga0157380_10163035 | Ga0157380_101630352 | 282 |
| 711 | 3300014745 | Ga0157377_10078649 | Ga0157377_100786492 | 282 |
| 712 | 3300014968 | Ga0157379_10270345 | Ga0157379_102703452 | 282 |
| 713 | 3300017792 | Ga0163161_10070039 | Ga0163161_100700391 | 282 |
| 714 | 3300025297 | Ga0209758_1001918 | Ga0209758_100191816 | 282 |
| 715 | 3300025297 | Ga0209758_1048464 | Ga0209758_10484641 | 282 |
| 716 | 3300025302 | Ga0207426_1001156 | Ga0207426_10011562 | 282 |
| 717 | 3300025321 | Ga0207656_10003400 | Ga0207656_100034001 | 282 |
| 718 | 3300025321 | Ga0207656_10020096 | Ga0207656_100200962 | 282 |
| 719 | 3300025900 | Ga0207710_10014866 | Ga0207710_100148662 | 282 |
| 720 | 3300025901 | Ga0207688_10058536 | Ga0207688_100585362 | 282 |
| 721 | 3300025901 | Ga0207688_10107952 | Ga0207688_101079522 | 282 |
| 722 | 3300025904 | Ga0207647_10009887 | Ga0207647_100098877 | 282 |
| 723 | 3300025907 | Ga0207645_10220582 | Ga0207645_102205821 | 282 |
| 724 | 3300025908 | Ga0207643_10084567 | Ga0207643_100845672 | 282 |
| 725 | 3300025909 | Ga0207705_10241570 | Ga0207705_102415702 | 282 |
| 726 | 3300025911 | Ga0207654_10069399 | Ga0207654_100693992 | 282 |
| 727 | 3300025912 | Ga0207707_10007389 | Ga0207707_1000738910 | 282 |
| 728 | 3300025912 | Ga0207707_10232942 | Ga0207707_102329421 | 282 |
| 729 | 3300025913 | Ga0207695_10000148 | Ga0207695_10000148109 | 282 |
| 730 | 3300025913 | Ga0207695_10000387 | Ga0207695_1000038724 | 282 |
| 731 | 3300025913 | Ga0207695_10136588 | Ga0207695_101365882 | 282 |
| 732 | 3300025913 | Ga0207695_10177135 | Ga0207695_101771352 | 282 |
| 733 | 3300025914 | Ga0207671_10003051 | Ga0207671_100030516 | 282 |
| 734 | 3300025914 | Ga0207671_10026208 | Ga0207671_100262082 | 282 |
| 735 | 3300025916 | Ga0207663_10037861 | Ga0207663_100378613 | 282 |
| 736 | 3300025917 | Ga0207660_10062767 | Ga0207660_100627672 | 282 |
| 737 | 3300025919 | Ga0207657_10009668 | Ga0207657_100096685 | 282 |
| 738 | 3300025919 | Ga0207657_10024873 | Ga0207657_100248735 | 282 |
| 739 | 3300025921 | Ga0207652_10060204 | Ga0207652_100602041 | 282 |
| 740 | 3300025921 | Ga0207652_10069014 | Ga0207652_100690142 | 282 |
| 741 | 3300025924 | Ga0207694_10000121 | Ga0207694_1000012136 | 282 |
| 742 | 3300025924 | Ga0207694_10015653 | Ga0207694_100156533 | 282 |
| 743 | 3300025924 | Ga0207694_10287278 | Ga0207694_102872781 | 282 |
| 744 | 3300025927 | Ga0207687_10014891 | Ga0207687_100148915 | 282 |
| 745 | 3300025929 | Ga0207664_10217097 | Ga0207664_102170972 | 282 |
| 746 | 3300025931 | Ga0207644_10050991 | Ga0207644_100509914 | 282 |
| 747 | 3300025931 | Ga0207644_10135617 | Ga0207644_101356172 | 282 |
| 748 | 3300025932 | Ga0207690_10340721 | Ga0207690_103407213 | 282 |
| 749 | 3300025933 | Ga0207706_10044297 | Ga0207706_100442973 | 282 |
| 750 | 3300025933 | Ga0207706_10111603 | Ga0207706_101116031 | 282 |
| 751 | 3300025935 | Ga0207709_10052061 | Ga0207709_100520612 | 282 |
| 752 | 3300025935 | Ga0207709_10073008 | Ga0207709_100730082 | 282 |
| 753 | 3300025936 | Ga0207670_10229635 | Ga0207670_102296352 | 282 |
| 754 | 3300025937 | Ga0207669_10025452 | Ga0207669_100254522 | 282 |
| 755 | 3300025937 | Ga0207669_10082593 | Ga0207669_100825932 | 282 |
| 756 | 3300025940 | Ga0207691_10253519 | Ga0207691_102535192 | 282 |
| 757 | 3300025940 | Ga0207691_10477779 | Ga0207691_104777791 | 282 |
| 758 | 3300025941 | Ga0207711_10029240 | Ga0207711_100292405 | 282 |
| 759 | 3300025941 | Ga0207711_10219501 | Ga0207711_102195012 | 282 |
| 760 | 3300025942 | Ga0207689_10371073 | Ga0207689_103710732 | 282 |
| 761 | 3300025944 | Ga0207661_10056017 | Ga0207661_100560172 | 282 |
| 762 | 3300025949 | Ga0207667_10007656 | Ga0207667_1000765615 | 282 |
| 763 | 3300025949 | Ga0207667_10016003 | Ga0207667_100160035 | 282 |
| 764 | 3300025949 | Ga0207667_10054033 | Ga0207667_100540333 | 282 |
| 765 | 3300025949 | Ga0207667_10137555 | Ga0207667_101375552 | 282 |
| 766 | 3300025949 | Ga0207667_10316090 | Ga0207667_103160901 | 282 |
| 767 | 3300025961 | Ga0207712_10187413 | Ga0207712_101874132 | 282 |
| 768 | 3300025972 | Ga0207668_10145485 | Ga0207668_101454851 | 282 |
| 769 | 3300025981 | Ga0207640_10005594 | Ga0207640_100055945 | 282 |
| 770 | 3300025981 | Ga0207640_10055934 | Ga0207640_100559341 | 282 |
| 771 | 3300025986 | Ga0207658_10301124 | Ga0207658_103011241 | 282 |
| 772 | 3300026035 | Ga0207703_10014932 | Ga0207703_100149324 | 282 |
| 773 | 3300026035 | Ga0207703_10077871 | Ga0207703_100778713 | 282 |
| 774 | 3300026041 | Ga0207639_10014436 | Ga0207639_100144364 | 282 |
| 775 | 3300026041 | Ga0207639_10308765 | Ga0207639_103087652 | 282 |
| 776 | 3300026067 | Ga0207678_10007286 | Ga0207678_100072862 | 282 |
| 777 | 3300026067 | Ga0207678_10044075 | Ga0207678_100440752 | 282 |
| 778 | 3300026067 | Ga0207678_10232539 | Ga0207678_102325392 | 282 |
| 779 | 3300026067 | Ga0207678_10297876 | Ga0207678_102978762 | 282 |
| 780 | 3300026075 | Ga0207708_10172435 | Ga0207708_101724352 | 282 |
| 781 | 3300026078 | Ga0207702_10000004 | Ga0207702_10000004116 | 282 |
| 782 | 3300026078 | Ga0207702_10051367 | Ga0207702_100513673 | 282 |
| 783 | 3300026078 | Ga0207702_10325607 | Ga0207702_103256072 | 282 |
| 784 | 3300026095 | Ga0207676_10088633 | Ga0207676_100886332 | 282 |
| 785 | 3300026095 | Ga0207676_10205751 | Ga0207676_102057511 | 282 |
| 786 | 3300026116 | Ga0207674_10005964 | Ga0207674_1000596411 | 282 |
| 787 | 3300026116 | Ga0207674_10006033 | Ga0207674_100060339 | 282 |
| 788 | 3300026116 | Ga0207674_10012348 | Ga0207674_100123484 | 282 |
| 789 | 3300026116 | Ga0207674_10122866 | Ga0207674_101228663 | 282 |
| 790 | 3300026118 | Ga0207675_100026733 | Ga0207675_1000267334 | 282 |
| 791 | 3300026118 | Ga0207675_100051099 | Ga0207675_1000510992 | 282 |
| 792 | 3300026118 | Ga0207675_100237438 | Ga0207675_1002374382 | 282 |
| 793 | 3300026121 | Ga0207683_10028337 | Ga0207683_100283373 | 282 |
| 794 | 3300026121 | Ga0207683_10066450 | Ga0207683_100664502 | 282 |
| 795 | 3300026121 | Ga0207683_10360374 | Ga0207683_103603742 | 282 |
| 796 | 3300026142 | Ga0207698_10013415 | Ga0207698_100134152 | 282 |
| 797 | 3300026142 | Ga0207698_10329898 | Ga0207698_103298982 | 282 |
| 798 | 3300027512 | Ga0209179_1016514 | Ga0209179_10165142 | 282 |
| 799 | 3300027671 | Ga0209588_1053255 | Ga0209588_10532552 | 282 |
| 800 | 3300027907 | Ga0207428_10046668 | Ga0207428_100466682 | 282 |
| 801 | 3300027907 | Ga0207428_10311886 | Ga0207428_103118861 | 282 |
| 802 | 3300028379 | Ga0268266_10001906 | Ga0268266_100019061 | 282 |
| 803 | 3300028380 | Ga0268265_10122027 | Ga0268265_101220272 | 282 |
| 804 | 3300028381 | Ga0268264_10470329 | Ga0268264_104703291 | 282 |
| 805 | 3300028573 | Ga0265334_10089935 | Ga0265334_100899351 | 282 |
| 806 | 3300028786 | Ga0307517_10000175 | Ga0307517_10000175109 | 282 |
| 807 | 3300028794 | Ga0307515_10099000 | Ga0307515_100990001 | 282 |
| 808 | 3300028794 | Ga0307515_10236976 | Ga0307515_102369762 | 282 |
| 809 | 3300031456 | Ga0307513_10212321 | Ga0307513_102123211 | 282 |
| 810 | 3300031616 | Ga0307508_10034088 | Ga0307508_100340886 | 282 |
| 811 | 3300031711 | Ga0265314_10014911 | Ga0265314_100149116 | 282 |
| 812 | 3300031712 | Ga0265342_10168724 | Ga0265342_101687242 | 282 |
| 813 | 3300031730 | Ga0307516_10049470 | Ga0307516_100494704 | 282 |
| 814 | 3300031730 | Ga0307516_10161987 | Ga0307516_101619872 | 282 |
| 815 | 3300031730 | Ga0307516_10406943 | Ga0307516_104069431 | 282 |
| 816 | 3300031903 | Ga0307407_10163740 | Ga0307407_101637401 | 282 |
| 817 | 3300032005 | Ga0307411_10150769 | Ga0307411_101507692 | 282 |
| 818 | 3300032126 | Ga0307415_100207760 | Ga0307415_1002077601 | 282 |
| 819 | 3300033180 | Ga0307510_10042915 | Ga0307510_100429152 | 282 |
| 820 | 3300034816 | Ga0373930_0045829 | Ga0373930_0045829_41_913 | 282 |
| 821 | 3300035083 | Ga0373926_0094737 | Ga0373926_0094737_49_921 | 282 |
| 822 | 3300035086 | Ga0373934_0014812 | Ga0373934_0014812_1991_2863 | 282 |
| 823 | 3300035113 | Ga0373936_0023840 | Ga0373936_0023840_777_1655 | 282 |
| 824 | 3300035119 | Ga0373956_0004385 | Ga0373956_0004385_3720_4592 | 282 |
| 825 | 3300035120 | Ga0373957_0007126 | Ga0373957_0007126_2151_3023 | 282 |
| 826 | 3300035170 | Ga0373943_0025075 | Ga0373943_0025075_1309_2181 | 282 |
| 827 | 3300035172 | Ga0373955_0094738 | Ga0373955_0094738_32_904 | 282 |
| 828 | 3300035691 | Ga0373931_0006320 | Ga0373931_0006320_4140_5012 | 282 |
| 829 | 3300035692 | Ga0373935_0219253 | Ga0373935_0219253_369_1241 | 282 |
| 830 | 3300035695 | Ga0373927_0003727 | Ga0373927_0003727_6691_7563 | 282 |
| 831 | 3300035695 | Ga0373927_0114622 | Ga0373927_0114622_146_1018 | 282 |
| 832 | 3300035724 | Ga0373933_0012657 | Ga0373933_0012657_1398_2270 | 282 |
| 833 | 3300035724 | Ga0373933_0171054 | Ga0373933_0171054_386_1258 | 282 |
| 834 | 3300035725 | Ga0373947_0021592 | Ga0373947_0021592_418_1290 | 282 |
| 835 | 3300036401 | Ga0373937_0017394 | Ga0373937_0017394_1237_2109 | 282 |
| 836 | 3300036401 | Ga0373937_0211596 | Ga0373937_0211596_361_1233 | 282 |
| 837 | 3300037068 | Ga0373925_0106664 | Ga0373925_0106664_990_1862 | 282 |
| 838 | 3300037068 | Ga0373925_0297317 | Ga0373925_0297317_302_1174 | 282 |
| 839 | 3300037068 | Ga0373925_0384790 | Ga0373925_0384790_169_1041 | 282 |
| 840 | 3300037418 | Ga0395900_0183174 | Ga0395900_0183174_985_1863 | 282 |
| 841 | 3300037466 | Ga0395898_0085558 | Ga0395898_0085558_1626_2498 | 282 |
| 842 | 3300037471 | Ga0395905_0070559 | Ga0395905_0070559_453_1325 | 282 |
| 843 | 3300037471 | Ga0395905_0096286 | Ga0395905_0096286_1088_1960 | 282 |
| 844 | 3300041443 | Ga0451789_0781606 | Ga0451789_0781606_79_951 | 282 |
| 845 | 3300044684 | Ga0466966_0030392 | Ga0466966_0030392_2445_3329 | 282 |
| 846 | 3300045049 | Ga0466959_0029672 | Ga0466959_0029672_946_1830 | 282 |
| 847 | 3300045976 | Ga0466967_0024550 | Ga0466967_0024550_2670_3542 | 282 |
| 848 | 3300046452 | Ga0495617_012208 | Ga0495617_012208_1773_2645 | 282 |
| 849 | 3300046454 | Ga0495592_0047510 | Ga0495592_0047510_558_1430 | 282 |
| 850 | 3300046454 | Ga0495592_0096467 | Ga0495592_0096467_950_1822 | 282 |
| 851 | 3300046455 | Ga0495603_0003728 | Ga0495603_0003728_4763_5635 | 282 |
| 852 | 3300046455 | Ga0495603_0087718 | Ga0495603_0087718_283_1155 | 282 |
| 853 | 3300046455 | Ga0495603_0172051 | Ga0495603_0172051_75_947 | 282 |
| 854 | 3300046457 | Ga0495590_0043598 | Ga0495590_0043598_569_1441 | 282 |
| 855 | 3300046459 | Ga0495629_0012976 | Ga0495629_0012976_4080_4952 | 282 |
| 856 | 3300046459 | Ga0495629_0188349 | Ga0495629_0188349_273_1145 | 282 |
| 857 | 3300046460 | Ga0495638_0042429 | Ga0495638_0042429_588_1460 | 282 |
| 858 | 3300046460 | Ga0495638_0213480 | Ga0495638_0213480_74_946 | 282 |
| 859 | 3300046461 | Ga0495641_0050540 | Ga0495641_0050540_176_1048 | 282 |
| 860 | 3300046463 | Ga0495653_0029817 | Ga0495653_0029817_1632_2504 | 282 |
| 861 | 3300046472 | Ga0495580_0126051 | Ga0495580_0126051_384_1256 | 282 |
| 862 | 3300046473 | Ga0495582_0105319 | Ga0495582_0105319_567_1439 | 282 |
| 863 | 3300046475 | Ga0495639_0022066 | Ga0495639_0022066_819_1706 | 282 |
| 864 | 3300046492 | Ga0495585_0054506 | Ga0495585_0054506_100_987 | 282 |
| 865 | 3300046492 | Ga0495585_0132400 | Ga0495585_0132400_351_1223 | 282 |
| 866 | 3300046501 | Ga0495607_0108264 | Ga0495607_0108264_307_1179 | 282 |
| 867 | 3300046511 | Ga0495608_0020001 | Ga0495608_0020001_2580_3452 | 282 |
| 868 | 3300046511 | Ga0495608_0035508 | Ga0495608_0035508_477_1349 | 282 |
| 869 | 3300046512 | Ga0495610_0062504 | Ga0495610_0062504_130_1002 | 282 |
| 870 | 3300046514 | Ga0495618_0035721 | Ga0495618_0035721_600_1472 | 282 |
| 871 | 3300046516 | Ga0495628_0003465 | Ga0495628_0003465_258_1130 | 282 |
| 872 | 3300046516 | Ga0495628_0086586 | Ga0495628_0086586_685_1557 | 282 |
| 873 | 3300046519 | Ga0495632_0083372 | Ga0495632_0083372_600_1472 | 282 |
| 874 | 3300046520 | Ga0495637_0022738 | Ga0495637_0022738_326_1198 | 282 |
| 875 | 3300046523 | Ga0495644_0027753 | Ga0495644_0027753_434_1321 | 282 |
| 876 | 3300046523 | Ga0495644_0075459 | Ga0495644_0075459_161_1033 | 282 |
| 877 | 3300046524 | Ga0495648_0003200 | Ga0495648_0003200_1345_2217 | 282 |
| 878 | 3300046524 | Ga0495648_0063981 | Ga0495648_0063981_14_886 | 282 |
| 879 | 3300046525 | Ga0495663_0030584 | Ga0495663_0030584_534_1406 | 282 |
| 880 | 3300046528 | Ga0495642_0059322 | Ga0495642_0059322_385_1257 | 282 |
| 881 | 3300046529 | Ga0495652_0069920 | Ga0495652_0069920_289_1161 | 282 |
| 882 | 3300046530 | Ga0495654_0073393 | Ga0495654_0073393_343_1215 | 282 |
| 883 | 3300046531 | Ga0495665_0070590 | Ga0495665_0070590_780_1652 | 282 |
| 884 | 3300046533 | Ga0495640_0010120 | Ga0495640_0010120_5707_6579 | 282 |
| 885 | 3300046536 | Ga0495587_0062786 | Ga0495587_0062786_1030_1902 | 282 |
| 886 | 3300046539 | Ga0495621_0089462 | Ga0495621_0089462_204_1076 | 282 |
| 887 | 3300046543 | Ga0495645_0010485 | Ga0495645_0010485_418_1290 | 282 |
| 888 | 3300046543 | Ga0495645_0014817 | Ga0495645_0014817_2559_3431 | 282 |
| 889 | 3300046557 | Ga0495622_0017286 | Ga0495622_0017286_157_1029 | 282 |
| 890 | 3300046558 | Ga0495633_0116803 | Ga0495633_0116803_231_1118 | 282 |
| 891 | 3300046559 | Ga0495667_0007798 | Ga0495667_0007798_1967_2839 | 282 |
| 892 | 3300046615 | Ga0495656_0002973 | Ga0495656_0002973_1052_1924 | 282 |
| 893 | 3300046615 | Ga0495656_0015117 | Ga0495656_0015117_1063_1950 | 282 |
| 894 | 3300046616 | Ga0495668_0050768 | Ga0495668_0050768_1090_1968 | 282 |
| 895 | 3300046642 | Ga0495634_0021038 | Ga0495634_0021038_1797_2669 | 282 |
| 896 | 3300046642 | Ga0495634_0099675 | Ga0495634_0099675_136_1008 | 282 |
| 897 | 3300046660 | Ga0495625_0163978 | Ga0495625_0163978_35_907 | 282 |
| 898 | 3300046660 | Ga0495625_0189714 | Ga0495625_0189714_264_1136 | 282 |
| 899 | 3300046663 | Ga0495635_0001868 | Ga0495635_0001868_10797_11669 | 282 |
| 900 | 3300046663 | Ga0495635_0168155 | Ga0495635_0168155_213_1085 | 282 |
| 901 | 3300046664 | Ga0495659_0006735 | Ga0495659_0006735_168_1040 | 282 |
| 902 | 3300046665 | Ga0495661_0040977 | Ga0495661_0040977_487_1359 | 282 |
| 903 | 3300046665 | Ga0495661_0147899 | Ga0495661_0147899_334_1206 | 282 |
| 904 | 3300046675 | Ga0495657_0104274 | Ga0495657_0104274_635_1507 | 282 |
| 905 | 3300046678 | Ga0495599_0020349 | Ga0495599_0020349_56_928 | 282 |
| 906 | 3300046679 | Ga0495623_0025208 | Ga0495623_0025208_1051_1923 | 282 |
| 907 | 3300046679 | Ga0495623_0067334 | Ga0495623_0067334_1048_1920 | 282 |
| 908 | 3300046680 | Ga0495646_0024986 | Ga0495646_0024986_491_1363 | 282 |
| 909 | 3300046680 | Ga0495646_0033708 | Ga0495646_0033708_1959_2831 | 282 |
| 910 | 3300046689 | Ga0495613_0064597 | Ga0495613_0064597_818_1690 | 282 |
| 911 | 3300046689 | Ga0495613_0067323 | Ga0495613_0067323_1494_2366 | 282 |
| 912 | 3300046689 | Ga0495613_0350029 | Ga0495613_0350029_132_1004 | 282 |
| 913 | 3300046691 | Ga0495670_0030236 | Ga0495670_0030236_1247_2134 | 282 |
| 914 | 3300046692 | Ga0495671_0072016 | Ga0495671_0072016_776_1648 | 282 |
| 915 | 3300046809 | Ga0495600_0017842 | Ga0495600_0017842_1137_2009 | 282 |
| 916 | 3300046809 | Ga0495600_0095483 | Ga0495600_0095483_344_1216 | 282 |
| 917 | 3300047315 | Ga0495581_0197803 | Ga0495581_0197803_20_892 | 282 |
| 918 | 3300047315 | Ga0495581_0253545 | Ga0495581_0253545_100_987 | 282 |
| 919 | 3300047317 | Ga0495604_0006243 | Ga0495604_0006243_262_1134 | 282 |
| 920 | 3300047317 | Ga0495604_0071809 | Ga0495604_0071809_907_1779 | 282 |
| 921 | 3300047317 | Ga0495604_0239433 | Ga0495604_0239433_282_1154 | 282 |
| 922 | 3300047318 | Ga0495636_0033052 | Ga0495636_0033052_835_1707 | 282 |
| 923 | 3300047318 | Ga0495636_0119699 | Ga0495636_0119699_130_1017 | 282 |
| 924 | 3300047319 | Ga0495674_0085620 | Ga0495674_0085620_737_1609 | 282 |
| 925 | 3300047319 | Ga0495674_0133635 | Ga0495674_0133635_190_1062 | 282 |
| 926 | 3300047320 | Ga0495672_0010170 | Ga0495672_0010170_4654_5526 | 282 |
| 927 | 3300047320 | Ga0495672_0077919 | Ga0495672_0077919_534_1406 | 282 |
| 928 | 3300047320 | Ga0495672_0078951 | Ga0495672_0078951_952_1824 | 282 |
| 929 | 3300047320 | Ga0495672_0102901 | Ga0495672_0102901_573_1445 | 282 |
| 930 | 3300047320 | Ga0495672_0135313 | Ga0495672_0135313_16_894 | 282 |
| 931 | 3300047320 | Ga0495672_0160184 | Ga0495672_0160184_100_972 | 282 |
| 932 | 3300047322 | Ga0495680_0015081 | Ga0495680_0015081_2818_3690 | 282 |
| 933 | 3300047322 | Ga0495680_0083270 | Ga0495680_0083270_585_1457 | 282 |
| 934 | 3300047444 | Ga0495675_0005364 | Ga0495675_0005364_6581_7453 | 282 |
| 935 | 3300047444 | Ga0495675_0044709 | Ga0495675_0044709_565_1437 | 282 |
| 936 | 3300047469 | Ga0495673_0030759 | Ga0495673_0030759_307_1179 | 282 |
| 937 | 3300047471 | Ga0495684_0006597 | Ga0495684_0006597_5251_6123 | 282 |
| 938 | 3300047471 | Ga0495684_0042816 | Ga0495684_0042816_1587_2459 | 282 |
| 939 | 3300047472 | Ga0495686_0045908 | Ga0495686_0045908_439_1311 | 282 |
| 940 | 3300047673 | Ga0495593_0003761 | Ga0495593_0003761_657_1529 | 282 |
| 941 | 3300048088 | Ga0495602_0182433 | Ga0495602_0182433_119_991 | 282 |
| 942 | 3300048903 | Ga0496100_0268489 | Ga0496100_0268489_330_1202 | 282 |
| 943 | 3300048904 | Ga0496101_0342882 | Ga0496101_0342882_222_1094 | 282 |
| 944 | 3300048905 | Ga0496102_0097615 | Ga0496102_0097615_411_1283 | 282 |
| 945 | 3300048905 | Ga0496102_0139695 | Ga0496102_0139695_523_1395 | 282 |
| 946 | 3300048907 | Ga0496104_0041991 | Ga0496104_0041991_911_1783 | 282 |
| 947 | 3300048907 | Ga0496104_0052663 | Ga0496104_0052663_1641_2513 | 282 |
| 948 | 3300048908 | Ga0496105_0066881 | Ga0496105_0066881_2037_2909 | 282 |
| 949 | 3300048909 | Ga0496106_0001943 | Ga0496106_0001943_1942_2814 | 282 |
| 950 | 3300048909 | Ga0496106_0061971 | Ga0496106_0061971_493_1365 | 282 |
| 951 | 3300048910 | Ga0496107_0008009 | Ga0496107_0008009_365_1237 | 282 |
| 952 | 3300048911 | Ga0496108_0000927 | Ga0496108_0000927_13351_14223 | 282 |
| 953 | 3300048911 | Ga0496108_0104573 | Ga0496108_0104573_177_1049 | 282 |
| 954 | 3300048912 | Ga0496109_0000229 | Ga0496109_0000229_9870_10742 | 282 |
| 955 | 3300048912 | Ga0496109_0104428 | Ga0496109_0104428_839_1711 | 282 |
| 956 | 3300048913 | Ga0496110_0364261 | Ga0496110_0364261_215_1087 | 282 |
| 957 | 3300048914 | Ga0496111_0175050 | Ga0496111_0175050_86_958 | 282 |
| 958 | 3300048915 | Ga0496112_0000018 | Ga0496112_0000018_75713_76585 | 282 |
| 959 | 3300048915 | Ga0496112_0001343 | Ga0496112_0001343_8729_9601 | 282 |
| 960 | 3300048915 | Ga0496112_0320058 | Ga0496112_0320058_53_925 | 282 |
| 961 | 3300048916 | Ga0496113_0017066 | Ga0496113_0017066_54_926 | 282 |
| 962 | 3300048917 | Ga0496114_0274275 | Ga0496114_0274275_84_956 | 282 |
| 963 | 3300048918 | Ga0496115_0374258 | Ga0496115_0374258_117_989 | 282 |
| 964 | 3300048919 | Ga0496116_0009681 | Ga0496116_0009681_7074_7946 | 282 |
| 965 | 3300048920 | Ga0496117_0110810 | Ga0496117_0110810_21_893 | 282 |
| 966 | 3300048921 | Ga0496118_0108992 | Ga0496118_0108992_787_1659 | 282 |
| 967 | 3300048921 | Ga0496118_0165108 | Ga0496118_0165108_141_1028 | 282 |
| 968 | 3300048922 | Ga0496119_0033208 | Ga0496119_0033208_2168_3040 | 282 |
| 969 | 3300048922 | Ga0496119_0118990 | Ga0496119_0118990_495_1367 | 282 |
| 970 | 3300048923 | Ga0496120_0040754 | Ga0496120_0040754_51_923 | 282 |
| 971 | 3300048924 | Ga0496121_0000278 | Ga0496121_0000278_24330_25202 | 282 |
| 972 | 3300048924 | Ga0496121_0000654 | Ga0496121_0000654_12394_13272 | 282 |
| 973 | 3300048924 | Ga0496121_0004075 | Ga0496121_0004075_13242_14114 | 282 |
| 974 | 3300048924 | Ga0496121_0025719 | Ga0496121_0025719_2080_2952 | 282 |
| 975 | 3300048924 | Ga0496121_0055934 | Ga0496121_0055934_548_1420 | 282 |
| 976 | 3300048924 | Ga0496121_0076724 | Ga0496121_0076724_837_1709 | 282 |
| 977 | 3300048924 | Ga0496121_0089434 | Ga0496121_0089434_819_1706 | 282 |
| 978 | 3300048924 | Ga0496121_0145334 | Ga0496121_0145334_764_1636 | 282 |
| 979 | 3300048924 | Ga0496121_0186152 | Ga0496121_0186152_523_1395 | 282 |
| 980 | 3300048925 | Ga0496122_0058926 | Ga0496122_0058926_1745_2617 | 282 |
| 981 | 3300048927 | Ga0496124_0053161 | Ga0496124_0053161_1149_2021 | 282 |
| 982 | 3300048927 | Ga0496124_0251121 | Ga0496124_0251121_302_1174 | 282 |
| 983 | 3300048928 | Ga0496125_0000869 | Ga0496125_0000869_12105_12977 | 282 |
| 984 | 3300048928 | Ga0496125_0003929 | Ga0496125_0003929_7495_8367 | 282 |
| 985 | 3300048928 | Ga0496125_0009814 | Ga0496125_0009814_7360_8232 | 282 |
| 986 | 3300048928 | Ga0496125_0055518 | Ga0496125_0055518_1321_2196 | 282 |
| 987 | 3300048929 | Ga0496126_0005056 | Ga0496126_0005056_5449_6321 | 282 |
| 988 | 3300048929 | Ga0496126_0013259 | Ga0496126_0013259_3772_4644 | 282 |
| 989 | 3300048929 | Ga0496126_0021739 | Ga0496126_0021739_2233_3105 | 282 |
| 990 | 3300048929 | Ga0496126_0039419 | Ga0496126_0039419_2842_3729 | 282 |
| 991 | 3300048929 | Ga0496126_0065601 | Ga0496126_0065601_1054_1932 | 282 |
| 992 | 3300048929 | Ga0496126_0476798 | Ga0496126_0476798_90_962 | 282 |
| 993 | 3300049568 | Ga0501031_0000207 | Ga0501031_0000207_20809_21681 | 282 |
| 994 | 3300049568 | Ga0501031_0000674 | Ga0501031_0000674_2486_3358 | 282 |
| 995 | 3300049568 | Ga0501031_0042550 | Ga0501031_0042550_2057_2941 | 282 |
| 996 | 3300049568 | Ga0501031_0174922 | Ga0501031_0174922_431_1303 | 282 |
| 997 | 3300049569 | Ga0501032_0000252 | Ga0501032_0000252_40710_41582 | 282 |
| 998 | 3300049569 | Ga0501032_0002975 | Ga0501032_0002975_11485_12357 | 282 |
| 999 | 3300049569 | Ga0501032_0175449 | Ga0501032_0175449_16_900 | 282 |
| 1000 | 3300049569 | Ga0501032_0210542 | Ga0501032_0210542_208_1080 | 282 |
| 1001 | 3300049569 | Ga0501032_0228662 | Ga0501032_0228662_24_908 | 282 |
| 1002 | 3300049570 | Ga0501033_0000082 | Ga0501033_0000082_26309_27181 | 282 |
| 1003 | 3300049570 | Ga0501033_0006748 | Ga0501033_0006748_17_889 | 282 |
| 1004 | 3300049570 | Ga0501033_0056363 | Ga0501033_0056363_380_1252 | 282 |
| 1005 | 3300049570 | Ga0501033_0059881 | Ga0501033_0059881_1809_2693 | 282 |
| 1006 | 3300049570 | Ga0501033_0243491 | Ga0501033_0243491_24_908 | 282 |
| 1007 | 3300049571 | Ga0501034_0000198 | Ga0501034_0000198_15592_16464 | 282 |
| 1008 | 3300049571 | Ga0501034_0066295 | Ga0501034_0066295_130_1014 | 282 |
| 1009 | 3300049571 | Ga0501034_0137996 | Ga0501034_0137996_730_1602 | 282 |
| 1010 | 3300049571 | Ga0501034_0370474 | Ga0501034_0370474_365_1237 | 282 |
| 1011 | 3300049572 | Ga0501036_0001281 | Ga0501036_0001281_15382_16254 | 282 |
| 1012 | 3300049572 | Ga0501036_0041485 | Ga0501036_0041485_553_1425 | 282 |
| 1013 | 3300049572 | Ga0501036_0070087 | Ga0501036_0070087_24_908 | 282 |
| 1014 | 3300049572 | Ga0501036_0089653 | Ga0501036_0089653_1354_2235 | 282 |
| 1015 | 3300049572 | Ga0501036_0153984 | Ga0501036_0153984_146_1030 | 282 |
| 1016 | 3300049572 | Ga0501036_0296825 | Ga0501036_0296825_281_1153 | 282 |
| 1017 | 3300049573 | Ga0501037_0000050 | Ga0501037_0000050_17109_17981 | 282 |
| 1018 | 3300049573 | Ga0501037_0001896 | Ga0501037_0001896_10373_11245 | 282 |
| 1019 | 3300049573 | Ga0501037_0013075 | Ga0501037_0013075_3114_3992 | 282 |
| 1020 | 3300049573 | Ga0501037_0065242 | Ga0501037_0065242_35_919 | 282 |
| 1021 | 3300049573 | Ga0501037_0126416 | Ga0501037_0126416_848_1720 | 282 |
| 1022 | 3300049574 | Ga0501038_0000538 | Ga0501038_0000538_15592_16464 | 282 |
| 1023 | 3300049574 | Ga0501038_0000630 | Ga0501038_0000630_6854_7861 | 282 |
| 1024 | 3300049574 | Ga0501038_0021325 | Ga0501038_0021325_3393_4265 | 282 |
| 1025 | 3300049574 | Ga0501038_0069455 | Ga0501038_0069455_17_889 | 282 |
| 1026 | 3300049574 | Ga0501038_0108190 | Ga0501038_0108190_885_1769 | 282 |
| 1027 | 3300049574 | Ga0501038_0184478 | Ga0501038_0184478_447_1331 | 282 |
| 1028 | 3300049575 | Ga0501039_0000366 | Ga0501039_0000366_5955_6827 | 282 |
| 1029 | 3300049575 | Ga0501039_0042730 | Ga0501039_0042730_561_1445 | 282 |
| 1030 | 3300049575 | Ga0501039_0207574 | Ga0501039_0207574_451_1323 | 282 |
| 1031 | 3300049575 | Ga0501039_0209073 | Ga0501039_0209073_228_1100 | 282 |
| 1032 | 3300049577 | Ga0501041_0105409 | Ga0501041_0105409_97_969 | 282 |
| 1033 | 3300049578 | Ga0501042_0017539 | Ga0501042_0017539_3971_4843 | 282 |
| 1034 | 3300049578 | Ga0501042_0042451 | Ga0501042_0042451_2277_3161 | 282 |
| 1035 | 3300049579 | Ga0501043_0002344 | Ga0501043_0002344_11491_12363 | 282 |
| 1036 | 3300049579 | Ga0501043_0003664 | Ga0501043_0003664_10456_11328 | 282 |
| 1037 | 3300049579 | Ga0501043_0061870 | Ga0501043_0061870_775_1659 | 282 |
| 1038 | 3300049579 | Ga0501043_0087805 | Ga0501043_0087805_679_1563 | 282 |
| 1039 | 3300049579 | Ga0501043_0217731 | Ga0501043_0217731_389_1261 | 282 |
| 1040 | 3300049580 | Ga0501046_0000434 | Ga0501046_0000434_1950_2822 | 282 |
| 1041 | 3300049580 | Ga0501046_0030471 | Ga0501046_0030471_3330_4214 | 282 |
| 1042 | 3300049580 | Ga0501046_0049305 | Ga0501046_0049305_55_927 | 282 |
| 1043 | 3300049581 | Ga0501047_0000131 | Ga0501047_0000131_33981_34853 | 282 |
| 1044 | 3300049581 | Ga0501047_0092774 | Ga0501047_0092774_1989_2861 | 282 |
| 1045 | 3300049581 | Ga0501047_0095805 | Ga0501047_0095805_1776_2663 | 282 |
| 1046 | 3300049581 | Ga0501047_0183102 | Ga0501047_0183102_481_1365 | 282 |
| 1047 | 3300049581 | Ga0501047_0268941 | Ga0501047_0268941_646_1518 | 282 |
| 1048 | 3300049581 | Ga0501047_0399434 | Ga0501047_0399434_107_991 | 282 |
| 1049 | 3300049582 | Ga0501048_0000531 | Ga0501048_0000531_19942_20814 | 282 |
| 1050 | 3300049582 | Ga0501048_0020580 | Ga0501048_0020580_476_1360 | 282 |
| 1051 | 3300049583 | Ga0501067_0000628 | Ga0501067_0000628_769_1641 | 282 |
| 1052 | 3300049583 | Ga0501067_0004783 | Ga0501067_0004783_5813_6697 | 282 |
| 1053 | 3300049584 | Ga0501068_0011209 | Ga0501068_0011209_489_1361 | 282 |
| 1054 | 3300049585 | Ga0501069_0001211 | Ga0501069_0001211_5190_6062 | 282 |
| 1055 | 3300049586 | Ga0501070_0005971 | Ga0501070_0005971_7324_8196 | 282 |
| 1056 | 3300049586 | Ga0501070_0039960 | Ga0501070_0039960_617_1501 | 282 |
| 1057 | 3300049586 | Ga0501070_0260973 | Ga0501070_0260973_79_951 | 282 |
| 1058 | 3300049588 | Ga0501072_0000378 | Ga0501072_0000378_12061_12933 | 282 |
| 1059 | 3300049588 | Ga0501072_0203018 | Ga0501072_0203018_485_1369 | 282 |
| 1060 | 3300049589 | Ga0501073_0029767 | Ga0501073_0029767_218_1090 | 282 |
| 1061 | 3300049589 | Ga0501073_0103023 | Ga0501073_0103023_916_1788 | 282 |
| 1062 | 3300049590 | Ga0501074_0003814 | Ga0501074_0003814_9750_10622 | 282 |
| 1063 | 3300049590 | Ga0501074_0018155 | Ga0501074_0018155_1883_2767 | 282 |
| 1064 | 3300049590 | Ga0501074_0070660 | Ga0501074_0070660_511_1383 | 282 |
| 1065 | 3300049741 | Ga0501079_0001399 | Ga0501079_0001399_14684_15556 | 282 |
| 1066 | 3300049742 | Ga0501080_0009398 | Ga0501080_0009398_7102_7974 | 282 |
| 1067 | 3300049744 | Ga0501083_0000341 | Ga0501083_0000341_19338_20210 | 282 |
| 1068 | 3300049744 | Ga0501083_0060526 | Ga0501083_0060526_68_952 | 282 |
| 1069 | 3300049822 | Ga0501035_0000123 | Ga0501035_0000123_81635_82507 | 282 |
| 1070 | 3300049822 | Ga0501035_0005862 | Ga0501035_0005862_6540_7412 | 282 |
| 1071 | 3300049822 | Ga0501035_0093321 | Ga0501035_0093321_288_1172 | 282 |
| 1072 | 3300049822 | Ga0501035_0173882 | Ga0501035_0173882_474_1346 | 282 |
| 1073 | 3300049822 | Ga0501035_0180926 | Ga0501035_0180926_47_931 | 282 |
| 1074 | 3300049822 | Ga0501035_0206075 | Ga0501035_0206075_415_1287 | 282 |
| 1075 | 3300049823 | Ga0501044_0000100 | Ga0501044_0000100_67743_68615 | 282 |
| 1076 | 3300049823 | Ga0501044_0039767 | Ga0501044_0039767_963_1847 | 282 |
| 1077 | 3300049823 | Ga0501044_0113578 | Ga0501044_0113578_637_1509 | 282 |
| 1078 | 3300049823 | Ga0501044_0214949 | Ga0501044_0214949_846_1718 | 282 |
| 1079 | 3300049824 | Ga0501045_0009959 | Ga0501045_0009959_2623_3507 | 282 |
| 1080 | 3300049824 | Ga0501045_0022359 | Ga0501045_0022359_3478_4350 | 282 |
| 1081 | 3300050492 | nmdc:mga0yw44_153826_c1 | nmdc:mga0yw44_153826_c1_232_1104 | 282 |
| 1082 | 3300050493 | nmdc:mga0k408_130449_c1 | nmdc:mga0k408_130449_c1_454_1326 | 282 |
| 1083 | 3300050493 | nmdc:mga0k408_63841_c2 | nmdc:mga0k408_63841_c2_19_891 | 282 |
| 1084 | 3300050494 | nmdc:mga06z11_177617_c1 | nmdc:mga06z11_177617_c1_61_933 | 282 |
| 1085 | 3300050495 | nmdc:mga04h51_11839_c1 | nmdc:mga04h51_11839_c1_1176_2048 | 282 |
| 1086 | 3300050495 | nmdc:mga04h51_42469_c1 | nmdc:mga04h51_42469_c1_240_1112 | 282 |
| 1087 | 3300050496 | nmdc:mga07m45_119498_c1 | nmdc:mga07m45_119498_c1_46_918 | 282 |
| 1088 | 3300050496 | nmdc:mga07m45_143090_c1 | nmdc:mga07m45_143090_c1_245_1120 | 282 |
| 1089 | 3300050496 | nmdc:mga07m45_215146_c1 | nmdc:mga07m45_215146_c1_141_1013 | 282 |
| 1090 | 3300050496 | nmdc:mga07m45_3103_c1 | nmdc:mga07m45_3103_c1_2833_3705 | 282 |
| 1091 | 3300050511 | nmdc:mga08y16_199419_c1 | nmdc:mga08y16_199419_c1_1180_2052 | 282 |
| 1092 | 3300050511 | nmdc:mga08y16_42067_c1 | nmdc:mga08y16_42067_c1_2648_3520 | 282 |
| 1093 | 3300050513 | nmdc:mga0rr50_99236_c1 | nmdc:mga0rr50_99236_c1_216_1088 | 282 |
| 1094 | 3300050516 | nmdc:mga0sz30_19967_c1 | nmdc:mga0sz30_19967_c1_445_1320 | 282 |
| 1095 | 3300053078 | Ga0495612_0062897 | Ga0495612_0062897_211_1083 | 282 |
| 1096 | 3300053083 | Ga0495655_0058021 | Ga0495655_0058021_23_895 | 282 |
| 1097 | 3300053085 | Ga0495619_0028554 | Ga0495619_0028554_1245_2117 | 282 |
| 1098 | 3300053090 | Ga0500646_0087203 | Ga0500646_0087203_41_913 | 282 |
| 1099 | 3300053092 | Ga0500583_0100611 | Ga0500583_0100611_339_1211 | 282 |
| 1100 | 3300053093 | Ga0500651_0069761 | Ga0500651_0069761_10_882 | 282 |
| 1101 | 3300053093 | Ga0500651_0128499 | Ga0500651_0128499_89_961 | 282 |
| 1102 | 3300053094 | Ga0500566_0006857 | Ga0500566_0006857_2892_3764 | 282 |
| 1103 | 3300053094 | Ga0500566_0016736 | Ga0500566_0016736_483_1355 | 282 |
| 1104 | 3300053098 | Ga0500650_0050150 | Ga0500650_0050150_391_1263 | 282 |
| 1105 | 3300053098 | Ga0500650_0146655 | Ga0500650_0146655_71_958 | 282 |
| 1106 | 3300053102 | Ga0500554_005159 | Ga0500554_005159_1739_2611 | 282 |
| 1107 | 3300053103 | Ga0500555_057288 | Ga0500555_057288_129_1001 | 282 |
| 1108 | 3300053109 | Ga0500569_001078 | Ga0500569_001078_884_1756 | 282 |
| 1109 | 3300053119 | Ga0500595_001968 | Ga0500595_001968_5341_6228 | 282 |
| 1110 | 3300053119 | Ga0500595_002686 | Ga0500595_002686_69_941 | 282 |
| 1111 | 3300053119 | Ga0500595_007413 | Ga0500595_007413_1587_2459 | 282 |
| 1112 | 3300053119 | Ga0500595_026838 | Ga0500595_026838_1034_1906 | 282 |
| 1113 | 3300053119 | Ga0500595_042387 | Ga0500595_042387_190_1077 | 282 |
| 1114 | 3300053121 | Ga0500607_069800 | Ga0500607_069800_65_937 | 282 |
| 1115 | 3300053122 | Ga0500608_000949 | Ga0500608_000949_6097_6969 | 282 |
| 1116 | 3300053125 | Ga0500618_005453 | Ga0500618_005453_115_987 | 282 |
| 1117 | 3300053130 | Ga0500642_0000042 | Ga0500642_0000042_43821_44699 | 282 |
| 1118 | 3300053130 | Ga0500642_0058519 | Ga0500642_0058519_175_1062 | 282 |
| 1119 | 3300053136 | Ga0500559_0000106 | Ga0500559_0000106_50022_50894 | 282 |
| 1120 | 3300053139 | Ga0500568_0139346 | Ga0500568_0139346_14_886 | 282 |
| 1121 | 3300053142 | Ga0500577_0009194 | Ga0500577_0009194_1812_2684 | 282 |
| 1122 | 3300053142 | Ga0500577_0150528 | Ga0500577_0150528_44_916 | 282 |
| 1123 | 3300053146 | Ga0500588_0100585 | Ga0500588_0100585_23_910 | 282 |
| 1124 | 3300053147 | Ga0500589_079745 | Ga0500589_079745_418_1290 | 282 |
| 1125 | 3300053148 | Ga0500590_026483 | Ga0500590_026483_1006_1878 | 282 |
| 1126 | 3300053148 | Ga0500590_054115 | Ga0500590_054115_975_1847 | 282 |
| 1127 | 3300053150 | Ga0500603_013476 | Ga0500603_013476_29_901 | 282 |
| 1128 | 3300053151 | Ga0500604_0019202 | Ga0500604_0019202_824_1696 | 282 |
| 1129 | 3300053153 | Ga0500616_0000227 | Ga0500616_0000227_44900_45772 | 282 |
| 1130 | 3300053160 | Ga0500633_0138491 | Ga0500633_0138491_17_889 | 282 |
| 1131 | 3300053162 | Ga0500638_002787 | Ga0500638_002787_990_1862 | 282 |
| 1132 | 3300053178 | Ga0500637_0000180 | Ga0500637_0000180_8732_9604 | 282 |
| 1133 | 3300053178 | Ga0500637_0011782 | Ga0500637_0011782_2300_3172 | 282 |
| 1134 | 3300053730 | Ga0500645_047381 | Ga0500645_047381_59_931 | 282 |
| 1135 | 3300053731 | Ga0500609_007813 | Ga0500609_007813_494_1366 | 282 |
| 1136 | 3300054114 | Ga0501084_0019061 | Ga0501084_0019061_4731_5603 | 282 |
| 1137 | 3300054114 | Ga0501084_0135809 | Ga0501084_0135809_693_1577 | 282 |
| 1138 | 3300060353 | Ga0501082_0001776 | Ga0501082_0001776_5253_6125 | 282 |
| 1139 | 3300060353 | Ga0501082_0022020 | Ga0501082_0022020_4117_5001 | 282 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3ejx-assembly5.cif.gz_D | crystal structure of diaminopimelate epimerase from arabidopsis thaliana in complex with ll-azidap | 0.9157 | 7 | 271 |
| 7vdy-assembly1.cif.gz_B | crystal structure of o-ureidoserine racemase | 0.8742 | 5 | 273 |
| 3ejx-assembly5.cif.gz_D | crystal structure of diaminopimelate epimerase from arabidopsis thaliana in complex with ll-azidap | 0.8595 | 7 | 271 |
| 7vdy-assembly1.cif.gz_B | crystal structure of o-ureidoserine racemase | 0.8422 | 5 | 273 |
| 5ha4-assembly1.cif.gz_A | structure of a diaminopimelate epimerase from acinetobacter baumannii | 0.8335 | 7 | 278 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q55GS8_377_492_3.10.310.10 | Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 | 0.9433 | 158 | 261 | 3.10.310.10 |
| af_P0A6K1_1_112_3.10.310.10 | Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 | 0.8992 | 9 | 113 | 3.10.310.10 |
| 3ejxD01 | Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 | 0.8852 | 7 | 122 | 3.10.310.10 |
| 2q9jA01 | Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 | 0.8824 | 8 | 113 | 3.10.310.10 |
| 3ejxA01 | Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 | 0.8791 | 7 | 108 | 3.10.310.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-Q1QHJ3-F1-model_v4 | Diaminopimelate epimerase (DAP epimerase) (EC 5.1.1.7) (PLP-independent amino acid racemase) | 0.9887 | 1 | 282 |
GO:0005829
GO:0008837 GO:0009089 |
| AF-Q1QHJ3-F1-model_v4 | Diaminopimelate epimerase (DAP epimerase) (EC 5.1.1.7) (PLP-independent amino acid racemase) | 0.9852 | 1 | 282 |
GO:0005829
GO:0008837 GO:0009089 |
| AF-A4YKA5-F1-model_v4 | Diaminopimelate epimerase (DAP epimerase) (EC 5.1.1.7) (PLP-independent amino acid racemase) | 0.9773 | 1 | 282 |
GO:0005829
GO:0008837 GO:0009089 |
| AF-Q13DT7-F1-model_v4 | Diaminopimelate epimerase (DAP epimerase) (EC 5.1.1.7) (PLP-independent amino acid racemase) | 0.9764 | 1 | 281 |
GO:0005829
GO:0008837 GO:0009089 |
| AF-A4YKA5-F1-model_v4 | Diaminopimelate epimerase (DAP epimerase) (EC 5.1.1.7) (PLP-independent amino acid racemase) | 0.9739 | 1 | 282 |
GO:0005829
GO:0008837 GO:0009089 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar