F490664

General Info

Members Datasets Scaffolds Average Seq Length
1138 471 1104 272

Family's Representative Sequence

Representative Sequence 3300026067|Ga0207678_10305925|Ga0207678_103059252
Length 311
Sequence MRGRSRFLTLWLVAGFVFFYGPIASMIVFSFNASRLATVWGGFSTKWYVALWGNRQVMDAALLSLQIAAISATIATALGTMAGIALARFGRFRGRLLLAGMVTAPLVMPEVITGLSLLLLFVALEDSFGWPSGRGAMTITIAHVTFCMAYVAVVVQSRLADMDASIEEAAADLGSRPWQVMVDITLPLLAPAMVSGWLLAFTLSLDDLVIATFTSGPGANTLPMLIFSKVRLGLTPDINALATIIILVVASFXXAIRASWLIQTPPSAGFGLTTTCHWSLRCVWSKVFFSCRGFMFCCLGNTHIWRKFAGS

Samples

Sample ID Description Type Environment
1 2511231221 Azospirillum lipoferum 4B Isolate Rhizosphere
2 2524023250 Niveispirillum irakense DSM 11586 Isolate Unclassified
3 2585427591 Rahnella aquatilis OV744 Isolate Rhizosphere
4 2585427592 Rahnella aquatilis OV588 Isolate Rhizosphere
5 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
6 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
7 2643221569 Achromobacter sp. Root565 Isolate Unclassified
8 2643221594 Achromobacter sp. Root170 Isolate Unclassified
9 2643221621 Achromobacter sp. Root83 Isolate Unclassified
10 2643221629 Devosia sp. Root105 Isolate Unclassified
11 2643221662 Devosia sp. Root413D1 Isolate Unclassified
12 2728369276 Kineococcus rhizosphaerae DSM 19711 Isolate Rhizosphere
13 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
14 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
15 2842775625 Roseomonas sp. R-71825 Isolate Unclassified
16 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
17 2846033681 Chromobacterium sinusclupearum MWU13-2610 Isolate Rhizosphere
18 2846037992 Chromobacterium alticapitis MWU14-2602 Isolate Rhizosphere
19 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
20 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
21 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
22 2858950400 Achromobacter sp. K91 Isolate Unclassified
23 2898795034 Rhodobacter sp. SGA-6-6 Isolate Rhizosphere
24 2904474040 Rahnella aquatilis 4485 Isolate Rhizosphere
25 2919150387 Rahnella aceris 1817 Isolate Unclassified
26 2927143783 Rahnella sp. 2050 Isolate Unclassified
27 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
28 2941479691
29 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
30 2998344455 Vogesella urethralis SLBN-145 Isolate Rhizosphere
31 3000405567 Rhodobacteraceae bacterium LNNU 3342 Isolate Rhizosphere
32 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
33 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
34 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
35 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
36 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
37 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
38 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
39 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
40 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
41 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
42 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
43 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
44 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
45 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
46 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
47 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
48 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
49 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
50 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
51 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
52 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
53 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
54 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
55 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
56 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
57 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
58 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
59 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
60 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
61 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
62 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
63 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
64 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
65 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
66 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
67 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
68 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
69 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
70 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
71 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
72 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
73 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
74 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
75 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
76 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
77 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
78 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
79 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
80 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
81 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
82 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
83 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
84 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
85 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
86 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
87 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
88 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
89 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
90 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
91 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
92 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
93 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
94 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
95 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
96 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
97 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
98 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
99 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
100 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
101 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
102 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
103 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
104 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
105 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
106 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
107 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
108 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
109 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
110 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
111 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
112 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
113 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
114 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
115 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
116 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
117 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
118 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
119 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
120 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
121 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
122 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
123 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
124 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
125 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
126 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
127 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
128 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
129 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
130 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
131 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
132 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
133 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
134 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
135 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
136 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
137 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
138 3300013874 Rhizosphere microbial communities from switchgrass harvested rhizosphere in Austin, TX, USA - RS_213 Metagenome Rhizosphere
139 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
140 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
141 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
142 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
143 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
144 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
145 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
146 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
147 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
148 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
149 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
151 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
152 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
153 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
154 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
155 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
157 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
158 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
159 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
160 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
161 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
216 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
218 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
219 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
220 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
221 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
222 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
223 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
224 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
225 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
226 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
230 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
231 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
232 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
233 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
234 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
235 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
236 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
237 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
238 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
239 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
240 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
241 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
242 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
243 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
244 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
245 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
246 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
247 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
248 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
249 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
250 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
251 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
252 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
253 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
254 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
255 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
256 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
257 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
258 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
259 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
260 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
261 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
262 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
263 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
264 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
265 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
266 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
267 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
268 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
269 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
270 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
271 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
272 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
273 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
274 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
275 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
276 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
277 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
278 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
279 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
280 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
281 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
282 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
283 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
284 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
285 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
286 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
287 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
288 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
289 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
290 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
291 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
292 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
293 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
294 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
295 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
296 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
297 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
298 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
299 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
300 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
301 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
302 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
303 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
304 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
305 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
306 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
307 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
308 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
309 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
310 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
311 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
312 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
313 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
314 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
315 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
316 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
317 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
318 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
319 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
320 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
321 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
322 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
323 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
324 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
325 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
326 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
327 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
328 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
329 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
330 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
331 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
332 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
333 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
334 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
335 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
336 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
337 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
338 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
339 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
340 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
341 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
342 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
343 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
344 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
345 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
346 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
347 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
348 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
349 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
350 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
351 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
352 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
353 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
354 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
355 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
356 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
357 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
358 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
359 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
360 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
361 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
362 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
363 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
364 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
365 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
366 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
367 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
368 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
369 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
370 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
371 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
372 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
373 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
374 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
375 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
376 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
377 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
378 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
379 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
380 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
381 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
382 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
383 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
384 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
385 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
386 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
387 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
388 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
389 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
390 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
391 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
392 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
393 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
394 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
395 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
396 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
397 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
398 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
399 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
400 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
401 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
402 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
403 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
404 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
405 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
406 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
407 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
408 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
409 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
410 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
411 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
412 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
413 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
414 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
415 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
416 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
417 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
418 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
419 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
420 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
421 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
422 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
423 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
424 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
425 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
426 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
427 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
428 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
429 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
430 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
431 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
432 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
433 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
434 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
435 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
436 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
437 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
438 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
439 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
440 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
441 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
442 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
443 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
444 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
445 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
446 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
447 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
448 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
449 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
450 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
451 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
452 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
453 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
454 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
455 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
456 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
457 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
458 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
459 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
460 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
461 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
462 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
463 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
464 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
465 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
466 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
467 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
468 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
469 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
470 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
471 8054002106 Azospirillum lipoferum 59b Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.75
Metatranscriptomes 0.26
Isolates 2.99

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.1
Nodule 0
Rhizoplane 2.72
Rhizosphere 83.3
Stem 0
Stem Tuber 0
Unclassified 8.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25159J45721_1020272 3300002987 Bacteria 1286
2 JGI25151J46595_10000130 3300003187 Bacteria 101649
3 JGI25151J46595_10000312 3300003187 Bacteria 52924
4 JGI25151J46595_10000436 3300003187 Bacteria 41270
5 JGI25406J46586_10015918 3300003203 Bacteria 3154
6 JGI25153J46596_10000132 3300003215 Bacteria 79600
7 JGI25153J46596_10000426 3300003215 Bacteria 27425
8 rootH2_10070126 3300003320 Bacteria 2716
9 rootL2_10029180 3300003322 Bacteria 1700
10 rootL2_10278328 3300003322 Bacteria 1426
11 rootH1_10064332 3300003323 Bacteria 3050
12 rootH1_10300231 3300003323 Bacteria 1397
13 Ga0055527_1000005 3300003760 Bacteria 504776
14 Ga0055542_1000006 3300003762 Bacteria 504776
15 Ga0055529_1000013 3300003763 Bacteria 373267
16 Ga0065704_10140248 3300005289 Bacteria 1525
17 Ga0065712_10114830 3300005290 Bacteria 1760
18 Ga0070683_100042785 3300005329 Bacteria 4172
19 Ga0070690_100056392 3300005330 Bacteria 2519
20 Ga0070666_10003820 3300005335 Bacteria 9140
21 Ga0070666_10211953 3300005335 Bacteria 1364
22 Ga0070666_10500410 3300005335 Bacteria 881
23 Ga0070680_100004606 3300005336 Bacteria 10361
24 Ga0070680_100091900 3300005336 Bacteria 2512
25 Ga0070680_100134045 3300005336 Bacteria 2074
26 Ga0068868_100015991 3300005338 Bacteria 5563
27 Ga0068868_100522536 3300005338 Bacteria 1042
28 Ga0070660_100052227 3300005339 Bacteria 3151
29 Ga0070660_100360160 3300005339 Bacteria 1199
30 Ga0070660_100451080 3300005339 Bacteria 1067
31 Ga0070661_100000775 3300005344 Bacteria 23068
32 Ga0070668_100037293 3300005347 Bacteria 3711
33 Ga0070669_100005076 3300005353 Bacteria 9515
34 Ga0070675_100014302 3300005354 Bacteria 6256
35 Ga0070675_100035991 3300005354 Bacteria 4026
36 Ga0070671_100022140 3300005355 Bacteria 5192
37 Ga0070671_100069722 3300005355 Bacteria 2932
38 Ga0070674_100107403 3300005356 Bacteria 2043
39 Ga0070688_100021247 3300005365 Bacteria 3789
40 Ga0070667_100018886 3300005367 Bacteria 5715
41 Ga0070667_100027818 3300005367 Bacteria 4705
42 Ga0070667_100041630 3300005367 Bacteria 3854
43 Ga0070667_100061427 3300005367 Bacteria 3181
44 Ga0070667_100210335 3300005367 Bacteria 1728
45 Ga0070667_100433309 3300005367 Bacteria 1200
46 Ga0070709_10085941 3300005434 Bacteria 2064
47 Ga0070709_10091586 3300005434 Bacteria 2007
48 Ga0070709_10259233 3300005434 Bacteria 1256
49 Ga0070713_100035644 3300005436 Bacteria 4008
50 Ga0070713_100036136 3300005436 Bacteria 3984
51 Ga0070713_100049136 3300005436 Bacteria 3478
52 Ga0070713_100167499 3300005436 Bacteria 1966
53 Ga0070713_100515829 3300005436 Bacteria 1129
54 Ga0070710_10006217 3300005437 Bacteria 5717
55 Ga0070711_100054528 3300005439 Bacteria 2759
56 Ga0070711_100121593 3300005439 Bacteria 1932
57 Ga0070711_100259883 3300005439 Bacteria 1365
58 Ga0070705_100141188 3300005440 Bacteria 1585
59 Ga0070700_100052749 3300005441 Bacteria 2536
60 Ga0070694_100448572 3300005444 Bacteria 1018
61 Ga0070663_100065355 3300005455 Bacteria 2632
62 Ga0070663_100149231 3300005455 Bacteria 1791
63 Ga0070663_100253307 3300005455 Bacteria 1394
64 Ga0070662_100003902 3300005457 Bacteria 9349
65 Ga0070662_100538669 3300005457 Bacteria 977
66 Ga0070681_10007653 3300005458 Bacteria 10563
67 Ga0070681_10008934 3300005458 Bacteria 9851
68 Ga0070681_10103019 3300005458 Bacteria 2799
69 Ga0068867_100019954 3300005459 Bacteria 4776
70 Ga0068867_100413626 3300005459 Bacteria 1140
71 Ga0068867_100419531 3300005459 Bacteria 1133
72 Ga0070698_100065367 3300005471 Bacteria 3662
73 Ga0070679_100000523 3300005530 Bacteria 32664
74 Ga0070679_100006850 3300005530 Bacteria 10628
75 Ga0070679_100123644 3300005530 Unclassified 2571
76 Ga0070679_100153710 3300005530 Bacteria 2277
77 Ga0070679_100380104 3300005530 Bacteria 1359
78 Ga0070684_100044457 3300005535 Bacteria 3842
79 Ga0070684_100220864 3300005535 Bacteria 1729
80 Ga0070684_100400697 3300005535 Bacteria 1265
81 Ga0068853_100006497 3300005539 Bacteria 9301
82 Ga0068853_100042108 3300005539 Bacteria 3903
83 Ga0068853_100083513 3300005539 Bacteria 2798
84 Ga0068853_100109331 3300005539 Bacteria 2454
85 Ga0068853_100452398 3300005539 Bacteria 1208
86 Ga0068853_100504721 3300005539 Bacteria 1142
87 Ga0070672_100021778 3300005543 Bacteria 4694
88 Ga0070672_100023391 3300005543 Bacteria 4554
89 Ga0070686_100017327 3300005544 Bacteria 4208
90 Ga0070695_100138237 3300005545 Bacteria 1686
91 Ga0070693_100281698 3300005547 Bacteria 1113
92 Ga0070665_100000543 3300005548 Bacteria 52995
93 Ga0070665_100003944 3300005548 Bacteria 15661
94 Ga0070665_100023201 3300005548 Bacteria 6249
95 Ga0070665_100073814 3300005548 Bacteria 3417
96 Ga0070665_100100197 3300005548 Bacteria 2901
97 Ga0070665_100172965 3300005548 Bacteria 2161
98 Ga0070665_100224231 3300005548 Bacteria 1880
99 Ga0070665_100274053 3300005548 Bacteria 1689
100 Ga0070665_100464757 3300005548 Bacteria 1275
101 Ga0070704_100009353 3300005549 Bacteria 5917
102 Ga0070704_100287057 3300005549 Bacteria 1366
103 Ga0068855_100176374 3300005563 Bacteria 2418
104 Ga0068855_100236507 3300005563 Bacteria 2043
105 Ga0068855_100280539 3300005563 Bacteria 1850
106 Ga0068855_100307806 3300005563 Bacteria 1753
107 Ga0068855_100446602 3300005563 Bacteria 1412
108 Ga0068857_100261616 3300005577 Bacteria 1588
109 Ga0068857_100580528 3300005577 Bacteria 1058
110 Ga0068854_100018789 3300005578 Bacteria 4646
111 Ga0068854_100212093 3300005578 Bacteria 1528
112 Ga0068856_100145714 3300005614 Bacteria 2376
113 Ga0068856_100155933 3300005614 Bacteria 2293
114 Ga0068852_100112335 3300005616 Bacteria 2479
115 Ga0068852_100505074 3300005616 Bacteria 1204
116 Ga0068859_100002193 3300005617 Bacteria 19831
117 Ga0068859_100007416 3300005617 Bacteria 11134
118 Ga0068859_100027568 3300005617 Bacteria 5698
119 Ga0068859_100030044 3300005617 Bacteria 5452
120 Ga0068859_100034471 3300005617 Bacteria 5080
121 Ga0068859_100069694 3300005617 Bacteria 3552
122 Ga0068859_100144102 3300005617 Bacteria 2456
123 Ga0068864_100065782 3300005618 Bacteria 3145
124 Ga0068864_100278302 3300005618 Bacteria 1561
125 Ga0068861_100006751 3300005719 Bacteria 7842
126 Ga0068861_100300486 3300005719 Bacteria 1390
127 Ga0068851_10006113 3300005834 Bacteria 5494
128 Ga0068870_10018568 3300005840 Bacteria 3360
129 Ga0068863_100001099 3300005841 Bacteria 27025
130 Ga0068863_100005032 3300005841 Bacteria 13033
131 Ga0068863_100022625 3300005841 Bacteria 6002
132 Ga0068863_100112958 3300005841 Bacteria 2587
133 Ga0068863_100248581 3300005841 Bacteria 1717
134 Ga0068863_100851104 3300005841 Bacteria 911
135 Ga0068858_100001773 3300005842 Bacteria 22007
136 Ga0068858_100001802 3300005842 Bacteria 21829
137 Ga0068858_100002680 3300005842 Bacteria 17929
138 Ga0068858_100007229 3300005842 Bacteria 10762
139 Ga0068860_100005207 3300005843 Bacteria 13207
140 Ga0068860_100010729 3300005843 Bacteria 9046
141 Ga0068860_100029041 3300005843 Bacteria 5320
142 Ga0068860_100079184 3300005843 Bacteria 3124
143 Ga0068860_100087827 3300005843 Bacteria 2960
144 Ga0068860_100118452 3300005843 Bacteria 2535
145 Ga0068862_100074597 3300005844 Bacteria 2932
146 Ga0068862_100166684 3300005844 Bacteria 1970
147 Ga0068862_100190620 3300005844 Bacteria 1844
148 Ga0068862_100395828 3300005844 Bacteria 1291
149 Ga0081455_10022056 3300005937 Bacteria 5961
150 Ga0081455_10286575 3300005937 Bacteria 1187
151 Ga0081540_1011922 3300005983 Bacteria 5768
152 Ga0081540_1039510 3300005983 Bacteria 2473
153 Ga0081539_10000028 3300005985 Bacteria 328182
154 Ga0081539_10000572 3300005985 Bacteria 76133
155 Ga0070717_10008740 3300006028 Bacteria 7578
156 Ga0070717_10505885 3300006028 Bacteria 1092
157 Ga0075363_100167385 3300006048 Bacteria 1246
158 Ga0075363_100191462 3300006048 Bacteria 1167
159 Ga0070712_100043863 3300006175 Bacteria 3081
160 Ga0070712_100049035 3300006175 Bacteria 2930
161 Ga0070712_100317876 3300006175 Bacteria 1265
162 Ga0070712_100332292 3300006175 Bacteria 1239
163 Ga0075367_10048990 3300006178 Bacteria 2490
164 Ga0075367_10125721 3300006178 Bacteria 1582
165 Ga0097621_100323684 3300006237 Bacteria 1366
166 Ga0097621_100676337 3300006237 Bacteria 949
167 Ga0075370_10028886 3300006353 Bacteria 3085
168 Ga0068871_100026906 3300006358 Bacteria 4493
169 Ga0068871_100121433 3300006358 Bacteria 2207
170 Ga0068871_100238794 3300006358 Bacteria 1579
171 Ga0075428_100007872 3300006844 Bacteria 11817
172 Ga0075428_100133315 3300006844 Bacteria 2701
173 Ga0075428_100179632 3300006844 Bacteria 2291
174 Ga0075430_100003646 3300006846 Bacteria 12922
175 Ga0075430_100204848 3300006846 Bacteria 1637
176 Ga0075430_100462388 3300006846 Bacteria 1047
177 Ga0075431_100008804 3300006847 Bacteria 10112
178 Ga0075431_100010293 3300006847 Bacteria 9398
179 Ga0075431_100040109 3300006847 Bacteria 4824
180 Ga0075431_100040688 3300006847 Bacteria 4790
181 Ga0075431_100071130 3300006847 Bacteria 3589
182 Ga0075431_100173057 3300006847 Bacteria 2218
183 Ga0075431_100203659 3300006847 Bacteria 2024
184 Ga0075433_10005192 3300006852 Bacteria 10202
185 Ga0075434_100001680 3300006871 Bacteria 18905
186 Ga0075434_100719378 3300006871 Bacteria 1016
187 Ga0075429_100062955 3300006880 Bacteria 3232
188 Ga0075429_100145387 3300006880 Bacteria 2075
189 Ga0075429_100317192 3300006880 Bacteria 1364
190 Ga0068865_100032871 3300006881 Bacteria 3470
191 Ga0068865_100051043 3300006881 Bacteria 2861
192 Ga0075436_100106071 3300006914 Bacteria 1960
193 Ga0097620_100002193 3300006931 Bacteria 19831
194 Ga0097620_100007416 3300006931 Bacteria 11134
195 Ga0097620_100027568 3300006931 Bacteria 5698
196 Ga0097620_100030045 3300006931 Bacteria 5452
197 Ga0097620_100034472 3300006931 Bacteria 5080
198 Ga0097620_100069696 3300006931 Bacteria 3552
199 Ga0097620_100144103 3300006931 Bacteria 2456
200 Ga0097620_100491412 3300006931 Bacteria 1322
201 Ga0075435_100092318 3300007076 Bacteria 2500
202 Ga0075435_100093142 3300007076 Bacteria 2489
203 Ga0075435_100425553 3300007076 Bacteria 1144
204 Ga0099795_10000022 3300007788 Bacteria 52585
205 Ga0099795_10039386 3300007788 Bacteria 1673
206 Ga0105244_10000485 3300009036 Bacteria 35910
207 Ga0105240_10002127 3300009093 Bacteria 32338
208 Ga0105240_10019489 3300009093 Bacteria 9062
209 Ga0105240_10040891 3300009093 Bacteria 5924
210 Ga0105240_10166139 3300009093 Bacteria 2617
211 Ga0105240_10342568 3300009093 Bacteria 1698
212 Ga0105240_10453705 3300009093 Bacteria 1434
213 Ga0105240_10598508 3300009093 Bacteria 1214
214 Ga0111539_10000539 3300009094 Bacteria 48163
215 Ga0111539_10008011 3300009094 Bacteria 13478
216 Ga0111539_10042495 3300009094 Bacteria 5458
217 Ga0111539_10051848 3300009094 Bacteria 4885
218 Ga0111539_10119806 3300009094 Bacteria 3083
219 Ga0111539_10184014 3300009094 Bacteria 2440
220 Ga0111539_10187293 3300009094 Bacteria 2416
221 Ga0105245_10041273 3300009098 Bacteria 4113
222 Ga0105245_10346510 3300009098 Bacteria 1470
223 Ga0105247_10000300 3300009101 Bacteria 44647
224 Ga0105247_10002560 3300009101 Bacteria 12335
225 Ga0105247_10021799 3300009101 Bacteria 3854
226 Ga0105247_10034970 3300009101 Bacteria 3060
227 Ga0105247_10046950 3300009101 Bacteria 2652
228 Ga0105247_10152903 3300009101 Bacteria 1522
229 Ga0105247_10243378 3300009101 Bacteria 1226
230 Ga0114129_10018202 3300009147 Bacteria 10002
231 Ga0114129_10043590 3300009147 Bacteria 6312
232 Ga0114129_10079019 3300009147 Bacteria 4574
233 Ga0114129_10157357 3300009147 Bacteria 3106
234 Ga0114129_10360628 3300009147 Bacteria 1923
235 Ga0114129_10796081 3300009147 Bacteria 1206
236 Ga0105243_10373640 3300009148 Bacteria 1316
237 Ga0105241_10083942 3300009174 Bacteria 2500
238 Ga0105242_10296324 3300009176 Bacteria 1474
239 Ga0105242_10487791 3300009176 Bacteria 1169
240 Ga0105248_10004437 3300009177 Bacteria 15538
241 Ga0105248_10045977 3300009177 Bacteria 4894
242 Ga0105248_10154022 3300009177 Bacteria 2593
243 Ga0105248_10166119 3300009177 Bacteria 2488
244 Ga0105248_10209038 3300009177 Bacteria 2199
245 Ga0105248_10215252 3300009177 Bacteria 2164
246 Ga0105248_10482361 3300009177 Bacteria 1397
247 Ga0105237_10018777 3300009545 Bacteria 7150
248 Ga0105237_10039226 3300009545 Bacteria 4781
249 Ga0105237_10066928 3300009545 Bacteria 3587
250 Ga0105237_10074516 3300009545 Bacteria 3386
251 Ga0105237_10079543 3300009545 Bacteria 3268
252 Ga0105237_10337908 3300009545 Bacteria 1510
253 Ga0105237_10349702 3300009545 Bacteria 1482
254 Ga0105238_10065070 3300009551 Bacteria 3647
255 Ga0105238_10119147 3300009551 Bacteria 2620
256 Ga0105238_10122845 3300009551 Bacteria 2576
257 Ga0105238_10555519 3300009551 Bacteria 1153
258 Ga0105249_10013186 3300009553 Bacteria 7294
259 Ga0105249_10063863 3300009553 Bacteria 3383
260 Ga0105249_10126799 3300009553 Bacteria 2431
261 Ga0105249_10189268 3300009553 Bacteria 2008
262 Ga0105249_10401251 3300009553 Bacteria 1401
263 Ga0105030_100135 3300009987 Bacteria 5867
264 Ga0099796_10000025 3300010159 Bacteria 37858
265 Ga0099796_10047809 3300010159 Bacteria 1473
266 Ga0105239_10005592 3300010375 Bacteria 14700
267 Ga0105239_10052494 3300010375 Bacteria 4471
268 Ga0105239_10127177 3300010375 Bacteria 2833
269 Ga0157371_10214250 3300013102 Bacteria 1382
270 Ga0157370_10001622 3300013104 Bacteria 27793
271 Ga0157370_10052398 3300013104 Bacteria 3896
272 Ga0157369_10091788 3300013105 Bacteria 3241
273 Ga0157369_10358490 3300013105 Bacteria 1514
274 Ga0157369_10392959 3300013105 Bacteria 1439
275 Ga0157374_10057123 3300013296 Bacteria 3644
276 Ga0157374_10266109 3300013296 Bacteria 1690
277 Ga0157378_10192571 3300013297 Bacteria 1924
278 Ga0163162_10068089 3300013306 Bacteria 3611
279 Ga0163162_10243601 3300013306 Bacteria 1929
280 Ga0163162_10496428 3300013306 Bacteria 1351
281 Ga0157372_10058628 3300013307 Bacteria 4305
282 Ga0157375_10052786 3300013308 Bacteria 3998
283 Ga0157375_10333620 3300013308 Bacteria 1682
284 Ga0157375_10719807 3300013308 Bacteria 1151
285 Ga0157375_11020506 3300013308 Bacteria 966
286 Ga0157514_109572 3300013874 Bacteria 1488
287 Ga0163163_10008179 3300014325 Bacteria 9278
288 Ga0163163_10010899 3300014325 Bacteria 8211
289 Ga0163163_10032882 3300014325 Bacteria 5012
290 Ga0163163_10033348 3300014325 Bacteria 4980
291 Ga0163163_10054754 3300014325 Bacteria 3942
292 Ga0163163_10164638 3300014325 Bacteria 2263
293 Ga0163163_10241991 3300014325 Bacteria 1854
294 Ga0163163_10549227 3300014325 Bacteria 1218
295 Ga0163163_10886454 3300014325 Bacteria 955
296 Ga0157380_10000110 3300014326 Bacteria 44612
297 Ga0157380_10010381 3300014326 Bacteria 6699
298 Ga0157380_10096919 3300014326 Bacteria 2446
299 Ga0157380_10247030 3300014326 Bacteria 1613
300 Ga0157380_10313909 3300014326 Bacteria 1450
301 Ga0157380_10318476 3300014326 Bacteria 1441
302 Ga0157377_10096682 3300014745 Bacteria 1752
303 Ga0157377_10115359 3300014745 Bacteria 1620
304 Ga0157379_10002677 3300014968 Bacteria 15005
305 Ga0157379_10005225 3300014968 Bacteria 11148
306 Ga0157379_10056900 3300014968 Bacteria 3494
307 Ga0157379_10096564 3300014968 Bacteria 2652
308 Ga0157379_10111786 3300014968 Bacteria 2454
309 Ga0157379_10200864 3300014968 Bacteria 1803
310 Ga0157379_10252200 3300014968 Bacteria 1602
311 Ga0157379_10628382 3300014968 Bacteria 1004
312 Ga0157376_10037280 3300014969 Bacteria 3945
313 Ga0157376_10144989 3300014969 Bacteria 2135
314 Ga0157376_10213577 3300014969 Bacteria 1783
315 Ga0163161_10278323 3300017792 Bacteria 1312
316 Ga0213872_10042800 3300021361 Bacteria 2064
317 Ga0213872_10057513 3300021361 Bacteria 1761
318 Ga0213875_10004869 3300021388 Bacteria 7287
319 Ga0213875_10093453 3300021388 Bacteria 1403
320 Ga0213871_10030523 3300021441 Bacteria 1403
321 Ga0213871_10031699 3300021441 Bacteria 1382
322 Ga0209672_100003 3300025228 Bacteria 1560476
323 Ga0209147_100509 3300025229 Bacteria 22628
324 Ga0209258_106134 3300025242 Bacteria 1923
325 Ga0209148_1000004 3300025254 Bacteria 1844481
326 Ga0209233_1000010 3300025261 Bacteria 1194329
327 Ga0209455_1000022 3300025272 Bacteria 688910
328 Ga0209130_1000167 3300025284 Bacteria 95517
329 Ga0209130_1001359 3300025284 Bacteria 16509
330 Ga0209676_1003691 3300025292 Bacteria 9150
331 Ga0209025_1000077 3300025294 Bacteria 271958
332 Ga0209025_1000152 3300025294 Bacteria 171558
333 Ga0209758_1000169 3300025297 Bacteria 149782
334 Ga0209758_1002944 3300025297 Bacteria 16373
335 Ga0209758_1004047 3300025297 Bacteria 12635
336 Ga0209050_1004720 3300025298 Bacteria 9028
337 Ga0207426_1000239 3300025302 Bacteria 123307
338 Ga0207426_1000333 3300025302 Bacteria 88786
339 Ga0209051_1007044 3300025303 Bacteria 6221
340 Ga0207656_10032714 3300025321 Bacteria 2161
341 Ga0207655_1000060 3300025728 Bacteria 260572
342 Ga0207713_1007835 3300025735 Bacteria 6230
343 Ga0207710_10001255 3300025900 Bacteria 12843
344 Ga0207710_10001815 3300025900 Bacteria 10295
345 Ga0207710_10041557 3300025900 Bacteria 2039
346 Ga0207680_10087713 3300025903 Bacteria 1971
347 Ga0207680_10275492 3300025903 Bacteria 1168
348 Ga0207647_10015135 3300025904 Bacteria 5300
349 Ga0207647_10017113 3300025904 Bacteria 4935
350 Ga0207699_10011068 3300025906 Bacteria 4545
351 Ga0207645_10001223 3300025907 Bacteria 21174
352 Ga0207643_10057011 3300025908 Bacteria 2223
353 Ga0207705_10008147 3300025909 Bacteria 7674
354 Ga0207705_10211283 3300025909 Bacteria 1472
355 Ga0207654_10072903 3300025911 Bacteria 2045
356 Ga0207707_10000753 3300025912 Bacteria 31898
357 Ga0207707_10068485 3300025912 Bacteria 3092
358 Ga0207707_10091549 3300025912 Bacteria 2658
359 Ga0207707_10136893 3300025912 Bacteria 2141
360 Ga0207695_10009529 3300025913 Bacteria 12008
361 Ga0207695_10024867 3300025913 Bacteria 6721
362 Ga0207695_10047805 3300025913 Bacteria 4523
363 Ga0207695_10091079 3300025913 Bacteria 3064
364 Ga0207695_10095476 3300025913 Bacteria 2977
365 Ga0207695_10098191 3300025913 Bacteria 2928
366 Ga0207695_10117564 3300025913 Bacteria 2631
367 Ga0207695_10127044 3300025913 Bacteria 2511
368 Ga0207695_10243725 3300025913 Bacteria 1698
369 Ga0207695_10269834 3300025913 Bacteria 1597
370 Ga0207695_10317224 3300025913 Bacteria 1448
371 Ga0207671_10013339 3300025914 Bacteria 6549
372 Ga0207671_10033612 3300025914 Bacteria 3814
373 Ga0207671_10039105 3300025914 Bacteria 3514
374 Ga0207671_10078427 3300025914 Bacteria 2474
375 Ga0207671_10111889 3300025914 Bacteria 2078
376 Ga0207671_10158215 3300025914 Bacteria 1753
377 Ga0207693_10018817 3300025915 Bacteria 5496
378 Ga0207693_10117336 3300025915 Bacteria 2089
379 Ga0207693_10168011 3300025915 Bacteria 1727
380 Ga0207693_10371332 3300025915 Bacteria 1119
381 Ga0207663_10099392 3300025916 Bacteria 1950
382 Ga0207663_10164144 3300025916 Bacteria 1571
383 Ga0207663_10204893 3300025916 Bacteria 1425
384 Ga0207663_10219841 3300025916 Bacteria 1381
385 Ga0207660_10024249 3300025917 Bacteria 4105
386 Ga0207660_10037930 3300025917 Bacteria 3361
387 Ga0207660_10321609 3300025917 Bacteria 1235
388 Ga0207657_10009568 3300025919 Bacteria 9729
389 Ga0207657_10408995 3300025919 Bacteria 1067
390 Ga0207649_10001165 3300025920 Bacteria 15847
391 Ga0207649_10105728 3300025920 Bacteria 1871
392 Ga0207652_10011550 3300025921 Bacteria 7121
393 Ga0207652_10032150 3300025921 Bacteria 4408
394 Ga0207646_10055232 3300025922 Bacteria 3551
395 Ga0207681_10096522 3300025923 Bacteria 2122
396 Ga0207681_10216990 3300025923 Bacteria 1478
397 Ga0207681_10243985 3300025923 Bacteria 1399
398 Ga0207694_10009564 3300025924 Bacteria 7314
399 Ga0207694_10578677 3300025924 Bacteria 944
400 Ga0207659_10015047 3300025926 Bacteria 5003
401 Ga0207659_10023791 3300025926 Bacteria 4094
402 Ga0207687_10017700 3300025927 Bacteria 4696
403 Ga0207687_10242797 3300025927 Bacteria 1428
404 Ga0207687_10480576 3300025927 Bacteria 1034
405 Ga0207700_10067505 3300025928 Bacteria 2738
406 Ga0207700_10078242 3300025928 Bacteria 2572
407 Ga0207700_10238863 3300025928 Bacteria 1548
408 Ga0207700_10443037 3300025928 Bacteria 1144
409 Ga0207664_10043496 3300025929 Bacteria 3513
410 Ga0207664_10197896 3300025929 Bacteria 1733
411 Ga0207644_10001224 3300025931 Bacteria 16517
412 Ga0207644_10008565 3300025931 Bacteria 6691
413 Ga0207644_10020759 3300025931 Bacteria 4468
414 Ga0207706_10003281 3300025933 Bacteria 15479
415 Ga0207706_10004326 3300025933 Bacteria 13333
416 Ga0207669_10062312 3300025937 Bacteria 2296
417 Ga0207704_10016231 3300025938 Bacteria 3822
418 Ga0207704_10057443 3300025938 Bacteria 2390
419 Ga0207665_10077250 3300025939 Bacteria 2285
420 Ga0207665_10182214 3300025939 Bacteria 1522
421 Ga0207691_10001448 3300025940 Bacteria 23639
422 Ga0207691_10018310 3300025940 Bacteria 6635
423 Ga0207691_10290208 3300025940 Bacteria 1407
424 Ga0207711_10077329 3300025941 Bacteria 2900
425 Ga0207711_10106629 3300025941 Bacteria 2486
426 Ga0207711_10191619 3300025941 Bacteria 1863
427 Ga0207689_10145911 3300025942 Bacteria 1950
428 Ga0207661_10110675 3300025944 Bacteria 2322
429 Ga0207667_10004634 3300025949 Bacteria 16866
430 Ga0207667_10006777 3300025949 Bacteria 13836
431 Ga0207667_10179116 3300025949 Bacteria 2177
432 Ga0207667_10291902 3300025949 Bacteria 1666
433 Ga0207651_10154320 3300025960 Bacteria 1792
434 Ga0207712_10059202 3300025961 Bacteria 2710
435 Ga0207712_10464629 3300025961 Bacteria 1076
436 Ga0207712_10736621 3300025961 Bacteria 863
437 Ga0207668_10023557 3300025972 Bacteria 3960
438 Ga0207640_10053272 3300025981 Bacteria 2640
439 Ga0207640_10523179 3300025981 Bacteria 992
440 Ga0207658_10013905 3300025986 Bacteria 5507
441 Ga0207658_10017695 3300025986 Bacteria 4914
442 Ga0207658_10046985 3300025986 Bacteria 3156
443 Ga0207658_10349464 3300025986 Bacteria 1287
444 Ga0207677_10336233 3300026023 Bacteria 1260
445 Ga0207703_10000684 3300026035 Bacteria 33643
446 Ga0207703_10028593 3300026035 Bacteria 4395
447 Ga0207703_10073668 3300026035 Bacteria 2825
448 Ga0207639_10004843 3300026041 Bacteria 9077
449 Ga0207639_10006241 3300026041 Bacteria 8098
450 Ga0207639_10182852 3300026041 Bacteria 1784
451 Ga0207678_10032138 3300026067 Bacteria 4575
452 Ga0207678_10033497 3300026067 Bacteria 4474
453 Ga0207678_10085075 3300026067 Bacteria 2704
454 Ga0207678_10124850 3300026067 Bacteria 2196
455 Ga0207678_10305925 3300026067 Bacteria 1366
456 Ga0207708_10026815 3300026075 Bacteria 4362
457 Ga0207702_10070413 3300026078 Bacteria 3008
458 Ga0207702_10204640 3300026078 Bacteria 1832
459 Ga0207702_10647059 3300026078 Bacteria 1039
460 Ga0207641_10000218 3300026088 Bacteria 74549
461 Ga0207641_10000313 3300026088 Bacteria 60517
462 Ga0207641_10005318 3300026088 Bacteria 10992
463 Ga0207641_10009065 3300026088 Bacteria 8218
464 Ga0207641_10031125 3300026088 Bacteria 4424
465 Ga0207641_10282153 3300026088 Bacteria 1563
466 Ga0207641_10439271 3300026088 Bacteria 1259
467 Ga0207641_10508518 3300026088 Bacteria 1171
468 Ga0207641_10651959 3300026088 Bacteria 1034
469 Ga0207648_10003080 3300026089 Bacteria 17612
470 Ga0207648_10004235 3300026089 Bacteria 14825
471 Ga0207648_10187355 3300026089 Bacteria 1833
472 Ga0207648_10376827 3300026089 Bacteria 1283
473 Ga0207676_10104929 3300026095 Bacteria 2352
474 Ga0207674_10047539 3300026116 Bacteria 4397
475 Ga0207674_10195076 3300026116 Bacteria 1975
476 Ga0207674_10344051 3300026116 Bacteria 1442
477 Ga0207674_10442308 3300026116 Bacteria 1256
478 Ga0207674_10456467 3300026116 Bacteria 1235
479 Ga0207675_100006460 3300026118 Bacteria 11099
480 Ga0207675_100013913 3300026118 Bacteria 7501
481 Ga0207675_100575056 3300026118 Bacteria 1128
482 Ga0207698_10112794 3300026142 Bacteria 2283
483 Ga0209371_1000215 3300027312 Bacteria 78569
484 Ga0209371_1001291 3300027312 Bacteria 17602
485 Ga0209179_1000048 3300027512 Bacteria 23370
486 Ga0209968_1024913 3300027526 Bacteria 983
487 Ga0209982_1000774 3300027552 Bacteria 4117
488 Ga0209970_1021752 3300027614 Bacteria 1087
489 Ga0209970_1032790 3300027614 Bacteria 907
490 Ga0210002_1000664 3300027617 Bacteria 4657
491 Ga0210002_1002126 3300027617 Bacteria 2862
492 Ga0209983_1000414 3300027665 Bacteria 9197
493 Ga0209983_1007773 3300027665 Bacteria 2195
494 Ga0209983_1017107 3300027665 Bacteria 1499
495 Ga0209971_1000988 3300027682 Bacteria 7314
496 Ga0209971_1022112 3300027682 Bacteria 1514
497 Ga0209998_10002182 3300027717 Bacteria 4544
498 Ga0209998_10002926 3300027717 Bacteria 3819
499 Ga0209974_10037113 3300027876 Bacteria 1618
500 Ga0207428_10025978 3300027907 Bacteria 4893
501 Ga0207428_10028273 3300027907 Bacteria 4660
502 Ga0207428_10065196 3300027907 Bacteria 2874
503 Ga0207428_10076142 3300027907 Bacteria 2628
504 Ga0207428_10254496 3300027907 Bacteria 1309
505 Ga0268266_10001602 3300028379 Bacteria 26388
506 Ga0268266_10003289 3300028379 Bacteria 16241
507 Ga0268266_10024426 3300028379 Bacteria 5140
508 Ga0268266_10041031 3300028379 Bacteria 3946
509 Ga0268266_10069361 3300028379 Bacteria 3054
510 Ga0268266_10081141 3300028379 Bacteria 2827
511 Ga0268266_10112936 3300028379 Bacteria 2409
512 Ga0268266_10248700 3300028379 Bacteria 1644
513 Ga0268265_10004447 3300028380 Bacteria 9730
514 Ga0268265_10066844 3300028380 Bacteria 2780
515 Ga0268265_10099057 3300028380 Bacteria 2349
516 Ga0268265_10476063 3300028380 Bacteria 1172
517 Ga0268265_10544145 3300028380 Bacteria 1101
518 Ga0268264_10000047 3300028381 Bacteria 349944
519 Ga0268264_10000140 3300028381 Bacteria 171592
520 Ga0268264_10004448 3300028381 Bacteria 11959
521 Ga0268264_10012089 3300028381 Bacteria 7107
522 Ga0268264_10024711 3300028381 Bacteria 4907
523 Ga0268264_10044934 3300028381 Bacteria 3666
524 Ga0268264_10089829 3300028381 Bacteria 2646
525 Ga0307515_10018263 3300028794 Bacteria 12715
526 Ga0265338_10091735 3300028800 Bacteria 2508
527 Ga0265338_10270660 3300028800 Bacteria 1245
528 Ga0268256_1000172 3300030500 Bacteria 78620
529 Ga0268256_1001102 3300030500 Bacteria 17602
530 Ga0307511_10028868 3300030521 Bacteria 5023
531 Ga0265325_10028726 3300031241 Bacteria 2994
532 Ga0265325_10033917 3300031241 Bacteria 2720
533 Ga0265340_10017304 3300031247 Bacteria 3727
534 Ga0265340_10068994 3300031247 Bacteria 1678
535 Ga0265340_10097134 3300031247 Bacteria 1372
536 Ga0265340_10119807 3300031247 Bacteria 1211
537 Ga0265339_10123897 3300031249 Bacteria 1326
538 Ga0265339_10126512 3300031249 Bacteria 1310
539 Ga0265331_10027782 3300031250 Bacteria 2833
540 Ga0265331_10108780 3300031250 Bacteria 1272
541 Ga0307513_10049441 3300031456 Bacteria 4555
542 Ga0307509_10001396 3300031507 Bacteria 40975
543 Ga0307509_10002372 3300031507 Bacteria 30641
544 Ga0307509_10148841 3300031507 Bacteria 2261
545 Ga0307408_100016261 3300031548 Bacteria 4963
546 Ga0307408_100017852 3300031548 Bacteria 4754
547 Ga0307408_100022764 3300031548 Bacteria 4262
548 Ga0307408_100101573 3300031548 Bacteria 2192
549 Ga0307408_100445606 3300031548 Bacteria 1122
550 Ga0265313_10027030 3300031595 Bacteria 3010
551 Ga0265313_10033559 3300031595 Bacteria 2606
552 Ga0265313_10037843 3300031595 Bacteria 2408
553 Ga0307508_10211816 3300031616 Bacteria 1538
554 Ga0307508_10227050 3300031616 Bacteria 1466
555 Ga0307514_10145144 3300031649 Bacteria 1605
556 Ga0316575_10017248 3300031665 Bacteria 2741
557 Ga0316575_10027915 3300031665 Bacteria 2197
558 Ga0316579_10022252 3300031691 Bacteria 2833
559 Ga0265314_10093275 3300031711 Bacteria 1955
560 Ga0265342_10035713 3300031712 Bacteria 3040
561 Ga0265342_10077743 3300031712 Bacteria 1921
562 Ga0316576_10005161 3300031727 Bacteria 7934
563 Ga0316576_10017920 3300031727 Bacteria 4824
564 Ga0316576_10117867 3300031727 Bacteria 1992
565 Ga0316576_10205853 3300031727 Bacteria 1482
566 Ga0316576_10362421 3300031727 Bacteria 1077
567 Ga0316576_10399452 3300031727 Bacteria 1018
568 Ga0316578_10005082 3300031728 Bacteria 6329
569 Ga0316578_10016838 3300031728 Bacteria 3966
570 Ga0316578_10018257 3300031728 Bacteria 3838
571 Ga0316578_10041771 3300031728 Bacteria 2657
572 Ga0316578_10042084 3300031728 Bacteria 2647
573 Ga0316578_10099244 3300031728 Bacteria 1745
574 Ga0316578_10249296 3300031728 Bacteria 1065
575 Ga0307405_10261658 3300031731 Bacteria 1292
576 Ga0307405_10449484 3300031731 Bacteria 1021
577 Ga0316577_10009416 3300031733 Bacteria 5254
578 Ga0316577_10042335 3300031733 Bacteria 2548
579 Ga0316577_10083642 3300031733 Bacteria 1785
580 Ga0307413_10115670 3300031824 Bacteria 1805
581 Ga0307410_10037833 3300031852 Bacteria 3156
582 Ga0307410_10116082 3300031852 Bacteria 1944
583 Ga0307406_10147578 3300031901 Bacteria 1674
584 Ga0307406_10191032 3300031901 Bacteria 1499
585 Ga0307407_10091954 3300031903 Bacteria 1862
586 Ga0307407_10134976 3300031903 Bacteria 1584
587 Ga0307412_10000918 3300031911 Bacteria 16854
588 Ga0307412_10259049 3300031911 Bacteria 1355
589 Ga0307409_100213315 3300031995 Bacteria 1737
590 Ga0307409_100291150 3300031995 Bacteria 1514
591 Ga0307409_100334752 3300031995 Bacteria 1422
592 Ga0307416_100003094 3300032002 Bacteria 9732
593 Ga0307416_100042886 3300032002 Bacteria 3537
594 Ga0307416_100052766 3300032002 Bacteria 3257
595 Ga0307416_100138453 3300032002 Bacteria 2207
596 Ga0307414_10136025 3300032004 Bacteria 1916
597 Ga0307414_10182422 3300032004 Bacteria 1689
598 Ga0307411_10002953 3300032005 Bacteria 7717
599 Ga0307411_10438790 3300032005 Bacteria 1089
600 Ga0307415_100001180 3300032126 Bacteria 12227
601 Ga0307415_100001775 3300032126 Bacteria 10549
602 Ga0316583_10042320 3300032133 Bacteria 1611
603 Ga0316580_10012084 3300032139 Bacteria 2626
604 Ga0316580_10018645 3300032139 Bacteria 2135
605 Ga0316593_10026050 3300032168 Bacteria 1867
606 Ga0307510_10000009 3300033180 Bacteria 409702
607 Ga0316592_1031644 3300033524 Bacteria 1153
608 Ga0316588_1019297 3300033528 Bacteria 1534
609 Ga0373923_0026198 3300035111 Bacteria 2318
610 Ga0373923_0113682 3300035111 Bacteria 1204
611 Ga0373936_0002315 3300035113 Bacteria 7133
612 Ga0373953_0003712 3300035117 Bacteria 4796
613 Ga0373956_0042636 3300035119 Bacteria 2018
614 Ga0373943_0042003 3300035170 Bacteria 2214
615 Ga0373955_0011701 3300035172 Bacteria 4193
616 Ga0316574_0002663 3300035398 Bacteria 9017
617 Ga0316574_0007652 3300035398 Bacteria 5935
618 Ga0316574_0014132 3300035398 Bacteria 4605
619 Ga0316574_0025571 3300035398 Bacteria 3544
620 Ga0316574_0028433 3300035398 Bacteria 3372
621 Ga0316574_0033917 3300035398 Bacteria 3109
622 Ga0316574_0037650 3300035398 Bacteria 2967
623 Ga0316574_0052334 3300035398 Bacteria 2546
624 Ga0316574_0052849 3300035398 Bacteria 2535
625 Ga0316574_0116042 3300035398 Bacteria 1717
626 Ga0316574_0134129 3300035398 Bacteria 1594
627 Ga0316574_0293659 3300035398 Bacteria 1034
628 Ga0373924_0129968 3300035410 Bacteria 1096
629 Ga0373931_0261437 3300035691 Bacteria 1056
630 Ga0373935_0026844 3300035692 Bacteria 3558
631 Ga0373927_0009759 3300035695 Bacteria 6436
632 Ga0373933_0003783 3300035724 Bacteria 8361
633 Ga0373933_0005208 3300035724 Bacteria 7095
634 Ga0373933_0012987 3300035724 Bacteria 4607
635 Ga0373933_0103066 3300035724 Bacteria 1772
636 Ga0373947_0060979 3300035725 Bacteria 2291
637 Ga0373937_0001734 3300036401 Bacteria 18336
638 Ga0373937_0012692 3300036401 Bacteria 7413
639 Ga0373937_0018708 3300036401 Bacteria 6190
640 Ga0373937_0031120 3300036401 Bacteria 4832
641 Ga0373937_0034493 3300036401 Bacteria 4603
642 Ga0316582_0012393 3300036647 Bacteria 4757
643 Ga0316582_0055960 3300036647 Bacteria 2515
644 Ga0316584_0004710 3300036712 Bacteria 9049
645 Ga0316584_0015022 3300036712 Bacteria 5531
646 Ga0316584_0032057 3300036712 Bacteria 3887
647 Ga0316584_0044014 3300036712 Bacteria 3329
648 Ga0373925_0090259 3300037068 Bacteria 2342
649 Ga0373925_0493190 3300037068 Bacteria 1005
650 Ga0395898_0020339 3300037466 Bacteria 6740
651 Ga0316581_0013589 3300037588 Bacteria 2310
652 Ga0436364_0509785 3300037853 Bacteria 8537
653 Ga0436364_0676183 3300037853 Bacteria 1581
654 Ga0436364_0745335 3300037853 Bacteria 1994
655 Ga0436364_0924171 3300037853 Bacteria 5557
656 Ga0436365_0404170 3300039437 Bacteria 1625
657 Ga0436365_1466348 3300039437 Bacteria 3634
658 Ga0436360_0392412 3300039438 Bacteria 4505
659 Ga0436360_0567944 3300039438 Bacteria 1269
660 Ga0436360_0638300 3300039438 Bacteria 1415
661 Ga0436360_0708385 3300039438 Bacteria 1153
662 Ga0436360_1050799 3300039438 Bacteria 1596
663 Ga0436360_1274780 3300039438 Bacteria 4531
664 Ga0436360_1301488 3300039438 Bacteria 1574
665 Ga0436361_0262581 3300039447 Bacteria 4707
666 Ga0436361_0328064 3300039447 Bacteria 5863
667 Ga0436361_0896160 3300039447 Bacteria 4446
668 Ga0436361_1206202 3300039447 Bacteria 1992
669 Ga0436363_1126933 3300039450 Bacteria 1428
670 Ga0436363_1135590 3300039450 Bacteria 989
671 Ga0436362_0776327 3300039453 Bacteria 1612
672 Ga0439438_061253 3300041405 Bacteria 942
673 Ga0451795_1220757 3300041456 Bacteria 1035
674 Ga0451833_1471124 3300041491 Bacteria 2158
675 Ga0451855_1730903 3300041511 Bacteria 1097
676 Ga0451853_0564721 3300041512 Bacteria 1952
677 Ga0439431_0067067 3300041997 Bacteria 952
678 Ga0439443_004650 3300042003 Bacteria 1799
679 Ga0439456_025965 3300042013 Bacteria 1245
680 Ga0450923_004500 3300042125 Bacteria 2191
681 Ga0450923_006323 3300042125 Bacteria 1958
682 Ga0450923_008008 3300042125 Bacteria 1806
683 Ga0450894_001909 3300042131 Bacteria 2883
684 Ga0450894_002729 3300042131 Bacteria 2338
685 Ga0450895_000553 3300042132 Bacteria 2208
686 Ga0450896_000078 3300042133 Bacteria 6552
687 Ga0450896_007483 3300042133 Bacteria 1506
688 Ga0450896_009427 3300042133 Bacteria 1359
689 Ga0450899_004788 3300042135 Bacteria 1450
690 Ga0450907_003204 3300042146 Bacteria 2954
691 Ga0450910_004879 3300042147 Bacteria 1821
692 Ga0439446_0000678 3300042156 Bacteria 7100
693 Ga0439446_0004444 3300042156 Bacteria 3556
694 Ga0439446_0016746 3300042156 Bacteria 2043
695 Ga0450908_001318 3300042184 Bacteria 4814
696 Ga0450908_001577 3300042184 Bacteria 4429
697 Ga0450908_007495 3300042184 Bacteria 2057
698 Ga0439434_0003968 3300042435 Bacteria 4318
699 Ga0439434_0004234 3300042435 Bacteria 4192
700 Ga0439434_0012069 3300042435 Bacteria 2555
701 Ga0439434_0014278 3300042435 Bacteria 2362
702 Ga0439434_0017233 3300042435 Bacteria 2161
703 Ga0439435_0041453 3300042436 Bacteria 1290
704 Ga0439444_0002496 3300042437 Bacteria 2519
705 Ga0439444_0006939 3300042437 Bacteria 1725
706 Ga0439464_0048652 3300042439 Unclassified 1222
707 Ga0439460_0055323 3300042461 Bacteria 1199
708 Ga0450918_010721 3300042531 Bacteria 1600
709 Ga0466969_0002997 3300044656 Bacteria 8993
710 Ga0466969_0003345 3300044656 Bacteria 8536
711 Ga0466969_0019932 3300044656 Bacteria 3477
712 Ga0466969_0036636 3300044656 Bacteria 2477
713 Ga0466966_0004455 3300044684 Bacteria 9235
714 Ga0466966_0064912 3300044684 Bacteria 2297
715 Ga0466966_0082288 3300044684 Bacteria 2003
716 Ga0466961_0001050 3300044693 Bacteria 17009
717 Ga0466963_0219371 3300044694 Bacteria 1332
718 Ga0466964_0025831 3300044706 Bacteria 2296
719 Ga0466971_0009912 3300044719 Bacteria 4161
720 Ga0466968_0174893 3300044735 Bacteria 996
721 Ga0466970_0018159 3300044765 Bacteria 3639
722 Ga0466970_0042029 3300044765 Bacteria 2430
723 Ga0466957_0004657 3300044842 Bacteria 7664
724 Ga0466959_0004232 3300045049 Bacteria 9573
725 Ga0466959_0006382 3300045049 Bacteria 8164
726 Ga0466959_0051682 3300045049 Bacteria 3012
727 Ga0466959_0066819 3300045049 Bacteria 2607
728 Ga0451576_0017273 3300045051 Bacteria 7939
729 Ga0451576_0095535 3300045051 Bacteria 3091
730 Ga0495592_0070764 3300046454 Bacteria 2540
731 Ga0495592_0082570 3300046454 Bacteria 2322
732 Ga0495603_0001283 3300046455 Bacteria 14634
733 Ga0495629_0000490 3300046459 Bacteria 33122
734 Ga0495629_0151636 3300046459 Bacteria 1611
735 Ga0495638_0010078 3300046460 Bacteria 6587
736 Ga0495638_0023670 3300046460 Bacteria 4013
737 Ga0495638_0135754 3300046460 Bacteria 1441
738 Ga0495641_0012212 3300046461 Bacteria 4821
739 Ga0495651_0031101 3300046462 Bacteria 4163
740 Ga0495580_0008705 3300046472 Bacteria 8047
741 Ga0495580_0010876 3300046472 Bacteria 7064
742 Ga0495582_0003939 3300046473 Bacteria 8341
743 Ga0495582_0363647 3300046473 Bacteria 833
744 Ga0495639_0005800 3300046475 Bacteria 5314
745 Ga0495664_0000789 3300046477 Bacteria 16177
746 Ga0495594_0004890 3300046499 Bacteria 6897
747 Ga0495606_0090274 3300046507 Bacteria 1886
748 Ga0495608_0013950 3300046511 Bacteria 5577
749 Ga0495610_0006077 3300046512 Bacteria 8428
750 Ga0495610_0065673 3300046512 Bacteria 1711
751 Ga0495628_0133199 3300046516 Bacteria 1900
752 Ga0495628_0138051 3300046516 Bacteria 1862
753 Ga0495630_0149032 3300046517 Unclassified 1780
754 Ga0495632_0060396 3300046519 Bacteria 1842
755 Ga0495666_0020760 3300046526 Bacteria 3252
756 Ga0495665_0051259 3300046531 Bacteria 2186
757 Ga0495640_0069265 3300046533 Bacteria 2373
758 Ga0495586_0012842 3300046535 Bacteria 4440
759 Ga0495587_0020619 3300046536 Bacteria 4065
760 Ga0495645_0185966 3300046543 Bacteria 1419
761 Ga0495622_0004166 3300046557 Bacteria 6746
762 Ga0495622_0084306 3300046557 Bacteria 1462
763 Ga0495667_0013353 3300046559 Bacteria 5559
764 Ga0495667_0042585 3300046559 Bacteria 3011
765 Ga0495634_0006857 3300046642 Bacteria 8617
766 Ga0495625_0016231 3300046660 Bacteria 5865
767 Ga0495635_0019280 3300046663 Bacteria 4758
768 Ga0495635_0197899 3300046663 Bacteria 1364
769 Ga0495635_0268862 3300046663 Bacteria 1147
770 Ga0495588_0015794 3300046674 Bacteria 3640
771 Ga0495657_0031496 3300046675 Bacteria 3707
772 Ga0495599_0011784 3300046678 Bacteria 5375
773 Ga0495623_0025535 3300046679 Bacteria 3806
774 Ga0495646_0006351 3300046680 Bacteria 7495
775 Ga0495647_0009478 3300046681 Bacteria 3300
776 Ga0495658_0041913 3300046683 Bacteria 2553
777 Ga0495613_0008530 3300046689 Bacteria 7605
778 Ga0495649_0152153 3300046694 Bacteria 1215
779 Ga0495600_0055760 3300046809 Bacteria 2581
780 Ga0495581_0000838 3300047315 Bacteria 16367
781 Ga0495581_0334930 3300047315 Bacteria 883
782 Ga0495604_0043627 3300047317 Bacteria 3510
783 Ga0495604_0047733 3300047317 Bacteria 3334
784 Ga0495674_0045561 3300047319 Bacteria 3894
785 Ga0495676_0040521 3300047321 Bacteria 3843
786 Ga0495680_0065698 3300047322 Bacteria 2778
787 Ga0495680_0154836 3300047322 Bacteria 1668
788 Ga0495687_033524 3300047443 Bacteria 2328
789 Ga0495687_056745 3300047443 Bacteria 1632
790 Ga0495675_0016707 3300047444 Bacteria 4641
791 Ga0495684_0032940 3300047471 Bacteria 3979
792 Ga0495684_0123713 3300047471 Bacteria 1947
793 Ga0495593_0008079 3300047673 Bacteria 6121
794 Ga0495602_0000230 3300048088 Bacteria 52313
795 Ga0495602_0023230 3300048088 Bacteria 6048
796 Ga0496100_0063978 3300048903 Bacteria 2433
797 Ga0496100_0209269 3300048903 Bacteria 1426
798 Ga0496100_0317085 3300048903 Bacteria 1170
799 Ga0496101_0112452 3300048904 Bacteria 2051
800 Ga0496101_0196100 3300048904 Bacteria 1560
801 Ga0496102_0006952 3300048905 Bacteria 9655
802 Ga0496102_0103364 3300048905 Bacteria 2649
803 Ga0496102_0355179 3300048905 Bacteria 1380
804 Ga0496102_0504506 3300048905 Bacteria 1132
805 Ga0496102_0508558 3300048905 Bacteria 1127
806 Ga0496103_0064031 3300048906 Bacteria 2291
807 Ga0496103_0103374 3300048906 Bacteria 1805
808 Ga0496104_0116842 3300048907 Bacteria 2560
809 Ga0496105_0041734 3300048908 Bacteria 3781
810 Ga0496105_0180782 3300048908 Bacteria 1727
811 Ga0496106_0044529 3300048909 Bacteria 3331
812 Ga0496106_0322834 3300048909 Bacteria 1239
813 Ga0496107_0040341 3300048910 Bacteria 3351
814 Ga0496108_0115259 3300048911 Bacteria 2301
815 Ga0496109_0011659 3300048912 Bacteria 7559
816 Ga0496109_0326771 3300048912 Bacteria 1448
817 Ga0496109_0542097 3300048912 Bacteria 1098
818 Ga0496110_0234677 3300048913 Bacteria 1669
819 Ga0496110_0295157 3300048913 Bacteria 1476
820 Ga0496111_0251369 3300048914 Bacteria 1312
821 Ga0496112_0011589 3300048915 Bacteria 8060
822 Ga0496112_0078126 3300048915 Bacteria 3273
823 Ga0496113_0016702 3300048916 Bacteria 5075
824 Ga0496113_0070019 3300048916 Bacteria 2665
825 Ga0496116_0005644 3300048919 Bacteria 11518
826 Ga0496116_0010899 3300048919 Bacteria 7574
827 Ga0496116_0058508 3300048919 Bacteria 2512
828 Ga0496116_0060114 3300048919 Bacteria 2466
829 Ga0496116_0069692 3300048919 Bacteria 2235
830 Ga0496117_0000024 3300048920 Bacteria 418750
831 Ga0496117_0000151 3300048920 Bacteria 148304
832 Ga0496117_0009752 3300048920 Bacteria 8860
833 Ga0496118_0000014 3300048921 Bacteria 561628
834 Ga0496118_0000016 3300048921 Bacteria 549586
835 Ga0496118_0012449 3300048921 Bacteria 8164
836 Ga0496118_0058135 3300048921 Bacteria 2892
837 Ga0496118_0075382 3300048921 Bacteria 2406
838 Ga0496119_0002124 3300048922 Bacteria 22306
839 Ga0496119_0002302 3300048922 Bacteria 21116
840 Ga0496119_0006967 3300048922 Bacteria 10310
841 Ga0496119_0033719 3300048922 Bacteria 3388
842 Ga0496119_0042107 3300048922 Bacteria 2899
843 Ga0496119_0085815 3300048922 Bacteria 1801
844 Ga0496120_0004180 3300048923 Bacteria 12366
845 Ga0496120_0024323 3300048923 Bacteria 3778
846 Ga0496121_0001243 3300048924 Bacteria 44207
847 Ga0496121_0003216 3300048924 Bacteria 23498
848 Ga0496121_0004468 3300048924 Bacteria 18789
849 Ga0496121_0012476 3300048924 Bacteria 9256
850 Ga0496121_0048466 3300048924 Bacteria 3614
851 Ga0496121_0178453 3300048924 Bacteria 1535
852 Ga0496121_0212988 3300048924 Bacteria 1367
853 Ga0496122_0001381 3300048925 Bacteria 39387
854 Ga0496122_0026283 3300048925 Bacteria 5023
855 Ga0496122_0085209 3300048925 Bacteria 2181
856 Ga0496123_0000411 3300048926 Bacteria 78453
857 Ga0496123_0009295 3300048926 Bacteria 8871
858 Ga0496123_0046633 3300048926 Bacteria 2937
859 Ga0496124_0018504 3300048927 Bacteria 6521
860 Ga0496124_0023398 3300048927 Bacteria 5639
861 Ga0496124_0035173 3300048927 Bacteria 4385
862 Ga0496124_0050643 3300048927 Bacteria 3537
863 Ga0496124_0093302 3300048927 Bacteria 2450
864 Ga0496124_0094739 3300048927 Bacteria 2427
865 Ga0496125_0000011 3300048928 Bacteria 655895
866 Ga0496125_0000759 3300048928 Bacteria 52858
867 Ga0496125_0004038 3300048928 Bacteria 17205
868 Ga0496125_0018493 3300048928 Bacteria 6618
869 Ga0496125_0026580 3300048928 Bacteria 5269
870 Ga0496125_0089405 3300048928 Bacteria 2316
871 Ga0496126_0002263 3300048929 Bacteria 26552
872 Ga0496126_0007137 3300048929 Bacteria 12300
873 Ga0496126_0007197 3300048929 Bacteria 12245
874 Ga0496126_0100825 3300048929 Bacteria 2526
875 Ga0496126_0141282 3300048929 Bacteria 2072
876 Ga0496126_0160733 3300048929 Bacteria 1919
877 Ga0501031_0007394 3300049568 Bacteria 7155
878 Ga0501031_0032142 3300049568 Bacteria 3422
879 Ga0501031_0237618 3300049568 Bacteria 1185
880 Ga0501032_0009798 3300049569 Bacteria 6930
881 Ga0501032_0142906 3300049569 Bacteria 1576
882 Ga0501032_0162978 3300049569 Bacteria 1464
883 Ga0501033_0013025 3300049570 Bacteria 6342
884 Ga0501033_0031947 3300049570 Bacteria 3952
885 Ga0501033_0042219 3300049570 Bacteria 3401
886 Ga0501034_0046397 3300049571 Bacteria 4390
887 Ga0501034_0069339 3300049571 Bacteria 3537
888 Ga0501034_0104026 3300049571 Bacteria 2833
889 Ga0501034_0381963 3300049571 Bacteria 1333
890 Ga0501034_0452822 3300049571 Bacteria 1201
891 Ga0501034_0614967 3300049571 Bacteria 991
892 Ga0501036_0005940 3300049572 Bacteria 9890
893 Ga0501036_0011396 3300049572 Bacteria 7358
894 Ga0501036_0055798 3300049572 Bacteria 3347
895 Ga0501036_0203441 3300049572 Bacteria 1665
896 Ga0501036_0228880 3300049572 Bacteria 1560
897 Ga0501036_0549238 3300049572 Bacteria 960
898 Ga0501037_0136019 3300049573 Bacteria 1760
899 Ga0501037_0164579 3300049573 Bacteria 1580
900 Ga0501038_0003978 3300049574 Bacteria 13728
901 Ga0501038_0016537 3300049574 Bacteria 6687
902 Ga0501039_0004768 3300049575 Bacteria 10273
903 Ga0501039_0022208 3300049575 Bacteria 4871
904 Ga0501039_0111822 3300049575 Bacteria 2135
905 Ga0501039_0156225 3300049575 Bacteria 1792
906 Ga0501039_0163526 3300049575 Bacteria 1750
907 Ga0501039_0227798 3300049575 Bacteria 1465
908 Ga0501039_0243079 3300049575 Bacteria 1415
909 Ga0501040_0002910 3300049576 Bacteria 11068
910 Ga0501040_0003703 3300049576 Bacteria 9907
911 Ga0501040_0013219 3300049576 Bacteria 5428
912 Ga0501040_0052937 3300049576 Bacteria 2779
913 Ga0501040_0063824 3300049576 Bacteria 2535
914 Ga0501041_0003207 3300049577 Bacteria 9402
915 Ga0501041_0012828 3300049577 Bacteria 4965
916 Ga0501041_0028170 3300049577 Bacteria 3388
917 Ga0501041_0054412 3300049577 Bacteria 2441
918 Ga0501041_0063869 3300049577 Bacteria 2254
919 Ga0501041_0188152 3300049577 Bacteria 1293
920 Ga0501042_0004113 3300049578 Bacteria 9244
921 Ga0501042_0034453 3300049578 Bacteria 3591
922 Ga0501042_0336441 3300049578 Bacteria 1091
923 Ga0501042_0414320 3300049578 Bacteria 976
924 Ga0501043_0052903 3300049579 Bacteria 3189
925 Ga0501046_0006343 3300049580 Bacteria 10483
926 Ga0501046_0006557 3300049580 Bacteria 10291
927 Ga0501046_0045310 3300049580 Bacteria 3495
928 Ga0501046_0104778 3300049580 Bacteria 2167
929 Ga0501046_0259384 3300049580 Bacteria 1277
930 Ga0501047_0208082 3300049581 Bacteria 1816
931 Ga0501048_0009506 3300049582 Bacteria 7297
932 Ga0501048_0018079 3300049582 Bacteria 5188
933 Ga0501048_0033976 3300049582 Bacteria 3682
934 Ga0501048_0133298 3300049582 Bacteria 1756
935 Ga0501048_0145338 3300049582 Bacteria 1677
936 Ga0501048_0146861 3300049582 Bacteria 1668
937 Ga0501048_0223769 3300049582 Bacteria 1335
938 Ga0501067_0022940 3300049583 Bacteria 3456
939 Ga0501067_0046289 3300049583 Bacteria 2414
940 Ga0501068_0029402 3300049584 Bacteria 3253
941 Ga0501068_0129211 3300049584 Bacteria 1579
942 Ga0501070_0000446 3300049586 Bacteria 37561
943 Ga0501070_0101758 3300049586 Bacteria 2376
944 Ga0501071_0013254 3300049587 Bacteria 5617
945 Ga0501071_0022554 3300049587 Bacteria 4389
946 Ga0501071_0101123 3300049587 Bacteria 2125
947 Ga0501072_0001734 3300049588 Bacteria 16263
948 Ga0501072_0006537 3300049588 Bacteria 8880
949 Ga0501072_0049910 3300049588 Bacteria 3294
950 Ga0501072_0087339 3300049588 Bacteria 2475
951 Ga0501072_0139668 3300049588 Bacteria 1931
952 Ga0501073_0009718 3300049589 Bacteria 7084
953 Ga0501073_0009857 3300049589 Bacteria 7028
954 Ga0501073_0014697 3300049589 Bacteria 5687
955 Ga0501073_0040143 3300049589 Bacteria 3314
956 Ga0501073_0092776 3300049589 Bacteria 2098
957 Ga0501073_0114580 3300049589 Bacteria 1869
958 Ga0501074_0024862 3300049590 Bacteria 4351
959 Ga0501074_0032787 3300049590 Bacteria 3763
960 Ga0501074_0063689 3300049590 Bacteria 2656
961 Ga0501074_0116847 3300049590 Bacteria 1908
962 Ga0501074_0159872 3300049590 Bacteria 1609
963 Ga0501075_0000282 3300049591 Bacteria 28099
964 Ga0501075_0003838 3300049591 Bacteria 10118
965 Ga0501075_0011522 3300049591 Bacteria 6258
966 Ga0501075_0015902 3300049591 Bacteria 5411
967 Ga0501075_0052844 3300049591 Bacteria 3055
968 Ga0501075_0247864 3300049591 Bacteria 1358
969 Ga0501075_0314420 3300049591 Bacteria 1193
970 Ga0501076_0000955 3300049592 Bacteria 18891
971 Ga0501076_0002461 3300049592 Bacteria 12726
972 Ga0501076_0020250 3300049592 Bacteria 5090
973 Ga0501076_0027639 3300049592 Bacteria 4399
974 Ga0501076_0039830 3300049592 Bacteria 3690
975 Ga0501076_0050402 3300049592 Bacteria 3293
976 Ga0501076_0346084 3300049592 Bacteria 1220
977 Ga0501076_0445338 3300049592 Bacteria 1066
978 Ga0501076_0447718 3300049592 Bacteria 1063
979 Ga0501077_0006923 3300049593 Bacteria 6980
980 Ga0501077_0007715 3300049593 Bacteria 6642
981 Ga0501077_0024697 3300049593 Bacteria 3816
982 Ga0501077_0039617 3300049593 Bacteria 3002
983 Ga0501252_000719 3300049682 Bacteria 2722
984 Ga0501079_0001340 3300049741 Bacteria 17314
985 Ga0501079_0002370 3300049741 Bacteria 13690
986 Ga0501079_0024982 3300049741 Bacteria 4583
987 Ga0501079_0215105 3300049741 Bacteria 1501
988 Ga0501079_0229806 3300049741 Bacteria 1449
989 Ga0501079_0350794 3300049741 Bacteria 1156
990 Ga0501080_0001574 3300049742 Bacteria 19318
991 Ga0501080_0002465 3300049742 Bacteria 16197
992 Ga0501080_0016499 3300049742 Bacteria 6822
993 Ga0501080_0055485 3300049742 Bacteria 3690
994 Ga0501080_0076684 3300049742 Bacteria 3108
995 Ga0501080_0542777 3300049742 Bacteria 1036
996 Ga0501080_0632172 3300049742 Bacteria 948
997 Ga0501081_0000147 3300049743 Bacteria 32041
998 Ga0501081_0000552 3300049743 Bacteria 21253
999 Ga0501081_0002949 3300049743 Bacteria 10798
1000 Ga0501081_0011022 3300049743 Bacteria 5911
1001 Ga0501081_0028375 3300049743 Bacteria 3777
1002 Ga0501081_0081301 3300049743 Bacteria 2269
1003 Ga0501081_0086496 3300049743 Bacteria 2201
1004 Ga0501081_0274222 3300049743 Bacteria 1234
1005 Ga0501083_0016930 3300049744 Bacteria 5092
1006 Ga0501083_0118144 3300049744 Bacteria 1740
1007 Ga0501035_0036281 3300049822 Bacteria 4469
1008 Ga0501035_0095305 3300049822 Bacteria 2616
1009 Ga0501044_0106227 3300049823 Bacteria 2820
1010 Ga0501044_0169055 3300049823 Bacteria 2159
1011 Ga0501044_0381748 3300049823 Bacteria 1324
1012 Ga0501045_0000401 3300049824 Bacteria 26284
1013 Ga0501045_0004402 3300049824 Bacteria 9717
1014 Ga0501045_0124199 3300049824 Bacteria 1917
1015 Ga0501045_0135301 3300049824 Bacteria 1832
1016 Ga0501045_0143311 3300049824 Bacteria 1777
1017 nmdc:mga00v17_31397_c1 3300050491 Bacteria 3132
1018 nmdc:mga0k408_139525_c1 3300050493 Bacteria 1441
1019 nmdc:mga04h51_53784_c1 3300050495 Bacteria 1359
1020 nmdc:mga05p37_150028_c1 3300050507 Bacteria 2852
1021 nmdc:mga05p37_248800_c1 3300050507 Bacteria 2133
1022 nmdc:mga05p37_416528_c1 3300050507 Bacteria 1564
1023 nmdc:mga05p37_98508_c1 3300050507 Bacteria 3601
1024 nmdc:mga09592_242121_c1 3300050508 Bacteria 1563
1025 nmdc:mga0qj67_275984_c1 3300050509 Bacteria 1363
1026 nmdc:mga0qj67_38204_c1 3300050509 Bacteria 3766
1027 nmdc:mga06r32_228616_c1 3300050510 Bacteria 1848
1028 nmdc:mga06r32_32508_c1 3300050510 Bacteria 4910
1029 nmdc:mga06r32_33913_c1 3300050510 Bacteria 4811
1030 nmdc:mga06r32_355355_c1 3300050510 Bacteria 1450
1031 nmdc:mga06r32_40748_c1 3300050510 Bacteria 4410
1032 nmdc:mga06r32_438315_c1 3300050510 Bacteria 1287
1033 nmdc:mga06r32_441986_c1 3300050510 Bacteria 1281
1034 nmdc:mga08y16_213141_c1 3300050511 Bacteria 2000
1035 nmdc:mga08y16_229475_c1 3300050511 Bacteria 1920
1036 nmdc:mga08y16_230019_c1 3300050511 Bacteria 1918
1037 nmdc:mga08y16_293748_c1 3300050511 Bacteria 1675
1038 nmdc:mga08y16_35895_c1 3300050511 Bacteria 5207
1039 nmdc:mga08y16_5377_c2 3300050511 Bacteria 8083
1040 nmdc:mga0n895_1121_c1 3300050512 Bacteria 19562
1041 nmdc:mga0n895_188290_c1 3300050512 Bacteria 2095
1042 nmdc:mga0n895_231741_c1 3300050512 Bacteria 1874
1043 nmdc:mga0n895_260567_c1 3300050512 Bacteria 1759
1044 nmdc:mga0rr50_66501_c1 3300050513 Bacteria 2735
1045 nmdc:mga0rr50_80020_c1 3300050513 Bacteria 2518
1046 nmdc:mga08x19_14319_c1 3300050514 Bacteria 4811
1047 nmdc:mga0a205_110653_c1 3300050515 Bacteria 2646
1048 nmdc:mga0a205_2501_c1 3300050515 Bacteria 16205
1049 nmdc:mga0a205_574656_c1 3300050515 Bacteria 981
1050 nmdc:mga0sz30_185927_c1 3300050516 Bacteria 922
1051 Ga0495601_0008393 3300053077 Bacteria 6100
1052 Ga0495612_0001142 3300053078 Bacteria 10900
1053 Ga0495612_0143477 3300053078 Bacteria 1037
1054 Ga0495595_0007709 3300053084 Bacteria 4410
1055 Ga0495619_0011851 3300053085 Bacteria 5491
1056 Ga0495619_0050966 3300053085 Bacteria 2734
1057 Ga0495619_0405238 3300053085 Bacteria 941
1058 Ga0500646_0070609 3300053090 Bacteria 1047
1059 Ga0500583_0015825 3300053092 Bacteria 2996
1060 Ga0500583_0054104 3300053092 Bacteria 1873
1061 Ga0500641_0003000 3300053096 Bacteria 5976
1062 Ga0500650_0000025 3300053098 Bacteria 60928
1063 Ga0500555_002546 3300053103 Bacteria 5256
1064 Ga0500556_0001581 3300053104 Bacteria 9146
1065 Ga0500562_018905 3300053108 Bacteria 1780
1066 Ga0500591_070332 3300053115 Bacteria 1587
1067 Ga0500617_039365 3300053124 Bacteria 2117
1068 Ga0500618_020687 3300053125 Bacteria 1610
1069 Ga0500559_0031324 3300053136 Bacteria 2281
1070 Ga0500559_0108184 3300053136 Bacteria 1286
1071 Ga0500573_0069269 3300053140 Bacteria 2013
1072 Ga0500588_0018376 3300053146 Bacteria 1840
1073 Ga0500616_0000073 3300053153 Bacteria 231290
1074 Ga0500616_0034535 3300053153 Bacteria 2754
1075 Ga0500616_0047796 3300053153 Bacteria 2271
1076 Ga0500616_0101867 3300053153 Bacteria 1402
1077 Ga0500622_0007236 3300053156 Bacteria 6320
1078 Ga0500634_0000026 3300053161 Bacteria 81353
1079 Ga0500639_083294 3300053163 Bacteria 1608
1080 Ga0501084_0002063 3300054114 Bacteria 16034
1081 Ga0501084_0003463 3300054114 Bacteria 12814
1082 Ga0501084_0011958 3300054114 Bacteria 7187
1083 Ga0501084_0013640 3300054114 Bacteria 6726
1084 Ga0501084_0014584 3300054114 Bacteria 6516
1085 Ga0501084_0119333 3300054114 Bacteria 2217
1086 Ga0501084_0157325 3300054114 Bacteria 1917
1087 Ga0501084_0209771 3300054114 Bacteria 1644
1088 Ga0501084_0463514 3300054114 Bacteria 1071
1089 Ga0501082_0002075 3300060353 Bacteria 17636
1090 Ga0501082_0004888 3300060353 Bacteria 11690
1091 Ga0501082_0012280 3300060353 Bacteria 7360
1092 Ga0501082_0013531 3300060353 Bacteria 7010
1093 Ga0501082_0032198 3300060353 Bacteria 4521
1094 Ga0501082_0039470 3300060353 Bacteria 4072
1095 Ga0501082_0052077 3300060353 Bacteria 3528
1096 Ga0501082_0103899 3300060353 Bacteria 2458
1097 Ga0501082_0308386 3300060353 Bacteria 1378
1098 Ga0501082_0309888 3300060353 Bacteria 1375
1099 Ga0501082_0422603 3300060353 Bacteria 1164
1100 Ga0466962_0007564 3300061719 Bacteria 5212
1101 Ga0530510_0012468 3300061734 Bacteria 5971
1102 Ga0530510_0021387 3300061734 Bacteria 4602
1103 Ga0530510_0046245 3300061734 Bacteria 3144
1104 Ga0530510_0248105 3300061734 Bacteria 1326

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009093 Ga0105240_10019489 Ga0105240_100194892 196
2 3300009545 Ga0105237_10039226 Ga0105237_100392263 196
3 3300005335 Ga0070666_10211953 Ga0070666_102119532 208
4 3300005367 Ga0070667_100061427 Ga0070667_1000614272 208
5 3300005617 Ga0068859_100030044 Ga0068859_1000300444 208
6 3300005841 Ga0068863_100248581 Ga0068863_1002485811 208
7 3300006931 Ga0097620_100030045 Ga0097620_1000300453 208
8 3300014968 Ga0157379_10056900 Ga0157379_100569002 208
9 3300025903 Ga0207680_10087713 Ga0207680_100877132 208
10 3300025961 Ga0207712_10059202 Ga0207712_100592022 208
11 3300025986 Ga0207658_10349464 Ga0207658_103494641 208
12 3300026088 Ga0207641_10439271 Ga0207641_104392711 208
13 3300028381 Ga0268264_10012089 Ga0268264_100120895 208
14 3300025913 Ga0207695_10091079 Ga0207695_100910792 209
15 3300025914 Ga0207671_10039105 Ga0207671_100391053 209
16 3300025949 Ga0207667_10006777 Ga0207667_100067778 209
17 3300047443 Ga0495687_033524 Ga0495687_033524_25_831 211
18 3300035724 Ga0373933_0103066 Ga0373933_0103066_17_781 213
19 3300005434 Ga0070709_10085941 Ga0070709_100859412 214
20 3300035170 Ga0373943_0042003 Ga0373943_0042003_53_877 214
21 3300037068 Ga0373925_0090259 Ga0373925_0090259_1150_1974 214
22 3300044656 Ga0466969_0019932 Ga0466969_0019932_938_1744 214
23 3300044706 Ga0466964_0025831 Ga0466964_0025831_56_862 214
24 3300044765 Ga0466970_0042029 Ga0466970_0042029_149_955 214
25 3300045049 Ga0466959_0051682 Ga0466959_0051682_1708_2514 214
26 3300047315 Ga0495581_0334930 Ga0495581_0334930_34_858 214
27 3300005436 Ga0070713_100049136 Ga0070713_1000491363 215
28 3300025928 Ga0207700_10067505 Ga0207700_100675053 215
29 3300036401 Ga0373937_0012692 Ga0373937_0012692_4782_5606 215
30 3300046462 Ga0495651_0031101 Ga0495651_0031101_2004_2828 215
31 3300046477 Ga0495664_0000789 Ga0495664_0000789_2092_2916 215
32 3300046511 Ga0495608_0013950 Ga0495608_0013950_2907_3731 215
33 3300046516 Ga0495628_0133199 Ga0495628_0133199_382_1206 215
34 3300046533 Ga0495640_0069265 Ga0495640_0069265_113_937 215
35 3300046536 Ga0495587_0020619 Ga0495587_0020619_524_1348 215
36 3300046543 Ga0495645_0185966 Ga0495645_0185966_521_1345 215
37 3300046663 Ga0495635_0019280 Ga0495635_0019280_1131_1955 215
38 3300046675 Ga0495657_0031496 Ga0495657_0031496_1147_1971 215
39 3300046678 Ga0495599_0011784 Ga0495599_0011784_2563_3387 215
40 3300046680 Ga0495646_0006351 Ga0495646_0006351_6166_6990 215
41 3300047317 Ga0495604_0047733 Ga0495604_0047733_563_1387 215
42 3300047319 Ga0495674_0045561 Ga0495674_0045561_662_1486 215
43 3300047322 Ga0495680_0154836 Ga0495680_0154836_565_1389 215
44 3300047444 Ga0495675_0016707 Ga0495675_0016707_2857_3681 215
45 3300047471 Ga0495684_0032940 Ga0495684_0032940_803_1627 215
46 3300048088 Ga0495602_0000230 Ga0495602_0000230_23450_24274 215
47 3300053078 Ga0495612_0001142 Ga0495612_0001142_6419_7243 215
48 3300053084 Ga0495595_0007709 Ga0495595_0007709_3384_4208 215
49 3300053085 Ga0495619_0405238 Ga0495619_0405238_92_916 215
50 3300035111 Ga0373923_0113682 Ga0373923_0113682_196_1020 217
51 3300035119 Ga0373956_0042636 Ga0373956_0042636_770_1594 217
52 3300035724 Ga0373933_0003783 Ga0373933_0003783_2031_2855 217
53 3300036401 Ga0373937_0001734 Ga0373937_0001734_16513_17337 217
54 3300046559 Ga0495667_0042585 Ga0495667_0042585_1106_1930 217
55 3300048905 Ga0496102_0355179 Ga0496102_0355179_250_1098 217
56 3300053096 Ga0500641_0003000 Ga0500641_0003000_295_1041 217
57 3300025914 Ga0207671_10111889 Ga0207671_101118892 219
58 3300046454 Ga0495592_0070764 Ga0495592_0070764_177_1001 220
59 3300005367 Ga0070667_100433309 Ga0070667_1004333092 221
60 3300049573 Ga0501037_0164579 Ga0501037_0164579_16_777 222
61 3300021388 Ga0213875_10093453 Ga0213875_100934531 223
62 3300025939 Ga0207665_10077250 Ga0207665_100772504 223
63 3300037853 Ga0436364_0676183 Ga0436364_0676183_302_1129 223
64 3300046473 Ga0495582_0363647 Ga0495582_0363647_37_822 223
65 3300049571 Ga0501034_0614967 Ga0501034_0614967_11_775 223
66 3300005335 Ga0070666_10500410 Ga0070666_105004101 224
67 3300005367 Ga0070667_100210335 Ga0070667_1002103352 224
68 3300005539 Ga0068853_100109331 Ga0068853_1001093312 224
69 3300005563 Ga0068855_100446602 Ga0068855_1004466021 224
70 3300005841 Ga0068863_100005032 Ga0068863_1000050326 224
71 3300005843 Ga0068860_100010729 Ga0068860_1000107292 224
72 3300009545 Ga0105237_10079543 Ga0105237_100795433 224
73 3300025914 Ga0207671_10033612 Ga0207671_100336123 224
74 3300025986 Ga0207658_10046985 Ga0207658_100469853 224
75 3300026041 Ga0207639_10182852 Ga0207639_101828522 224
76 3300026067 Ga0207678_10033497 Ga0207678_100334974 224
77 3300026088 Ga0207641_10000313 Ga0207641_1000031322 224
78 3300028381 Ga0268264_10004448 Ga0268264_100044483 224
79 3300048905 Ga0496102_0006952 Ga0496102_0006952_6451_7332 224
80 3300048906 Ga0496103_0103374 Ga0496103_0103374_896_1777 224
81 3300048919 Ga0496116_0069692 Ga0496116_0069692_1155_2036 224
82 3300048920 Ga0496117_0000024 Ga0496117_0000024_351974_352855 224
83 3300048921 Ga0496118_0000014 Ga0496118_0000014_66207_67088 224
84 3300048922 Ga0496119_0006967 Ga0496119_0006967_2273_3154 224
85 3300048923 Ga0496120_0024323 Ga0496120_0024323_564_1445 224
86 3300048924 Ga0496121_0012476 Ga0496121_0012476_310_1191 224
87 3300048927 Ga0496124_0035173 Ga0496124_0035173_2428_3309 224
88 3300048928 Ga0496125_0004038 Ga0496125_0004038_2111_2992 224
89 3300048929 Ga0496126_0160733 Ga0496126_0160733_762_1643 224
90 3300005458 Ga0070681_10103019 Ga0070681_101030193 225
91 3300013105 Ga0157369_10392959 Ga0157369_103929592 225
92 3300025912 Ga0207707_10091549 Ga0207707_100915493 225
93 3300039447 Ga0436361_1206202 Ga0436361_1206202_835_1590 225
94 3300049586 Ga0501070_0000446 Ga0501070_0000446_4606_5418 225
95 3300005355 Ga0070671_100022140 Ga0070671_1000221404 226
96 3300005367 Ga0070667_100027818 Ga0070667_1000278183 226
97 3300005548 Ga0070665_100274053 Ga0070665_1002740531 226
98 3300005617 Ga0068859_100002193 Ga0068859_1000021936 226
99 3300005842 Ga0068858_100001773 Ga0068858_10000177311 226
100 3300006931 Ga0097620_100002193 Ga0097620_10000219311 226
101 3300009101 Ga0105247_10002560 Ga0105247_100025602 226
102 3300009177 Ga0105248_10209038 Ga0105248_102090382 226
103 3300014325 Ga0163163_10008179 Ga0163163_100081793 226
104 3300014968 Ga0157379_10002677 Ga0157379_100026779 226
105 3300025900 Ga0207710_10001255 Ga0207710_100012552 226
106 3300025931 Ga0207644_10001224 Ga0207644_100012245 226
107 3300025941 Ga0207711_10191619 Ga0207711_101916192 226
108 3300025986 Ga0207658_10017695 Ga0207658_100176952 226
109 3300026088 Ga0207641_10005318 Ga0207641_100053188 226
110 3300031241 Ga0265325_10033917 Ga0265325_100339173 226
111 3300048912 Ga0496109_0542097 Ga0496109_0542097_204_1052 226
112 3300048924 Ga0496121_0001243 Ga0496121_0001243_10136_10984 226
113 3300003322 rootL2_10278328 rootL2_102783281 227
114 3300028380 Ga0268265_10099057 Ga0268265_100990572 227
115 3300031247 Ga0265340_10068994 Ga0265340_100689943 227
116 3300031249 Ga0265339_10126512 Ga0265339_101265122 227
117 3300031712 Ga0265342_10035713 Ga0265342_100357132 227
118 3300044694 Ga0466963_0219371 Ga0466963_0219371_43_867 227
119 3300046459 Ga0495629_0151636 Ga0495629_0151636_461_1282 227
120 3300025929 Ga0207664_10043496 Ga0207664_100434962 228
121 3300031727 Ga0316576_10205853 Ga0316576_102058531 228
122 3300035398 Ga0316574_0293659 Ga0316574_0293659_216_1022 228
123 3300037466 Ga0395898_0020339 Ga0395898_0020339_2932_3780 228
124 3300053108 Ga0500562_018905 Ga0500562_018905_73_855 228
125 3300031649 Ga0307514_10145144 Ga0307514_101451442 229
126 3300037853 Ga0436364_0745335 Ga0436364_0745335_928_1725 229
127 3300009177 Ga0105248_10482361 Ga0105248_104823611 230
128 3300010159 Ga0099796_10047809 Ga0099796_100478092 230
129 3300039438 Ga0436360_0638300 Ga0436360_0638300_182_955 230
130 3300025916 Ga0207663_10219841 Ga0207663_102198412 231
131 3300049589 Ga0501073_0092776 Ga0501073_0092776_679_1497 231
132 3300006846 Ga0075430_100003646 Ga0075430_10000364612 232
133 3300006847 Ga0075431_100008804 Ga0075431_1000088048 232
134 3300050509 nmdc:mga0qj67_275984_c1 nmdc:mga0qj67_275984_c1_463_1302 232
135 3300005937 Ga0081455_10022056 Ga0081455_100220566 233
136 3300009147 Ga0114129_10079019 Ga0114129_100790194 233
137 3300009147 Ga0114129_10157357 Ga0114129_101573572 233
138 3300014968 Ga0157379_10628382 Ga0157379_106283822 233
139 3300036401 Ga0373937_0034493 Ga0373937_0034493_1399_2181 233
140 3300046454 Ga0495592_0082570 Ga0495592_0082570_1237_2019 233
141 3300046516 Ga0495628_0138051 Ga0495628_0138051_732_1514 233
142 3300046559 Ga0495667_0013353 Ga0495667_0013353_304_1086 233
143 3300046663 Ga0495635_0268862 Ga0495635_0268862_203_985 233
144 3300046809 Ga0495600_0055760 Ga0495600_0055760_375_1157 233
145 3300047322 Ga0495680_0065698 Ga0495680_0065698_1704_2486 233
146 3300049583 Ga0501067_0046289 Ga0501067_0046289_640_1416 233
147 3300049589 Ga0501073_0009718 Ga0501073_0009718_4601_5377 233
148 3300049593 Ga0501077_0039617 Ga0501077_0039617_1061_1837 233
149 3300049742 Ga0501080_0076684 Ga0501080_0076684_1500_2276 233
150 3300050507 nmdc:mga05p37_150028_c1 nmdc:mga05p37_150028_c1_55_894 233
151 3300050507 nmdc:mga05p37_248800_c1 nmdc:mga05p37_248800_c1_204_1043 233
152 3300053077 Ga0495601_0008393 Ga0495601_0008393_3519_4301 233
153 3300053136 Ga0500559_0031324 Ga0500559_0031324_1187_2035 233
154 3300054114 Ga0501084_0014584 Ga0501084_0014584_4999_5775 233
155 3300060353 Ga0501082_0052077 Ga0501082_0052077_482_1258 233
156 3300039453 Ga0436362_0776327 Ga0436362_0776327_686_1483 234
157 iso_pu_bacteria 2842775625 2842775765 234
158 3300014968 Ga0157379_10252200 Ga0157379_102522002 235
159 3300044684 Ga0466966_0082288 Ga0466966_0082288_491_1297 235
160 3300046694 Ga0495649_0152153 Ga0495649_0152153_38_847 235
161 3300048912 Ga0496109_0326771 Ga0496109_0326771_414_1253 235
162 iso_pu_bacteria 2728369276 2729908184 235
163 3300005539 Ga0068853_100452398 Ga0068853_1004523982 236
164 3300006175 Ga0070712_100332292 Ga0070712_1003322922 236
165 3300007076 Ga0075435_100425553 Ga0075435_1004255532 236
166 3300035398 Ga0316574_0025571 Ga0316574_0025571_119_922 236
167 3300036712 Ga0316584_0004710 Ga0316584_0004710_5608_6411 236
168 3300005338 Ga0068868_100522536 Ga0068868_1005225361 237
169 3300005444 Ga0070694_100448572 Ga0070694_1004485721 237
170 3300005530 Ga0070679_100123644 Ga0070679_1001236443 237
171 3300009094 Ga0111539_10042495 Ga0111539_100424952 237
172 3300031241 Ga0265325_10028726 Ga0265325_100287262 237
173 3300031247 Ga0265340_10119807 Ga0265340_101198072 237
174 3300031249 Ga0265339_10123897 Ga0265339_101238972 237
175 3300031250 Ga0265331_10108780 Ga0265331_101087802 237
176 3300031595 Ga0265313_10033559 Ga0265313_100335592 237
177 3300031711 Ga0265314_10093275 Ga0265314_100932752 237
178 3300031712 Ga0265342_10077743 Ga0265342_100777432 237
179 3300042184 Ga0450908_007495 Ga0450908_007495_24_830 237
180 3300046460 Ga0495638_0023670 Ga0495638_0023670_721_1560 237
181 3300048905 Ga0496102_0508558 Ga0496102_0508558_276_1115 237
182 3300009093 Ga0105240_10002127 Ga0105240_100021276 238
183 3300009094 Ga0111539_10119806 Ga0111539_101198062 238
184 3300013307 Ga0157372_10058628 Ga0157372_100586283 238
185 3300014326 Ga0157380_10313909 Ga0157380_103139092 238
186 3300014745 Ga0157377_10096682 Ga0157377_100966822 238
187 3300039438 Ga0436360_0392412 Ga0436360_0392412_3265_4056 238
188 3300042125 Ga0450923_004500 Ga0450923_004500_349_1140 238
189 3300042133 Ga0450896_007483 Ga0450896_007483_89_880 238
190 3300042147 Ga0450910_004879 Ga0450910_004879_999_1808 238
191 3300042437 Ga0439444_0002496 Ga0439444_0002496_646_1437 238
192 3300042461 Ga0439460_0055323 Ga0439460_0055323_385_1176 238
193 3300049572 Ga0501036_0549238 Ga0501036_0549238_144_935 238
194 3300049578 Ga0501042_0336441 Ga0501042_0336441_227_1036 238
195 3300049582 Ga0501048_0146861 Ga0501048_0146861_494_1285 238
196 3300049823 Ga0501044_0106227 Ga0501044_0106227_78_920 238
197 3300050511 nmdc:mga08y16_229475_c1 nmdc:mga08y16_229475_c1_580_1371 238
198 3300050512 nmdc:mga0n895_188290_c1 nmdc:mga0n895_188290_c1_87_896 238
199 3300050513 nmdc:mga0rr50_66501_c1 nmdc:mga0rr50_66501_c1_247_1056 238
200 3300050515 nmdc:mga0a205_110653_c1 nmdc:mga0a205_110653_c1_1514_2323 238
201 3300054114 Ga0501084_0157325 Ga0501084_0157325_88_930 238
202 3300041456 Ga0451795_1220757 Ga0451795_1220757_22_882 239
203 3300049569 Ga0501032_0162978 Ga0501032_0162978_351_1163 239
204 3300049570 Ga0501033_0042219 Ga0501033_0042219_2365_3177 239
205 3300049572 Ga0501036_0228880 Ga0501036_0228880_47_859 239
206 3300049575 Ga0501039_0163526 Ga0501039_0163526_778_1590 239
207 3300049576 Ga0501040_0013219 Ga0501040_0013219_21_833 239
208 3300049577 Ga0501041_0054412 Ga0501041_0054412_537_1349 239
209 3300049578 Ga0501042_0034453 Ga0501042_0034453_2256_3068 239
210 3300049580 Ga0501046_0045310 Ga0501046_0045310_375_1187 239
211 3300049590 Ga0501074_0032787 Ga0501074_0032787_1310_2122 239
212 3300049591 Ga0501075_0003838 Ga0501075_0003838_8125_8937 239
213 3300049593 Ga0501077_0024697 Ga0501077_0024697_1000_1812 239
214 3300049741 Ga0501079_0024982 Ga0501079_0024982_1967_2779 239
215 3300049743 Ga0501081_0011022 Ga0501081_0011022_3231_4043 239
216 3300049744 Ga0501083_0118144 Ga0501083_0118144_265_1077 239
217 3300054114 Ga0501084_0002063 Ga0501084_0002063_1637_2449 239
218 3300060353 Ga0501082_0012280 Ga0501082_0012280_4728_5540 239
219 3300061734 Ga0530510_0021387 Ga0530510_0021387_2060_2872 239
220 iso_pu_bacteria 2643221629 2644165078 239
221 iso_pu_bacteria 2643221662 2644345653 239
222 3300003323 rootH1_10300231 rootH1_103002312 240
223 3300003760 Ga0055527_1000005 Ga0055527_1000005246 240
224 3300003762 Ga0055542_1000006 Ga0055542_1000006246 240
225 3300003763 Ga0055529_1000013 Ga0055529_1000013155 240
226 3300005457 Ga0070662_100538669 Ga0070662_1005386692 240
227 3300005937 Ga0081455_10286575 Ga0081455_102865752 240
228 3300009177 Ga0105248_10215252 Ga0105248_102152522 240
229 3300013105 Ga0157369_10358490 Ga0157369_103584902 240
230 3300014326 Ga0157380_10318476 Ga0157380_103184762 240
231 3300025228 Ga0209672_100003 Ga0209672_100003590 240
232 3300025229 Ga0209147_100509 Ga0209147_1005095 240
233 3300025242 Ga0209258_106134 Ga0209258_1061342 240
234 3300025254 Ga0209148_1000004 Ga0209148_1000004885 240
235 3300025272 Ga0209455_1000022 Ga0209455_100002298 240
236 3300031616 Ga0307508_10227050 Ga0307508_102270502 240
237 3300053136 Ga0500559_0108184 Ga0500559_0108184_443_1252 240
238 3300053140 Ga0500573_0069269 Ga0500573_0069269_814_1620 240
239 iso_pu_bacteria 2599185292 2599906106 240
240 iso_pu_bacteria 2643221569 2643861890 240
241 iso_pu_bacteria 2643221594 2643979946 240
242 iso_pu_bacteria 2643221621 2644122541 240
243 iso_pu_bacteria 2808606395 2809031607 240
244 iso_pu_bacteria 2857537821 2857540863 240
245 iso_pu_bacteria 2858950400 2858956415 240
246 iso_pu_bacteria 2941479691 2941485815 240
247 iso_pu_bacteria 3000405567 3000407782 240
248 3300013102 Ga0157371_10214250 Ga0157371_102142502 241
249 3300013105 Ga0157369_10091788 Ga0157369_100917882 241
250 3300021441 Ga0213871_10030523 Ga0213871_100305232 241
251 3300025292 Ga0209676_1003691 Ga0209676_10036915 241
252 3300025298 Ga0209050_1004720 Ga0209050_10047209 241
253 3300025303 Ga0209051_1007044 Ga0209051_10070445 241
254 3300025904 Ga0207647_10017113 Ga0207647_100171132 241
255 3300031911 Ga0307412_10000918 Ga0307412_1000091810 241
256 3300039438 Ga0436360_1301488 Ga0436360_1301488_687_1484 241
257 3300048904 Ga0496101_0112452 Ga0496101_0112452_1057_1989 241
258 3300048908 Ga0496105_0180782 Ga0496105_0180782_414_1223 241
259 3300048915 Ga0496112_0078126 Ga0496112_0078126_1322_2263 241
260 3300048919 Ga0496116_0005644 Ga0496116_0005644_2707_3516 241
261 3300048919 Ga0496116_0058508 Ga0496116_0058508_1085_1894 241
262 3300048919 Ga0496116_0060114 Ga0496116_0060114_1092_2024 241
263 3300048920 Ga0496117_0009752 Ga0496117_0009752_361_1170 241
264 3300048921 Ga0496118_0012449 Ga0496118_0012449_2416_3225 241
265 3300048921 Ga0496118_0058135 Ga0496118_0058135_1161_2102 241
266 3300048921 Ga0496118_0075382 Ga0496118_0075382_370_1179 241
267 3300048922 Ga0496119_0002124 Ga0496119_0002124_11370_12179 241
268 3300048922 Ga0496119_0033719 Ga0496119_0033719_195_1004 241
269 3300048922 Ga0496119_0085815 Ga0496119_0085815_603_1544 241
270 3300048923 Ga0496120_0004180 Ga0496120_0004180_4279_5088 241
271 3300048924 Ga0496121_0004468 Ga0496121_0004468_10249_11058 241
272 3300048925 Ga0496122_0001381 Ga0496122_0001381_11034_11843 241
273 3300048925 Ga0496122_0026283 Ga0496122_0026283_3808_4617 241
274 3300048925 Ga0496122_0085209 Ga0496122_0085209_121_1053 241
275 3300048926 Ga0496123_0000411 Ga0496123_0000411_5530_6339 241
276 3300048926 Ga0496123_0009295 Ga0496123_0009295_483_1292 241
277 3300048926 Ga0496123_0046633 Ga0496123_0046633_1863_2795 241
278 3300048927 Ga0496124_0050643 Ga0496124_0050643_1164_1973 241
279 3300048927 Ga0496124_0093302 Ga0496124_0093302_1499_2308 241
280 3300048927 Ga0496124_0094739 Ga0496124_0094739_636_1445 241
281 3300048928 Ga0496125_0000011 Ga0496125_0000011_611578_612387 241
282 3300048928 Ga0496125_0026580 Ga0496125_0026580_1904_2713 241
283 3300048928 Ga0496125_0089405 Ga0496125_0089405_230_1039 241
284 3300048929 Ga0496126_0007137 Ga0496126_0007137_9246_10055 241
285 3300048929 Ga0496126_0100825 Ga0496126_0100825_1135_1944 241
286 3300060353 Ga0501082_0309888 Ga0501082_0309888_215_1066 241
287 iso_pu_bacteria 2524023250 2524612077 241
288 3300009036 Ga0105244_10000485 Ga0105244_1000048526 242
289 3300025728 Ga0207655_1000060 Ga0207655_1000060226 242
290 3300025735 Ga0207713_1007835 Ga0207713_10078356 242
291 3300027312 Ga0209371_1000215 Ga0209371_100021538 242
292 3300030500 Ga0268256_1000172 Ga0268256_100017237 242
293 3300031595 Ga0265313_10037843 Ga0265313_100378432 242
294 3300031691 Ga0316579_10022252 Ga0316579_100222523 242
295 3300031727 Ga0316576_10117867 Ga0316576_101178672 242
296 3300031727 Ga0316576_10399452 Ga0316576_103994522 242
297 3300031728 Ga0316578_10018257 Ga0316578_100182572 242
298 3300031728 Ga0316578_10249296 Ga0316578_102492962 242
299 3300031733 Ga0316577_10042335 Ga0316577_100423352 242
300 3300032139 Ga0316580_10012084 Ga0316580_100120842 242
301 3300032168 Ga0316593_10026050 Ga0316593_100260502 242
302 3300033524 Ga0316592_1031644 Ga0316592_10316442 242
303 3300033528 Ga0316588_1019297 Ga0316588_10192972 242
304 3300035398 Ga0316574_0028433 Ga0316574_0028433_2132_2938 242
305 3300036647 Ga0316582_0055960 Ga0316582_0055960_1278_2084 242
306 3300036712 Ga0316584_0044014 Ga0316584_0044014_724_1530 242
307 3300048903 Ga0496100_0209269 Ga0496100_0209269_104_964 242
308 3300053125 Ga0500618_020687 Ga0500618_020687_639_1460 242
309 iso_pu_bacteria 2511231221 2512035213 242
310 iso_pu_bacteria 2585427591 2585828224 242
311 iso_pu_bacteria 2585427592 2585833912 242
312 iso_pu_bacteria 2597490356 2599101100 242
313 iso_pu_bacteria 2846952575 2846954180 242
314 iso_pu_bacteria 2848858292 2848859655 242
315 iso_pu_bacteria 2904474040 2904478359 242
316 iso_pu_bacteria 2919150387 2919154614 242
317 iso_pu_bacteria 2927143783 2927148051 242
318 3300005339 Ga0070660_100052227 Ga0070660_1000522273 243
319 3300005339 Ga0070660_100360160 Ga0070660_1003601601 243
320 3300005339 Ga0070660_100451080 Ga0070660_1004510802 243
321 3300005344 Ga0070661_100000775 Ga0070661_10000077518 243
322 3300005434 Ga0070709_10091586 Ga0070709_100915861 243
323 3300005436 Ga0070713_100035644 Ga0070713_1000356444 243
324 3300005436 Ga0070713_100036136 Ga0070713_1000361364 243
325 3300005437 Ga0070710_10006217 Ga0070710_100062173 243
326 3300005439 Ga0070711_100054528 Ga0070711_1000545281 243
327 3300005439 Ga0070711_100259883 Ga0070711_1002598832 243
328 3300005455 Ga0070663_100065355 Ga0070663_1000653552 243
329 3300005539 Ga0068853_100006497 Ga0068853_1000064978 243
330 3300005539 Ga0068853_100083513 Ga0068853_1000835133 243
331 3300005547 Ga0070693_100281698 Ga0070693_1002816981 243
332 3300005548 Ga0070665_100464757 Ga0070665_1004647571 243
333 3300005563 Ga0068855_100176374 Ga0068855_1001763742 243
334 3300005563 Ga0068855_100236507 Ga0068855_1002365072 243
335 3300005563 Ga0068855_100307806 Ga0068855_1003078062 243
336 3300005577 Ga0068857_100261616 Ga0068857_1002616161 243
337 3300005578 Ga0068854_100018789 Ga0068854_1000187894 243
338 3300005614 Ga0068856_100145714 Ga0068856_1001457141 243
339 3300005616 Ga0068852_100112335 Ga0068852_1001123351 243
340 3300005616 Ga0068852_100505074 Ga0068852_1005050742 243
341 3300005834 Ga0068851_10006113 Ga0068851_100061135 243
342 3300005983 Ga0081540_1011922 Ga0081540_10119224 243
343 3300005985 Ga0081539_10000572 Ga0081539_1000057266 243
344 3300006028 Ga0070717_10008740 Ga0070717_100087401 243
345 3300006048 Ga0075363_100167385 Ga0075363_1001673852 243
346 3300006048 Ga0075363_100191462 Ga0075363_1001914622 243
347 3300006175 Ga0070712_100049035 Ga0070712_1000490353 243
348 3300006178 Ga0075367_10048990 Ga0075367_100489902 243
349 3300006178 Ga0075367_10125721 Ga0075367_101257212 243
350 3300006353 Ga0075370_10028886 Ga0075370_100288863 243
351 3300009093 Ga0105240_10166139 Ga0105240_101661392 243
352 3300009093 Ga0105240_10598508 Ga0105240_105985081 243
353 3300009098 Ga0105245_10346510 Ga0105245_103465101 243
354 3300009174 Ga0105241_10083942 Ga0105241_100839423 243
355 3300009545 Ga0105237_10074516 Ga0105237_100745161 243
356 3300009551 Ga0105238_10119147 Ga0105238_101191473 243
357 3300009551 Ga0105238_10122845 Ga0105238_101228452 243
358 3300010375 Ga0105239_10005592 Ga0105239_100055929 243
359 3300013296 Ga0157374_10057123 Ga0157374_100571231 243
360 3300021388 Ga0213875_10004869 Ga0213875_100048695 243
361 3300025321 Ga0207656_10032714 Ga0207656_100327141 243
362 3300025909 Ga0207705_10008147 Ga0207705_100081474 243
363 3300025909 Ga0207705_10211283 Ga0207705_102112832 243
364 3300025911 Ga0207654_10072903 Ga0207654_100729033 243
365 3300025913 Ga0207695_10127044 Ga0207695_101270441 243
366 3300025915 Ga0207693_10117336 Ga0207693_101173363 243
367 3300025916 Ga0207663_10099392 Ga0207663_100993923 243
368 3300025919 Ga0207657_10009568 Ga0207657_100095682 243
369 3300025919 Ga0207657_10408995 Ga0207657_104089952 243
370 3300025920 Ga0207649_10001165 Ga0207649_1000116510 243
371 3300025920 Ga0207649_10105728 Ga0207649_101057281 243
372 3300025927 Ga0207687_10242797 Ga0207687_102427972 243
373 3300025927 Ga0207687_10480576 Ga0207687_104805762 243
374 3300025928 Ga0207700_10238863 Ga0207700_102388632 243
375 3300025929 Ga0207664_10197896 Ga0207664_101978962 243
376 3300025949 Ga0207667_10179116 Ga0207667_101791161 243
377 3300025981 Ga0207640_10053272 Ga0207640_100532723 243
378 3300026041 Ga0207639_10004843 Ga0207639_100048438 243
379 3300026041 Ga0207639_10006241 Ga0207639_100062416 243
380 3300026067 Ga0207678_10085075 Ga0207678_100850753 243
381 3300026078 Ga0207702_10204640 Ga0207702_102046401 243
382 3300026116 Ga0207674_10195076 Ga0207674_101950763 243
383 3300026142 Ga0207698_10112794 Ga0207698_101127941 243
384 3300027665 Ga0209983_1007773 Ga0209983_10077732 243
385 3300032004 Ga0307414_10182422 Ga0307414_101824221 243
386 3300037853 Ga0436364_0509785 Ga0436364_0509785_2501_3316 243
387 3300037853 Ga0436364_0924171 Ga0436364_0924171_2195_2998 243
388 3300039437 Ga0436365_1466348 Ga0436365_1466348_1649_2461 243
389 3300048929 Ga0496126_0002263 Ga0496126_0002263_18149_18982 243
390 3300049568 Ga0501031_0007394 Ga0501031_0007394_2819_3619 243
391 3300049568 Ga0501031_0237618 Ga0501031_0237618_190_1002 243
392 3300049569 Ga0501032_0009798 Ga0501032_0009798_3105_3905 243
393 3300049569 Ga0501032_0142906 Ga0501032_0142906_533_1345 243
394 3300049571 Ga0501034_0046397 Ga0501034_0046397_2844_3650 243
395 3300049571 Ga0501034_0069339 Ga0501034_0069339_1564_2367 243
396 3300049571 Ga0501034_0104026 Ga0501034_0104026_51_857 243
397 3300049571 Ga0501034_0381963 Ga0501034_0381963_103_909 243
398 3300049571 Ga0501034_0452822 Ga0501034_0452822_296_1102 243
399 3300049572 Ga0501036_0005940 Ga0501036_0005940_1829_2629 243
400 3300049574 Ga0501038_0016537 Ga0501038_0016537_3508_4308 243
401 3300049577 Ga0501041_0012828 Ga0501041_0012828_2193_2993 243
402 3300049581 Ga0501047_0208082 Ga0501047_0208082_983_1795 243
403 3300049582 Ga0501048_0145338 Ga0501048_0145338_271_1071 243
404 3300049588 Ga0501072_0049910 Ga0501072_0049910_256_1056 243
405 3300049590 Ga0501074_0159872 Ga0501074_0159872_418_1218 243
406 3300049591 Ga0501075_0314420 Ga0501075_0314420_271_1071 243
407 3300049592 Ga0501076_0050402 Ga0501076_0050402_1875_2675 243
408 3300049743 Ga0501081_0081301 Ga0501081_0081301_256_1056 243
409 3300049822 Ga0501035_0036281 Ga0501035_0036281_1411_2211 243
410 3300049823 Ga0501044_0381748 Ga0501044_0381748_48_860 243
411 3300050491 nmdc:mga00v17_31397_c1 nmdc:mga00v17_31397_c1_1446_2252 243
412 3300050493 nmdc:mga0k408_139525_c1 nmdc:mga0k408_139525_c1_378_1187 243
413 3300050495 nmdc:mga04h51_53784_c1 nmdc:mga04h51_53784_c1_491_1297 243
414 3300053161 Ga0500634_0000026 Ga0500634_0000026_55876_56685 243
415 3300054114 Ga0501084_0119333 Ga0501084_0119333_301_1101 243
416 3300060353 Ga0501082_0039470 Ga0501082_0039470_1823_2623 243
417 iso_pu_bacteria 2844533157 2844533393 243
418 iso_pu_bacteria 2846033681 2846034770 243
419 iso_pu_bacteria 2846037992 2846041159 243
420 iso_pu_bacteria 2998344455 2998346693 243
421 iso_pu_bacteria 8054002106 8054009098 243
422 3300003320 rootH2_10070126 rootH2_100701263 244
423 3300005290 Ga0065712_10114830 Ga0065712_101148302 244
424 3300005336 Ga0070680_100004606 Ga0070680_1000046063 244
425 3300005354 Ga0070675_100014302 Ga0070675_1000143023 244
426 3300005436 Ga0070713_100167499 Ga0070713_1001674991 244
427 3300005436 Ga0070713_100515829 Ga0070713_1005158291 244
428 3300005440 Ga0070705_100141188 Ga0070705_1001411882 244
429 3300005458 Ga0070681_10007653 Ga0070681_100076536 244
430 3300005459 Ga0068867_100019954 Ga0068867_1000199543 244
431 3300005530 Ga0070679_100000523 Ga0070679_10000052328 244
432 3300005530 Ga0070679_100006850 Ga0070679_1000068502 244
433 3300005530 Ga0070679_100153710 Ga0070679_1001537101 244
434 3300005535 Ga0070684_100400697 Ga0070684_1004006972 244
435 3300005543 Ga0070672_100023391 Ga0070672_1000233914 244
436 3300005545 Ga0070695_100138237 Ga0070695_1001382372 244
437 3300005548 Ga0070665_100172965 Ga0070665_1001729652 244
438 3300005549 Ga0070704_100009353 Ga0070704_1000093533 244
439 3300005843 Ga0068860_100118452 Ga0068860_1001184522 244
440 3300005844 Ga0068862_100074597 Ga0068862_1000745972 244
441 3300006028 Ga0070717_10505885 Ga0070717_105058852 244
442 3300006844 Ga0075428_100179632 Ga0075428_1001796321 244
443 3300006847 Ga0075431_100040109 Ga0075431_1000401093 244
444 3300006847 Ga0075431_100040688 Ga0075431_1000406882 244
445 3300006847 Ga0075431_100173057 Ga0075431_1001730572 244
446 3300006847 Ga0075431_100203659 Ga0075431_1002036592 244
447 3300006852 Ga0075433_10005192 Ga0075433_100051923 244
448 3300006871 Ga0075434_100001680 Ga0075434_1000016802 244
449 3300006880 Ga0075429_100145387 Ga0075429_1001453872 244
450 3300006881 Ga0068865_100051043 Ga0068865_1000510433 244
451 3300006914 Ga0075436_100106071 Ga0075436_1001060713 244
452 3300007076 Ga0075435_100092318 Ga0075435_1000923183 244
453 3300009094 Ga0111539_10008011 Ga0111539_100080114 244
454 3300009094 Ga0111539_10051848 Ga0111539_100518484 244
455 3300009147 Ga0114129_10360628 Ga0114129_103606283 244
456 3300009148 Ga0105243_10373640 Ga0105243_103736401 244
457 3300009177 Ga0105248_10166119 Ga0105248_101661192 244
458 3300009553 Ga0105249_10401251 Ga0105249_104012512 244
459 3300010375 Ga0105239_10127177 Ga0105239_101271773 244
460 3300013104 Ga0157370_10001622 Ga0157370_1000162213 244
461 3300013104 Ga0157370_10052398 Ga0157370_100523985 244
462 3300013296 Ga0157374_10266109 Ga0157374_102661092 244
463 3300014745 Ga0157377_10115359 Ga0157377_101153592 244
464 3300017792 Ga0163161_10278323 Ga0163161_102783232 244
465 3300021441 Ga0213871_10031699 Ga0213871_100316992 244
466 3300025903 Ga0207680_10275492 Ga0207680_102754922 244
467 3300025906 Ga0207699_10011068 Ga0207699_100110682 244
468 3300025912 Ga0207707_10000753 Ga0207707_1000075323 244
469 3300025912 Ga0207707_10136893 Ga0207707_101368932 244
470 3300025913 Ga0207695_10117564 Ga0207695_101175643 244
471 3300025913 Ga0207695_10269834 Ga0207695_102698342 244
472 3300025915 Ga0207693_10371332 Ga0207693_103713322 244
473 3300025916 Ga0207663_10204893 Ga0207663_102048932 244
474 3300025917 Ga0207660_10037930 Ga0207660_100379303 244
475 3300025921 Ga0207652_10011550 Ga0207652_100115503 244
476 3300025923 Ga0207681_10096522 Ga0207681_100965222 244
477 3300025926 Ga0207659_10015047 Ga0207659_100150473 244
478 3300025928 Ga0207700_10443037 Ga0207700_104430372 244
479 3300025933 Ga0207706_10003281 Ga0207706_1000328112 244
480 3300025937 Ga0207669_10062312 Ga0207669_100623122 244
481 3300025938 Ga0207704_10057443 Ga0207704_100574432 244
482 3300025939 Ga0207665_10182214 Ga0207665_101822142 244
483 3300025940 Ga0207691_10018310 Ga0207691_100183107 244
484 3300025940 Ga0207691_10290208 Ga0207691_102902082 244
485 3300025942 Ga0207689_10145911 Ga0207689_101459112 244
486 3300025960 Ga0207651_10154320 Ga0207651_101543202 244
487 3300025961 Ga0207712_10736621 Ga0207712_107366211 244
488 3300026078 Ga0207702_10647059 Ga0207702_106470592 244
489 3300026088 Ga0207641_10282153 Ga0207641_102821532 244
490 3300026089 Ga0207648_10004235 Ga0207648_100042353 244
491 3300026116 Ga0207674_10047539 Ga0207674_100475392 244
492 3300027526 Ga0209968_1024913 Ga0209968_10249132 244
493 3300027614 Ga0209970_1032790 Ga0209970_10327901 244
494 3300027617 Ga0210002_1000664 Ga0210002_10006645 244
495 3300027682 Ga0209971_1022112 Ga0209971_10221122 244
496 3300027717 Ga0209998_10002926 Ga0209998_100029263 244
497 3300027907 Ga0207428_10025978 Ga0207428_100259782 244
498 3300027907 Ga0207428_10028273 Ga0207428_100282734 244
499 3300027907 Ga0207428_10254496 Ga0207428_102544962 244
500 3300028379 Ga0268266_10112936 Ga0268266_101129361 244
501 3300028379 Ga0268266_10248700 Ga0268266_102487002 244
502 3300028380 Ga0268265_10476063 Ga0268265_104760632 244
503 3300028381 Ga0268264_10089829 Ga0268264_100898291 244
504 3300031548 Ga0307408_100017852 Ga0307408_1000178523 244
505 3300031548 Ga0307408_100022764 Ga0307408_1000227644 244
506 3300031548 Ga0307408_100445606 Ga0307408_1004456062 244
507 3300031728 Ga0316578_10042084 Ga0316578_100420843 244
508 3300031731 Ga0307405_10449484 Ga0307405_104494841 244
509 3300031852 Ga0307410_10037833 Ga0307410_100378332 244
510 3300031852 Ga0307410_10116082 Ga0307410_101160822 244
511 3300031995 Ga0307409_100334752 Ga0307409_1003347522 244
512 3300032002 Ga0307416_100052766 Ga0307416_1000527662 244
513 3300032002 Ga0307416_100138453 Ga0307416_1001384533 244
514 3300032004 Ga0307414_10136025 Ga0307414_101360252 244
515 3300032005 Ga0307411_10438790 Ga0307411_104387902 244
516 3300032126 Ga0307415_100001775 Ga0307415_1000017757 244
517 3300035117 Ga0373953_0003712 Ga0373953_0003712_2774_3583 244
518 3300035172 Ga0373955_0011701 Ga0373955_0011701_322_1131 244
519 3300035398 Ga0316574_0116042 Ga0316574_0116042_800_1606 244
520 3300035410 Ga0373924_0129968 Ga0373924_0129968_34_843 244
521 3300035724 Ga0373933_0005208 Ga0373933_0005208_3257_4066 244
522 3300036401 Ga0373937_0018708 Ga0373937_0018708_1732_2541 244
523 3300039438 Ga0436360_0708385 Ga0436360_0708385_314_1129 244
524 3300039438 Ga0436360_1274780 Ga0436360_1274780_1157_2005 244
525 3300039447 Ga0436361_0262581 Ga0436361_0262581_577_1395 244
526 3300039447 Ga0436361_0896160 Ga0436361_0896160_141_1034 244
527 3300039450 Ga0436363_1135590 Ga0436363_1135590_19_834 244
528 3300041997 Ga0439431_0067067 Ga0439431_0067067_59_868 244
529 3300042132 Ga0450895_000553 Ga0450895_000553_245_1054 244
530 3300042133 Ga0450896_009427 Ga0450896_009427_540_1343 244
531 3300042156 Ga0439446_0000678 Ga0439446_0000678_211_1020 244
532 3300042156 Ga0439446_0004444 Ga0439446_0004444_335_1144 244
533 3300042184 Ga0450908_001318 Ga0450908_001318_2566_3375 244
534 3300042435 Ga0439434_0014278 Ga0439434_0014278_1192_2001 244
535 3300042435 Ga0439434_0017233 Ga0439434_0017233_400_1209 244
536 3300042436 Ga0439435_0041453 Ga0439435_0041453_61_870 244
537 3300042439 Ga0439464_0048652 Ga0439464_0048652_306_1112 244
538 3300042531 Ga0450918_010721 Ga0450918_010721_398_1207 244
539 3300045051 Ga0451576_0095535 Ga0451576_0095535_837_1643 244
540 3300047471 Ga0495684_0123713 Ga0495684_0123713_820_1629 244
541 3300048909 Ga0496106_0322834 Ga0496106_0322834_89_901 244
542 3300048916 Ga0496113_0070019 Ga0496113_0070019_1715_2551 244
543 3300048924 Ga0496121_0212988 Ga0496121_0212988_451_1260 244
544 3300049575 Ga0501039_0227798 Ga0501039_0227798_560_1366 244
545 3300049576 Ga0501040_0063824 Ga0501040_0063824_1214_2023 244
546 3300049584 Ga0501068_0029402 Ga0501068_0029402_414_1223 244
547 3300049586 Ga0501070_0101758 Ga0501070_0101758_629_1441 244
548 3300049588 Ga0501072_0139668 Ga0501072_0139668_1052_1855 244
549 3300049590 Ga0501074_0063689 Ga0501074_0063689_348_1157 244
550 3300049591 Ga0501075_0247864 Ga0501075_0247864_310_1119 244
551 3300049592 Ga0501076_0039830 Ga0501076_0039830_2745_3554 244
552 3300049682 Ga0501252_000719 Ga0501252_000719_1341_2171 244
553 3300049741 Ga0501079_0229806 Ga0501079_0229806_463_1269 244
554 3300049742 Ga0501080_0542777 Ga0501080_0542777_211_1011 244
555 3300049743 Ga0501081_0274222 Ga0501081_0274222_190_996 244
556 3300050509 nmdc:mga0qj67_38204_c1 nmdc:mga0qj67_38204_c1_1305_2108 244
557 3300050510 nmdc:mga06r32_355355_c1 nmdc:mga06r32_355355_c1_546_1349 244
558 3300050510 nmdc:mga06r32_438315_c1 nmdc:mga06r32_438315_c1_226_1035 244
559 3300050511 nmdc:mga08y16_213141_c1 nmdc:mga08y16_213141_c1_551_1360 244
560 3300050511 nmdc:mga08y16_35895_c1 nmdc:mga08y16_35895_c1_3279_4088 244
561 3300050511 nmdc:mga08y16_5377_c2 nmdc:mga08y16_5377_c2_4736_5542 244
562 3300050512 nmdc:mga0n895_1121_c1 nmdc:mga0n895_1121_c1_17768_18577 244
563 3300050512 nmdc:mga0n895_231741_c1 nmdc:mga0n895_231741_c1_862_1698 244
564 3300050513 nmdc:mga0rr50_80020_c1 nmdc:mga0rr50_80020_c1_1011_1820 244
565 3300050514 nmdc:mga08x19_14319_c1 nmdc:mga08x19_14319_c1_1393_2229 244
566 3300050515 nmdc:mga0a205_2501_c1 nmdc:mga0a205_2501_c1_2512_3321 244
567 3300053078 Ga0495612_0143477 Ga0495612_0143477_209_1021 244
568 3300053085 Ga0495619_0050966 Ga0495619_0050966_630_1439 244
569 3300053098 Ga0500650_0000025 Ga0500650_0000025_12050_12880 244
570 3300053153 Ga0500616_0101867 Ga0500616_0101867_535_1371 244
571 iso_pu_bacteria 2821443989 2821445913 244
572 iso_pu_bacteria 2844533157 2844537943 244
573 iso_pu_bacteria 2898795034 2898797260 244
574 iso_pu_bacteria 2928157003 2928163577 244
575 iso_pu_bacteria 2981990288 2981996527 244
576 iso_pu_bacteria 8018845410 8018847185 244
577 3300005330 Ga0070690_100056392 Ga0070690_1000563922 245
578 3300005335 Ga0070666_10003820 Ga0070666_100038207 245
579 3300005338 Ga0068868_100015991 Ga0068868_1000159914 245
580 3300005367 Ga0070667_100041630 Ga0070667_1000416304 245
581 3300005548 Ga0070665_100073814 Ga0070665_1000738142 245
582 3300005617 Ga0068859_100027568 Ga0068859_1000275683 245
583 3300005618 Ga0068864_100065782 Ga0068864_1000657822 245
584 3300005841 Ga0068863_100022625 Ga0068863_1000226255 245
585 3300005842 Ga0068858_100007229 Ga0068858_1000072293 245
586 3300005843 Ga0068860_100029041 Ga0068860_1000290414 245
587 3300005844 Ga0068862_100395828 Ga0068862_1003958282 245
588 3300006358 Ga0068871_100026906 Ga0068871_1000269062 245
589 3300006881 Ga0068865_100032871 Ga0068865_1000328712 245
590 3300006931 Ga0097620_100027568 Ga0097620_1000275683 245
591 3300007788 Ga0099795_10000022 Ga0099795_1000002212 245
592 3300009098 Ga0105245_10041273 Ga0105245_100412732 245
593 3300009101 Ga0105247_10021799 Ga0105247_100217992 245
594 3300009176 Ga0105242_10487791 Ga0105242_104877912 245
595 3300009177 Ga0105248_10154022 Ga0105248_101540223 245
596 3300010159 Ga0099796_10000025 Ga0099796_1000002522 245
597 3300013297 Ga0157378_10192571 Ga0157378_101925712 245
598 3300013306 Ga0163162_10243601 Ga0163162_102436012 245
599 3300013308 Ga0157375_10052786 Ga0157375_100527863 245
600 3300014325 Ga0163163_10010899 Ga0163163_100108997 245
601 3300014969 Ga0157376_10037280 Ga0157376_100372802 245
602 3300021361 Ga0213872_10042800 Ga0213872_100428001 245
603 3300021361 Ga0213872_10057513 Ga0213872_100575132 245
604 3300025927 Ga0207687_10017700 Ga0207687_100177002 245
605 3300025938 Ga0207704_10016231 Ga0207704_100162314 245
606 3300025941 Ga0207711_10106629 Ga0207711_101066293 245
607 3300026023 Ga0207677_10336233 Ga0207677_103362332 245
608 3300026035 Ga0207703_10028593 Ga0207703_100285932 245
609 3300026088 Ga0207641_10031125 Ga0207641_100311252 245
610 3300027512 Ga0209179_1000048 Ga0209179_100004826 245
611 3300027876 Ga0209974_10037113 Ga0209974_100371132 245
612 3300028380 Ga0268265_10544145 Ga0268265_105441452 245
613 3300028381 Ga0268264_10024711 Ga0268264_100247112 245
614 3300039437 Ga0436365_0404170 Ga0436365_0404170_390_1232 245
615 3300039447 Ga0436361_0328064 Ga0436361_0328064_3409_4236 245
616 3300048904 Ga0496101_0196100 Ga0496101_0196100_196_1038 245
617 3300048908 Ga0496105_0041734 Ga0496105_0041734_1413_2255 245
618 3300048913 Ga0496110_0295157 Ga0496110_0295157_295_1137 245
619 3300050510 nmdc:mga06r32_228616_c1 nmdc:mga06r32_228616_c1_389_1237 245
620 3300053153 Ga0500616_0034535 Ga0500616_0034535_147_977 245
621 3300003187 JGI25151J46595_10000436 JGI25151J46595_100004369 246
622 3300005289 Ga0065704_10140248 Ga0065704_101402482 246
623 3300005455 Ga0070663_100253307 Ga0070663_1002533072 246
624 3300006846 Ga0075430_100462388 Ga0075430_1004623882 246
625 3300014326 Ga0157380_10010381 Ga0157380_100103815 246
626 3300025284 Ga0209130_1000167 Ga0209130_100016785 246
627 3300025294 Ga0209025_1000077 Ga0209025_100007791 246
628 3300025297 Ga0209758_1004047 Ga0209758_10040479 246
629 3300025302 Ga0207426_1000239 Ga0207426_100023955 246
630 3300027312 Ga0209371_1001291 Ga0209371_10012917 246
631 3300027614 Ga0209970_1021752 Ga0209970_10217522 246
632 3300027665 Ga0209983_1017107 Ga0209983_10171072 246
633 3300030500 Ga0268256_1001102 Ga0268256_100110212 246
634 3300031247 Ga0265340_10097134 Ga0265340_100971342 246
635 3300031548 Ga0307408_100016261 Ga0307408_1000162613 246
636 3300031665 Ga0316575_10027915 Ga0316575_100279154 246
637 3300031728 Ga0316578_10005082 Ga0316578_100050825 246
638 3300031728 Ga0316578_10099244 Ga0316578_100992442 246
639 3300031731 Ga0307405_10261658 Ga0307405_102616582 246
640 3300031733 Ga0316577_10009416 Ga0316577_100094164 246
641 3300031733 Ga0316577_10083642 Ga0316577_100836423 246
642 3300031824 Ga0307413_10115670 Ga0307413_101156702 246
643 3300031901 Ga0307406_10191032 Ga0307406_101910322 246
644 3300031903 Ga0307407_10134976 Ga0307407_101349761 246
645 3300031995 Ga0307409_100291150 Ga0307409_1002911502 246
646 3300032002 Ga0307416_100003094 Ga0307416_1000030945 246
647 3300032005 Ga0307411_10002953 Ga0307411_100029532 246
648 3300032126 Ga0307415_100001180 Ga0307415_1000011805 246
649 3300032133 Ga0316583_10042320 Ga0316583_100423202 246
650 3300035398 Ga0316574_0037650 Ga0316574_0037650_448_1290 246
651 3300035398 Ga0316574_0052849 Ga0316574_0052849_1069_1911 246
652 3300037588 Ga0316581_0013589 Ga0316581_0013589_1421_2263 246
653 3300039438 Ga0436360_0567944 Ga0436360_0567944_11_847 246
654 3300041405 Ga0439438_061253 Ga0439438_061253_53_889 246
655 3300042003 Ga0439443_004650 Ga0439443_004650_600_1436 246
656 3300042013 Ga0439456_025965 Ga0439456_025965_297_1133 246
657 3300042131 Ga0450894_001909 Ga0450894_001909_617_1453 246
658 3300042131 Ga0450894_002729 Ga0450894_002729_484_1320 246
659 3300042133 Ga0450896_000078 Ga0450896_000078_4092_4928 246
660 3300042135 Ga0450899_004788 Ga0450899_004788_534_1370 246
661 3300042146 Ga0450907_003204 Ga0450907_003204_259_1095 246
662 3300042184 Ga0450908_001577 Ga0450908_001577_541_1377 246
663 3300042435 Ga0439434_0003968 Ga0439434_0003968_3228_4064 246
664 3300042437 Ga0439444_0006939 Ga0439444_0006939_620_1456 246
665 3300046512 Ga0495610_0065673 Ga0495610_0065673_628_1464 246
666 3300005618 Ga0068864_100278302 Ga0068864_1002783021 247
667 3300006880 Ga0075429_100317192 Ga0075429_1003171922 247
668 3300009094 Ga0111539_10184014 Ga0111539_101840143 247
669 3300009147 Ga0114129_10796081 Ga0114129_107960811 247
670 3300009987 Ga0105030_100135 Ga0105030_1001356 247
671 3300013308 Ga0157375_10719807 Ga0157375_107198072 247
672 3300013874 Ga0157514_109572 Ga0157514_1095722 247
673 3300014325 Ga0163163_10032882 Ga0163163_100328823 247
674 3300014968 Ga0157379_10200864 Ga0157379_102008643 247
675 3300028794 Ga0307515_10018263 Ga0307515_100182637 247
676 3300031456 Ga0307513_10049441 Ga0307513_100494414 247
677 3300031548 Ga0307408_100101573 Ga0307408_1001015732 247
678 3300031595 Ga0265313_10027030 Ga0265313_100270303 247
679 3300032002 Ga0307416_100042886 Ga0307416_1000428862 247
680 3300035398 Ga0316574_0033917 Ga0316574_0033917_1774_2610 247
681 3300035398 Ga0316574_0134129 Ga0316574_0134129_491_1327 247
682 3300041491 Ga0451833_1471124 Ga0451833_1471124_458_1297 247
683 3300041511 Ga0451855_1730903 Ga0451855_1730903_192_1031 247
684 3300041512 Ga0451853_0564721 Ga0451853_0564721_1078_1917 247
685 3300042125 Ga0450923_006323 Ga0450923_006323_230_1069 247
686 3300042156 Ga0439446_0016746 Ga0439446_0016746_751_1590 247
687 3300042435 Ga0439434_0004234 Ga0439434_0004234_1198_2037 247
688 3300042435 Ga0439434_0012069 Ga0439434_0012069_1189_2028 247
689 3300045051 Ga0451576_0017273 Ga0451576_0017273_2595_3434 247
690 3300046517 Ga0495630_0149032 Ga0495630_0149032_138_980 247
691 3300046519 Ga0495632_0060396 Ga0495632_0060396_299_1135 247
692 3300046557 Ga0495622_0084306 Ga0495622_0084306_346_1188 247
693 3300049568 Ga0501031_0032142 Ga0501031_0032142_2414_3253 247
694 3300049570 Ga0501033_0013025 Ga0501033_0013025_5355_6194 247
695 3300049570 Ga0501033_0031947 Ga0501033_0031947_1706_2545 247
696 3300049572 Ga0501036_0011396 Ga0501036_0011396_5437_6276 247
697 3300049572 Ga0501036_0055798 Ga0501036_0055798_348_1187 247
698 3300049572 Ga0501036_0203441 Ga0501036_0203441_89_928 247
699 3300049573 Ga0501037_0136019 Ga0501037_0136019_211_1050 247
700 3300049574 Ga0501038_0003978 Ga0501038_0003978_10158_10997 247
701 3300049575 Ga0501039_0004768 Ga0501039_0004768_1697_2536 247
702 3300049575 Ga0501039_0022208 Ga0501039_0022208_3112_3951 247
703 3300049575 Ga0501039_0111822 Ga0501039_0111822_962_1801 247
704 3300049575 Ga0501039_0156225 Ga0501039_0156225_576_1415 247
705 3300049576 Ga0501040_0002910 Ga0501040_0002910_4148_4987 247
706 3300049576 Ga0501040_0003703 Ga0501040_0003703_3201_4040 247
707 3300049577 Ga0501041_0003207 Ga0501041_0003207_3158_3997 247
708 3300049577 Ga0501041_0028170 Ga0501041_0028170_2370_3209 247
709 3300049577 Ga0501041_0188152 Ga0501041_0188152_50_889 247
710 3300049578 Ga0501042_0004113 Ga0501042_0004113_3185_4024 247
711 3300049579 Ga0501043_0052903 Ga0501043_0052903_2190_3029 247
712 3300049580 Ga0501046_0006343 Ga0501046_0006343_4376_5215 247
713 3300049580 Ga0501046_0006557 Ga0501046_0006557_5108_5947 247
714 3300049580 Ga0501046_0259384 Ga0501046_0259384_234_1073 247
715 3300049582 Ga0501048_0009506 Ga0501048_0009506_4840_5679 247
716 3300049582 Ga0501048_0018079 Ga0501048_0018079_2975_3814 247
717 3300049582 Ga0501048_0033976 Ga0501048_0033976_2092_2931 247
718 3300049582 Ga0501048_0133298 Ga0501048_0133298_568_1407 247
719 3300049587 Ga0501071_0013254 Ga0501071_0013254_4264_5103 247
720 3300049587 Ga0501071_0022554 Ga0501071_0022554_2044_2883 247
721 3300049588 Ga0501072_0001734 Ga0501072_0001734_13172_14011 247
722 3300049588 Ga0501072_0006537 Ga0501072_0006537_340_1179 247
723 3300049589 Ga0501073_0009857 Ga0501073_0009857_3418_4257 247
724 3300049589 Ga0501073_0040143 Ga0501073_0040143_132_971 247
725 3300049589 Ga0501073_0114580 Ga0501073_0114580_128_967 247
726 3300049590 Ga0501074_0024862 Ga0501074_0024862_1024_1863 247
727 3300049590 Ga0501074_0116847 Ga0501074_0116847_613_1452 247
728 3300049591 Ga0501075_0000282 Ga0501075_0000282_817_1656 247
729 3300049591 Ga0501075_0015902 Ga0501075_0015902_39_878 247
730 3300049591 Ga0501075_0052844 Ga0501075_0052844_2113_2952 247
731 3300049592 Ga0501076_0000955 Ga0501076_0000955_7333_8172 247
732 3300049592 Ga0501076_0002461 Ga0501076_0002461_2282_3121 247
733 3300049592 Ga0501076_0020250 Ga0501076_0020250_2724_3563 247
734 3300049592 Ga0501076_0445338 Ga0501076_0445338_114_953 247
735 3300049592 Ga0501076_0447718 Ga0501076_0447718_120_959 247
736 3300049593 Ga0501077_0006923 Ga0501077_0006923_3301_4140 247
737 3300049593 Ga0501077_0007715 Ga0501077_0007715_3180_4019 247
738 3300049741 Ga0501079_0001340 Ga0501079_0001340_13902_14741 247
739 3300049741 Ga0501079_0002370 Ga0501079_0002370_9253_10092 247
740 3300049742 Ga0501080_0001574 Ga0501080_0001574_389_1228 247
741 3300049742 Ga0501080_0002465 Ga0501080_0002465_9484_10323 247
742 3300049742 Ga0501080_0055485 Ga0501080_0055485_158_997 247
743 3300049743 Ga0501081_0000147 Ga0501081_0000147_26489_27328 247
744 3300049743 Ga0501081_0002949 Ga0501081_0002949_3373_4212 247
745 3300049743 Ga0501081_0028375 Ga0501081_0028375_2494_3333 247
746 3300049744 Ga0501083_0016930 Ga0501083_0016930_1940_2779 247
747 3300049822 Ga0501035_0095305 Ga0501035_0095305_372_1211 247
748 3300049823 Ga0501044_0169055 Ga0501044_0169055_219_1058 247
749 3300049824 Ga0501045_0000401 Ga0501045_0000401_5315_6154 247
750 3300049824 Ga0501045_0124199 Ga0501045_0124199_292_1131 247
751 3300049824 Ga0501045_0135301 Ga0501045_0135301_288_1127 247
752 3300050511 nmdc:mga08y16_293748_c1 nmdc:mga08y16_293748_c1_39_878 247
753 3300053090 Ga0500646_0070609 Ga0500646_0070609_29_865 247
754 3300053092 Ga0500583_0054104 Ga0500583_0054104_424_1260 247
755 3300053104 Ga0500556_0001581 Ga0500556_0001581_6427_7269 247
756 3300053156 Ga0500622_0007236 Ga0500622_0007236_5215_6096 247
757 3300054114 Ga0501084_0003463 Ga0501084_0003463_327_1166 247
758 3300054114 Ga0501084_0011958 Ga0501084_0011958_1150_1989 247
759 3300054114 Ga0501084_0013640 Ga0501084_0013640_2672_3511 247
760 3300054114 Ga0501084_0209771 Ga0501084_0209771_397_1236 247
761 3300060353 Ga0501082_0002075 Ga0501082_0002075_15880_16719 247
762 3300060353 Ga0501082_0004888 Ga0501082_0004888_430_1269 247
763 3300060353 Ga0501082_0032198 Ga0501082_0032198_2546_3385 247
764 3300060353 Ga0501082_0308386 Ga0501082_0308386_259_1098 247
765 3300061734 Ga0530510_0012468 Ga0530510_0012468_2801_3640 247
766 3300061734 Ga0530510_0248105 Ga0530510_0248105_166_1005 247
767 3300003203 JGI25406J46586_10015918 JGI25406J46586_100159181 248
768 3300003215 JGI25153J46596_10000132 JGI25153J46596_1000013265 248
769 3300003215 JGI25153J46596_10000426 JGI25153J46596_1000042613 248
770 3300003322 rootL2_10029180 rootL2_100291802 248
771 3300003323 rootH1_10064332 rootH1_100643323 248
772 3300005329 Ga0070683_100042785 Ga0070683_1000427854 248
773 3300005336 Ga0070680_100091900 Ga0070680_1000919003 248
774 3300005336 Ga0070680_100134045 Ga0070680_1001340452 248
775 3300005347 Ga0070668_100037293 Ga0070668_1000372931 248
776 3300005353 Ga0070669_100005076 Ga0070669_1000050764 248
777 3300005354 Ga0070675_100035991 Ga0070675_1000359913 248
778 3300005355 Ga0070671_100069722 Ga0070671_1000697223 248
779 3300005356 Ga0070674_100107403 Ga0070674_1001074032 248
780 3300005365 Ga0070688_100021247 Ga0070688_1000212473 248
781 3300005367 Ga0070667_100018886 Ga0070667_1000188866 248
782 3300005434 Ga0070709_10259233 Ga0070709_102592332 248
783 3300005439 Ga0070711_100121593 Ga0070711_1001215931 248
784 3300005441 Ga0070700_100052749 Ga0070700_1000527492 248
785 3300005455 Ga0070663_100149231 Ga0070663_1001492312 248
786 3300005457 Ga0070662_100003902 Ga0070662_1000039025 248
787 3300005458 Ga0070681_10008934 Ga0070681_100089344 248
788 3300005459 Ga0068867_100413626 Ga0068867_1004136262 248
789 3300005459 Ga0068867_100419531 Ga0068867_1004195311 248
790 3300005471 Ga0070698_100065367 Ga0070698_1000653674 248
791 3300005530 Ga0070679_100380104 Ga0070679_1003801042 248
792 3300005535 Ga0070684_100044457 Ga0070684_1000444573 248
793 3300005535 Ga0070684_100220864 Ga0070684_1002208642 248
794 3300005539 Ga0068853_100042108 Ga0068853_1000421084 248
795 3300005539 Ga0068853_100504721 Ga0068853_1005047212 248
796 3300005543 Ga0070672_100021778 Ga0070672_1000217783 248
797 3300005544 Ga0070686_100017327 Ga0070686_1000173273 248
798 3300005548 Ga0070665_100000543 Ga0070665_10000054322 248
799 3300005548 Ga0070665_100003944 Ga0070665_1000039447 248
800 3300005548 Ga0070665_100023201 Ga0070665_1000232013 248
801 3300005548 Ga0070665_100100197 Ga0070665_1001001973 248
802 3300005548 Ga0070665_100224231 Ga0070665_1002242313 248
803 3300005549 Ga0070704_100287057 Ga0070704_1002870572 248
804 3300005563 Ga0068855_100280539 Ga0068855_1002805393 248
805 3300005577 Ga0068857_100580528 Ga0068857_1005805282 248
806 3300005578 Ga0068854_100212093 Ga0068854_1002120932 248
807 3300005614 Ga0068856_100155933 Ga0068856_1001559333 248
808 3300005617 Ga0068859_100007416 Ga0068859_1000074165 248
809 3300005617 Ga0068859_100034471 Ga0068859_1000344712 248
810 3300005617 Ga0068859_100069694 Ga0068859_1000696942 248
811 3300005617 Ga0068859_100144102 Ga0068859_1001441023 248
812 3300005719 Ga0068861_100006751 Ga0068861_1000067512 248
813 3300005719 Ga0068861_100300486 Ga0068861_1003004862 248
814 3300005840 Ga0068870_10018568 Ga0068870_100185683 248
815 3300005841 Ga0068863_100001099 Ga0068863_10000109910 248
816 3300005841 Ga0068863_100112958 Ga0068863_1001129582 248
817 3300005841 Ga0068863_100851104 Ga0068863_1008511041 248
818 3300005842 Ga0068858_100001802 Ga0068858_10000180211 248
819 3300005842 Ga0068858_100002680 Ga0068858_10000268010 248
820 3300005843 Ga0068860_100005207 Ga0068860_1000052078 248
821 3300005843 Ga0068860_100079184 Ga0068860_1000791844 248
822 3300005843 Ga0068860_100087827 Ga0068860_1000878274 248
823 3300005844 Ga0068862_100166684 Ga0068862_1001666841 248
824 3300005844 Ga0068862_100190620 Ga0068862_1001906202 248
825 3300005985 Ga0081539_10000028 Ga0081539_10000028260 248
826 3300006175 Ga0070712_100043863 Ga0070712_1000438633 248
827 3300006175 Ga0070712_100317876 Ga0070712_1003178762 248
828 3300006237 Ga0097621_100323684 Ga0097621_1003236842 248
829 3300006237 Ga0097621_100676337 Ga0097621_1006763371 248
830 3300006358 Ga0068871_100121433 Ga0068871_1001214332 248
831 3300006358 Ga0068871_100238794 Ga0068871_1002387942 248
832 3300006844 Ga0075428_100007872 Ga0075428_1000078723 248
833 3300006844 Ga0075428_100133315 Ga0075428_1001333153 248
834 3300006846 Ga0075430_100204848 Ga0075430_1002048482 248
835 3300006847 Ga0075431_100010293 Ga0075431_1000102936 248
836 3300006847 Ga0075431_100071130 Ga0075431_1000711302 248
837 3300006871 Ga0075434_100719378 Ga0075434_1007193782 248
838 3300006880 Ga0075429_100062955 Ga0075429_1000629552 248
839 3300006931 Ga0097620_100007416 Ga0097620_1000074165 248
840 3300006931 Ga0097620_100034472 Ga0097620_1000344722 248
841 3300006931 Ga0097620_100069696 Ga0097620_1000696964 248
842 3300006931 Ga0097620_100144103 Ga0097620_1001441033 248
843 3300006931 Ga0097620_100491412 Ga0097620_1004914122 248
844 3300007076 Ga0075435_100093142 Ga0075435_1000931423 248
845 3300007788 Ga0099795_10039386 Ga0099795_100393862 248
846 3300009093 Ga0105240_10040891 Ga0105240_100408915 248
847 3300009093 Ga0105240_10342568 Ga0105240_103425682 248
848 3300009093 Ga0105240_10453705 Ga0105240_104537052 248
849 3300009094 Ga0111539_10000539 Ga0111539_1000053937 248
850 3300009094 Ga0111539_10187293 Ga0111539_101872933 248
851 3300009101 Ga0105247_10000300 Ga0105247_1000030011 248
852 3300009101 Ga0105247_10034970 Ga0105247_100349703 248
853 3300009101 Ga0105247_10046950 Ga0105247_100469502 248
854 3300009101 Ga0105247_10152903 Ga0105247_101529032 248
855 3300009101 Ga0105247_10243378 Ga0105247_102433782 248
856 3300009147 Ga0114129_10018202 Ga0114129_100182028 248
857 3300009147 Ga0114129_10043590 Ga0114129_100435902 248
858 3300009176 Ga0105242_10296324 Ga0105242_102963242 248
859 3300009177 Ga0105248_10004437 Ga0105248_1000443711 248
860 3300009177 Ga0105248_10045977 Ga0105248_100459774 248
861 3300009545 Ga0105237_10018777 Ga0105237_100187776 248
862 3300009545 Ga0105237_10066928 Ga0105237_100669281 248
863 3300009545 Ga0105237_10337908 Ga0105237_103379082 248
864 3300009545 Ga0105237_10349702 Ga0105237_103497022 248
865 3300009551 Ga0105238_10065070 Ga0105238_100650704 248
866 3300009551 Ga0105238_10555519 Ga0105238_105555192 248
867 3300009553 Ga0105249_10013186 Ga0105249_100131864 248
868 3300009553 Ga0105249_10063863 Ga0105249_100638633 248
869 3300009553 Ga0105249_10126799 Ga0105249_101267993 248
870 3300009553 Ga0105249_10189268 Ga0105249_101892682 248
871 3300010375 Ga0105239_10052494 Ga0105239_100524941 248
872 3300013306 Ga0163162_10068089 Ga0163162_100680893 248
873 3300013306 Ga0163162_10496428 Ga0163162_104964282 248
874 3300013308 Ga0157375_10333620 Ga0157375_103336202 248
875 3300013308 Ga0157375_11020506 Ga0157375_110205061 248
876 3300014325 Ga0163163_10033348 Ga0163163_100333484 248
877 3300014325 Ga0163163_10054754 Ga0163163_100547544 248
878 3300014325 Ga0163163_10164638 Ga0163163_101646382 248
879 3300014325 Ga0163163_10241991 Ga0163163_102419912 248
880 3300014325 Ga0163163_10549227 Ga0163163_105492272 248
881 3300014325 Ga0163163_10886454 Ga0163163_108864541 248
882 3300014326 Ga0157380_10000110 Ga0157380_1000011031 248
883 3300014326 Ga0157380_10096919 Ga0157380_100969193 248
884 3300014326 Ga0157380_10247030 Ga0157380_102470302 248
885 3300014968 Ga0157379_10005225 Ga0157379_100052257 248
886 3300014968 Ga0157379_10096564 Ga0157379_100965643 248
887 3300014968 Ga0157379_10111786 Ga0157379_101117863 248
888 3300014969 Ga0157376_10144989 Ga0157376_101449892 248
889 3300014969 Ga0157376_10213577 Ga0157376_102135772 248
890 3300025261 Ga0209233_1000010 Ga0209233_1000010468 248
891 3300025297 Ga0209758_1000169 Ga0209758_100016967 248
892 3300025900 Ga0207710_10001815 Ga0207710_100018156 248
893 3300025900 Ga0207710_10041557 Ga0207710_100415572 248
894 3300025904 Ga0207647_10015135 Ga0207647_100151354 248
895 3300025907 Ga0207645_10001223 Ga0207645_1000122317 248
896 3300025908 Ga0207643_10057011 Ga0207643_100570112 248
897 3300025912 Ga0207707_10068485 Ga0207707_100684853 248
898 3300025913 Ga0207695_10009529 Ga0207695_100095297 248
899 3300025913 Ga0207695_10024867 Ga0207695_100248676 248
900 3300025913 Ga0207695_10047805 Ga0207695_100478053 248
901 3300025913 Ga0207695_10095476 Ga0207695_100954763 248
902 3300025913 Ga0207695_10098191 Ga0207695_100981912 248
903 3300025913 Ga0207695_10243725 Ga0207695_102437252 248
904 3300025913 Ga0207695_10317224 Ga0207695_103172242 248
905 3300025914 Ga0207671_10013339 Ga0207671_100133396 248
906 3300025914 Ga0207671_10078427 Ga0207671_100784272 248
907 3300025914 Ga0207671_10158215 Ga0207671_101582152 248
908 3300025915 Ga0207693_10018817 Ga0207693_100188176 248
909 3300025915 Ga0207693_10168011 Ga0207693_101680112 248
910 3300025916 Ga0207663_10164144 Ga0207663_101641441 248
911 3300025917 Ga0207660_10024249 Ga0207660_100242492 248
912 3300025917 Ga0207660_10321609 Ga0207660_103216092 248
913 3300025921 Ga0207652_10032150 Ga0207652_100321502 248
914 3300025922 Ga0207646_10055232 Ga0207646_100552324 248
915 3300025923 Ga0207681_10216990 Ga0207681_102169902 248
916 3300025923 Ga0207681_10243985 Ga0207681_102439852 248
917 3300025924 Ga0207694_10009564 Ga0207694_100095643 248
918 3300025924 Ga0207694_10578677 Ga0207694_105786771 248
919 3300025926 Ga0207659_10023791 Ga0207659_100237914 248
920 3300025928 Ga0207700_10078242 Ga0207700_100782422 248
921 3300025931 Ga0207644_10008565 Ga0207644_100085656 248
922 3300025931 Ga0207644_10020759 Ga0207644_100207594 248
923 3300025933 Ga0207706_10004326 Ga0207706_100043266 248
924 3300025940 Ga0207691_10001448 Ga0207691_1000144817 248
925 3300025941 Ga0207711_10077329 Ga0207711_100773293 248
926 3300025944 Ga0207661_10110675 Ga0207661_101106752 248
927 3300025949 Ga0207667_10004634 Ga0207667_100046343 248
928 3300025949 Ga0207667_10291902 Ga0207667_102919022 248
929 3300025961 Ga0207712_10464629 Ga0207712_104646292 248
930 3300025972 Ga0207668_10023557 Ga0207668_100235574 248
931 3300025981 Ga0207640_10523179 Ga0207640_105231792 248
932 3300025986 Ga0207658_10013905 Ga0207658_100139056 248
933 3300026035 Ga0207703_10000684 Ga0207703_1000068421 248
934 3300026035 Ga0207703_10073668 Ga0207703_100736683 248
935 3300026067 Ga0207678_10032138 Ga0207678_100321383 248
936 3300026067 Ga0207678_10124850 Ga0207678_101248502 248
937 3300026067 Ga0207678_10305925 Ga0207678_103059252 248
938 3300026075 Ga0207708_10026815 Ga0207708_100268154 248
939 3300026078 Ga0207702_10070413 Ga0207702_100704133 248
940 3300026088 Ga0207641_10000218 Ga0207641_1000021855 248
941 3300026088 Ga0207641_10009065 Ga0207641_100090656 248
942 3300026088 Ga0207641_10508518 Ga0207641_105085182 248
943 3300026088 Ga0207641_10651959 Ga0207641_106519592 248
944 3300026089 Ga0207648_10003080 Ga0207648_100030804 248
945 3300026089 Ga0207648_10187355 Ga0207648_101873551 248
946 3300026089 Ga0207648_10376827 Ga0207648_103768271 248
947 3300026095 Ga0207676_10104929 Ga0207676_101049292 248
948 3300026116 Ga0207674_10344051 Ga0207674_103440512 248
949 3300026116 Ga0207674_10442308 Ga0207674_104423081 248
950 3300026116 Ga0207674_10456467 Ga0207674_104564671 248
951 3300026118 Ga0207675_100006460 Ga0207675_1000064609 248
952 3300026118 Ga0207675_100013913 Ga0207675_1000139133 248
953 3300026118 Ga0207675_100575056 Ga0207675_1005750562 248
954 3300027552 Ga0209982_1000774 Ga0209982_10007742 248
955 3300027617 Ga0210002_1002126 Ga0210002_10021261 248
956 3300027665 Ga0209983_1000414 Ga0209983_10004144 248
957 3300027682 Ga0209971_1000988 Ga0209971_10009885 248
958 3300027717 Ga0209998_10002182 Ga0209998_100021824 248
959 3300027907 Ga0207428_10065196 Ga0207428_100651963 248
960 3300027907 Ga0207428_10076142 Ga0207428_100761422 248
961 3300028379 Ga0268266_10001602 Ga0268266_1000160214 248
962 3300028379 Ga0268266_10003289 Ga0268266_1000328912 248
963 3300028379 Ga0268266_10024426 Ga0268266_100244262 248
964 3300028379 Ga0268266_10041031 Ga0268266_100410312 248
965 3300028379 Ga0268266_10069361 Ga0268266_100693613 248
966 3300028379 Ga0268266_10081141 Ga0268266_100811412 248
967 3300028380 Ga0268265_10004447 Ga0268265_100044478 248
968 3300028380 Ga0268265_10066844 Ga0268265_100668442 248
969 3300028381 Ga0268264_10000047 Ga0268264_100000479 248
970 3300028381 Ga0268264_10000140 Ga0268264_100001408 248
971 3300028381 Ga0268264_10044934 Ga0268264_100449342 248
972 3300028800 Ga0265338_10091735 Ga0265338_100917352 248
973 3300028800 Ga0265338_10270660 Ga0265338_102706602 248
974 3300030521 Ga0307511_10028868 Ga0307511_100288683 248
975 3300031247 Ga0265340_10017304 Ga0265340_100173041 248
976 3300031250 Ga0265331_10027782 Ga0265331_100277822 248
977 3300031507 Ga0307509_10001396 Ga0307509_1000139636 248
978 3300031507 Ga0307509_10002372 Ga0307509_100023726 248
979 3300031507 Ga0307509_10148841 Ga0307509_101488412 248
980 3300031616 Ga0307508_10211816 Ga0307508_102118162 248
981 3300031665 Ga0316575_10017248 Ga0316575_100172482 248
982 3300031727 Ga0316576_10005161 Ga0316576_100051615 248
983 3300031727 Ga0316576_10017920 Ga0316576_100179203 248
984 3300031727 Ga0316576_10362421 Ga0316576_103624212 248
985 3300031728 Ga0316578_10016838 Ga0316578_100168383 248
986 3300031728 Ga0316578_10041771 Ga0316578_100417712 248
987 3300031901 Ga0307406_10147578 Ga0307406_101475782 248
988 3300031903 Ga0307407_10091954 Ga0307407_100919541 248
989 3300031911 Ga0307412_10259049 Ga0307412_102590492 248
990 3300031995 Ga0307409_100213315 Ga0307409_1002133152 248
991 3300032139 Ga0316580_10018645 Ga0316580_100186452 248
992 3300033180 Ga0307510_10000009 Ga0307510_1000000976 248
993 3300035111 Ga0373923_0026198 Ga0373923_0026198_378_1226 248
994 3300035113 Ga0373936_0002315 Ga0373936_0002315_1087_1935 248
995 3300035398 Ga0316574_0002663 Ga0316574_0002663_5966_6826 248
996 3300035398 Ga0316574_0007652 Ga0316574_0007652_3700_4569 248
997 3300035398 Ga0316574_0014132 Ga0316574_0014132_1751_2620 248
998 3300035398 Ga0316574_0052334 Ga0316574_0052334_823_1665 248
999 3300035691 Ga0373931_0261437 Ga0373931_0261437_207_1046 248
1000 3300035692 Ga0373935_0026844 Ga0373935_0026844_276_1139 248
1001 3300035695 Ga0373927_0009759 Ga0373927_0009759_645_1508 248
1002 3300035724 Ga0373933_0012987 Ga0373933_0012987_1707_2555 248
1003 3300035725 Ga0373947_0060979 Ga0373947_0060979_34_897 248
1004 3300036401 Ga0373937_0031120 Ga0373937_0031120_3170_4018 248
1005 3300036647 Ga0316582_0012393 Ga0316582_0012393_2812_3681 248
1006 3300036712 Ga0316584_0015022 Ga0316584_0015022_1504_2373 248
1007 3300036712 Ga0316584_0032057 Ga0316584_0032057_2906_3775 248
1008 3300037068 Ga0373925_0493190 Ga0373925_0493190_119_982 248
1009 3300039438 Ga0436360_1050799 Ga0436360_1050799_482_1330 248
1010 3300039450 Ga0436363_1126933 Ga0436363_1126933_69_917 248
1011 3300042125 Ga0450923_008008 Ga0450923_008008_182_1051 248
1012 3300044656 Ga0466969_0002997 Ga0466969_0002997_747_1595 248
1013 3300044656 Ga0466969_0003345 Ga0466969_0003345_5810_6658 248
1014 3300044656 Ga0466969_0036636 Ga0466969_0036636_1503_2354 248
1015 3300044684 Ga0466966_0004455 Ga0466966_0004455_1072_1920 248
1016 3300044684 Ga0466966_0064912 Ga0466966_0064912_970_1818 248
1017 3300044693 Ga0466961_0001050 Ga0466961_0001050_15245_16093 248
1018 3300044719 Ga0466971_0009912 Ga0466971_0009912_3221_4069 248
1019 3300044735 Ga0466968_0174893 Ga0466968_0174893_36_884 248
1020 3300044765 Ga0466970_0018159 Ga0466970_0018159_1190_2038 248
1021 3300044842 Ga0466957_0004657 Ga0466957_0004657_2839_3687 248
1022 3300045049 Ga0466959_0004232 Ga0466959_0004232_671_1519 248
1023 3300045049 Ga0466959_0006382 Ga0466959_0006382_6645_7493 248
1024 3300045049 Ga0466959_0066819 Ga0466959_0066819_1667_2515 248
1025 3300046455 Ga0495603_0001283 Ga0495603_0001283_1427_2290 248
1026 3300046459 Ga0495629_0000490 Ga0495629_0000490_13228_14091 248
1027 3300046460 Ga0495638_0010078 Ga0495638_0010078_4483_5328 248
1028 3300046460 Ga0495638_0135754 Ga0495638_0135754_565_1419 248
1029 3300046461 Ga0495641_0012212 Ga0495641_0012212_3275_4138 248
1030 3300046472 Ga0495580_0008705 Ga0495580_0008705_5139_5987 248
1031 3300046472 Ga0495580_0010876 Ga0495580_0010876_4540_5403 248
1032 3300046473 Ga0495582_0003939 Ga0495582_0003939_5639_6502 248
1033 3300046475 Ga0495639_0005800 Ga0495639_0005800_4055_4918 248
1034 3300046499 Ga0495594_0004890 Ga0495594_0004890_1307_2170 248
1035 3300046507 Ga0495606_0090274 Ga0495606_0090274_191_1039 248
1036 3300046526 Ga0495666_0020760 Ga0495666_0020760_275_1138 248
1037 3300046531 Ga0495665_0051259 Ga0495665_0051259_276_1139 248
1038 3300046535 Ga0495586_0012842 Ga0495586_0012842_3559_4401 248
1039 3300046557 Ga0495622_0004166 Ga0495622_0004166_597_1460 248
1040 3300046642 Ga0495634_0006857 Ga0495634_0006857_1539_2402 248
1041 3300046660 Ga0495625_0016231 Ga0495625_0016231_4187_5032 248
1042 3300046663 Ga0495635_0197899 Ga0495635_0197899_203_1051 248
1043 3300046674 Ga0495588_0015794 Ga0495588_0015794_1472_2335 248
1044 3300046679 Ga0495623_0025535 Ga0495623_0025535_1028_1876 248
1045 3300046681 Ga0495647_0009478 Ga0495647_0009478_1035_1898 248
1046 3300046683 Ga0495658_0041913 Ga0495658_0041913_268_1131 248
1047 3300046689 Ga0495613_0008530 Ga0495613_0008530_2939_3802 248
1048 3300047315 Ga0495581_0000838 Ga0495581_0000838_3116_3979 248
1049 3300047317 Ga0495604_0043627 Ga0495604_0043627_2625_3473 248
1050 3300047321 Ga0495676_0040521 Ga0495676_0040521_1660_2523 248
1051 3300047443 Ga0495687_056745 Ga0495687_056745_544_1392 248
1052 3300047673 Ga0495593_0008079 Ga0495593_0008079_2751_3614 248
1053 3300048088 Ga0495602_0023230 Ga0495602_0023230_4963_5811 248
1054 3300048903 Ga0496100_0063978 Ga0496100_0063978_1295_2143 248
1055 3300048903 Ga0496100_0317085 Ga0496100_0317085_187_1014 248
1056 3300048905 Ga0496102_0103364 Ga0496102_0103364_1080_1928 248
1057 3300048905 Ga0496102_0504506 Ga0496102_0504506_177_1016 248
1058 3300048906 Ga0496103_0064031 Ga0496103_0064031_750_1577 248
1059 3300048907 Ga0496104_0116842 Ga0496104_0116842_775_1602 248
1060 3300048909 Ga0496106_0044529 Ga0496106_0044529_47_928 248
1061 3300048910 Ga0496107_0040341 Ga0496107_0040341_1074_1901 248
1062 3300048911 Ga0496108_0115259 Ga0496108_0115259_507_1334 248
1063 3300048912 Ga0496109_0011659 Ga0496109_0011659_618_1445 248
1064 3300048913 Ga0496110_0234677 Ga0496110_0234677_774_1601 248
1065 3300048914 Ga0496111_0251369 Ga0496111_0251369_361_1188 248
1066 3300048915 Ga0496112_0011589 Ga0496112_0011589_455_1282 248
1067 3300048916 Ga0496113_0016702 Ga0496113_0016702_120_947 248
1068 3300048919 Ga0496116_0010899 Ga0496116_0010899_3924_4772 248
1069 3300048920 Ga0496117_0000151 Ga0496117_0000151_82702_83550 248
1070 3300048921 Ga0496118_0000016 Ga0496118_0000016_7771_8619 248
1071 3300048922 Ga0496119_0002302 Ga0496119_0002302_13393_14241 248
1072 3300048922 Ga0496119_0042107 Ga0496119_0042107_1139_1987 248
1073 3300048924 Ga0496121_0003216 Ga0496121_0003216_4131_4979 248
1074 3300048924 Ga0496121_0048466 Ga0496121_0048466_1582_2430 248
1075 3300048924 Ga0496121_0178453 Ga0496121_0178453_422_1270 248
1076 3300048927 Ga0496124_0018504 Ga0496124_0018504_5100_5948 248
1077 3300048927 Ga0496124_0023398 Ga0496124_0023398_123_971 248
1078 3300048928 Ga0496125_0000759 Ga0496125_0000759_14751_15599 248
1079 3300048928 Ga0496125_0018493 Ga0496125_0018493_238_1086 248
1080 3300048929 Ga0496126_0007197 Ga0496126_0007197_5929_6777 248
1081 3300048929 Ga0496126_0141282 Ga0496126_0141282_1031_1879 248
1082 3300049575 Ga0501039_0243079 Ga0501039_0243079_397_1239 248
1083 3300049576 Ga0501040_0052937 Ga0501040_0052937_1843_2685 248
1084 3300049577 Ga0501041_0063869 Ga0501041_0063869_1237_2079 248
1085 3300049578 Ga0501042_0414320 Ga0501042_0414320_113_955 248
1086 3300049580 Ga0501046_0104778 Ga0501046_0104778_414_1256 248
1087 3300049582 Ga0501048_0223769 Ga0501048_0223769_134_1003 248
1088 3300049583 Ga0501067_0022940 Ga0501067_0022940_2489_3331 248
1089 3300049584 Ga0501068_0129211 Ga0501068_0129211_668_1510 248
1090 3300049587 Ga0501071_0101123 Ga0501071_0101123_68_910 248
1091 3300049588 Ga0501072_0087339 Ga0501072_0087339_395_1264 248
1092 3300049589 Ga0501073_0014697 Ga0501073_0014697_2813_3655 248
1093 3300049591 Ga0501075_0011522 Ga0501075_0011522_2662_3504 248
1094 3300049592 Ga0501076_0027639 Ga0501076_0027639_116_958 248
1095 3300049592 Ga0501076_0346084 Ga0501076_0346084_240_1082 248
1096 3300049741 Ga0501079_0215105 Ga0501079_0215105_520_1362 248
1097 3300049741 Ga0501079_0350794 Ga0501079_0350794_262_1107 248
1098 3300049742 Ga0501080_0016499 Ga0501080_0016499_1110_1952 248
1099 3300049742 Ga0501080_0632172 Ga0501080_0632172_82_924 248
1100 3300049743 Ga0501081_0000552 Ga0501081_0000552_8363_9205 248
1101 3300049743 Ga0501081_0086496 Ga0501081_0086496_1193_2035 248
1102 3300049824 Ga0501045_0004402 Ga0501045_0004402_7415_8254 248
1103 3300049824 Ga0501045_0143311 Ga0501045_0143311_315_1184 248
1104 3300050507 nmdc:mga05p37_416528_c1 nmdc:mga05p37_416528_c1_571_1440 248
1105 3300050507 nmdc:mga05p37_98508_c1 nmdc:mga05p37_98508_c1_341_1180 248
1106 3300050508 nmdc:mga09592_242121_c1 nmdc:mga09592_242121_c1_261_1100 248
1107 3300050510 nmdc:mga06r32_32508_c1 nmdc:mga06r32_32508_c1_1316_2185 248
1108 3300050510 nmdc:mga06r32_33913_c1 nmdc:mga06r32_33913_c1_209_1048 248
1109 3300050510 nmdc:mga06r32_40748_c1 nmdc:mga06r32_40748_c1_3218_4087 248
1110 3300050510 nmdc:mga06r32_441986_c1 nmdc:mga06r32_441986_c1_178_1047 248
1111 3300050511 nmdc:mga08y16_230019_c1 nmdc:mga08y16_230019_c1_135_977 248
1112 3300050512 nmdc:mga0n895_260567_c1 nmdc:mga0n895_260567_c1_195_1022 248
1113 3300050515 nmdc:mga0a205_574656_c1 nmdc:mga0a205_574656_c1_32_859 248
1114 3300050516 nmdc:mga0sz30_185927_c1 nmdc:mga0sz30_185927_c1_67_906 248
1115 3300053085 Ga0495619_0011851 Ga0495619_0011851_518_1381 248
1116 3300053092 Ga0500583_0015825 Ga0500583_0015825_1227_2084 248
1117 3300053103 Ga0500555_002546 Ga0500555_002546_3374_4213 248
1118 3300053115 Ga0500591_070332 Ga0500591_070332_362_1210 248
1119 3300053124 Ga0500617_039365 Ga0500617_039365_230_1090 248
1120 3300053146 Ga0500588_0018376 Ga0500588_0018376_438_1298 248
1121 3300053153 Ga0500616_0000073 Ga0500616_0000073_36233_37090 248
1122 3300053153 Ga0500616_0047796 Ga0500616_0047796_980_1837 248
1123 3300053163 Ga0500639_083294 Ga0500639_083294_291_1139 248
1124 3300054114 Ga0501084_0463514 Ga0501084_0463514_83_925 248
1125 3300060353 Ga0501082_0013531 Ga0501082_0013531_5531_6373 248
1126 3300060353 Ga0501082_0103899 Ga0501082_0103899_122_964 248
1127 3300060353 Ga0501082_0422603 Ga0501082_0422603_181_1023 248
1128 3300061719 Ga0466962_0007564 Ga0466962_0007564_1574_2422 248
1129 3300061734 Ga0530510_0046245 Ga0530510_0046245_2167_3009 248
1130 3300002987 JGI25159J45721_1020272 JGI25159J45721_10202722 249
1131 3300003187 JGI25151J46595_10000130 JGI25151J46595_1000013025 249
1132 3300003187 JGI25151J46595_10000312 JGI25151J46595_1000031225 249
1133 3300005983 Ga0081540_1039510 Ga0081540_10395103 249
1134 3300025284 Ga0209130_1001359 Ga0209130_100135913 249
1135 3300025294 Ga0209025_1000152 Ga0209025_100015258 249
1136 3300025297 Ga0209758_1002944 Ga0209758_100294415 249
1137 3300025302 Ga0207426_1000333 Ga0207426_100033359 249
1138 3300046512 Ga0495610_0006077 Ga0495610_0006077_246_1091 249

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

75

263

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
2onk-assembly2.cif.gz_I abc transporter modbc in complex with its binding protein moda 0.8637 7 245
3d31-assembly1.cif.gz_C modbc from methanosarcina acetivorans 0.8421 8 244
3tui-assembly2.cif.gz_E inward facing conformations of the metni methionine abc transporter: cy5 native crystal form 0.8298 57 244
8hps-assembly1.cif.gz_A lpqy-sugabc in state 5 0.8153 6 244
7cad-assembly1.cif.gz_B mycobacterium smegmatis sugabc complex 0.8116 6 244
ID Description Score Start End Superfamily
af_P0AFL1_11_271_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9807 9 244 1.10.3720.10
af_P0AFK6_8_259_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9525 11 244 1.10.3720.10
af_Q2G2A9_6_266_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9459 10 245 1.10.3720.10
af_P0AFL1_11_271_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9265 9 244 1.10.3720.10
af_P0AFR9_7_261_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9106 5 244 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A3D0ZSD2-F1-model_v4 Putrescine ABC transporter permease PotI 0.9952 70 227 GO:0005886
GO:0055085
AF-A0A6B8MDS5-F1-model_v4 ABC transporter permease subunit 0.9794 30 247 GO:0005886
GO:0055085
AF-A0A3D0ZSD2-F1-model_v4 Putrescine ABC transporter permease PotI 0.9768 70 227 GO:0005886
GO:0055085
AF-A0A2X3JMI3-F1-model_v4 Putrescine ABC transporter membrane protein 0.9764 3 248 GO:0005886
GO:0055085
AF-A0A6P2JVI4-F1-model_v4 deleted 0.9764 9 244

Feature Viewer

pLDDT pTM Quality
85.26 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map