F490550

General Info

Members Datasets Scaffolds Average Seq Length
1131 608 965 294

Family's Representative Sequence

Representative Sequence 3300039447|Ga0436361_0143802|Ga0436361_0143802_205_1320
Length 350
Sequence MCQAARDGPMLPSSVRLGRSESAGRSNISQVGKLVKCSRKYMADIGFIGLGIMGGPMALNLQKGGHRLFLHSRSGVKEKALLDGGGTECGSPAEVAARAEYIIMMLPNTPDVEAVLFGERGVAAGLTGAGRPAPGREAKLVIDMSSISPLVTRTFAKRISELGADYLDAPVSGGDVGAKNATLTIMVGGSEQAFSRAKPLFELMGKNITLVGGIGDGQTTKVANQIIVALTIEAISEALVFAAKAGADPAKVREALMGGFASSRILEVHGERLLKRNFAPGFRIELHQKDLNLALEGAKSLGVSLPNTASCQELFNACVANGLAKSDHSAMVRALELLANFAIDGSNGKT

Samples

Sample ID Description Type Environment
1 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
2 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
3 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
4 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
5 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
6 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
7 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
8 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
9 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
10 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
11 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
12 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
13 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
14 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
15 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
16 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
17 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
18 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
19 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
20 2643221580 Devosia sp. Root635 Isolate Unclassified
21 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
22 2643221629 Devosia sp. Root105 Isolate Unclassified
23 2643221638 Duganella sp. Root336D2 Isolate Unclassified
24 2643221645 Massilia sp. Root351 Isolate Unclassified
25 2643221662 Devosia sp. Root413D1 Isolate Unclassified
26 2643221664 Massilia sp. Root418 Isolate Unclassified
27 2643221674 Devosia sp. Root436 Isolate Unclassified
28 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
29 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
30 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
31 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
32 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
33 2738541280 Massilia sp. GV090 Isolate Unclassified
34 2738541300 Massilia sp. GV016 Isolate Unclassified
35 2738543018 Massilia sp. GV045 Isolate Unclassified
36 2738543030 Massilia sp. GV097 Isolate Unclassified
37 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
38 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
39 2791355267 Rhizobium sp. L18 Isolate Nodule
40 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
41 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
42 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
43 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
44 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
45 2818991436 Collimonas arenae 515 Isolate Unclassified
46 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
47 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
48 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
49 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
50 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
51 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
52 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
53 2842711865 Duganella sp. R-73148 Isolate Unclassified
54 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
55 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
56 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
57 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
58 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
59 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
60 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
61 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
62 2870721527 Saccharothrix ecbatanensis DSM 45486 Isolate Rhizosphere
63 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
64 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
65 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
66 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
67 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
68 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
69 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
70 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
71 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
72 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
73 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
74 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
75 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
76 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
77 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
78 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
79 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
80 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
81 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
82 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
83 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
84 2887443736 Ruania rhizosphaerae LNNU 22110 Isolate Rhizosphere
85 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
86 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
87 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
88 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
89 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
90 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
91 2897803580 Azospirillum doebereinerae GSF71 Isolate Unclassified
92 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
93 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
94 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
95 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
96 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
97 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
98 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
99 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
100 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
101 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
102 2915358134 Pseudonocardia pini CAP47R Isolate Unclassified
103 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
104 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
105 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
106 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
107 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
108 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
109 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
110 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
111 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
112 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
113 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
114 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
115 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
116 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
117 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
118 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
119 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
120 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
121 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
122 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
123 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
124 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
125 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
126 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
127 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
128 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
129 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
130 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
131 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
132 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
133 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
134 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
135 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
136 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
137 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
138 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
139 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
140 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
141 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
142 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
143 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
144 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
145 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
146 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
147 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
148 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
149 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
150 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
151 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
152 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
153 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
154 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
155 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
156 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
157 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
158 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
159 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
160 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
161 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
162 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
163 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
164 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
165 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
166 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
167 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
168 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
169 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
170 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
171 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
172 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
173 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
174 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
175 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
176 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
177 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
178 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
179 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
180 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
181 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
182 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
183 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
184 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
185 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
186 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
187 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
188 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
189 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
190 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
191 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
192 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
193 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
194 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
195 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
196 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
197 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
198 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
199 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
200 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
201 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
202 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
203 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
204 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
205 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
206 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
207 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
208 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
209 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
210 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
211 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
212 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
213 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
214 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
215 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
216 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
217 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
218 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
219 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
220 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
221 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
222 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
223 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
224 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
225 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
226 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
227 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
228 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
229 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
230 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
231 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
232 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
233 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
234 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
235 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
236 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
237 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
238 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
239 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
240 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
241 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
242 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
243 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
244 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
245 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
246 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
247 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
248 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
249 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
250 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
251 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
252 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
253 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
254 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
255 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
256 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
257 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
258 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
259 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
260 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
261 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
262 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
263 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
264 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
265 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
266 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
267 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
268 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
269 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
270 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
271 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
272 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
273 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
274 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
275 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
276 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
277 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
278 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
279 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
280 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
281 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
282 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
283 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
284 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
285 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
286 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
287 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
288 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
289 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
290 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
291 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
292 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
293 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
294 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
295 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
296 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
297 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
298 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
299 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
300 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
301 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
302 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
303 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
304 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
305 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
306 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
307 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
308 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
309 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
310 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
311 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
312 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
313 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
314 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
315 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
316 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
317 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
318 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
319 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
320 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
321 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
322 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
323 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
324 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
325 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
326 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
327 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
328 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
329 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
330 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
331 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
332 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
333 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
334 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
335 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
336 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
337 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
338 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
339 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
340 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
341 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
342 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
343 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
344 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
345 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
346 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
347 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
348 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
349 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
350 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
351 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
352 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
353 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
354 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
355 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
356 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
357 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
358 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
359 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
360 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
361 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
362 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
363 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
364 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
365 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
366 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
367 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
368 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
369 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
370 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
371 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
372 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
373 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
374 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
375 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
376 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
377 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
378 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
379 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
380 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
381 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
382 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
383 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
384 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
385 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
386 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
387 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
388 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
389 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
390 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
391 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
392 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
393 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
394 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
395 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
396 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
397 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
398 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
399 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
400 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
401 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
402 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
403 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
404 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
405 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
406 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
407 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
408 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
409 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
410 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
411 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
412 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
413 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
414 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
415 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
416 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
417 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
418 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
419 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
420 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
421 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
422 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
423 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
424 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
425 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
426 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
427 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
428 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
429 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
430 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
431 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
432 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
433 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
434 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
435 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
436 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
437 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
438 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
439 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
440 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
441 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
442 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
443 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
444 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
445 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
446 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
447 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
448 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
449 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
450 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
451 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
452 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
453 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
454 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
455 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
456 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
457 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
458 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
459 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
460 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
461 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
462 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
463 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
464 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
465 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
466 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
467 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
468 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
469 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
470 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
471 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
472 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
473 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
474 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
475 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
476 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
477 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
478 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
479 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
480 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
481 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
482 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
483 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
484 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
485 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
486 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
487 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
488 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
489 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
490 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
491 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
492 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
493 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
494 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
495 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
496 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
497 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
498 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
499 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
500 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
501 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
502 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
503 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
504 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
505 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
506 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
507 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
508 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
509 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
510 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
511 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
512 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
513 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
514 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
515 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
516 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
517 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
518 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
519 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
520 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
521 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
522 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
523 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
524 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
525 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
526 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
527 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
528 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
529 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
530 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
531 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
532 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
533 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
534 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
535 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
536 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
537 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
538 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
539 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
540 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
541 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
542 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
543 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
544 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
545 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
546 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
547 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
548 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
549 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
550 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
551 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
552 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
553 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
554 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
555 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
556 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
557 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
558 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
559 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
560 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
561 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
562 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
563 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
564 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
565 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
566 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
567 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
568 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
569 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
570 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
571 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
572 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
573 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
574 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
575 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
576 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
577 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
578 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
579 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
580 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
581 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
582 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
583 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
584 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
585 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
586 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
587 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
588 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
589 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
590 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
591 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
592 641522639 Methylobacterium sp. 4-46 Isolate Nodule
593 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
594 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
595 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
596 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
597 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
598 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
599 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
600 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
601 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
602 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
603 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
604 8048746797 Alcaligenes endophyticus DSM 100498 Isolate Unclassified
605 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified
606 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified
607 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
608 8057575449 Rhizobium mayense CCGE526 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 85.06
Metatranscriptomes 0.27
Isolates 14.68

Biome Distribution

Category Percentage (%)
Aerial Root 0.35
Bulb 0
Endosphere 14.68
Nodule 7.16
Rhizoplane 2.21
Rhizosphere 64.54
Stem 0
Stem Tuber 0
Unclassified 11.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24749J21850_1000008 3300002076 Bacteria 45410
2 JGI25155J39150_1000898 3300002704 Bacteria 4161
3 JGI25155J39150_1000924 3300002704 Bacteria 3829
4 JGI25156J39149_1004604 3300002705 Bacteria 4161
5 JGI25162J39368_1000420 3300002737 Bacteria 34477
6 JGI25162J39368_1006253 3300002737 Bacteria 2100
7 JGI25154J39366_1000840 3300002738 Bacteria 13349
8 JGI25154J39366_1004395 3300002738 Bacteria 2541
9 JGI25157J39369_1000918 3300002741 Bacteria 14047
10 JGI25163J39215_1002583 3300002771 Bacteria 1783
11 JGI25152J39213_1000181 3300002773 Bacteria 42307
12 JGI25152J39213_1002643 3300002773 Bacteria 6644
13 JGI25152J39213_1002734 3300002773 Bacteria 6436
14 JGI25152J39213_1011499 3300002773 Bacteria 1954
15 JGI25150J39212_1000357 3300002774 Bacteria 22438
16 JGI25150J39212_1004088 3300002774 Bacteria 3299
17 JGI25159J45721_1001272 3300002987 Bacteria 10656
18 JGI25159J45721_1001631 3300002987 Bacteria 9123
19 JGI25159J45721_1006561 3300002987 Bacteria 3467
20 JGI25151J46595_10001104 3300003187 Bacteria 19829
21 JGI25151J46595_10004657 3300003187 Bacteria 7216
22 JGI25151J46595_10045182 3300003187 Bacteria 1557
23 JGI25165J46597_1000303 3300003214 Bacteria 61420
24 JGI25165J46597_1000547 3300003214 Bacteria 34477
25 JGI25153J46596_10004410 3300003215 Bacteria 7596
26 JGI25153J46596_10004839 3300003215 Bacteria 7176
27 JGI25153J46596_10005483 3300003215 Bacteria 6644
28 JGI25153J46596_10030291 3300003215 Bacteria 1843
29 rootH2_10032358 3300003320 Bacteria 11896
30 rootH1_10108747 3300003323 Bacteria 1072
31 JGI25160J50197_1006241 3300003354 Bacteria 4843
32 JGI25160J50197_1009997 3300003354 Bacteria 3467
33 JGI25161J50226_1000079 3300003374 Bacteria 83375
34 JGI25161J50226_1000409 3300003374 Bacteria 21021
35 JGI25161J50226_1006338 3300003374 Bacteria 2157
36 JGI25404J52841_10014882 3300003659 Bacteria 1689
37 JGI25404J52841_10045227 3300003659 Bacteria 928
38 Ga0055538_1000209 3300003751 Bacteria 34477
39 Ga0055538_1000664 3300003751 Bacteria 10790
40 Ga0055539_1000251 3300003752 Bacteria 34462
41 Ga0055539_1000557 3300003752 Bacteria 10790
42 Ga0055533_1000242 3300003756 Bacteria 34477
43 Ga0055533_1000718 3300003756 Bacteria 10790
44 Ga0055532_1000097 3300003758 Bacteria 98781
45 Ga0055525_1000338 3300003759 Bacteria 34336
46 Ga0055525_1000759 3300003759 Bacteria 10790
47 Ga0055535_1005969 3300003761 Bacteria 2553
48 Ga0055529_1000032 3300003763 Bacteria 255895
49 Ga0055526_1000402 3300003771 Bacteria 35007
50 Ga0055526_1000951 3300003771 Bacteria 21419
51 Ga0055526_1001247 3300003771 Bacteria 18251
52 Ga0055526_1007163 3300003771 Bacteria 5870
53 Ga0055526_1009071 3300003771 Bacteria 4852
54 Ga0055526_1014548 3300003771 Bacteria 3227
55 Ga0055537_1000030 3300003773 Bacteria 100491
56 Ga0055537_1003332 3300003773 Bacteria 4969
57 Ga0055524_1000851 3300003775 Bacteria 20015
58 Ga0055524_1002689 3300003775 Bacteria 8994
59 Ga0055524_1016960 3300003775 Bacteria 2586
60 Ga0055524_1017942 3300003775 Bacteria 2478
61 Ga0055534_1000203 3300003784 Bacteria 43799
62 Ga0055534_1001261 3300003784 Bacteria 10366
63 Ga0055534_1012691 3300003784 Bacteria 1653
64 Ga0055528_1000439 3300003790 Bacteria 33348
65 Ga0055528_1005416 3300003790 Bacteria 5949
66 Ga0055528_1029743 3300003790 Bacteria 1469
67 Ga0055530_10000604 3300003791 Bacteria 31118
68 Ga0055540_1024817 3300003792 Bacteria 1481
69 Ga0055531_10001184 3300003794 Bacteria 20028
70 Ga0055531_10002864 3300003794 Bacteria 11242
71 Ga0055541_1000149 3300003841 Bacteria 34336
72 Ga0055541_1000513 3300003841 Bacteria 10790
73 Ga0058692_1000086 3300003856 Bacteria 64977
74 Ga0055543_1000031 3300004625 Bacteria 130583
75 Ga0055543_1000550 3300004625 Bacteria 21059
76 Ga0065165_1001805 3300005262 Bacteria 21038
77 Ga0065165_1005147 3300005262 Bacteria 7568
78 Ga0065707_10002796 3300005295 Bacteria 6684
79 Ga0070658_10185638 3300005327 Bacteria 1751
80 Ga0070676_10178179 3300005328 Bacteria 1380
81 Ga0070683_100175519 3300005329 Bacteria 2034
82 Ga0070690_100000109 3300005330 Bacteria 42695
83 Ga0070690_100236319 3300005330 Bacteria 1287
84 Ga0070670_100029086 3300005331 Bacteria 4755
85 Ga0070670_100371130 3300005331 Bacteria 1259
86 Ga0068869_100000272 3300005334 Bacteria 27189
87 Ga0070680_100265547 3300005336 Bacteria 1453
88 Ga0070682_100038780 3300005337 Bacteria 2924
89 Ga0070660_100038243 3300005339 Bacteria 3642
90 Ga0070689_100012618 3300005340 Bacteria 6092
91 Ga0070691_10015476 3300005341 Bacteria 3505
92 Ga0070687_100011426 3300005343 Bacteria 3885
93 Ga0070661_100397586 3300005344 Bacteria 1089
94 Ga0070671_100053527 3300005355 Bacteria 3355
95 Ga0070659_100112112 3300005366 Bacteria 2202
96 Ga0070667_100000667 3300005367 Bacteria 33258
97 Ga0070667_100031798 3300005367 Bacteria 4399
98 Ga0070667_100080860 3300005367 Bacteria 2780
99 Ga0070667_100237047 3300005367 Bacteria 1628
100 Ga0070714_100001359 3300005435 Bacteria 17702
101 Ga0070713_100305292 3300005436 Bacteria 1466
102 Ga0070701_10000446 3300005438 Bacteria 14104
103 Ga0070711_100175933 3300005439 Bacteria 1635
104 Ga0070711_100341124 3300005439 Bacteria 1202
105 Ga0070700_100000237 3300005441 Bacteria 30204
106 Ga0070700_100004413 3300005441 Bacteria 7350
107 Ga0070694_100141182 3300005444 Bacteria 1750
108 Ga0070708_100155966 3300005445 Bacteria 2126
109 Ga0070678_100147827 3300005456 Bacteria 1889
110 Ga0070681_10219589 3300005458 Bacteria 1816
111 Ga0068867_100001174 3300005459 Bacteria 17935
112 Ga0070707_100005918 3300005468 Bacteria 11411
113 Ga0070698_100006326 3300005471 Bacteria 12859
114 Ga0070698_100098284 3300005471 Bacteria 2902
115 Ga0070698_100376174 3300005471 Bacteria 1353
116 Ga0070699_100028974 3300005518 Bacteria 4773
117 Ga0070679_100058363 3300005530 Bacteria 3845
118 Ga0070679_100091532 3300005530 Bacteria 3029
119 Ga0070679_100461289 3300005530 Bacteria 1215
120 Ga0070684_100112266 3300005535 Bacteria 2445
121 Ga0070697_100022227 3300005536 Bacteria 5033
122 Ga0068853_100309034 3300005539 Bacteria 1463
123 Ga0070672_100009322 3300005543 Bacteria 6764
124 Ga0070686_100000464 3300005544 Bacteria 24551
125 Ga0070686_100390150 3300005544 Bacteria 1056
126 Ga0070695_100024435 3300005545 Bacteria 3722
127 Ga0070696_100280000 3300005546 Bacteria 1271
128 Ga0070704_100077821 3300005549 Bacteria 2431
129 Ga0068855_100000951 3300005563 Bacteria 36038
130 Ga0068855_100153432 3300005563 Bacteria 2618
131 Ga0070664_100000682 3300005564 Bacteria 25899
132 Ga0068857_100002406 3300005577 Bacteria 15253
133 Ga0068857_100263262 3300005577 Bacteria 1583
134 Ga0068854_100017008 3300005578 Bacteria 4859
135 Ga0068856_100026055 3300005614 Bacteria 5703
136 Ga0068856_100106259 3300005614 Bacteria 2801
137 Ga0068856_100562433 3300005614 Bacteria 1162
138 Ga0070702_100026943 3300005615 Bacteria 3096
139 Ga0068852_100131398 3300005616 Bacteria 2306
140 Ga0068852_100204790 3300005616 Bacteria 1868
141 Ga0068859_100005767 3300005617 Bacteria 12590
142 Ga0068866_10001195 3300005718 Bacteria 11324
143 Ga0068861_100000333 3300005719 Bacteria 26666
144 Ga0068861_100013959 3300005719 Bacteria 5631
145 Ga0068870_10039634 3300005840 Bacteria 2438
146 Ga0068863_100004683 3300005841 Bacteria 13479
147 Ga0068863_100331272 3300005841 Bacteria 1480
148 Ga0068858_100025288 3300005842 Bacteria 5525
149 Ga0068860_100020873 3300005843 Bacteria 6345
150 Ga0068862_100001937 3300005844 Bacteria 18793
151 Ga0068862_100002549 3300005844 Bacteria 16113
152 Ga0068862_100021490 3300005844 Bacteria 5393
153 Ga0068862_100056436 3300005844 Bacteria 3365
154 Ga0081455_10151879 3300005937 Bacteria 1784
155 Ga0081538_10004456 3300005981 Bacteria 12903
156 Ga0081538_10005813 3300005981 Bacteria 10994
157 Ga0081540_1000201 3300005983 Bacteria 62353
158 Ga0081540_1003632 3300005983 Bacteria 12108
159 Ga0081540_1015179 3300005983 Bacteria 4889
160 Ga0081539_10008288 3300005985 Bacteria 9106
161 Ga0081539_10045778 3300005985 Bacteria 2513
162 Ga0070717_10048879 3300006028 Bacteria 3471
163 Ga0075365_10023666 3300006038 Bacteria 3866
164 Ga0070712_100002440 3300006175 Bacteria 11455
165 Ga0075366_10005655 3300006195 Bacteria 6780
166 Ga0068871_100179316 3300006358 Bacteria 1820
167 Ga0075428_100002468 3300006844 Bacteria 20071
168 Ga0075430_100013887 3300006846 Bacteria 6864
169 Ga0075430_100042004 3300006846 Bacteria 3867
170 Ga0075430_100258100 3300006846 Bacteria 1444
171 Ga0075433_10039571 3300006852 Bacteria 4077
172 Ga0075434_100003847 3300006871 Bacteria 13425
173 Ga0075434_100300126 3300006871 Bacteria 1627
174 Ga0075429_100032506 3300006880 Bacteria 4535
175 Ga0068865_100000379 3300006881 Bacteria 24707
176 Ga0097620_100005767 3300006931 Bacteria 12590
177 Ga0075435_100019943 3300007076 Bacteria 5126
178 Ga0105240_10013457 3300009093 Bacteria 11236
179 Ga0105240_10060062 3300009093 Bacteria 4741
180 Ga0105240_10066905 3300009093 Bacteria 4456
181 Ga0105240_10297170 3300009093 Bacteria 1849
182 Ga0105240_10363333 3300009093 Bacteria 1639
183 Ga0111539_10001915 3300009094 Bacteria 27718
184 Ga0111539_10005209 3300009094 Bacteria 16838
185 Ga0105245_10001340 3300009098 Bacteria 22300
186 Ga0105245_10003250 3300009098 Bacteria 14573
187 Ga0105247_10005532 3300009101 Bacteria 7948
188 Ga0105243_10000789 3300009148 Bacteria 30347
189 Ga0105243_10013742 3300009148 Bacteria 6126
190 Ga0105242_10001855 3300009176 Bacteria 16575
191 Ga0105248_10000157 3300009177 Bacteria 79064
192 Ga0105248_10026867 3300009177 Bacteria 6402
193 Ga0105248_10075531 3300009177 Bacteria 3788
194 Ga0105237_10033514 3300009545 Bacteria 5204
195 Ga0105237_10048394 3300009545 Bacteria 4273
196 Ga0105238_10010332 3300009551 Bacteria 9366
197 Ga0105238_10074378 3300009551 Bacteria 3390
198 Ga0105238_10118544 3300009551 Bacteria 2627
199 Ga0105238_10262191 3300009551 Bacteria 1708
200 Ga0105238_10298273 3300009551 Bacteria 1595
201 Ga0105249_10006020 3300009553 Bacteria 10509
202 Ga0105249_10399582 3300009553 Bacteria 1404
203 Ga0123341_1000059 3300009765 Bacteria 46893
204 Ga0105239_10109019 3300010375 Bacteria 3068
205 Ga0105239_10252141 3300010375 Bacteria 1982
206 Ga0157373_10287131 3300013100 Bacteria 1167
207 Ga0157370_10213080 3300013104 Bacteria 1790
208 Ga0157369_10235678 3300013105 Bacteria 1912
209 Ga0157369_10332877 3300013105 Bacteria 1577
210 Ga0157378_10001061 3300013297 Bacteria 25145
211 Ga0163162_10005600 3300013306 Bacteria 12149
212 Ga0163162_10059762 3300013306 Bacteria 3844
213 Ga0163162_10359516 3300013306 Bacteria 1589
214 Ga0157375_10058395 3300013308 Bacteria 3816
215 Ga0157375_10081781 3300013308 Bacteria 3270
216 Ga0157375_10100144 3300013308 Bacteria 2978
217 Ga0157375_10911938 3300013308 Bacteria 1022
218 Ga0157380_10020480 3300014326 Bacteria 4944
219 Ga0157379_10022456 3300014968 Bacteria 5589
220 Ga0157379_10368054 3300014968 Bacteria 1318
221 Ga0157376_10509653 3300014969 Bacteria 1184
222 Ga0182006_1001104 3300015261 Bacteria 17230
223 Ga0182006_1018185 3300015261 Bacteria 2974
224 Ga0182007_10002870 3300015262 Bacteria 8381
225 Ga0182007_10005932 3300015262 Bacteria 5304
226 Ga0163161_10070365 3300017792 Bacteria 2558
227 Ga0163161_10106602 3300017792 Bacteria 2091
228 Ga0206356_10261284 3300020070 Bacteria 1778
229 Ga0206354_10465120 3300020081 Bacteria 1084
230 Ga0206353_10609877 3300020082 Bacteria 1471
231 Ga0213873_10001831 3300021358 Bacteria 3598
232 Ga0213873_10041559 3300021358 Bacteria 1186
233 Ga0213872_10000600 3300021361 Bacteria 27447
234 Ga0213872_10004201 3300021361 Bacteria 7731
235 Ga0213872_10005734 3300021361 Bacteria 6321
236 Ga0213872_10008921 3300021361 Bacteria 4828
237 Ga0213872_10010382 3300021361 Bacteria 4436
238 Ga0213872_10031458 3300021361 Bacteria 2432
239 Ga0213872_10036269 3300021361 Bacteria 2254
240 Ga0213872_10067952 3300021361 Bacteria 1608
241 Ga0213876_10000781 3300021384 Bacteria 21705
242 Ga0213871_10004755 3300021441 Bacteria 2745
243 Ga0213871_10007967 3300021441 Bacteria 2315
244 Ga0213871_10015781 3300021441 Bacteria 1811
245 Ga0213871_10040704 3300021441 Bacteria 1247
246 Ga0209435_100040 3300025206 Bacteria 115475
247 Ga0209436_100110 3300025208 Bacteria 41189
248 Ga0209436_100343 3300025208 Bacteria 21073
249 Ga0209436_101709 3300025208 Bacteria 7232
250 Ga0209784_100002 3300025224 Bacteria 1753105
251 Ga0209784_100020 3300025224 Bacteria 412353
252 Ga0209566_100003 3300025225 Bacteria 1753105
253 Ga0209566_100020 3300025225 Bacteria 412353
254 Ga0209674_100004 3300025226 Bacteria 1753105
255 Ga0209674_100035 3300025226 Bacteria 412353
256 Ga0209147_100141 3300025229 Bacteria 115466
257 Ga0209563_100006 3300025230 Bacteria 1753105
258 Ga0209563_100038 3300025230 Bacteria 412353
259 Ga0207427_101174 3300025231 Bacteria 10235
260 Ga0209437_100066 3300025233 Bacteria 327883
261 Ga0209437_100229 3300025233 Bacteria 95900
262 Ga0209258_100346 3300025242 Bacteria 66811
263 Ga0207425_1000001 3300025245 Bacteria 2525432
264 Ga0207425_1000039 3300025245 Bacteria 219078
265 Ga0207425_1000730 3300025245 Bacteria 17415
266 Ga0209646_1000218 3300025246 Bacteria 62078
267 Ga0209646_1000235 3300025246 Bacteria 57627
268 Ga0209026_1000725 3300025250 Bacteria 19335
269 Ga0209026_1009785 3300025250 Bacteria 1850
270 Ga0209677_100003 3300025253 Bacteria 1753105
271 Ga0209677_100031 3300025253 Bacteria 329719
272 Ga0209759_1000447 3300025256 Bacteria 47749
273 Ga0209759_1001334 3300025256 Bacteria 14473
274 Ga0209129_1000001 3300025258 Bacteria 1452436
275 Ga0209129_1000300 3300025258 Bacteria 46275
276 Ga0209129_1000370 3300025258 Bacteria 36660
277 Ga0209129_1000786 3300025258 Bacteria 20051
278 Ga0209129_1001338 3300025258 Bacteria 13934
279 Ga0209129_1003963 3300025258 Bacteria 6106
280 Ga0209233_1000060 3300025261 Bacteria 412379
281 Ga0209233_1000188 3300025261 Bacteria 132904
282 Ga0209233_1033544 3300025261 Bacteria 1178
283 Ga0209565_1000017 3300025263 Bacteria 462438
284 Ga0209565_1000410 3300025263 Bacteria 35519
285 Ga0209565_1000440 3300025263 Bacteria 33208
286 Ga0209455_1000043 3300025272 Bacteria 413928
287 Ga0209455_1004598 3300025272 Bacteria 4468
288 Ga0209673_1000007 3300025273 Bacteria 634477
289 Ga0209673_1008713 3300025273 Bacteria 4485
290 Ga0209673_1011374 3300025273 Bacteria 3674
291 Ga0209130_1000023 3300025284 Bacteria 359355
292 Ga0209130_1000534 3300025284 Bacteria 38300
293 Ga0209130_1001866 3300025284 Bacteria 12051
294 Ga0209130_1002660 3300025284 Bacteria 8535
295 Ga0209130_1002808 3300025284 Bacteria 8124
296 Ga0209675_1000009 3300025291 Bacteria 562872
297 Ga0209675_1000630 3300025291 Bacteria 25153
298 Ga0209675_1002116 3300025291 Bacteria 10503
299 Ga0209675_1003002 3300025291 Bacteria 8302
300 Ga0209676_1006467 3300025292 Bacteria 5774
301 Ga0209025_1000505 3300025294 Bacteria 74909
302 Ga0209025_1000594 3300025294 Bacteria 65297
303 Ga0209025_1006291 3300025294 Bacteria 9281
304 Ga0209025_1007217 3300025294 Bacteria 8366
305 Ga0209564_1000055 3300025295 Bacteria 343782
306 Ga0209564_1000109 3300025295 Bacteria 212912
307 Ga0209564_1000393 3300025295 Bacteria 78338
308 Ga0209564_1000879 3300025295 Bacteria 39962
309 Ga0209564_1001055 3300025295 Bacteria 33601
310 Ga0209564_1018582 3300025295 Bacteria 2641
311 Ga0209564_1021373 3300025295 Bacteria 2330
312 Ga0209758_1000020 3300025297 Bacteria 734220
313 Ga0209758_1000390 3300025297 Bacteria 75869
314 Ga0209758_1000422 3300025297 Bacteria 71804
315 Ga0209758_1000766 3300025297 Bacteria 46275
316 Ga0209758_1004936 3300025297 Bacteria 10712
317 Ga0209050_1000074 3300025298 Bacteria 289334
318 Ga0209050_1000116 3300025298 Bacteria 204164
319 Ga0209050_1029605 3300025298 Bacteria 1746
320 Ga0209256_1000028 3300025299 Bacteria 420213
321 Ga0209256_1000559 3300025299 Bacteria 53325
322 Ga0209256_1000640 3300025299 Bacteria 47611
323 Ga0209256_1002555 3300025299 Bacteria 14561
324 Ga0209256_1003461 3300025299 Bacteria 11043
325 Ga0209256_1006115 3300025299 Bacteria 6532
326 Ga0207426_1000087 3300025302 Bacteria 288870
327 Ga0207426_1001693 3300025302 Bacteria 17025
328 Ga0207426_1007150 3300025302 Bacteria 4713
329 Ga0209051_1011200 3300025303 Bacteria 4451
330 Ga0209051_1012329 3300025303 Bacteria 4143
331 Ga0209257_1000003 3300025304 Bacteria 1702593
332 Ga0209257_1003961 3300025304 Bacteria 12012
333 Ga0209257_1005314 3300025304 Bacteria 9137
334 Ga0209257_1005865 3300025304 Bacteria 8305
335 Ga0207710_10003876 3300025900 Bacteria 6611
336 Ga0207688_10086663 3300025901 Bacteria 1794
337 Ga0207688_10193029 3300025901 Bacteria 1219
338 Ga0207647_10098630 3300025904 Bacteria 1736
339 Ga0207643_10191094 3300025908 Bacteria 1243
340 Ga0207705_10005885 3300025909 Bacteria 9120
341 Ga0207705_10081138 3300025909 Bacteria 2364
342 Ga0207695_10003541 3300025913 Bacteria 21873
343 Ga0207695_10007058 3300025913 Bacteria 14407
344 Ga0207695_10024767 3300025913 Bacteria 6739
345 Ga0207695_10136764 3300025913 Bacteria 2403
346 Ga0207695_10273950 3300025913 Bacteria 1583
347 Ga0207671_10005962 3300025914 Bacteria 11041
348 Ga0207693_10004734 3300025915 Bacteria 11440
349 Ga0207663_10135445 3300025916 Bacteria 1708
350 Ga0207657_10007073 3300025919 Bacteria 11528
351 Ga0207657_10028029 3300025919 Bacteria 5147
352 Ga0207652_10046407 3300025921 Bacteria 3707
353 Ga0207646_10028674 3300025922 Bacteria 5065
354 Ga0207681_10136039 3300025923 Bacteria 1824
355 Ga0207681_10221384 3300025923 Bacteria 1464
356 Ga0207694_10004415 3300025924 Bacteria 10994
357 Ga0207694_10201131 3300025924 Bacteria 1621
358 Ga0207694_10450320 3300025924 Bacteria 1074
359 Ga0207650_10022230 3300025925 Bacteria 4488
360 Ga0207687_10271563 3300025927 Bacteria 1356
361 Ga0207664_10001050 3300025929 Bacteria 18469
362 Ga0207644_10053125 3300025931 Bacteria 2915
363 Ga0207690_10096390 3300025932 Bacteria 2103
364 Ga0207690_10304884 3300025932 Bacteria 1247
365 Ga0207686_10048830 3300025934 Bacteria 2624
366 Ga0207709_10031585 3300025935 Bacteria 3095
367 Ga0207709_10039433 3300025935 Bacteria 2821
368 Ga0207670_10042894 3300025936 Bacteria 2984
369 Ga0207704_10396443 3300025938 Bacteria 1088
370 Ga0207691_10017651 3300025940 Bacteria 6763
371 Ga0207711_10004750 3300025941 Bacteria 11535
372 Ga0207711_10066381 3300025941 Bacteria 3120
373 Ga0207711_10136841 3300025941 Bacteria 2200
374 Ga0207689_10001544 3300025942 Bacteria 21884
375 Ga0207679_10094998 3300025945 Bacteria 2316
376 Ga0207667_10000642 3300025949 Bacteria 45282
377 Ga0207667_10059595 3300025949 Bacteria 3997
378 Ga0207667_10159921 3300025949 Bacteria 2317
379 Ga0207712_10000454 3300025961 Bacteria 34905
380 Ga0207712_10336234 3300025961 Bacteria 1251
381 Ga0207668_10003087 3300025972 Bacteria 9763
382 Ga0207640_10136932 3300025981 Bacteria 1779
383 Ga0207658_10112244 3300025986 Bacteria 2157
384 Ga0207658_10184262 3300025986 Bacteria 1730
385 Ga0207677_10394712 3300026023 Bacteria 1172
386 Ga0207639_10033066 3300026041 Bacteria 3812
387 Ga0207678_10108275 3300026067 Bacteria 2371
388 Ga0207678_10484957 3300026067 Bacteria 1077
389 Ga0207708_10000219 3300026075 Bacteria 45553
390 Ga0207708_10003595 3300026075 Bacteria 11426
391 Ga0207702_10093230 3300026078 Bacteria 2641
392 Ga0207702_10116526 3300026078 Bacteria 2384
393 Ga0207702_10247205 3300026078 Bacteria 1674
394 Ga0207641_10003687 3300026088 Bacteria 13496
395 Ga0207641_10176140 3300026088 Bacteria 1956
396 Ga0207648_10000534 3300026089 Bacteria 42312
397 Ga0207648_10233419 3300026089 Bacteria 1637
398 Ga0207674_10186817 3300026116 Bacteria 2022
399 Ga0207675_100001097 3300026118 Bacteria 26813
400 Ga0207675_100025791 3300026118 Bacteria 5470
401 Ga0207683_10039784 3300026121 Bacteria 4102
402 Ga0207683_10065908 3300026121 Bacteria 3193
403 Ga0207683_10380651 3300026121 Bacteria 1297
404 Ga0207698_10029821 3300026142 Bacteria 3913
405 Ga0209371_1000003 3300027312 Bacteria 1122971
406 Ga0209999_1002328 3300027543 Bacteria 3347
407 Ga0209971_1004191 3300027682 Bacteria 3420
408 Ga0207428_10006458 3300027907 Bacteria 10827
409 Ga0207428_10011331 3300027907 Bacteria 7885
410 Ga0268266_10323767 3300028379 Bacteria 1443
411 Ga0268265_10000535 3300028380 Bacteria 38794
412 Ga0268265_10007131 3300028380 Bacteria 7544
413 Ga0268265_10060805 3300028380 Bacteria 2896
414 Ga0268265_10139117 3300028380 Bacteria 2030
415 Ga0268264_10006442 3300028381 Bacteria 9884
416 Ga0268264_10025052 3300028381 Bacteria 4875
417 Ga0265319_1002495 3300028563 Bacteria 10000
418 Ga0265319_1005869 3300028563 Bacteria 5790
419 Ga0265319_1057627 3300028563 Bacteria 1267
420 Ga0265318_10002650 3300028577 Bacteria 9427
421 Ga0265318_10004899 3300028577 Bacteria 6384
422 Ga0265318_10034601 3300028577 Bacteria 1947
423 Ga0265338_10000415 3300028800 Bacteria 76424
424 Ga0268256_1000004 3300030500 Bacteria 1122967
425 Ga0307511_10001889 3300030521 Bacteria 21986
426 Ga0265330_10002740 3300031235 Bacteria 9482
427 Ga0265332_10001710 3300031238 Bacteria 11958
428 Ga0265332_10043875 3300031238 Bacteria 1930
429 Ga0265332_10081829 3300031238 Bacteria 1369
430 Ga0265328_10014547 3300031239 Bacteria 3098
431 Ga0265320_10001869 3300031240 Bacteria 14891
432 Ga0265320_10027214 3300031240 Bacteria 2984
433 Ga0265329_10000886 3300031242 Bacteria 15097
434 Ga0265340_10002506 3300031247 Bacteria 10436
435 Ga0265331_10002480 3300031250 Bacteria 12472
436 Ga0265316_10003173 3300031344 Bacteria 16718
437 Ga0265316_10042225 3300031344 Bacteria 3646
438 Ga0307513_10007045 3300031456 Bacteria 14623
439 Ga0307513_10082402 3300031456 Bacteria 3312
440 Ga0307509_10361386 3300031507 Bacteria 1171
441 Ga0307408_100000157 3300031548 Bacteria 75915
442 Ga0307408_100004977 3300031548 Bacteria 8927
443 Ga0307408_100182846 3300031548 Bacteria 1683
444 Ga0307408_100368771 3300031548 Bacteria 1224
445 Ga0265313_10000186 3300031595 Bacteria 66090
446 Ga0265313_10000483 3300031595 Bacteria 41854
447 Ga0265313_10009885 3300031595 Bacteria 6132
448 Ga0265314_10005273 3300031711 Bacteria 11698
449 Ga0265314_10079508 3300031711 Bacteria 2167
450 Ga0265342_10000054 3300031712 Bacteria 121080
451 Ga0265342_10007237 3300031712 Bacteria 8158
452 Ga0316578_10016320 3300031728 Bacteria 4016
453 Ga0307516_10001334 3300031730 Bacteria 34247
454 Ga0307516_10040735 3300031730 Bacteria 4622
455 Ga0307516_10258941 3300031730 Bacteria 1431
456 Ga0307405_10163203 3300031731 Bacteria 1581
457 Ga0307405_10486539 3300031731 Bacteria 986
458 Ga0307410_10031802 3300031852 Bacteria 3390
459 Ga0307410_10035744 3300031852 Bacteria 3230
460 Ga0307406_10239874 3300031901 Bacteria 1359
461 Ga0307409_100095333 3300031995 Bacteria 2451
462 Ga0307409_100484635 3300031995 Bacteria 1201
463 Ga0307416_100011348 3300032002 Bacteria 5933
464 Ga0307416_100572593 3300032002 Bacteria 1205
465 Ga0307414_10017306 3300032004 Bacteria 4407
466 Ga0307414_10325576 3300032004 Bacteria 1310
467 Ga0307411_10208175 3300032005 Bacteria 1508
468 Ga0307415_100074023 3300032126 Bacteria 2405
469 Ga0307507_10116066 3300033179 Bacteria 2163
470 Ga0373931_0009078 3300035691 Bacteria 4742
471 Ga0373931_0347032 3300035691 Bacteria 928
472 Ga0373947_0148638 3300035725 Bacteria 1508
473 Ga0395899_0003202 3300037312 Bacteria 12977
474 Ga0395899_0020447 3300037312 Bacteria 5018
475 Ga0395899_0021263 3300037312 Bacteria 4922
476 Ga0395899_0026047 3300037312 Bacteria 4413
477 Ga0395899_0064179 3300037312 Bacteria 2700
478 Ga0395899_0309664 3300037312 Bacteria 1066
479 Ga0395900_0005113 3300037418 Bacteria 13777
480 Ga0395900_0018578 3300037418 Bacteria 7090
481 Ga0395900_0046716 3300037418 Bacteria 4458
482 Ga0395900_0171737 3300037418 Bacteria 2206
483 Ga0395898_0007720 3300037466 Bacteria 11421
484 Ga0395898_0098827 3300037466 Bacteria 2802
485 Ga0395905_0005608 3300037471 Bacteria 12776
486 Ga0395905_0013373 3300037471 Bacteria 7863
487 Ga0395905_0024852 3300037471 Bacteria 5653
488 Ga0395905_0026178 3300037471 Bacteria 5501
489 Ga0436364_1350694 3300037853 Bacteria 4828
490 Ga0395901_0001319 3300038443 Bacteria 26126
491 Ga0395901_0046081 3300038443 Bacteria 4527
492 Ga0395901_0090830 3300038443 Bacteria 3196
493 Ga0395901_0169333 3300038443 Bacteria 2292
494 Ga0395901_0254415 3300038443 Bacteria 1829
495 Ga0436365_0090629 3300039437 Bacteria 57501
496 Ga0436365_0342453 3300039437 Bacteria 2981
497 Ga0436360_0022124 3300039438 Bacteria 2684
498 Ga0436360_0350415 3300039438 Bacteria 1672
499 Ga0436360_0369614 3300039438 Bacteria 1005
500 Ga0436360_0481236 3300039438 Bacteria 2752
501 Ga0436360_0989059 3300039438 Bacteria 6814
502 Ga0436361_0002397 3300039447 Bacteria 4007
503 Ga0436361_0014834 3300039447 Bacteria 7524
504 Ga0436361_0065044 3300039447 Bacteria 3112
505 Ga0436361_0143802 3300039447 Bacteria 2109
506 Ga0436361_0148264 3300039447 Bacteria 57652
507 Ga0436361_0273252 3300039447 Bacteria 20849
508 Ga0436361_0316723 3300039447 Bacteria 34024
509 Ga0436361_0362138 3300039447 Bacteria 1634
510 Ga0436361_0495212 3300039447 Bacteria 2761
511 Ga0436361_0699509 3300039447 Bacteria 1217
512 Ga0436361_0769001 3300039447 Bacteria 1563
513 Ga0436361_0879465 3300039447 Bacteria 1803
514 Ga0436363_0089457 3300039450 Bacteria 1280
515 Ga0436362_0984138 3300039453 Bacteria 8617
516 Ga0436362_1085390 3300039453 Bacteria 6879
517 Ga0451807_1740877 3300041486 Bacteria 1325
518 Ga0439431_0053006 3300041997 Bacteria 1055
519 Ga0450916_005623 3300042530 Bacteria 1455
520 Ga0451577_0077478 3300042876 Bacteria 2964
521 Ga0466969_0007082 3300044656 Bacteria 5965
522 Ga0466969_0009508 3300044656 Bacteria 5155
523 Ga0466969_0025919 3300044656 Bacteria 3010
524 Ga0466965_0000149 3300044683 Bacteria 20618
525 Ga0466965_0000613 3300044683 Bacteria 13026
526 Ga0466965_0024249 3300044683 Bacteria 2933
527 Ga0466965_0058929 3300044683 Bacteria 1915
528 Ga0466966_0003879 3300044684 Bacteria 9877
529 Ga0466961_0004681 3300044693 Bacteria 8595
530 Ga0466961_0081899 3300044693 Bacteria 2042
531 Ga0466961_0211566 3300044693 Bacteria 1197
532 Ga0466963_0020651 3300044694 Bacteria 4142
533 Ga0466963_0319334 3300044694 Bacteria 1093
534 Ga0466964_0004214 3300044706 Bacteria 5294
535 Ga0466964_0004520 3300044706 Bacteria 5137
536 Ga0466964_0081259 3300044706 Bacteria 1392
537 Ga0453684_0006630 3300044712 Bacteria 21884
538 Ga0453684_0055940 3300044712 Bacteria 5123
539 Ga0453684_0090090 3300044712 Bacteria 3791
540 Ga0466971_0053133 3300044719 Bacteria 1825
541 Ga0466968_0007816 3300044735 Bacteria 4080
542 Ga0466970_0008418 3300044765 Bacteria 5190
543 Ga0466970_0182426 3300044765 Bacteria 1165
544 Ga0466957_0001149 3300044842 Bacteria 13693
545 Ga0466957_0014213 3300044842 Bacteria 4633
546 Ga0466960_0267178 3300044901 Bacteria 955
547 Ga0466959_0000216 3300045049 Bacteria 37434
548 Ga0466959_0002489 3300045049 Bacteria 11797
549 Ga0451576_0071705 3300045051 Bacteria 3606
550 Ga0451576_0195537 3300045051 Bacteria 2112
551 Ga0466958_0022819 3300045836 Bacteria 3668
552 Ga0466958_0056808 3300045836 Bacteria 2378
553 Ga0466958_0109418 3300045836 Bacteria 1724
554 Ga0466958_0110732 3300045836 Bacteria 1714
555 Ga0466967_0064330 3300045976 Bacteria 3262
556 Ga0466967_0314178 3300045976 Bacteria 1510
557 Ga0495617_002431 3300046452 Bacteria 7407
558 Ga0495617_070500 3300046452 Bacteria 1149
559 Ga0495603_0000760 3300046455 Bacteria 18426
560 Ga0495629_0001443 3300046459 Bacteria 18744
561 Ga0495638_0001700 3300046460 Bacteria 19365
562 Ga0495638_0128977 3300046460 Bacteria 1488
563 Ga0495641_0007642 3300046461 Bacteria 6715
564 Ga0495651_0006073 3300046462 Bacteria 9224
565 Ga0495651_0044913 3300046462 Bacteria 3423
566 Ga0495653_0000578 3300046463 Bacteria 28112
567 Ga0495653_0008170 3300046463 Bacteria 8568
568 Ga0495650_0000383 3300046471 Bacteria 75998
569 Ga0495650_0000846 3300046471 Bacteria 36806
570 Ga0495580_0000763 3300046472 Bacteria 27666
571 Ga0495580_0018601 3300046472 Bacteria 5171
572 Ga0495580_0263420 3300046472 Bacteria 1179
573 Ga0495582_0000320 3300046473 Bacteria 26238
574 Ga0495605_0000665 3300046474 Bacteria 26127
575 Ga0495605_0011008 3300046474 Bacteria 5053
576 Ga0495605_0022422 3300046474 Bacteria 3335
577 Ga0495605_0037838 3300046474 Bacteria 2423
578 Ga0495664_0000261 3300046477 Bacteria 25528
579 Ga0495584_0000573 3300046491 Bacteria 24792
580 Ga0495584_0005997 3300046491 Bacteria 6400
581 Ga0495584_0014222 3300046491 Bacteria 4056
582 Ga0495584_0044014 3300046491 Bacteria 2253
583 Ga0495585_0000911 3300046492 Bacteria 25062
584 Ga0495585_0001878 3300046492 Bacteria 15827
585 Ga0495585_0019615 3300046492 Bacteria 3897
586 Ga0495594_0052422 3300046499 Bacteria 2246
587 Ga0495596_0000801 3300046500 Bacteria 19061
588 Ga0495596_0003413 3300046500 Bacteria 8055
589 Ga0495596_0008939 3300046500 Bacteria 4427
590 Ga0495607_0001240 3300046501 Bacteria 22879
591 Ga0495607_0001824 3300046501 Bacteria 18169
592 Ga0495607_0045539 3300046501 Bacteria 2579
593 Ga0495607_0049484 3300046501 Bacteria 2450
594 Ga0495607_0054906 3300046501 Bacteria 2294
595 Ga0495583_0000045 3300046506 Bacteria 220503
596 Ga0495583_0002856 3300046506 Bacteria 14055
597 Ga0495583_0019164 3300046506 Bacteria 3578
598 Ga0495583_0023795 3300046506 Bacteria 3090
599 Ga0495583_0069462 3300046506 Bacteria 1551
600 Ga0495606_0000360 3300046507 Bacteria 77832
601 Ga0495606_0005329 3300046507 Bacteria 12362
602 Ga0495606_0011366 3300046507 Bacteria 7269
603 Ga0495606_0034029 3300046507 Bacteria 3504
604 Ga0495606_0057561 3300046507 Bacteria 2503
605 Ga0495608_0007822 3300046511 Bacteria 7520
606 Ga0495608_0009704 3300046511 Bacteria 6718
607 Ga0495610_0007706 3300046512 Bacteria 7104
608 Ga0495610_0046016 3300046512 Bacteria 2156
609 Ga0495610_0056385 3300046512 Bacteria 1889
610 Ga0495616_0001927 3300046513 Bacteria 13959
611 Ga0495616_0008633 3300046513 Bacteria 6017
612 Ga0495616_0011082 3300046513 Bacteria 5180
613 Ga0495616_0016974 3300046513 Bacteria 4020
614 Ga0495618_0001870 3300046514 Bacteria 13883
615 Ga0495618_0002893 3300046514 Bacteria 10875
616 Ga0495618_0214361 3300046514 Bacteria 1216
617 Ga0495620_0001594 3300046515 Bacteria 13443
618 Ga0495628_0002356 3300046516 Bacteria 17046
619 Ga0495628_0005561 3300046516 Bacteria 11033
620 Ga0495628_0012017 3300046516 Bacteria 7303
621 Ga0495630_0000512 3300046517 Bacteria 28672
622 Ga0495631_0000752 3300046518 Bacteria 20761
623 Ga0495631_0011543 3300046518 Bacteria 4341
624 Ga0495632_0114174 3300046519 Bacteria 1266
625 Ga0495643_0000099 3300046522 Bacteria 145425
626 Ga0495643_0002592 3300046522 Bacteria 14095
627 Ga0495643_0038482 3300046522 Bacteria 2619
628 Ga0495643_0071574 3300046522 Bacteria 1820
629 Ga0495644_0000135 3300046523 Bacteria 35398
630 Ga0495644_0004017 3300046523 Bacteria 5785
631 Ga0495648_0000659 3300046524 Bacteria 36898
632 Ga0495648_0006023 3300046524 Bacteria 9959
633 Ga0495648_0030027 3300046524 Bacteria 3600
634 Ga0495648_0030583 3300046524 Bacteria 3557
635 Ga0495648_0032605 3300046524 Bacteria 3415
636 Ga0495648_0047035 3300046524 Bacteria 2670
637 Ga0495666_0000103 3300046526 Bacteria 34502
638 Ga0495642_0007016 3300046528 Bacteria 4323
639 Ga0495642_0071270 3300046528 Bacteria 1454
640 Ga0495652_0001284 3300046529 Bacteria 28084
641 Ga0495652_0003297 3300046529 Bacteria 16061
642 Ga0495652_0018130 3300046529 Bacteria 6282
643 Ga0495652_0020184 3300046529 Bacteria 5922
644 Ga0495665_0000233 3300046531 Bacteria 28084
645 Ga0495640_0004376 3300046533 Bacteria 11274
646 Ga0495586_0000365 3300046535 Bacteria 28006
647 Ga0495609_0000582 3300046538 Bacteria 28727
648 Ga0495609_0000604 3300046538 Bacteria 28136
649 Ga0495609_0000972 3300046538 Bacteria 20539
650 Ga0495609_0000992 3300046538 Bacteria 20251
651 Ga0495609_0034183 3300046538 Bacteria 2305
652 Ga0495597_0000172 3300046542 Bacteria 57536
653 Ga0495597_0005843 3300046542 Bacteria 6435
654 Ga0495597_0008165 3300046542 Bacteria 5265
655 Ga0495597_0015880 3300046542 Bacteria 3561
656 Ga0495597_0053820 3300046542 Bacteria 1769
657 Ga0495597_0073931 3300046542 Bacteria 1464
658 Ga0495645_0000480 3300046543 Bacteria 27638
659 Ga0495645_0018286 3300046543 Bacteria 5032
660 Ga0495622_0028162 3300046557 Bacteria 2623
661 Ga0495622_0107420 3300046557 Bacteria 1278
662 Ga0495633_0000349 3300046558 Bacteria 50979
663 Ga0495633_0002318 3300046558 Bacteria 13555
664 Ga0495633_0011431 3300046558 Bacteria 4787
665 Ga0495633_0012066 3300046558 Bacteria 4614
666 Ga0495633_0057090 3300046558 Bacteria 1834
667 Ga0495656_0028944 3300046615 Bacteria 2226
668 Ga0495656_0105906 3300046615 Bacteria 1308
669 Ga0495656_0209464 3300046615 Bacteria 971
670 Ga0495668_0000285 3300046616 Bacteria 70023
671 Ga0495668_0038149 3300046616 Bacteria 2686
672 Ga0495634_0000937 3300046642 Bacteria 27650
673 Ga0495611_0005392 3300046648 Bacteria 5473
674 Ga0495611_0006605 3300046648 Bacteria 4941
675 Ga0495611_0025671 3300046648 Bacteria 2569
676 Ga0495625_0001004 3300046660 Bacteria 37269
677 Ga0495625_0001275 3300046660 Bacteria 31649
678 Ga0495625_0003651 3300046660 Bacteria 15089
679 Ga0495625_0009741 3300046660 Bacteria 7997
680 Ga0495625_0013489 3300046660 Bacteria 6563
681 Ga0495625_0014512 3300046660 Bacteria 6280
682 Ga0495625_0027666 3300046660 Bacteria 4262
683 Ga0495625_0151120 3300046660 Bacteria 1561
684 Ga0495635_0001129 3300046663 Bacteria 17790
685 Ga0495635_0032334 3300046663 Bacteria 3630
686 Ga0495659_0000033 3300046664 Bacteria 64915
687 Ga0495659_0000294 3300046664 Bacteria 19839
688 Ga0495659_0021743 3300046664 Bacteria 2164
689 Ga0495659_0077394 3300046664 Bacteria 1256
690 Ga0495661_0000603 3300046665 Bacteria 36732
691 Ga0495661_0001041 3300046665 Bacteria 24617
692 Ga0495661_0002078 3300046665 Bacteria 15711
693 Ga0495661_0009392 3300046665 Bacteria 6713
694 Ga0495661_0012466 3300046665 Bacteria 5739
695 Ga0495661_0023083 3300046665 Bacteria 4042
696 Ga0495657_0159426 3300046675 Bacteria 1396
697 Ga0495599_0018939 3300046678 Bacteria 4290
698 Ga0495623_0002075 3300046679 Bacteria 13422
699 Ga0495623_0109893 3300046679 Bacteria 1672
700 Ga0495646_0000233 3300046680 Bacteria 27641
701 Ga0495646_0007025 3300046680 Bacteria 7149
702 Ga0495669_0061554 3300046684 Bacteria 1699
703 Ga0495669_0070356 3300046684 Bacteria 1594
704 Ga0495613_0001368 3300046689 Bacteria 18584
705 Ga0495624_0000625 3300046690 Bacteria 27666
706 Ga0495624_0024039 3300046690 Bacteria 4012
707 Ga0495670_0000252 3300046691 Bacteria 24908
708 Ga0495670_0000525 3300046691 Bacteria 18162
709 Ga0495670_0052519 3300046691 Bacteria 2041
710 Ga0495670_0058753 3300046691 Bacteria 1930
711 Ga0495671_0000398 3300046692 Bacteria 35463
712 Ga0495671_0008654 3300046692 Bacteria 5716
713 Ga0495649_0011261 3300046694 Bacteria 5255
714 Ga0495649_0075720 3300046694 Bacteria 1802
715 Ga0495649_0230265 3300046694 Bacteria 956
716 Ga0495589_0018258 3300046794 Bacteria 3598
717 Ga0495600_0000670 3300046809 Bacteria 17832
718 Ga0495660_0002258 3300046810 Bacteria 12399
719 Ga0495660_0018980 3300046810 Bacteria 3948
720 Ga0495581_0000632 3300047315 Bacteria 18401
721 Ga0495604_0003604 3300047317 Bacteria 12339
722 Ga0495604_0012180 3300047317 Bacteria 6836
723 Ga0495636_0000318 3300047318 Bacteria 18481
724 Ga0495674_0000945 3300047319 Bacteria 27666
725 Ga0495672_0000191 3300047320 Bacteria 88319
726 Ga0495672_0000257 3300047320 Bacteria 74176
727 Ga0495672_0000277 3300047320 Bacteria 71082
728 Ga0495672_0003583 3300047320 Bacteria 13203
729 Ga0495672_0038522 3300047320 Bacteria 2915
730 Ga0495676_0001514 3300047321 Bacteria 20095
731 Ga0495676_0042526 3300047321 Bacteria 3729
732 Ga0495680_0001203 3300047322 Bacteria 28389
733 Ga0495683_0000720 3300047323 Bacteria 24107
734 Ga0495683_0004676 3300047323 Bacteria 7712
735 Ga0495683_0007383 3300047323 Bacteria 5954
736 Ga0495683_0088482 3300047323 Bacteria 1503
737 Ga0495687_000666 3300047443 Bacteria 39241
738 Ga0495687_000677 3300047443 Bacteria 38715
739 Ga0495687_000710 3300047443 Bacteria 36977
740 Ga0495687_005170 3300047443 Bacteria 8445
741 Ga0495687_040707 3300047443 Bacteria 2044
742 Ga0495687_064105 3300047443 Bacteria 1501
743 Ga0495675_0002319 3300047444 Bacteria 11374
744 Ga0495677_0003824 3300047445 Bacteria 5823
745 Ga0495677_0004961 3300047445 Bacteria 5075
746 Ga0495677_0005822 3300047445 Bacteria 4665
747 Ga0495677_0010120 3300047445 Bacteria 3469
748 Ga0495677_0034066 3300047445 Bacteria 1857
749 Ga0495679_000820 3300047446 Bacteria 19744
750 Ga0495679_016535 3300047446 Bacteria 2667
751 Ga0495679_033145 3300047446 Bacteria 1652
752 Ga0495685_000093 3300047447 Bacteria 32265
753 Ga0495685_034250 3300047447 Bacteria 1745
754 Ga0495681_0001920 3300047470 Bacteria 15243
755 Ga0495681_0012266 3300047470 Bacteria 5048
756 Ga0495684_0003654 3300047471 Bacteria 11986
757 Ga0495684_0052760 3300047471 Bacteria 3103
758 Ga0495686_0000456 3300047472 Bacteria 61394
759 Ga0495686_0014904 3300047472 Bacteria 5333
760 Ga0495686_0017210 3300047472 Bacteria 4876
761 Ga0495686_0054385 3300047472 Bacteria 2506
762 Ga0495686_0065032 3300047472 Bacteria 2256
763 Ga0495686_0091814 3300047472 Bacteria 1842
764 Ga0495593_0001495 3300047673 Bacteria 13755
765 Ga0495602_0002606 3300048088 Bacteria 18420
766 Ga0495602_0025709 3300048088 Bacteria 5692
767 Ga0495602_0061370 3300048088 Bacteria 3269
768 Ga0495614_0000346 3300048089 Bacteria 18425
769 Ga0495626_0008206 3300048091 Bacteria 5751
770 Ga0496100_0117164 3300048903 Bacteria 1859
771 Ga0496102_0003649 3300048905 Bacteria 13020
772 Ga0496102_0034973 3300048905 Bacteria 4522
773 Ga0496102_0047852 3300048905 Bacteria 3888
774 Ga0496102_0099073 3300048905 Bacteria 2705
775 Ga0496102_0162044 3300048905 Bacteria 2104
776 Ga0496104_0010683 3300048907 Bacteria 8208
777 Ga0496106_0001363 3300048909 Bacteria 18291
778 Ga0496106_0283210 3300048909 Bacteria 1328
779 Ga0496106_0300261 3300048909 Bacteria 1288
780 Ga0496108_0149830 3300048911 Unclassified 2013
781 Ga0496108_0441164 3300048911 Bacteria 1137
782 Ga0496109_0060212 3300048912 Bacteria 3469
783 Ga0496109_0629302 3300048912 Bacteria 1010
784 Ga0496109_0715053 3300048912 Bacteria 939
785 Ga0496110_0023439 3300048913 Bacteria 5250
786 Ga0496110_0051847 3300048913 Bacteria 3606
787 Ga0496110_0125930 3300048913 Bacteria 2311
788 Ga0496110_0436027 3300048913 Bacteria 1194
789 Ga0496111_0122001 3300048914 Bacteria 1925
790 Ga0496111_0192227 3300048914 Bacteria 1517
791 Ga0496114_0001116 3300048917 Bacteria 20279
792 Ga0496114_0003346 3300048917 Bacteria 12323
793 Ga0496115_0030663 3300048918 Bacteria 4232
794 Ga0496116_0020463 3300048919 Bacteria 5025
795 Ga0496116_0051416 3300048919 Bacteria 2737
796 Ga0496116_0150357 3300048919 Bacteria 1294
797 Ga0496116_0158076 3300048919 Bacteria 1248
798 Ga0496117_0001889 3300048920 Bacteria 28087
799 Ga0496117_0009659 3300048920 Bacteria 8927
800 Ga0496117_0128318 3300048920 Bacteria 1542
801 Ga0496118_0000253 3300048921 Bacteria 94328
802 Ga0496118_0004703 3300048921 Bacteria 15996
803 Ga0496119_0033581 3300048922 Bacteria 3398
804 Ga0496120_0050446 3300048923 Bacteria 2383
805 Ga0496121_0005876 3300048924 Bacteria 15543
806 Ga0496121_0007911 3300048924 Bacteria 12718
807 Ga0496121_0029120 3300048924 Bacteria 5119
808 Ga0496121_0032418 3300048924 Bacteria 4749
809 Ga0496121_0053101 3300048924 Bacteria 3397
810 Ga0496121_0055122 3300048924 Bacteria 3315
811 Ga0496122_0000892 3300048925 Bacteria 55236
812 Ga0496122_0003634 3300048925 Bacteria 20065
813 Ga0496122_0128015 3300048925 Bacteria 1621
814 Ga0496123_0000842 3300048926 Bacteria 48999
815 Ga0496123_0016384 3300048926 Bacteria 6022
816 Ga0496124_0028640 3300048927 Bacteria 4980
817 Ga0496124_0034886 3300048927 Bacteria 4407
818 Ga0496124_0159830 3300048927 Bacteria 1757
819 Ga0496124_0168487 3300048927 Bacteria 1699
820 Ga0496124_0270532 3300048927 Bacteria 1245
821 Ga0496124_0537855 3300048927 Bacteria 774
822 Ga0496125_0000625 3300048928 Bacteria 59353
823 Ga0496125_0002058 3300048928 Bacteria 27177
824 Ga0496125_0002222 3300048928 Bacteria 25860
825 Ga0496125_0017830 3300048928 Bacteria 6755
826 Ga0496125_0021869 3300048928 Bacteria 5952
827 Ga0496125_0199133 3300048928 Bacteria 1313
828 Ga0496126_0007582 3300048929 Bacteria 11860
829 Ga0496126_0235461 3300048929 Bacteria 1532
830 Ga0495678_000262 3300049459 Bacteria 58570
831 Ga0495678_002136 3300049459 Bacteria 13979
832 Ga0495678_017397 3300049459 Bacteria 3260
833 Ga0495682_0000121 3300049460 Bacteria 68179
834 Ga0495682_0000195 3300049460 Bacteria 48762
835 Ga0495682_0016139 3300049460 Bacteria 2825
836 Ga0501031_0000250 3300049568 Bacteria 30138
837 Ga0501031_0008977 3300049568 Bacteria 6503
838 Ga0501031_0070194 3300049568 Bacteria 2282
839 Ga0501031_0260778 3300049568 Bacteria 1126
840 Ga0501032_0000524 3300049569 Bacteria 31194
841 Ga0501032_0002272 3300049569 Bacteria 15101
842 Ga0501032_0032528 3300049569 Bacteria 3574
843 Ga0501032_0065600 3300049569 Bacteria 2428
844 Ga0501032_0253693 3300049569 Bacteria 1141
845 Ga0501033_0000496 3300049570 Bacteria 37079
846 Ga0501033_0000732 3300049570 Bacteria 30126
847 Ga0501033_0002920 3300049570 Bacteria 14304
848 Ga0501033_0013435 3300049570 Bacteria 6236
849 Ga0501033_0123952 3300049570 Bacteria 1874
850 Ga0501034_0000067 3300049571 Bacteria 184398
851 Ga0501034_0001550 3300049571 Bacteria 30141
852 Ga0501034_0004537 3300049571 Bacteria 15432
853 Ga0501034_0008308 3300049571 Bacteria 10988
854 Ga0501036_0000414 3300049572 Bacteria 30141
855 Ga0501036_0033559 3300049572 Bacteria 4340
856 Ga0501036_0042011 3300049572 Bacteria 3870
857 Ga0501036_0053394 3300049572 Bacteria 3422
858 Ga0501037_0000509 3300049573 Bacteria 31179
859 Ga0501037_0015087 3300049573 Bacteria 5682
860 Ga0501037_0062584 3300049573 Bacteria 2712
861 Ga0501037_0203139 3300049573 Bacteria 1400
862 Ga0501037_0266015 3300049573 Bacteria 1197
863 Ga0501038_0000684 3300049574 Bacteria 30141
864 Ga0501038_0002220 3300049574 Bacteria 18066
865 Ga0501038_0085052 3300049574 Bacteria 2660
866 Ga0501038_0102723 3300049574 Bacteria 2378
867 Ga0501038_0350878 3300049574 Bacteria 1149
868 Ga0501038_0423320 3300049574 Unclassified 1027
869 Ga0501039_0000437 3300049575 Bacteria 30141
870 Ga0501039_0003748 3300049575 Bacteria 11423
871 Ga0501039_0017758 3300049575 Bacteria 5457
872 Ga0501039_0044986 3300049575 Bacteria 3410
873 Ga0501039_0074276 3300049575 Bacteria 2642
874 Ga0501039_0117362 3300049575 Bacteria 2084
875 Ga0501039_0150106 3300049575 Bacteria 1831
876 Ga0501039_0173563 3300049575 Bacteria 1695
877 Ga0501041_0084519 3300049577 Bacteria 1956
878 Ga0501042_0003635 3300049578 Bacteria 9726
879 Ga0501042_0020439 3300049578 Bacteria 4608
880 Ga0501043_0001892 3300049579 Bacteria 17933
881 Ga0501043_0003432 3300049579 Bacteria 13012
882 Ga0501043_0004152 3300049579 Bacteria 11835
883 Ga0501043_0064219 3300049579 Bacteria 2882
884 Ga0501043_0075340 3300049579 Bacteria 2650
885 Ga0501046_0002701 3300049580 Bacteria 16514
886 Ga0501046_0013687 3300049580 Bacteria 6858
887 Ga0501046_0069716 3300049580 Bacteria 2735
888 Ga0501046_0073183 3300049580 Bacteria 2660
889 Ga0501046_0111786 3300049580 Bacteria 2086
890 Ga0501046_0291857 3300049580 Bacteria 1193
891 Ga0501047_0003701 3300049581 Bacteria 14396
892 Ga0501047_0029100 3300049581 Bacteria 5327
893 Ga0501047_0034333 3300049581 Bacteria 4897
894 Ga0501047_0036793 3300049581 Bacteria 4731
895 Ga0501047_0249111 3300049581 Bacteria 1625
896 Ga0501048_0001718 3300049582 Bacteria 16695
897 Ga0501048_0048570 3300049582 Bacteria 3026
898 Ga0501067_0043773 3300049583 Bacteria 2487
899 Ga0501067_0102170 3300049583 Bacteria 1593
900 Ga0501067_0118711 3300049583 Bacteria 1471
901 Ga0501068_0016294 3300049584 Bacteria 4283
902 Ga0501068_0097685 3300049584 Bacteria 1818
903 Ga0501068_0135446 3300049584 Bacteria 1542
904 Ga0501070_0013356 3300049586 Bacteria 6926
905 Ga0501070_0070810 3300049586 Bacteria 2887
906 Ga0501071_0026754 3300049587 Bacteria 4052
907 Ga0501073_0032666 3300049589 Bacteria 3710
908 Ga0501073_0061722 3300049589 Bacteria 2615
909 Ga0501074_0171385 3300049590 Bacteria 1549
910 Ga0501075_0028419 3300049591 Bacteria 4128
911 Ga0501076_0018511 3300049592 Bacteria 5312
912 Ga0501079_0027185 3300049741 Bacteria 4386
913 Ga0501080_0005558 3300049742 Bacteria 11259
914 Ga0501080_0106730 3300049742 Bacteria 2595
915 Ga0501081_0025842 3300049743 Bacteria 3955
916 Ga0501083_0031591 3300049744 Bacteria 3634
917 Ga0501083_0257937 3300049744 Bacteria 1134
918 Ga0501035_0000986 3300049822 Bacteria 30120
919 Ga0501035_0003398 3300049822 Bacteria 15227
920 Ga0501035_0004909 3300049822 Bacteria 12691
921 Ga0501035_0051270 3300049822 Bacteria 3695
922 Ga0501035_0088823 3300049822 Bacteria 2722
923 Ga0501035_0240368 3300049822 Bacteria 1540
924 Ga0501044_0001253 3300049823 Bacteria 30141
925 Ga0501044_0005251 3300049823 Bacteria 14405
926 Ga0501044_0011708 3300049823 Bacteria 9503
927 Ga0501044_0186860 3300049823 Bacteria 2036
928 Ga0501044_0233358 3300049823 Bacteria 1786
929 Ga0501044_0325647 3300049823 Bacteria 1460
930 Ga0501045_0001489 3300049824 Bacteria 15588
931 Ga0501045_0051789 3300049824 Bacteria 2996
932 Ga0501045_0446303 3300049824 Bacteria 962
933 nmdc:mga00v17_253234_c1 3300050491 Bacteria 1142
934 nmdc:mga0yw44_10037_c1 3300050492 Bacteria 4817
935 nmdc:mga0yw44_63346_c1 3300050492 Bacteria 2273
936 nmdc:mga0k408_5452_c1 3300050493 Bacteria 4194
937 nmdc:mga05p37_57829_c1 3300050507 Bacteria 4775
938 nmdc:mga09592_61376_c1 3300050508 Bacteria 3180
939 nmdc:mga0qj67_7112_c1 3300050509 Bacteria 8257
940 nmdc:mga08y16_15476_c1 3300050511 Bacteria 8023
941 nmdc:mga08y16_332787_c1 3300050511 Bacteria 1562
942 nmdc:mga08y16_8074_c1 3300050511 Bacteria 11012
943 nmdc:mga0n895_102351_c1 3300050512 Bacteria 2875
944 nmdc:mga0n895_483991_c1 3300050512 Bacteria 1248
945 nmdc:mga0rr50_7235_c1 3300050513 Bacteria 6825
946 nmdc:mga0a205_5917_c1 3300050515 Bacteria 11021
947 Ga0495601_0071566 3300053077 Bacteria 2214
948 Ga0495612_0153355 3300053078 Bacteria 1004
949 Ga0500618_002522 3300053125 Bacteria 6835
950 Ga0500618_011796 3300053125 Bacteria 2308
951 Ga0500559_0000006 3300053136 Bacteria 229895
952 Ga0500568_0000226 3300053139 Bacteria 48324
953 Ga0500573_0171058 3300053140 Bacteria 1175
954 Ga0500604_0000948 3300053151 Bacteria 8035
955 Ga0500604_0028278 3300053151 Bacteria 1627
956 Ga0500619_000976 3300053154 Bacteria 4912
957 Ga0500622_0008388 3300053156 Bacteria 5784
958 Ga0500633_0000417 3300053160 Bacteria 6621
959 Ga0500634_0000006 3300053161 Bacteria 171639
960 Ga0500634_0171321 3300053161 Bacteria 988
961 Ga0500637_0211295 3300053178 Bacteria 1101
962 Ga0501084_0043075 3300054114 Bacteria 3776
963 Ga0501082_0056858 3300060353 Bacteria 3370
964 Ga0466962_0032555 3300061719 Bacteria 2495
965 Ga0530510_0033778 3300061734 Bacteria 3683

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048927 Ga0496124_0537855 Ga0496124_0537855_20_754 240
2 3300031711 Ga0265314_10079508 Ga0265314_100795082 250
3 3300048912 Ga0496109_0715053 Ga0496109_0715053_141_920 255
4 3300053151 Ga0500604_0000948 Ga0500604_0000948_4383_5165 259
5 3300048919 Ga0496116_0150357 Ga0496116_0150357_176_997 262
6 3300050491 nmdc:mga00v17_253234_c1 nmdc:mga00v17_253234_c1_72_893 262
7 3300046684 Ga0495669_0070356 Ga0495669_0070356_225_1028 264
8 3300046615 Ga0495656_0105906 Ga0495656_0105906_10_819 266
9 3300048922 Ga0496119_0033581 Ga0496119_0033581_237_1046 269
10 3300048927 Ga0496124_0168487 Ga0496124_0168487_325_1134 269
11 3300049568 Ga0501031_0000250 Ga0501031_0000250_26921_27805 270
12 3300049569 Ga0501032_0000524 Ga0501032_0000524_26921_27805 270
13 3300049570 Ga0501033_0000732 Ga0501033_0000732_2322_3206 270
14 3300049571 Ga0501034_0001550 Ga0501034_0001550_26921_27805 270
15 3300049572 Ga0501036_0000414 Ga0501036_0000414_26921_27805 270
16 3300049573 Ga0501037_0000509 Ga0501037_0000509_3390_4274 270
17 3300049574 Ga0501038_0000684 Ga0501038_0000684_26921_27805 270
18 3300049575 Ga0501039_0000437 Ga0501039_0000437_2337_3221 270
19 3300049579 Ga0501043_0003432 Ga0501043_0003432_1357_2241 270
20 3300049580 Ga0501046_0111786 Ga0501046_0111786_1079_1963 270
21 3300049581 Ga0501047_0034333 Ga0501047_0034333_2337_3221 270
22 3300049822 Ga0501035_0000986 Ga0501035_0000986_26921_27805 270
23 3300049823 Ga0501044_0001253 Ga0501044_0001253_26921_27805 270
24 3300028577 Ga0265318_10034601 Ga0265318_100346012 273
25 3300031238 Ga0265332_10043875 Ga0265332_100438752 273
26 3300031240 Ga0265320_10027214 Ga0265320_100272143 273
27 3300031344 Ga0265316_10042225 Ga0265316_100422254 273
28 3300028563 Ga0265319_1005869 Ga0265319_10058694 277
29 3300031595 Ga0265313_10009885 Ga0265313_100098856 277
30 3300031712 Ga0265342_10007237 Ga0265342_100072375 277
31 3300035691 Ga0373931_0347032 Ga0373931_0347032_46_888 277
32 3300039450 Ga0436363_0089457 Ga0436363_0089457_117_1061 277
33 3300042876 Ga0451577_0077478 Ga0451577_0077478_838_1698 277
34 3300044712 Ga0453684_0090090 Ga0453684_0090090_217_1077 277
35 3300045051 Ga0451576_0195537 Ga0451576_0195537_1012_1872 277
36 3300046491 Ga0495584_0014222 Ga0495584_0014222_2944_3786 277
37 3300046500 Ga0495596_0008939 Ga0495596_0008939_2660_3502 277
38 3300046501 Ga0495607_0001240 Ga0495607_0001240_16505_17347 277
39 3300046506 Ga0495583_0069462 Ga0495583_0069462_683_1525 277
40 3300046507 Ga0495606_0005329 Ga0495606_0005329_1201_2043 277
41 3300046542 Ga0495597_0005843 Ga0495597_0005843_4197_5039 277
42 3300046694 Ga0495649_0230265 Ga0495649_0230265_27_869 277
43 3300049584 Ga0501068_0135446 Ga0501068_0135446_682_1524 277
44 3300031731 Ga0307405_10486539 Ga0307405_104865391 279
45 3300031852 Ga0307410_10031802 Ga0307410_100318022 279
46 3300031995 Ga0307409_100095333 Ga0307409_1000953332 279
47 3300032002 Ga0307416_100572593 Ga0307416_1005725932 279
48 3300032126 Ga0307415_100074023 Ga0307415_1000740232 279
49 iso_pu_bacteria 2818991439 2819561715 279
50 iso_pu_bacteria 2821123053 2821130565 279
51 iso_pu_bacteria 2842922631 2842927458 279
52 iso_pu_bacteria 2929138655 2929143919 279
53 iso_pu_bacteria 2979100975 2979102933 279
54 iso_pu_bacteria 2984509177 2984513979 279
55 iso_pu_bacteria 2984518228 2984523012 279
56 iso_pu_bacteria 2984537506 2984542452 279
57 iso_pu_bacteria 2984601300 2984606244 279
58 3300021384 Ga0213876_10000781 Ga0213876_1000078118 280
59 3300039437 Ga0436365_0090629 Ga0436365_0090629_36904_37842 280
60 3300003659 JGI25404J52841_10045227 JGI25404J52841_100452271 281
61 3300028800 Ga0265338_10000415 Ga0265338_1000041511 281
62 3300037312 Ga0395899_0309664 Ga0395899_0309664_183_1037 281
63 3300039447 Ga0436361_0699509 Ga0436361_0699509_11_868 281
64 3300046471 Ga0495650_0000846 Ga0495650_0000846_5791_6645 281
65 3300046492 Ga0495585_0000911 Ga0495585_0000911_13777_14631 281
66 3300046499 Ga0495594_0052422 Ga0495594_0052422_33_887 281
67 3300046538 Ga0495609_0000972 Ga0495609_0000972_352_1206 281
68 3300046557 Ga0495622_0028162 Ga0495622_0028162_1434_2288 281
69 3300047443 Ga0495687_000666 Ga0495687_000666_10765_11619 281
70 3300053151 Ga0500604_0028278 Ga0500604_0028278_329_1207 281
71 iso_pu_bacteria 2643221580 2643909592 281
72 iso_pu_bacteria 2643221674 2644413724 281
73 3300021441 Ga0213871_10040704 Ga0213871_100407042 282
74 3300039438 Ga0436360_0350415 Ga0436360_0350415_488_1387 282
75 3300049569 Ga0501032_0253693 Ga0501032_0253693_14_865 282
76 iso_pu_bacteria 2675903060 2676491636 282
77 iso_pu_bacteria 2895427314 2895428175 282
78 iso_pu_bacteria 2895442618 2895449614 282
79 3300003856 Ga0058692_1000086 Ga0058692_100008652 283
80 3300027312 Ga0209371_1000003 Ga0209371_100000339 283
81 3300030500 Ga0268256_1000004 Ga0268256_10000041012 283
82 3300048924 Ga0496121_0029120 Ga0496121_0029120_3736_4587 283
83 iso_pu_bacteria 2887443736 2887447787 283
84 3300005367 Ga0070667_100080860 Ga0070667_1000808602 284
85 3300009765 Ga0123341_1000059 Ga0123341_100005917 284
86 3300025924 Ga0207694_10450320 Ga0207694_104503202 284
87 3300025986 Ga0207658_10184262 Ga0207658_101842622 284
88 3300044683 Ga0466965_0058929 Ga0466965_0058929_381_1238 284
89 3300044693 Ga0466961_0081899 Ga0466961_0081899_306_1175 284
90 3300044765 Ga0466970_0182426 Ga0466970_0182426_211_1080 284
91 3300049583 Ga0501067_0118711 Ga0501067_0118711_45_971 284
92 3300053156 Ga0500622_0008388 Ga0500622_0008388_3805_4683 284
93 iso_pu_bacteria 2891048133 2891050586 284
94 iso_pu_bacteria 2995392953 2995396088 284
95 3300005841 Ga0068863_100331272 Ga0068863_1003312722 285
96 3300025923 Ga0207681_10136039 Ga0207681_101360392 285
97 3300026088 Ga0207641_10176140 Ga0207641_101761402 285
98 3300048920 Ga0496117_0001889 Ga0496117_0001889_13869_14768 285
99 3300048921 Ga0496118_0004703 Ga0496118_0004703_13948_14847 285
100 iso_pu_bacteria 2842395702 2842396844 285
101 iso_pu_bacteria 8055172936 8055177136 285
102 3300044656 Ga0466969_0009508 Ga0466969_0009508_840_1706 286
103 iso_pu_bacteria 2510065019 2510134471 286
104 iso_pu_bacteria 2515075009 2515113634 286
105 iso_pu_bacteria 2534681796 2535518098 286
106 iso_pu_bacteria 2582581294 2585202643 286
107 iso_pu_bacteria 2582581298 2585225146 286
108 iso_pu_bacteria 2582581867 2585403056 286
109 iso_pu_bacteria 2585427529 2585547702 286
110 iso_pu_bacteria 2585427590 2585823880 286
111 iso_pu_bacteria 2615840624 2616297803 286
112 iso_pu_bacteria 2643221629 2644169634 286
113 iso_pu_bacteria 2643221662 2644350270 286
114 iso_pu_bacteria 2724679232 2725949314 286
115 iso_pu_bacteria 2791355267 2793366589 286
116 iso_pu_bacteria 2854916844 2854919350 286
117 iso_pu_bacteria 2870721527 2870726697 286
118 iso_pu_bacteria 2919100787 2919105702 286
119 iso_pu_bacteria 2919171160 2919173795 286
120 iso_pu_bacteria 3005445848 3005448941 286
121 iso_pu_bacteria 8005301065 8005306218 286
122 iso_pu_bacteria 8005460587 8005464321 286
123 iso_pu_bacteria 8005542996 8005548982 286
124 iso_pu_bacteria 8005688590 8005694085 286
125 iso_pu_bacteria 8018127388 8018132072 286
126 3300005330 Ga0070690_100236319 Ga0070690_1002363192 287
127 3300006846 Ga0075430_100042004 Ga0075430_1000420046 287
128 3300006846 Ga0075430_100258100 Ga0075430_1002581002 287
129 3300028563 Ga0265319_1057627 Ga0265319_10576272 287
130 3300031238 Ga0265332_10081829 Ga0265332_100818292 287
131 3300035725 Ga0373947_0148638 Ga0373947_0148638_56_943 287
132 3300044683 Ga0466965_0024249 Ga0466965_0024249_1448_2320 287
133 3300049580 Ga0501046_0073183 Ga0501046_0073183_1641_2516 287
134 3300049744 Ga0501083_0031591 Ga0501083_0031591_654_1529 287
135 3300050509 nmdc:mga0qj67_7112_c1 nmdc:mga0qj67_7112_c1_2120_3031 287
136 iso_pu_bacteria 2597490356 2599101275 287
137 iso_pu_bacteria 2897803580 2897805890 287
138 iso_pu_bacteria 641522639 641646303 287
139 3300027682 Ga0209971_1004191 Ga0209971_10041913 288
140 3300031548 Ga0307408_100182846 Ga0307408_1001828462 288
141 3300032004 Ga0307414_10017306 Ga0307414_100173062 288
142 3300041997 Ga0439431_0053006 Ga0439431_0053006_102_1040 288
143 3300042530 Ga0450916_005623 Ga0450916_005623_436_1380 288
144 iso_pu_bacteria 2511231003 2511251825 288
145 iso_pu_bacteria 2521172590 2521559185 288
146 iso_pu_bacteria 2548876994 2550693862 288
147 iso_pu_bacteria 2643221550 2643772267 288
148 iso_pu_bacteria 2643221554 2643790612 288
149 iso_pu_bacteria 2643221603 2644026741 288
150 iso_pu_bacteria 2643221638 2644211550 288
151 iso_pu_bacteria 2643221645 2644251843 288
152 iso_pu_bacteria 2643221664 2644360503 288
153 iso_pu_bacteria 2738541280 2738740457 288
154 iso_pu_bacteria 2738541300 2738843290 288
155 iso_pu_bacteria 2738543018 2739272073 288
156 iso_pu_bacteria 2738543030 2739341117 288
157 iso_pu_bacteria 2738543031 2739347184 288
158 iso_pu_bacteria 2765235838 2765570387 288
159 iso_pu_bacteria 2808606386 2808981361 288
160 iso_pu_bacteria 2808606415 2809128947 288
161 iso_pu_bacteria 2808606418 2809146308 288
162 iso_pu_bacteria 2808606419 2809148568 288
163 iso_pu_bacteria 2816332139 2816510022 288
164 iso_pu_bacteria 2818991436 2819542895 288
165 iso_pu_bacteria 2818991445 2819595135 288
166 iso_pu_bacteria 2818991449 2819615699 288
167 iso_pu_bacteria 2839094727 2839097933 288
168 iso_pu_bacteria 2842711865 2842715639 288
169 iso_pu_bacteria 2852618963 2852621101 288
170 iso_pu_bacteria 2884811622 2884811635 288
171 iso_pu_bacteria 2884836552 2884836841 288
172 iso_pu_bacteria 2884852848 2884853132 288
173 iso_pu_bacteria 2896154374 2896155750 288
174 iso_pu_bacteria 2904439833 2904443505 288
175 iso_pu_bacteria 2904530477 2904532487 288
176 iso_pu_bacteria 2904584206 2904584956 288
177 iso_pu_bacteria 2904589729 2904591478 288
178 iso_pu_bacteria 2904601388 2904605498 288
179 iso_pu_bacteria 2915358134 2915359440 288
180 iso_pu_bacteria 2919046199 2919048253 288
181 iso_pu_bacteria 2919079590 2919081272 288
182 iso_pu_bacteria 8047710418 8047718016 288
183 iso_pu_bacteria 8048746797 8048747050 288
184 iso_pu_bacteria 8055066027 8055068709 288
185 iso_pu_bacteria 8057575449 8057581411 288
186 3300003794 Ga0055531_10002864 Ga0055531_1000286411 289
187 3300005445 Ga0070708_100155966 Ga0070708_1001559662 289
188 3300005985 Ga0081539_10008288 Ga0081539_100082883 289
189 3300006028 Ga0070717_10048879 Ga0070717_100488792 289
190 3300021358 Ga0213873_10001831 Ga0213873_100018313 289
191 3300021361 Ga0213872_10004201 Ga0213872_100042013 289
192 3300021441 Ga0213871_10007967 Ga0213871_100079671 289
193 3300025304 Ga0209257_1003961 Ga0209257_100396111 289
194 3300039437 Ga0436365_0342453 Ga0436365_0342453_482_1381 289
195 3300039438 Ga0436360_0989059 Ga0436360_0989059_3144_4043 289
196 3300039453 Ga0436362_0984138 Ga0436362_0984138_2034_2933 289
197 iso_pu_bacteria 2508501127 2509144038 289
198 iso_pu_bacteria 2513237305 2514419881 289
199 iso_pu_bacteria 2597489875 2597813623 289
200 iso_pu_bacteria 2643221555 2643793604 289
201 iso_pu_bacteria 2693429783 2694631878 289
202 iso_pu_bacteria 2693429784 2694634703 289
203 iso_pu_bacteria 2721755686 2723576033 289
204 iso_pu_bacteria 2841734538 2841740488 289
205 iso_pu_bacteria 2847686936 2847687104 289
206 iso_pu_bacteria 2856342000 2856345868 289
207 iso_pu_bacteria 2856364286 2856367152 289
208 iso_pu_bacteria 2869169390 2869173381 289
209 iso_pu_bacteria 2869285874 2869287519 289
210 iso_pu_bacteria 2871429161 2871431046 289
211 iso_pu_bacteria 2871444079 2871448820 289
212 iso_pu_bacteria 2871474448 2871481028 289
213 iso_pu_bacteria 2871488783 2871495286 289
214 iso_pu_bacteria 2874102143 2874108385 289
215 iso_pu_bacteria 2874146452 2874150215 289
216 iso_pu_bacteria 2874155637 2874157285 289
217 iso_pu_bacteria 2876369609 2876371359 289
218 iso_pu_bacteria 2876392853 2876395299 289
219 iso_pu_bacteria 2876413966 2876415668 289
220 iso_pu_bacteria 2878745973 2878747667 289
221 iso_pu_bacteria 2878753008 2878758047 289
222 iso_pu_bacteria 2881161766 2881161827 289
223 iso_pu_bacteria 2881845957 2881851108 289
224 iso_pu_bacteria 2881861095 2881865138 289
225 iso_pu_bacteria 2882632389 2882633028 289
226 iso_pu_bacteria 2882912400 2882914953 289
227 iso_pu_bacteria 2885318864 2885323972 289
228 iso_pu_bacteria 2888343758 2888347905 289
229 iso_pu_bacteria 2889010040 2889011969 289
230 iso_pu_bacteria 2903492973 2903501570 289
231 iso_pu_bacteria 2903492973 2903502053 289
232 iso_pu_bacteria 2904659560 2904661929 289
233 iso_pu_bacteria 2906308376 2906310059 289
234 iso_pu_bacteria 2906321335 2906322932 289
235 iso_pu_bacteria 2906328253 2906332882 289
236 iso_pu_bacteria 2922158528 2922159671 289
237 iso_pu_bacteria 2924733363 2924736099 289
238 iso_pu_bacteria 2924754689 2924754870 289
239 iso_pu_bacteria 2924784321 2924784760 289
240 iso_pu_bacteria 2937813078 2937813358 289
241 iso_pu_bacteria 2937836603 2937839956 289
242 iso_pu_bacteria 2937891427 2937895343 289
243 iso_pu_bacteria 2958115193 2958122459 289
244 iso_pu_bacteria 2958130278 2958131922 289
245 iso_pu_bacteria 2958179912 2958181725 289
246 iso_pu_bacteria 2961077736 2961079568 289
247 iso_pu_bacteria 2961114664 2961117083 289
248 iso_pu_bacteria 2961170736 2961174677 289
249 iso_pu_bacteria 2965062239 2965066711 289
250 iso_pu_bacteria 2967996073 2968000612 289
251 iso_pu_bacteria 2968003550 2968010015 289
252 iso_pu_bacteria 2968091066 2968092541 289
253 iso_pu_bacteria 2968097103 2968101690 289
254 iso_pu_bacteria 2968110612 2968112991 289
255 iso_pu_bacteria 2968117919 2968123844 289
256 iso_pu_bacteria 2968128360 2968128729 289
257 iso_pu_bacteria 2970503327 2970507263 289
258 iso_pu_bacteria 2970524798 2970529977 289
259 iso_pu_bacteria 2970540015 2970546948 289
260 iso_pu_bacteria 2977821940 2977828879 289
261 iso_pu_bacteria 2977843712 2977845358 289
262 iso_pu_bacteria 2977858184 2977862239 289
263 iso_pu_bacteria 2979808191 2979812459 289
264 iso_pu_bacteria 2987652177 2987658258 289
265 iso_pu_bacteria 2989349275 2989352049 289
266 iso_pu_bacteria 2996336353 2996340618 289
267 iso_pu_bacteria 2996341866 2996347131 289
268 iso_pu_bacteria 3000135777 3000136133 289
269 iso_pu_bacteria 8004374579 8004379559 289
270 iso_pu_bacteria 8004387939 8004390258 289
271 iso_pu_bacteria 8004445564 8004451748 289
272 iso_pu_bacteria 8004703790 8004714419 289
273 iso_pu_bacteria 8004714634 8004716321 289
274 iso_pu_bacteria 8055617313 8055622041 289
275 3300002773 JGI25152J39213_1002643 JGI25152J39213_10026431 290
276 3300002773 JGI25152J39213_1002734 JGI25152J39213_10027343 290
277 3300002773 JGI25152J39213_1011499 JGI25152J39213_10114992 290
278 3300002774 JGI25150J39212_1004088 JGI25150J39212_10040881 290
279 3300002987 JGI25159J45721_1001272 JGI25159J45721_10012724 290
280 3300003187 JGI25151J46595_10001104 JGI25151J46595_100011045 290
281 3300003187 JGI25151J46595_10045182 JGI25151J46595_100451821 290
282 3300003215 JGI25153J46596_10004410 JGI25153J46596_100044107 290
283 3300003215 JGI25153J46596_10005483 JGI25153J46596_100054836 290
284 3300003215 JGI25153J46596_10030291 JGI25153J46596_100302911 290
285 3300003320 rootH2_10032358 rootH2_100323587 290
286 3300003323 rootH1_10108747 rootH1_101087471 290
287 3300003354 JGI25160J50197_1006241 JGI25160J50197_10062411 290
288 3300003374 JGI25161J50226_1000079 JGI25161J50226_100007922 290
289 3300003771 Ga0055526_1007163 Ga0055526_10071632 290
290 3300003771 Ga0055526_1009071 Ga0055526_10090714 290
291 3300003790 Ga0055528_1029743 Ga0055528_10297432 290
292 3300003792 Ga0055540_1024817 Ga0055540_10248172 290
293 3300004625 Ga0055543_1000031 Ga0055543_10000317 290
294 3300005262 Ga0065165_1005147 Ga0065165_10051474 290
295 3300005327 Ga0070658_10185638 Ga0070658_101856382 290
296 3300005458 Ga0070681_10219589 Ga0070681_102195891 290
297 3300005468 Ga0070707_100005918 Ga0070707_1000059184 290
298 3300005471 Ga0070698_100098284 Ga0070698_1000982844 290
299 3300005471 Ga0070698_100376174 Ga0070698_1003761742 290
300 3300005518 Ga0070699_100028974 Ga0070699_1000289743 290
301 3300005530 Ga0070679_100058363 Ga0070679_1000583634 290
302 3300005536 Ga0070697_100022227 Ga0070697_1000222274 290
303 3300006175 Ga0070712_100002440 Ga0070712_1000024408 290
304 3300013105 Ga0157369_10235678 Ga0157369_102356782 290
305 3300021361 Ga0213872_10036269 Ga0213872_100362691 290
306 3300025208 Ga0209436_100110 Ga0209436_1001107 290
307 3300025245 Ga0207425_1000730 Ga0207425_10007305 290
308 3300025258 Ga0209129_1000300 Ga0209129_10003006 290
309 3300025258 Ga0209129_1000370 Ga0209129_10003703 290
310 3300025258 Ga0209129_1000786 Ga0209129_10007866 290
311 3300025258 Ga0209129_1001338 Ga0209129_10013388 290
312 3300025273 Ga0209673_1008713 Ga0209673_10087133 290
313 3300025284 Ga0209130_1000023 Ga0209130_1000023242 290
314 3300025294 Ga0209025_1000505 Ga0209025_100050553 290
315 3300025294 Ga0209025_1006291 Ga0209025_10062913 290
316 3300025294 Ga0209025_1007217 Ga0209025_10072172 290
317 3300025295 Ga0209564_1000393 Ga0209564_10003933 290
318 3300025297 Ga0209758_1000390 Ga0209758_100039025 290
319 3300025297 Ga0209758_1000422 Ga0209758_100042225 290
320 3300025297 Ga0209758_1000766 Ga0209758_10007666 290
321 3300025299 Ga0209256_1002555 Ga0209256_10025555 290
322 3300025302 Ga0207426_1000087 Ga0207426_1000087120 290
323 3300025302 Ga0207426_1007150 Ga0207426_10071502 290
324 3300025303 Ga0209051_1012329 Ga0209051_10123293 290
325 3300025304 Ga0209257_1005314 Ga0209257_10053143 290
326 3300025901 Ga0207688_10193029 Ga0207688_101930292 290
327 3300025915 Ga0207693_10004734 Ga0207693_100047344 290
328 3300025921 Ga0207652_10046407 Ga0207652_100464072 290
329 3300025922 Ga0207646_10028674 Ga0207646_100286743 290
330 3300026121 Ga0207683_10380651 Ga0207683_103806512 290
331 3300030521 Ga0307511_10001889 Ga0307511_1000188917 290
332 3300031548 Ga0307408_100368771 Ga0307408_1003687712 290
333 3300031730 Ga0307516_10258941 Ga0307516_102589412 290
334 3300031901 Ga0307406_10239874 Ga0307406_102398742 290
335 3300031995 Ga0307409_100484635 Ga0307409_1004846351 290
336 3300035691 Ga0373931_0009078 Ga0373931_0009078_311_1186 290
337 3300037853 Ga0436364_1350694 Ga0436364_1350694_314_1201 290
338 3300039447 Ga0436361_0143802 Ga0436361_0143802_205_1320 290
339 3300041486 Ga0451807_1740877 Ga0451807_1740877_310_1185 290
340 3300044694 Ga0466963_0319334 Ga0466963_0319334_25_909 290
341 3300044901 Ga0466960_0267178 Ga0466960_0267178_14_898 290
342 3300046474 Ga0495605_0011008 Ga0495605_0011008_1700_2575 290
343 3300046506 Ga0495583_0002856 Ga0495583_0002856_10717_11592 290
344 3300046506 Ga0495583_0023795 Ga0495583_0023795_298_1173 290
345 3300046512 Ga0495610_0056385 Ga0495610_0056385_687_1562 290
346 3300046513 Ga0495616_0001927 Ga0495616_0001927_2386_3261 290
347 3300046515 Ga0495620_0001594 Ga0495620_0001594_2493_3368 290
348 3300046522 Ga0495643_0002592 Ga0495643_0002592_2510_3385 290
349 3300046542 Ga0495597_0008165 Ga0495597_0008165_1989_2864 290
350 3300046660 Ga0495625_0009741 Ga0495625_0009741_2430_3305 290
351 3300046694 Ga0495649_0075720 Ga0495649_0075720_348_1223 290
352 3300047323 Ga0495683_0004676 Ga0495683_0004676_812_1687 290
353 3300047443 Ga0495687_005170 Ga0495687_005170_6240_7115 290
354 3300047471 Ga0495684_0052760 Ga0495684_0052760_1608_2498 290
355 3300047472 Ga0495686_0017210 Ga0495686_0017210_1695_2570 290
356 3300048091 Ga0495626_0008206 Ga0495626_0008206_2484_3359 290
357 3300048920 Ga0496117_0128318 Ga0496117_0128318_637_1512 290
358 3300048923 Ga0496120_0050446 Ga0496120_0050446_702_1592 290
359 3300048924 Ga0496121_0007911 Ga0496121_0007911_321_1196 290
360 3300048928 Ga0496125_0021869 Ga0496125_0021869_4095_4970 290
361 3300049459 Ga0495678_017397 Ga0495678_017397_99_974 290
362 3300049569 Ga0501032_0002272 Ga0501032_0002272_4315_5223 290
363 3300049570 Ga0501033_0000496 Ga0501033_0000496_26997_27905 290
364 3300049571 Ga0501034_0004537 Ga0501034_0004537_10210_11118 290
365 3300049572 Ga0501036_0033559 Ga0501036_0033559_2684_3583 290
366 3300049573 Ga0501037_0015087 Ga0501037_0015087_4221_5129 290
367 3300049574 Ga0501038_0002220 Ga0501038_0002220_4287_5195 290
368 3300049575 Ga0501039_0003748 Ga0501039_0003748_1645_2553 290
369 3300049579 Ga0501043_0001892 Ga0501043_0001892_10595_11503 290
370 3300049581 Ga0501047_0003701 Ga0501047_0003701_9174_10082 290
371 3300049581 Ga0501047_0249111 Ga0501047_0249111_447_1346 290
372 3300049584 Ga0501068_0097685 Ga0501068_0097685_343_1218 290
373 3300049590 Ga0501074_0171385 Ga0501074_0171385_121_1020 290
374 3300049744 Ga0501083_0257937 Ga0501083_0257937_220_1095 290
375 3300049822 Ga0501035_0003398 Ga0501035_0003398_9183_10091 290
376 3300049823 Ga0501044_0005251 Ga0501044_0005251_9183_10091 290
377 3300050511 nmdc:mga08y16_332787_c1 nmdc:mga08y16_332787_c1_115_1008 290
378 3300050512 nmdc:mga0n895_483991_c1 nmdc:mga0n895_483991_c1_321_1205 290
379 3300053161 Ga0500634_0000006 Ga0500634_0000006_83730_84605 290
380 3300053161 Ga0500634_0171321 Ga0500634_0171321_81_956 290
381 3300053178 Ga0500637_0211295 Ga0500637_0211295_169_1086 290
382 3300002704 JGI25155J39150_1000898 JGI25155J39150_10008982 291
383 3300002704 JGI25155J39150_1000924 JGI25155J39150_10009243 291
384 3300002705 JGI25156J39149_1004604 JGI25156J39149_10046042 291
385 3300002737 JGI25162J39368_1000420 JGI25162J39368_100042016 291
386 3300002737 JGI25162J39368_1006253 JGI25162J39368_10062532 291
387 3300002738 JGI25154J39366_1000840 JGI25154J39366_10008403 291
388 3300002738 JGI25154J39366_1004395 JGI25154J39366_10043953 291
389 3300002741 JGI25157J39369_1000918 JGI25157J39369_100091811 291
390 3300002771 JGI25163J39215_1002583 JGI25163J39215_10025832 291
391 3300002773 JGI25152J39213_1000181 JGI25152J39213_100018131 291
392 3300002774 JGI25150J39212_1000357 JGI25150J39212_10003573 291
393 3300002987 JGI25159J45721_1001631 JGI25159J45721_10016315 291
394 3300002987 JGI25159J45721_1006561 JGI25159J45721_10065612 291
395 3300003187 JGI25151J46595_10004657 JGI25151J46595_100046576 291
396 3300003214 JGI25165J46597_1000547 JGI25165J46597_100054716 291
397 3300003215 JGI25153J46596_10004839 JGI25153J46596_100048393 291
398 3300003354 JGI25160J50197_1009997 JGI25160J50197_10099972 291
399 3300003374 JGI25161J50226_1000409 JGI25161J50226_100040913 291
400 3300003374 JGI25161J50226_1006338 JGI25161J50226_10063382 291
401 3300003659 JGI25404J52841_10014882 JGI25404J52841_100148822 291
402 3300003751 Ga0055538_1000209 Ga0055538_100020916 291
403 3300003751 Ga0055538_1000664 Ga0055538_10006644 291
404 3300003752 Ga0055539_1000251 Ga0055539_100025116 291
405 3300003752 Ga0055539_1000557 Ga0055539_10005574 291
406 3300003756 Ga0055533_1000242 Ga0055533_100024216 291
407 3300003756 Ga0055533_1000718 Ga0055533_10007184 291
408 3300003758 Ga0055532_1000097 Ga0055532_10000971 291
409 3300003759 Ga0055525_1000338 Ga0055525_100033816 291
410 3300003759 Ga0055525_1000759 Ga0055525_10007594 291
411 3300003761 Ga0055535_1005969 Ga0055535_10059691 291
412 3300003763 Ga0055529_1000032 Ga0055529_1000032144 291
413 3300003771 Ga0055526_1000402 Ga0055526_100040232 291
414 3300003771 Ga0055526_1000951 Ga0055526_10009517 291
415 3300003771 Ga0055526_1001247 Ga0055526_10012473 291
416 3300003771 Ga0055526_1014548 Ga0055526_10145483 291
417 3300003773 Ga0055537_1000030 Ga0055537_100003065 291
418 3300003773 Ga0055537_1003332 Ga0055537_10033323 291
419 3300003775 Ga0055524_1000851 Ga0055524_100085110 291
420 3300003775 Ga0055524_1002689 Ga0055524_10026896 291
421 3300003775 Ga0055524_1016960 Ga0055524_10169602 291
422 3300003775 Ga0055524_1017942 Ga0055524_10179423 291
423 3300003784 Ga0055534_1000203 Ga0055534_100020331 291
424 3300003784 Ga0055534_1001261 Ga0055534_100126111 291
425 3300003784 Ga0055534_1012691 Ga0055534_10126912 291
426 3300003790 Ga0055528_1000439 Ga0055528_100043926 291
427 3300003790 Ga0055528_1005416 Ga0055528_10054163 291
428 3300003791 Ga0055530_10000604 Ga0055530_100006043 291
429 3300003794 Ga0055531_10001184 Ga0055531_1000118414 291
430 3300003841 Ga0055541_1000149 Ga0055541_100014916 291
431 3300003841 Ga0055541_1000513 Ga0055541_10005134 291
432 3300004625 Ga0055543_1000550 Ga0055543_100055013 291
433 3300005262 Ga0065165_1001805 Ga0065165_10018053 291
434 3300005330 Ga0070690_100000109 Ga0070690_10000010922 291
435 3300005331 Ga0070670_100371130 Ga0070670_1003711301 291
436 3300005334 Ga0068869_100000272 Ga0068869_1000002724 291
437 3300005336 Ga0070680_100265547 Ga0070680_1002655471 291
438 3300005340 Ga0070689_100012618 Ga0070689_1000126182 291
439 3300005341 Ga0070691_10015476 Ga0070691_100154763 291
440 3300005343 Ga0070687_100011426 Ga0070687_1000114261 291
441 3300005344 Ga0070661_100397586 Ga0070661_1003975861 291
442 3300005366 Ga0070659_100112112 Ga0070659_1001121122 291
443 3300005367 Ga0070667_100031798 Ga0070667_1000317984 291
444 3300005367 Ga0070667_100237047 Ga0070667_1002370472 291
445 3300005436 Ga0070713_100305292 Ga0070713_1003052921 291
446 3300005438 Ga0070701_10000446 Ga0070701_100004469 291
447 3300005439 Ga0070711_100175933 Ga0070711_1001759332 291
448 3300005439 Ga0070711_100341124 Ga0070711_1003411241 291
449 3300005441 Ga0070700_100000237 Ga0070700_10000023724 291
450 3300005441 Ga0070700_100004413 Ga0070700_1000044135 291
451 3300005444 Ga0070694_100141182 Ga0070694_1001411821 291
452 3300005456 Ga0070678_100147827 Ga0070678_1001478272 291
453 3300005459 Ga0068867_100001174 Ga0068867_1000011742 291
454 3300005530 Ga0070679_100091532 Ga0070679_1000915323 291
455 3300005539 Ga0068853_100309034 Ga0068853_1003090342 291
456 3300005543 Ga0070672_100009322 Ga0070672_1000093223 291
457 3300005544 Ga0070686_100000464 Ga0070686_1000004645 291
458 3300005545 Ga0070695_100024435 Ga0070695_1000244353 291
459 3300005546 Ga0070696_100280000 Ga0070696_1002800002 291
460 3300005549 Ga0070704_100077821 Ga0070704_1000778212 291
461 3300005563 Ga0068855_100000951 Ga0068855_10000095110 291
462 3300005563 Ga0068855_100153432 Ga0068855_1001534322 291
463 3300005564 Ga0070664_100000682 Ga0070664_10000068227 291
464 3300005577 Ga0068857_100002406 Ga0068857_10000240615 291
465 3300005577 Ga0068857_100263262 Ga0068857_1002632622 291
466 3300005578 Ga0068854_100017008 Ga0068854_1000170084 291
467 3300005614 Ga0068856_100026055 Ga0068856_1000260552 291
468 3300005614 Ga0068856_100106259 Ga0068856_1001062594 291
469 3300005615 Ga0070702_100026943 Ga0070702_1000269433 291
470 3300005616 Ga0068852_100131398 Ga0068852_1001313983 291
471 3300005616 Ga0068852_100204790 Ga0068852_1002047902 291
472 3300005718 Ga0068866_10001195 Ga0068866_100011954 291
473 3300005719 Ga0068861_100013959 Ga0068861_1000139594 291
474 3300005840 Ga0068870_10039634 Ga0068870_100396342 291
475 3300005842 Ga0068858_100025288 Ga0068858_1000252883 291
476 3300005843 Ga0068860_100020873 Ga0068860_1000208735 291
477 3300005844 Ga0068862_100021490 Ga0068862_1000214901 291
478 3300005844 Ga0068862_100056436 Ga0068862_1000564363 291
479 3300005981 Ga0081538_10004456 Ga0081538_100044567 291
480 3300005983 Ga0081540_1000201 Ga0081540_100020129 291
481 3300005983 Ga0081540_1003632 Ga0081540_100363214 291
482 3300005983 Ga0081540_1015179 Ga0081540_10151791 291
483 3300006195 Ga0075366_10005655 Ga0075366_100056552 291
484 3300006358 Ga0068871_100179316 Ga0068871_1001793162 291
485 3300006844 Ga0075428_100002468 Ga0075428_10000246811 291
486 3300006846 Ga0075430_100013887 Ga0075430_1000138877 291
487 3300006871 Ga0075434_100300126 Ga0075434_1003001261 291
488 3300006880 Ga0075429_100032506 Ga0075429_1000325062 291
489 3300006881 Ga0068865_100000379 Ga0068865_1000003796 291
490 3300009093 Ga0105240_10013457 Ga0105240_100134575 291
491 3300009093 Ga0105240_10060062 Ga0105240_100600622 291
492 3300009093 Ga0105240_10066905 Ga0105240_100669052 291
493 3300009093 Ga0105240_10297170 Ga0105240_102971702 291
494 3300009093 Ga0105240_10363333 Ga0105240_103633331 291
495 3300009094 Ga0111539_10001915 Ga0111539_1000191516 291
496 3300009098 Ga0105245_10001340 Ga0105245_100013402 291
497 3300009148 Ga0105243_10000789 Ga0105243_1000078922 291
498 3300009148 Ga0105243_10013742 Ga0105243_100137423 291
499 3300009176 Ga0105242_10001855 Ga0105242_100018556 291
500 3300009177 Ga0105248_10075531 Ga0105248_100755312 291
501 3300009545 Ga0105237_10033514 Ga0105237_100335144 291
502 3300009545 Ga0105237_10048394 Ga0105237_100483944 291
503 3300009551 Ga0105238_10010332 Ga0105238_100103326 291
504 3300009551 Ga0105238_10118544 Ga0105238_101185443 291
505 3300009551 Ga0105238_10262191 Ga0105238_102621912 291
506 3300009551 Ga0105238_10298273 Ga0105238_102982732 291
507 3300009553 Ga0105249_10399582 Ga0105249_103995822 291
508 3300010375 Ga0105239_10109019 Ga0105239_101090192 291
509 3300010375 Ga0105239_10252141 Ga0105239_102521412 291
510 3300013100 Ga0157373_10287131 Ga0157373_102871312 291
511 3300013104 Ga0157370_10213080 Ga0157370_102130802 291
512 3300013297 Ga0157378_10001061 Ga0157378_1000106112 291
513 3300013306 Ga0163162_10005600 Ga0163162_100056007 291
514 3300013306 Ga0163162_10059762 Ga0163162_100597623 291
515 3300013306 Ga0163162_10359516 Ga0163162_103595162 291
516 3300013308 Ga0157375_10081781 Ga0157375_100817813 291
517 3300013308 Ga0157375_10100144 Ga0157375_101001442 291
518 3300014326 Ga0157380_10020480 Ga0157380_100204802 291
519 3300014968 Ga0157379_10022456 Ga0157379_100224564 291
520 3300014969 Ga0157376_10509653 Ga0157376_105096532 291
521 3300015261 Ga0182006_1001104 Ga0182006_100110410 291
522 3300015261 Ga0182006_1018185 Ga0182006_10181852 291
523 3300015262 Ga0182007_10002870 Ga0182007_100028706 291
524 3300015262 Ga0182007_10005932 Ga0182007_100059322 291
525 3300017792 Ga0163161_10070365 Ga0163161_100703652 291
526 3300021358 Ga0213873_10041559 Ga0213873_100415592 291
527 3300021361 Ga0213872_10000600 Ga0213872_1000060010 291
528 3300021361 Ga0213872_10005734 Ga0213872_100057347 291
529 3300021361 Ga0213872_10008921 Ga0213872_100089213 291
530 3300021361 Ga0213872_10010382 Ga0213872_100103824 291
531 3300021361 Ga0213872_10031458 Ga0213872_100314582 291
532 3300021361 Ga0213872_10067952 Ga0213872_100679521 291
533 3300021441 Ga0213871_10004755 Ga0213871_100047552 291
534 3300021441 Ga0213871_10015781 Ga0213871_100157812 291
535 3300025206 Ga0209435_100040 Ga0209435_10004085 291
536 3300025208 Ga0209436_100343 Ga0209436_1003433 291
537 3300025208 Ga0209436_101709 Ga0209436_1017093 291
538 3300025224 Ga0209784_100002 Ga0209784_1000021485 291
539 3300025224 Ga0209784_100020 Ga0209784_100020366 291
540 3300025225 Ga0209566_100003 Ga0209566_1000031485 291
541 3300025225 Ga0209566_100020 Ga0209566_100020366 291
542 3300025226 Ga0209674_100004 Ga0209674_1000041485 291
543 3300025226 Ga0209674_100035 Ga0209674_100035366 291
544 3300025229 Ga0209147_100141 Ga0209147_10014115 291
545 3300025230 Ga0209563_100006 Ga0209563_1000061485 291
546 3300025230 Ga0209563_100038 Ga0209563_100038366 291
547 3300025231 Ga0207427_101174 Ga0207427_1011743 291
548 3300025233 Ga0209437_100066 Ga0209437_10006615 291
549 3300025233 Ga0209437_100229 Ga0209437_10022971 291
550 3300025242 Ga0209258_100346 Ga0209258_10034648 291
551 3300025245 Ga0207425_1000001 Ga0207425_1000001912 291
552 3300025245 Ga0207425_1000039 Ga0207425_100003929 291
553 3300025246 Ga0209646_1000218 Ga0209646_100021838 291
554 3300025246 Ga0209646_1000235 Ga0209646_100023516 291
555 3300025250 Ga0209026_1000725 Ga0209026_10007251 291
556 3300025250 Ga0209026_1009785 Ga0209026_10097852 291
557 3300025253 Ga0209677_100003 Ga0209677_1000031485 291
558 3300025253 Ga0209677_100031 Ga0209677_100031306 291
559 3300025256 Ga0209759_1000447 Ga0209759_100044738 291
560 3300025256 Ga0209759_1001334 Ga0209759_100133412 291
561 3300025258 Ga0209129_1000001 Ga0209129_100000189 291
562 3300025258 Ga0209129_1003963 Ga0209129_10039636 291
563 3300025261 Ga0209233_1000060 Ga0209233_1000060366 291
564 3300025261 Ga0209233_1033544 Ga0209233_10335441 291
565 3300025263 Ga0209565_1000017 Ga0209565_100001741 291
566 3300025263 Ga0209565_1000410 Ga0209565_100041013 291
567 3300025263 Ga0209565_1000440 Ga0209565_100044011 291
568 3300025272 Ga0209455_1000043 Ga0209455_1000043235 291
569 3300025272 Ga0209455_1004598 Ga0209455_10045983 291
570 3300025273 Ga0209673_1000007 Ga0209673_1000007388 291
571 3300025273 Ga0209673_1011374 Ga0209673_10113743 291
572 3300025284 Ga0209130_1000534 Ga0209130_10005345 291
573 3300025284 Ga0209130_1001866 Ga0209130_10018665 291
574 3300025284 Ga0209130_1002660 Ga0209130_10026607 291
575 3300025284 Ga0209130_1002808 Ga0209130_10028084 291
576 3300025291 Ga0209675_1000009 Ga0209675_1000009130 291
577 3300025291 Ga0209675_1000630 Ga0209675_100063011 291
578 3300025291 Ga0209675_1002116 Ga0209675_10021163 291
579 3300025291 Ga0209675_1003002 Ga0209675_10030023 291
580 3300025292 Ga0209676_1006467 Ga0209676_10064676 291
581 3300025294 Ga0209025_1000594 Ga0209025_100059419 291
582 3300025295 Ga0209564_1000055 Ga0209564_100005565 291
583 3300025295 Ga0209564_1000109 Ga0209564_100010927 291
584 3300025295 Ga0209564_1000879 Ga0209564_100087932 291
585 3300025295 Ga0209564_1001055 Ga0209564_100105528 291
586 3300025295 Ga0209564_1018582 Ga0209564_10185822 291
587 3300025295 Ga0209564_1021373 Ga0209564_10213733 291
588 3300025297 Ga0209758_1000020 Ga0209758_1000020364 291
589 3300025298 Ga0209050_1000074 Ga0209050_100007428 291
590 3300025298 Ga0209050_1000116 Ga0209050_1000116104 291
591 3300025298 Ga0209050_1029605 Ga0209050_10296052 291
592 3300025299 Ga0209256_1000028 Ga0209256_1000028337 291
593 3300025299 Ga0209256_1000559 Ga0209256_100055915 291
594 3300025299 Ga0209256_1000640 Ga0209256_100064012 291
595 3300025299 Ga0209256_1003461 Ga0209256_10034616 291
596 3300025299 Ga0209256_1006115 Ga0209256_10061153 291
597 3300025302 Ga0207426_1001693 Ga0207426_10016939 291
598 3300025303 Ga0209051_1011200 Ga0209051_10112003 291
599 3300025304 Ga0209257_1000003 Ga0209257_1000003192 291
600 3300025304 Ga0209257_1005865 Ga0209257_100586510 291
601 3300025909 Ga0207705_10081138 Ga0207705_100811383 291
602 3300025913 Ga0207695_10003541 Ga0207695_1000354113 291
603 3300025913 Ga0207695_10007058 Ga0207695_100070582 291
604 3300025913 Ga0207695_10024767 Ga0207695_100247672 291
605 3300025913 Ga0207695_10136764 Ga0207695_101367643 291
606 3300025913 Ga0207695_10273950 Ga0207695_102739502 291
607 3300025914 Ga0207671_10005962 Ga0207671_100059626 291
608 3300025916 Ga0207663_10135445 Ga0207663_101354452 291
609 3300025919 Ga0207657_10028029 Ga0207657_100280293 291
610 3300025923 Ga0207681_10221384 Ga0207681_102213842 291
611 3300025924 Ga0207694_10004415 Ga0207694_100044155 291
612 3300025924 Ga0207694_10201131 Ga0207694_102011312 291
613 3300025927 Ga0207687_10271563 Ga0207687_102715631 291
614 3300025932 Ga0207690_10304884 Ga0207690_103048841 291
615 3300025934 Ga0207686_10048830 Ga0207686_100488302 291
616 3300025935 Ga0207709_10031585 Ga0207709_100315853 291
617 3300025935 Ga0207709_10039433 Ga0207709_100394332 291
618 3300025936 Ga0207670_10042894 Ga0207670_100428942 291
619 3300025938 Ga0207704_10396443 Ga0207704_103964432 291
620 3300025940 Ga0207691_10017651 Ga0207691_100176514 291
621 3300025941 Ga0207711_10066381 Ga0207711_100663813 291
622 3300025942 Ga0207689_10001544 Ga0207689_1000154410 291
623 3300025945 Ga0207679_10094998 Ga0207679_100949982 291
624 3300025949 Ga0207667_10000642 Ga0207667_1000064219 291
625 3300025949 Ga0207667_10159921 Ga0207667_101599211 291
626 3300025961 Ga0207712_10336234 Ga0207712_103362342 291
627 3300025981 Ga0207640_10136932 Ga0207640_101369322 291
628 3300025986 Ga0207658_10112244 Ga0207658_101122442 291
629 3300026023 Ga0207677_10394712 Ga0207677_103947121 291
630 3300026041 Ga0207639_10033066 Ga0207639_100330662 291
631 3300026067 Ga0207678_10108275 Ga0207678_101082752 291
632 3300026075 Ga0207708_10000219 Ga0207708_1000021941 291
633 3300026075 Ga0207708_10003595 Ga0207708_100035954 291
634 3300026078 Ga0207702_10093230 Ga0207702_100932303 291
635 3300026078 Ga0207702_10116526 Ga0207702_101165261 291
636 3300026078 Ga0207702_10247205 Ga0207702_102472052 291
637 3300026089 Ga0207648_10000534 Ga0207648_100005343 291
638 3300026089 Ga0207648_10233419 Ga0207648_102334192 291
639 3300026116 Ga0207674_10186817 Ga0207674_101868173 291
640 3300026118 Ga0207675_100025791 Ga0207675_1000257912 291
641 3300026121 Ga0207683_10039784 Ga0207683_100397844 291
642 3300026121 Ga0207683_10065908 Ga0207683_100659083 291
643 3300026142 Ga0207698_10029821 Ga0207698_100298213 291
644 3300027543 Ga0209999_1002328 Ga0209999_10023282 291
645 3300027907 Ga0207428_10011331 Ga0207428_100113312 291
646 3300028380 Ga0268265_10007131 Ga0268265_100071311 291
647 3300028380 Ga0268265_10139117 Ga0268265_101391172 291
648 3300028381 Ga0268264_10025052 Ga0268264_100250522 291
649 3300028563 Ga0265319_1002495 Ga0265319_10024952 291
650 3300028577 Ga0265318_10002650 Ga0265318_100026502 291
651 3300028577 Ga0265318_10004899 Ga0265318_100048995 291
652 3300031235 Ga0265330_10002740 Ga0265330_100027406 291
653 3300031238 Ga0265332_10001710 Ga0265332_100017109 291
654 3300031239 Ga0265328_10014547 Ga0265328_100145472 291
655 3300031240 Ga0265320_10001869 Ga0265320_100018692 291
656 3300031242 Ga0265329_10000886 Ga0265329_100008867 291
657 3300031247 Ga0265340_10002506 Ga0265340_100025064 291
658 3300031250 Ga0265331_10002480 Ga0265331_100024809 291
659 3300031344 Ga0265316_10003173 Ga0265316_100031739 291
660 3300031456 Ga0307513_10007045 Ga0307513_100070458 291
661 3300031507 Ga0307509_10361386 Ga0307509_103613862 291
662 3300031548 Ga0307408_100000157 Ga0307408_10000015773 291
663 3300031548 Ga0307408_100004977 Ga0307408_1000049773 291
664 3300031595 Ga0265313_10000186 Ga0265313_1000018611 291
665 3300031595 Ga0265313_10000483 Ga0265313_100004839 291
666 3300031711 Ga0265314_10005273 Ga0265314_100052738 291
667 3300031712 Ga0265342_10000054 Ga0265342_100000549 291
668 3300031730 Ga0307516_10040735 Ga0307516_100407353 291
669 3300031731 Ga0307405_10163203 Ga0307405_101632031 291
670 3300032002 Ga0307416_100011348 Ga0307416_1000113484 291
671 3300032004 Ga0307414_10325576 Ga0307414_103255761 291
672 3300032005 Ga0307411_10208175 Ga0307411_102081752 291
673 3300033179 Ga0307507_10116066 Ga0307507_101160662 291
674 3300037312 Ga0395899_0003202 Ga0395899_0003202_9021_9917 291
675 3300037312 Ga0395899_0020447 Ga0395899_0020447_2643_3521 291
676 3300037312 Ga0395899_0021263 Ga0395899_0021263_3911_4813 291
677 3300037312 Ga0395899_0026047 Ga0395899_0026047_335_1282 291
678 3300037312 Ga0395899_0064179 Ga0395899_0064179_1539_2438 291
679 3300037418 Ga0395900_0005113 Ga0395900_0005113_10165_11055 291
680 3300037418 Ga0395900_0018578 Ga0395900_0018578_5724_6623 291
681 3300037418 Ga0395900_0046716 Ga0395900_0046716_333_1280 291
682 3300037418 Ga0395900_0171737 Ga0395900_0171737_601_1479 291
683 3300037466 Ga0395898_0007720 Ga0395898_0007720_1604_2482 291
684 3300037466 Ga0395898_0098827 Ga0395898_0098827_1013_1912 291
685 3300037471 Ga0395905_0005608 Ga0395905_0005608_11518_12405 291
686 3300037471 Ga0395905_0013373 Ga0395905_0013373_3990_4868 291
687 3300037471 Ga0395905_0024852 Ga0395905_0024852_3956_4843 291
688 3300037471 Ga0395905_0026178 Ga0395905_0026178_2789_3685 291
689 3300038443 Ga0395901_0001319 Ga0395901_0001319_19082_20038 291
690 3300038443 Ga0395901_0046081 Ga0395901_0046081_2790_3689 291
691 3300038443 Ga0395901_0090830 Ga0395901_0090830_1130_2008 291
692 3300038443 Ga0395901_0169333 Ga0395901_0169333_804_1688 291
693 3300038443 Ga0395901_0254415 Ga0395901_0254415_378_1271 291
694 3300039438 Ga0436360_0022124 Ga0436360_0022124_656_1555 291
695 3300039438 Ga0436360_0369614 Ga0436360_0369614_45_935 291
696 3300039438 Ga0436360_0481236 Ga0436360_0481236_1284_2198 291
697 3300039447 Ga0436361_0002397 Ga0436361_0002397_95_994 291
698 3300039447 Ga0436361_0014834 Ga0436361_0014834_2586_3473 291
699 3300039447 Ga0436361_0065044 Ga0436361_0065044_478_1377 291
700 3300039447 Ga0436361_0148264 Ga0436361_0148264_41849_42736 291
701 3300039447 Ga0436361_0273252 Ga0436361_0273252_14356_15243 291
702 3300039447 Ga0436361_0316723 Ga0436361_0316723_5326_6213 291
703 3300039447 Ga0436361_0362138 Ga0436361_0362138_145_1035 291
704 3300039447 Ga0436361_0495212 Ga0436361_0495212_1336_2223 291
705 3300039447 Ga0436361_0769001 Ga0436361_0769001_445_1344 291
706 3300039447 Ga0436361_0879465 Ga0436361_0879465_589_1488 291
707 3300039453 Ga0436362_1085390 Ga0436362_1085390_1948_2862 291
708 3300044656 Ga0466969_0007082 Ga0466969_0007082_464_1384 291
709 3300044656 Ga0466969_0025919 Ga0466969_0025919_1908_2798 291
710 3300044683 Ga0466965_0000149 Ga0466965_0000149_13104_14003 291
711 3300044683 Ga0466965_0000613 Ga0466965_0000613_10120_11040 291
712 3300044684 Ga0466966_0003879 Ga0466966_0003879_4187_5107 291
713 3300044693 Ga0466961_0004681 Ga0466961_0004681_4515_5435 291
714 3300044693 Ga0466961_0211566 Ga0466961_0211566_267_1154 291
715 3300044694 Ga0466963_0020651 Ga0466963_0020651_235_1125 291
716 3300044706 Ga0466964_0004214 Ga0466964_0004214_3939_4829 291
717 3300044706 Ga0466964_0004520 Ga0466964_0004520_2549_3469 291
718 3300044706 Ga0466964_0081259 Ga0466964_0081259_229_1110 291
719 3300044712 Ga0453684_0006630 Ga0453684_0006630_3517_4419 291
720 3300044712 Ga0453684_0055940 Ga0453684_0055940_4220_5104 291
721 3300044719 Ga0466971_0053133 Ga0466971_0053133_679_1569 291
722 3300044735 Ga0466968_0007816 Ga0466968_0007816_2892_3791 291
723 3300044765 Ga0466970_0008418 Ga0466970_0008418_3456_4376 291
724 3300044842 Ga0466957_0001149 Ga0466957_0001149_9566_10486 291
725 3300044842 Ga0466957_0014213 Ga0466957_0014213_1790_2680 291
726 3300045049 Ga0466959_0000216 Ga0466959_0000216_3792_4682 291
727 3300045049 Ga0466959_0002489 Ga0466959_0002489_7494_8387 291
728 3300045051 Ga0451576_0071705 Ga0451576_0071705_1253_2137 291
729 3300045836 Ga0466958_0022819 Ga0466958_0022819_1466_2386 291
730 3300045836 Ga0466958_0056808 Ga0466958_0056808_1138_2049 291
731 3300045836 Ga0466958_0109418 Ga0466958_0109418_369_1259 291
732 3300045836 Ga0466958_0110732 Ga0466958_0110732_619_1512 291
733 3300046452 Ga0495617_002431 Ga0495617_002431_4620_5507 291
734 3300046452 Ga0495617_070500 Ga0495617_070500_27_914 291
735 3300046455 Ga0495603_0000760 Ga0495603_0000760_6710_7597 291
736 3300046459 Ga0495629_0001443 Ga0495629_0001443_11708_12595 291
737 3300046460 Ga0495638_0001700 Ga0495638_0001700_6082_6969 291
738 3300046460 Ga0495638_0128977 Ga0495638_0128977_400_1284 291
739 3300046461 Ga0495641_0007642 Ga0495641_0007642_2606_3493 291
740 3300046462 Ga0495651_0006073 Ga0495651_0006073_5101_5988 291
741 3300046462 Ga0495651_0044913 Ga0495651_0044913_2125_3012 291
742 3300046463 Ga0495653_0000578 Ga0495653_0000578_6150_7037 291
743 3300046463 Ga0495653_0008170 Ga0495653_0008170_6877_7764 291
744 3300046471 Ga0495650_0000383 Ga0495650_0000383_27451_28338 291
745 3300046472 Ga0495580_0000763 Ga0495580_0000763_6710_7597 291
746 3300046472 Ga0495580_0018601 Ga0495580_0018601_2302_3189 291
747 3300046472 Ga0495580_0263420 Ga0495580_0263420_187_1074 291
748 3300046473 Ga0495582_0000320 Ga0495582_0000320_6682_7569 291
749 3300046474 Ga0495605_0000665 Ga0495605_0000665_11511_12398 291
750 3300046474 Ga0495605_0022422 Ga0495605_0022422_1132_2019 291
751 3300046474 Ga0495605_0037838 Ga0495605_0037838_1145_2035 291
752 3300046477 Ga0495664_0000261 Ga0495664_0000261_19892_20779 291
753 3300046491 Ga0495584_0000573 Ga0495584_0000573_22567_23508 291
754 3300046491 Ga0495584_0005997 Ga0495584_0005997_1853_2743 291
755 3300046491 Ga0495584_0044014 Ga0495584_0044014_28_915 291
756 3300046492 Ga0495585_0001878 Ga0495585_0001878_10431_11318 291
757 3300046492 Ga0495585_0019615 Ga0495585_0019615_1049_1936 291
758 3300046500 Ga0495596_0000801 Ga0495596_0000801_9825_10715 291
759 3300046500 Ga0495596_0003413 Ga0495596_0003413_5619_6506 291
760 3300046501 Ga0495607_0001824 Ga0495607_0001824_13529_14416 291
761 3300046501 Ga0495607_0045539 Ga0495607_0045539_1262_2149 291
762 3300046501 Ga0495607_0049484 Ga0495607_0049484_240_1127 291
763 3300046501 Ga0495607_0054906 Ga0495607_0054906_453_1343 291
764 3300046506 Ga0495583_0000045 Ga0495583_0000045_215353_216240 291
765 3300046506 Ga0495583_0019164 Ga0495583_0019164_774_1661 291
766 3300046507 Ga0495606_0000360 Ga0495606_0000360_73444_74334 291
767 3300046507 Ga0495606_0011366 Ga0495606_0011366_1756_2643 291
768 3300046507 Ga0495606_0034029 Ga0495606_0034029_353_1240 291
769 3300046507 Ga0495606_0057561 Ga0495606_0057561_526_1413 291
770 3300046511 Ga0495608_0007822 Ga0495608_0007822_1411_2298 291
771 3300046511 Ga0495608_0009704 Ga0495608_0009704_303_1190 291
772 3300046512 Ga0495610_0007706 Ga0495610_0007706_1883_2770 291
773 3300046512 Ga0495610_0046016 Ga0495610_0046016_1220_2107 291
774 3300046513 Ga0495616_0008633 Ga0495616_0008633_2404_3291 291
775 3300046513 Ga0495616_0011082 Ga0495616_0011082_48_935 291
776 3300046513 Ga0495616_0016974 Ga0495616_0016974_512_1399 291
777 3300046514 Ga0495618_0001870 Ga0495618_0001870_3556_4443 291
778 3300046514 Ga0495618_0002893 Ga0495618_0002893_6699_7586 291
779 3300046514 Ga0495618_0214361 Ga0495618_0214361_149_1036 291
780 3300046516 Ga0495628_0002356 Ga0495628_0002356_5329_6216 291
781 3300046516 Ga0495628_0005561 Ga0495628_0005561_1566_2453 291
782 3300046516 Ga0495628_0012017 Ga0495628_0012017_3009_3896 291
783 3300046517 Ga0495630_0000512 Ga0495630_0000512_6710_7597 291
784 3300046518 Ga0495631_0000752 Ga0495631_0000752_5247_6134 291
785 3300046518 Ga0495631_0011543 Ga0495631_0011543_342_1232 291
786 3300046519 Ga0495632_0114174 Ga0495632_0114174_364_1248 291
787 3300046522 Ga0495643_0000099 Ga0495643_0000099_28740_29627 291
788 3300046522 Ga0495643_0038482 Ga0495643_0038482_920_1810 291
789 3300046522 Ga0495643_0071574 Ga0495643_0071574_390_1286 291
790 3300046523 Ga0495644_0000135 Ga0495644_0000135_19685_20572 291
791 3300046523 Ga0495644_0004017 Ga0495644_0004017_3767_4654 291
792 3300046524 Ga0495648_0000659 Ga0495648_0000659_22154_23041 291
793 3300046524 Ga0495648_0006023 Ga0495648_0006023_4378_5265 291
794 3300046524 Ga0495648_0030027 Ga0495648_0030027_2337_3224 291
795 3300046524 Ga0495648_0030583 Ga0495648_0030583_2491_3378 291
796 3300046524 Ga0495648_0032605 Ga0495648_0032605_75_962 291
797 3300046524 Ga0495648_0047035 Ga0495648_0047035_682_1569 291
798 3300046526 Ga0495666_0000103 Ga0495666_0000103_6688_7575 291
799 3300046528 Ga0495642_0007016 Ga0495642_0007016_2740_3636 291
800 3300046528 Ga0495642_0071270 Ga0495642_0071270_484_1377 291
801 3300046529 Ga0495652_0001284 Ga0495652_0001284_20488_21375 291
802 3300046529 Ga0495652_0003297 Ga0495652_0003297_11388_12275 291
803 3300046529 Ga0495652_0018130 Ga0495652_0018130_2812_3699 291
804 3300046529 Ga0495652_0020184 Ga0495652_0020184_2860_3747 291
805 3300046531 Ga0495665_0000233 Ga0495665_0000233_20488_21375 291
806 3300046533 Ga0495640_0004376 Ga0495640_0004376_6572_7459 291
807 3300046535 Ga0495586_0000365 Ga0495586_0000365_20410_21297 291
808 3300046538 Ga0495609_0000582 Ga0495609_0000582_9103_9990 291
809 3300046538 Ga0495609_0000604 Ga0495609_0000604_1549_2436 291
810 3300046538 Ga0495609_0000992 Ga0495609_0000992_13254_14141 291
811 3300046538 Ga0495609_0034183 Ga0495609_0034183_61_948 291
812 3300046542 Ga0495597_0000172 Ga0495597_0000172_22144_23031 291
813 3300046542 Ga0495597_0015880 Ga0495597_0015880_1440_2327 291
814 3300046542 Ga0495597_0053820 Ga0495597_0053820_588_1475 291
815 3300046542 Ga0495597_0073931 Ga0495597_0073931_51_938 291
816 3300046543 Ga0495645_0000480 Ga0495645_0000480_20070_20957 291
817 3300046543 Ga0495645_0018286 Ga0495645_0018286_49_936 291
818 3300046557 Ga0495622_0107420 Ga0495622_0107420_290_1177 291
819 3300046558 Ga0495633_0000349 Ga0495633_0000349_18605_19492 291
820 3300046558 Ga0495633_0002318 Ga0495633_0002318_8605_9492 291
821 3300046558 Ga0495633_0011431 Ga0495633_0011431_2163_3050 291
822 3300046558 Ga0495633_0012066 Ga0495633_0012066_2760_3647 291
823 3300046558 Ga0495633_0057090 Ga0495633_0057090_932_1819 291
824 3300046615 Ga0495656_0028944 Ga0495656_0028944_617_1504 291
825 3300046615 Ga0495656_0209464 Ga0495656_0209464_11_910 291
826 3300046616 Ga0495668_0000285 Ga0495668_0000285_28679_29566 291
827 3300046616 Ga0495668_0038149 Ga0495668_0038149_1702_2589 291
828 3300046642 Ga0495634_0000937 Ga0495634_0000937_6694_7581 291
829 3300046648 Ga0495611_0005392 Ga0495611_0005392_4264_5151 291
830 3300046648 Ga0495611_0006605 Ga0495611_0006605_3800_4687 291
831 3300046648 Ga0495611_0025671 Ga0495611_0025671_752_1639 291
832 3300046660 Ga0495625_0001004 Ga0495625_0001004_278_1165 291
833 3300046660 Ga0495625_0001275 Ga0495625_0001275_29750_30637 291
834 3300046660 Ga0495625_0003651 Ga0495625_0003651_1122_2009 291
835 3300046660 Ga0495625_0013489 Ga0495625_0013489_1413_2300 291
836 3300046660 Ga0495625_0014512 Ga0495625_0014512_4897_5784 291
837 3300046660 Ga0495625_0027666 Ga0495625_0027666_1171_2058 291
838 3300046660 Ga0495625_0151120 Ga0495625_0151120_645_1523 291
839 3300046663 Ga0495635_0001129 Ga0495635_0001129_6672_7559 291
840 3300046663 Ga0495635_0032334 Ga0495635_0032334_1129_2016 291
841 3300046664 Ga0495659_0000033 Ga0495659_0000033_33740_34627 291
842 3300046664 Ga0495659_0000294 Ga0495659_0000294_16543_17430 291
843 3300046664 Ga0495659_0021743 Ga0495659_0021743_386_1276 291
844 3300046664 Ga0495659_0077394 Ga0495659_0077394_136_1023 291
845 3300046665 Ga0495661_0000603 Ga0495661_0000603_30404_31291 291
846 3300046665 Ga0495661_0001041 Ga0495661_0001041_17044_17931 291
847 3300046665 Ga0495661_0002078 Ga0495661_0002078_4039_4935 291
848 3300046665 Ga0495661_0009392 Ga0495661_0009392_1440_2327 291
849 3300046665 Ga0495661_0012466 Ga0495661_0012466_4352_5239 291
850 3300046665 Ga0495661_0023083 Ga0495661_0023083_1754_2641 291
851 3300046675 Ga0495657_0159426 Ga0495657_0159426_441_1328 291
852 3300046678 Ga0495599_0018939 Ga0495599_0018939_258_1145 291
853 3300046679 Ga0495623_0002075 Ga0495623_0002075_6404_7291 291
854 3300046679 Ga0495623_0109893 Ga0495623_0109893_144_1031 291
855 3300046680 Ga0495646_0000233 Ga0495646_0000233_20057_20944 291
856 3300046680 Ga0495646_0007025 Ga0495646_0007025_3573_4460 291
857 3300046684 Ga0495669_0061554 Ga0495669_0061554_428_1312 291
858 3300046689 Ga0495613_0001368 Ga0495613_0001368_10830_11717 291
859 3300046690 Ga0495624_0000625 Ga0495624_0000625_20070_20957 291
860 3300046690 Ga0495624_0024039 Ga0495624_0024039_1381_2268 291
861 3300046691 Ga0495670_0000252 Ga0495670_0000252_13640_14527 291
862 3300046691 Ga0495670_0000525 Ga0495670_0000525_5224_6111 291
863 3300046691 Ga0495670_0052519 Ga0495670_0052519_778_1665 291
864 3300046691 Ga0495670_0058753 Ga0495670_0058753_37_924 291
865 3300046692 Ga0495671_0000398 Ga0495671_0000398_28346_29233 291
866 3300046692 Ga0495671_0008654 Ga0495671_0008654_566_1453 291
867 3300046694 Ga0495649_0011261 Ga0495649_0011261_1071_1958 291
868 3300046794 Ga0495589_0018258 Ga0495589_0018258_403_1290 291
869 3300046809 Ga0495600_0000670 Ga0495600_0000670_15620_16507 291
870 3300046810 Ga0495660_0002258 Ga0495660_0002258_856_1743 291
871 3300046810 Ga0495660_0018980 Ga0495660_0018980_1233_2120 291
872 3300047315 Ga0495581_0000632 Ga0495581_0000632_6685_7572 291
873 3300047317 Ga0495604_0003604 Ga0495604_0003604_2872_3759 291
874 3300047317 Ga0495604_0012180 Ga0495604_0012180_2740_3627 291
875 3300047318 Ga0495636_0000318 Ga0495636_0000318_13869_14756 291
876 3300047319 Ga0495674_0000945 Ga0495674_0000945_20070_20957 291
877 3300047320 Ga0495672_0000191 Ga0495672_0000191_53126_54013 291
878 3300047320 Ga0495672_0000257 Ga0495672_0000257_25467_26354 291
879 3300047320 Ga0495672_0000277 Ga0495672_0000277_16663_17550 291
880 3300047320 Ga0495672_0003583 Ga0495672_0003583_86_973 291
881 3300047320 Ga0495672_0038522 Ga0495672_0038522_775_1662 291
882 3300047321 Ga0495676_0001514 Ga0495676_0001514_6188_7075 291
883 3300047321 Ga0495676_0042526 Ga0495676_0042526_1935_2822 291
884 3300047322 Ga0495680_0001203 Ga0495680_0001203_7433_8320 291
885 3300047323 Ga0495683_0007383 Ga0495683_0007383_449_1336 291
886 3300047323 Ga0495683_0088482 Ga0495683_0088482_314_1201 291
887 3300047443 Ga0495687_000677 Ga0495687_000677_33910_34797 291
888 3300047443 Ga0495687_000710 Ga0495687_000710_24735_25622 291
889 3300047443 Ga0495687_040707 Ga0495687_040707_132_1019 291
890 3300047443 Ga0495687_064105 Ga0495687_064105_42_938 291
891 3300047444 Ga0495675_0002319 Ga0495675_0002319_8010_8897 291
892 3300047445 Ga0495677_0003824 Ga0495677_0003824_573_1460 291
893 3300047445 Ga0495677_0004961 Ga0495677_0004961_3354_4241 291
894 3300047445 Ga0495677_0005822 Ga0495677_0005822_1838_2725 291
895 3300047445 Ga0495677_0010120 Ga0495677_0010120_222_1112 291
896 3300047445 Ga0495677_0034066 Ga0495677_0034066_378_1265 291
897 3300047446 Ga0495679_000820 Ga0495679_000820_12148_13035 291
898 3300047446 Ga0495679_016535 Ga0495679_016535_847_1734 291
899 3300047446 Ga0495679_033145 Ga0495679_033145_561_1448 291
900 3300047447 Ga0495685_000093 Ga0495685_000093_19682_20569 291
901 3300047447 Ga0495685_034250 Ga0495685_034250_846_1733 291
902 3300047470 Ga0495681_0001920 Ga0495681_0001920_5399_6286 291
903 3300047470 Ga0495681_0012266 Ga0495681_0012266_1113_2000 291
904 3300047471 Ga0495684_0003654 Ga0495684_0003654_5924_6811 291
905 3300047472 Ga0495686_0000456 Ga0495686_0000456_48504_49391 291
906 3300047472 Ga0495686_0014904 Ga0495686_0014904_4266_5153 291
907 3300047472 Ga0495686_0054385 Ga0495686_0054385_1019_1906 291
908 3300047472 Ga0495686_0065032 Ga0495686_0065032_469_1356 291
909 3300047472 Ga0495686_0091814 Ga0495686_0091814_699_1589 291
910 3300047673 Ga0495593_0001495 Ga0495593_0001495_9404_10291 291
911 3300048088 Ga0495602_0002606 Ga0495602_0002606_6710_7597 291
912 3300048088 Ga0495602_0025709 Ga0495602_0025709_1005_1892 291
913 3300048088 Ga0495602_0061370 Ga0495602_0061370_258_1145 291
914 3300048089 Ga0495614_0000346 Ga0495614_0000346_10830_11717 291
915 3300048903 Ga0496100_0117164 Ga0496100_0117164_407_1306 291
916 3300048905 Ga0496102_0003649 Ga0496102_0003649_2855_3742 291
917 3300048905 Ga0496102_0034973 Ga0496102_0034973_1780_2667 291
918 3300048905 Ga0496102_0099073 Ga0496102_0099073_1000_1899 291
919 3300048905 Ga0496102_0162044 Ga0496102_0162044_666_1565 291
920 3300048907 Ga0496104_0010683 Ga0496104_0010683_1817_2716 291
921 3300048909 Ga0496106_0001363 Ga0496106_0001363_15680_16558 291
922 3300048909 Ga0496106_0283210 Ga0496106_0283210_395_1294 291
923 3300048909 Ga0496106_0300261 Ga0496106_0300261_104_991 291
924 3300048911 Ga0496108_0149830 Ga0496108_0149830_132_1226 291
925 3300048912 Ga0496109_0060212 Ga0496109_0060212_1232_2119 291
926 3300048912 Ga0496109_0629302 Ga0496109_0629302_40_978 291
927 3300048913 Ga0496110_0051847 Ga0496110_0051847_1875_2774 291
928 3300048913 Ga0496110_0125930 Ga0496110_0125930_129_1016 291
929 3300048913 Ga0496110_0436027 Ga0496110_0436027_85_969 291
930 3300048914 Ga0496111_0192227 Ga0496111_0192227_450_1334 291
931 3300048917 Ga0496114_0003346 Ga0496114_0003346_9529_10407 291
932 3300048918 Ga0496115_0030663 Ga0496115_0030663_2526_3425 291
933 3300048919 Ga0496116_0020463 Ga0496116_0020463_1117_2007 291
934 3300048919 Ga0496116_0051416 Ga0496116_0051416_537_1424 291
935 3300048919 Ga0496116_0158076 Ga0496116_0158076_352_1236 291
936 3300048924 Ga0496121_0005876 Ga0496121_0005876_540_1424 291
937 3300048924 Ga0496121_0032418 Ga0496121_0032418_1249_2136 291
938 3300048924 Ga0496121_0053101 Ga0496121_0053101_526_1413 291
939 3300048925 Ga0496122_0000892 Ga0496122_0000892_44264_45151 291
940 3300048925 Ga0496122_0128015 Ga0496122_0128015_324_1217 291
941 3300048926 Ga0496123_0000842 Ga0496123_0000842_37978_38865 291
942 3300048927 Ga0496124_0034886 Ga0496124_0034886_438_1322 291
943 3300048927 Ga0496124_0159830 Ga0496124_0159830_711_1598 291
944 3300048927 Ga0496124_0270532 Ga0496124_0270532_12_911 291
945 3300048928 Ga0496125_0000625 Ga0496125_0000625_45978_46862 291
946 3300048928 Ga0496125_0002058 Ga0496125_0002058_4332_5219 291
947 3300048928 Ga0496125_0002222 Ga0496125_0002222_8941_9828 291
948 3300048928 Ga0496125_0017830 Ga0496125_0017830_1931_2815 291
949 3300048928 Ga0496125_0199133 Ga0496125_0199133_279_1163 291
950 3300048929 Ga0496126_0007582 Ga0496126_0007582_5082_5969 291
951 3300048929 Ga0496126_0235461 Ga0496126_0235461_363_1247 291
952 3300049459 Ga0495678_000262 Ga0495678_000262_30708_31595 291
953 3300049459 Ga0495678_002136 Ga0495678_002136_8834_9721 291
954 3300049460 Ga0495682_0000121 Ga0495682_0000121_17969_18856 291
955 3300049460 Ga0495682_0000195 Ga0495682_0000195_13985_14872 291
956 3300049460 Ga0495682_0016139 Ga0495682_0016139_1070_1957 291
957 3300049568 Ga0501031_0260778 Ga0501031_0260778_151_1038 291
958 3300049570 Ga0501033_0013435 Ga0501033_0013435_1809_2696 291
959 3300049571 Ga0501034_0000067 Ga0501034_0000067_138283_139164 291
960 3300049574 Ga0501038_0350878 Ga0501038_0350878_203_1108 291
961 3300049575 Ga0501039_0044986 Ga0501039_0044986_226_1131 291
962 3300049575 Ga0501039_0117362 Ga0501039_0117362_545_1429 291
963 3300049575 Ga0501039_0150106 Ga0501039_0150106_622_1509 291
964 3300049580 Ga0501046_0002701 Ga0501046_0002701_6154_7050 291
965 3300049580 Ga0501046_0291857 Ga0501046_0291857_106_990 291
966 3300049583 Ga0501067_0102170 Ga0501067_0102170_443_1330 291
967 3300049742 Ga0501080_0106730 Ga0501080_0106730_695_1582 291
968 3300049823 Ga0501044_0233358 Ga0501044_0233358_90_977 291
969 3300049824 Ga0501045_0051789 Ga0501045_0051789_1864_2769 291
970 3300050493 nmdc:mga0k408_5452_c1 nmdc:mga0k408_5452_c1_240_1130 291
971 3300050508 nmdc:mga09592_61376_c1 nmdc:mga09592_61376_c1_1700_2587 291
972 3300050511 nmdc:mga08y16_8074_c1 nmdc:mga08y16_8074_c1_1712_2599 291
973 3300053077 Ga0495601_0071566 Ga0495601_0071566_1194_2081 291
974 3300053078 Ga0495612_0153355 Ga0495612_0153355_21_914 291
975 3300053125 Ga0500618_002522 Ga0500618_002522_210_1097 291
976 3300053125 Ga0500618_011796 Ga0500618_011796_1059_1949 291
977 3300053139 Ga0500568_0000226 Ga0500568_0000226_40636_41514 291
978 3300053140 Ga0500573_0171058 Ga0500573_0171058_31_918 291
979 3300053154 Ga0500619_000976 Ga0500619_000976_1719_2606 291
980 3300053160 Ga0500633_0000417 Ga0500633_0000417_2609_3487 291
981 3300061719 Ga0466962_0032555 Ga0466962_0032555_257_1147 291
982 iso_pu_bacteria 2643221645 2644251954 291
983 3300002076 JGI24749J21850_1000008 JGI24749J21850_100000814 292
984 3300003214 JGI25165J46597_1000303 JGI25165J46597_10003037 292
985 3300005295 Ga0065707_10002796 Ga0065707_100027964 292
986 3300005328 Ga0070676_10178179 Ga0070676_101781792 292
987 3300005329 Ga0070683_100175519 Ga0070683_1001755192 292
988 3300005331 Ga0070670_100029086 Ga0070670_1000290866 292
989 3300005337 Ga0070682_100038780 Ga0070682_1000387802 292
990 3300005339 Ga0070660_100038243 Ga0070660_1000382433 292
991 3300005355 Ga0070671_100053527 Ga0070671_1000535272 292
992 3300005367 Ga0070667_100000667 Ga0070667_10000066736 292
993 3300005435 Ga0070714_100001359 Ga0070714_1000013596 292
994 3300005471 Ga0070698_100006326 Ga0070698_1000063266 292
995 3300005530 Ga0070679_100461289 Ga0070679_1004612892 292
996 3300005535 Ga0070684_100112266 Ga0070684_1001122662 292
997 3300005544 Ga0070686_100390150 Ga0070686_1003901501 292
998 3300005614 Ga0068856_100562433 Ga0068856_1005624331 292
999 3300005617 Ga0068859_100005767 Ga0068859_1000057674 292
1000 3300005719 Ga0068861_100000333 Ga0068861_1000003336 292
1001 3300005841 Ga0068863_100004683 Ga0068863_1000046832 292
1002 3300005844 Ga0068862_100001937 Ga0068862_1000019378 292
1003 3300005844 Ga0068862_100002549 Ga0068862_1000025493 292
1004 3300005937 Ga0081455_10151879 Ga0081455_101518792 292
1005 3300005981 Ga0081538_10005813 Ga0081538_100058135 292
1006 3300005985 Ga0081539_10045778 Ga0081539_100457782 292
1007 3300006038 Ga0075365_10023666 Ga0075365_100236663 292
1008 3300006852 Ga0075433_10039571 Ga0075433_100395713 292
1009 3300006871 Ga0075434_100003847 Ga0075434_1000038473 292
1010 3300006931 Ga0097620_100005767 Ga0097620_1000057674 292
1011 3300007076 Ga0075435_100019943 Ga0075435_1000199432 292
1012 3300009094 Ga0111539_10005209 Ga0111539_1000520914 292
1013 3300009098 Ga0105245_10003250 Ga0105245_100032506 292
1014 3300009101 Ga0105247_10005532 Ga0105247_100055324 292
1015 3300009177 Ga0105248_10000157 Ga0105248_1000015726 292
1016 3300009177 Ga0105248_10026867 Ga0105248_100268672 292
1017 3300009551 Ga0105238_10074378 Ga0105238_100743783 292
1018 3300009553 Ga0105249_10006020 Ga0105249_100060202 292
1019 3300013105 Ga0157369_10332877 Ga0157369_103328772 292
1020 3300013308 Ga0157375_10058395 Ga0157375_100583954 292
1021 3300013308 Ga0157375_10911938 Ga0157375_109119381 292
1022 3300014968 Ga0157379_10368054 Ga0157379_103680542 292
1023 3300017792 Ga0163161_10106602 Ga0163161_101066022 292
1024 3300020070 Ga0206356_10261284 Ga0206356_102612843 292
1025 3300020081 Ga0206354_10465120 Ga0206354_104651201 292
1026 3300020082 Ga0206353_10609877 Ga0206353_106098772 292
1027 3300025261 Ga0209233_1000188 Ga0209233_100018885 292
1028 3300025297 Ga0209758_1004936 Ga0209758_100493613 292
1029 3300025900 Ga0207710_10003876 Ga0207710_100038764 292
1030 3300025901 Ga0207688_10086663 Ga0207688_100866632 292
1031 3300025904 Ga0207647_10098630 Ga0207647_100986301 292
1032 3300025908 Ga0207643_10191094 Ga0207643_101910942 292
1033 3300025909 Ga0207705_10005885 Ga0207705_100058858 292
1034 3300025919 Ga0207657_10007073 Ga0207657_100070733 292
1035 3300025925 Ga0207650_10022230 Ga0207650_100222305 292
1036 3300025929 Ga0207664_10001050 Ga0207664_1000105016 292
1037 3300025931 Ga0207644_10053125 Ga0207644_100531252 292
1038 3300025932 Ga0207690_10096390 Ga0207690_100963902 292
1039 3300025941 Ga0207711_10004750 Ga0207711_100047504 292
1040 3300025941 Ga0207711_10136841 Ga0207711_101368413 292
1041 3300025949 Ga0207667_10059595 Ga0207667_100595953 292
1042 3300025961 Ga0207712_10000454 Ga0207712_1000045416 292
1043 3300025972 Ga0207668_10003087 Ga0207668_100030874 292
1044 3300026067 Ga0207678_10484957 Ga0207678_104849571 292
1045 3300026088 Ga0207641_10003687 Ga0207641_100036872 292
1046 3300026118 Ga0207675_100001097 Ga0207675_1000010976 292
1047 3300027907 Ga0207428_10006458 Ga0207428_100064588 292
1048 3300028379 Ga0268266_10323767 Ga0268266_103237671 292
1049 3300028380 Ga0268265_10000535 Ga0268265_1000053518 292
1050 3300028380 Ga0268265_10060805 Ga0268265_100608051 292
1051 3300028381 Ga0268264_10006442 Ga0268264_100064424 292
1052 3300031456 Ga0307513_10082402 Ga0307513_100824022 292
1053 3300031728 Ga0316578_10016320 Ga0316578_100163202 292
1054 3300031730 Ga0307516_10001334 Ga0307516_1000133410 292
1055 3300031852 Ga0307410_10035744 Ga0307410_100357442 292
1056 3300045976 Ga0466967_0064330 Ga0466967_0064330_604_1500 292
1057 3300045976 Ga0466967_0314178 Ga0466967_0314178_281_1171 292
1058 3300047323 Ga0495683_0000720 Ga0495683_0000720_18761_19645 292
1059 3300048905 Ga0496102_0047852 Ga0496102_0047852_951_1862 292
1060 3300048911 Ga0496108_0441164 Ga0496108_0441164_187_1080 292
1061 3300048913 Ga0496110_0023439 Ga0496110_0023439_4349_5239 292
1062 3300048914 Ga0496111_0122001 Ga0496111_0122001_18_911 292
1063 3300048917 Ga0496114_0001116 Ga0496114_0001116_15085_15993 292
1064 3300048920 Ga0496117_0009659 Ga0496117_0009659_3502_4392 292
1065 3300048921 Ga0496118_0000253 Ga0496118_0000253_78159_79049 292
1066 3300048924 Ga0496121_0055122 Ga0496121_0055122_1266_2156 292
1067 3300048925 Ga0496122_0003634 Ga0496122_0003634_8775_9662 292
1068 3300048926 Ga0496123_0016384 Ga0496123_0016384_4648_5535 292
1069 3300048927 Ga0496124_0028640 Ga0496124_0028640_248_1135 292
1070 3300049568 Ga0501031_0008977 Ga0501031_0008977_1270_2154 292
1071 3300049568 Ga0501031_0070194 Ga0501031_0070194_270_1166 292
1072 3300049569 Ga0501032_0032528 Ga0501032_0032528_497_1381 292
1073 3300049569 Ga0501032_0065600 Ga0501032_0065600_727_1611 292
1074 3300049570 Ga0501033_0002920 Ga0501033_0002920_4122_5006 292
1075 3300049570 Ga0501033_0123952 Ga0501033_0123952_629_1516 292
1076 3300049571 Ga0501034_0008308 Ga0501034_0008308_7596_8480 292
1077 3300049572 Ga0501036_0042011 Ga0501036_0042011_1047_1931 292
1078 3300049572 Ga0501036_0053394 Ga0501036_0053394_1754_2638 292
1079 3300049573 Ga0501037_0062584 Ga0501037_0062584_1142_2026 292
1080 3300049573 Ga0501037_0203139 Ga0501037_0203139_468_1355 292
1081 3300049573 Ga0501037_0266015 Ga0501037_0266015_262_1146 292
1082 3300049574 Ga0501038_0085052 Ga0501038_0085052_1270_2154 292
1083 3300049574 Ga0501038_0102723 Ga0501038_0102723_1386_2270 292
1084 3300049574 Ga0501038_0423320 Ga0501038_0423320_52_948 292
1085 3300049575 Ga0501039_0017758 Ga0501039_0017758_4067_4951 292
1086 3300049575 Ga0501039_0074276 Ga0501039_0074276_750_1646 292
1087 3300049575 Ga0501039_0173563 Ga0501039_0173563_110_994 292
1088 3300049577 Ga0501041_0084519 Ga0501041_0084519_1042_1938 292
1089 3300049578 Ga0501042_0003635 Ga0501042_0003635_8356_9240 292
1090 3300049578 Ga0501042_0020439 Ga0501042_0020439_1631_2515 292
1091 3300049579 Ga0501043_0004152 Ga0501043_0004152_6825_7709 292
1092 3300049579 Ga0501043_0064219 Ga0501043_0064219_785_1669 292
1093 3300049579 Ga0501043_0075340 Ga0501043_0075340_1270_2154 292
1094 3300049580 Ga0501046_0013687 Ga0501046_0013687_4349_5233 292
1095 3300049580 Ga0501046_0069716 Ga0501046_0069716_1141_2037 292
1096 3300049581 Ga0501047_0029100 Ga0501047_0029100_2009_2893 292
1097 3300049581 Ga0501047_0036793 Ga0501047_0036793_1066_1950 292
1098 3300049582 Ga0501048_0001718 Ga0501048_0001718_10555_11439 292
1099 3300049582 Ga0501048_0048570 Ga0501048_0048570_1066_1950 292
1100 3300049583 Ga0501067_0043773 Ga0501067_0043773_912_1796 292
1101 3300049584 Ga0501068_0016294 Ga0501068_0016294_2569_3453 292
1102 3300049586 Ga0501070_0013356 Ga0501070_0013356_4350_5234 292
1103 3300049586 Ga0501070_0070810 Ga0501070_0070810_943_1830 292
1104 3300049587 Ga0501071_0026754 Ga0501071_0026754_496_1380 292
1105 3300049589 Ga0501073_0032666 Ga0501073_0032666_2136_3020 292
1106 3300049589 Ga0501073_0061722 Ga0501073_0061722_1021_1905 292
1107 3300049591 Ga0501075_0028419 Ga0501075_0028419_976_1872 292
1108 3300049592 Ga0501076_0018511 Ga0501076_0018511_17_913 292
1109 3300049741 Ga0501079_0027185 Ga0501079_0027185_1047_1943 292
1110 3300049742 Ga0501080_0005558 Ga0501080_0005558_939_1823 292
1111 3300049743 Ga0501081_0025842 Ga0501081_0025842_420_1316 292
1112 3300049822 Ga0501035_0004909 Ga0501035_0004909_2509_3393 292
1113 3300049822 Ga0501035_0051270 Ga0501035_0051270_2530_3417 292
1114 3300049822 Ga0501035_0088823 Ga0501035_0088823_365_1249 292
1115 3300049822 Ga0501035_0240368 Ga0501035_0240368_427_1314 292
1116 3300049823 Ga0501044_0011708 Ga0501044_0011708_4122_5006 292
1117 3300049823 Ga0501044_0186860 Ga0501044_0186860_86_973 292
1118 3300049823 Ga0501044_0325647 Ga0501044_0325647_319_1200 292
1119 3300049824 Ga0501045_0001489 Ga0501045_0001489_10378_11262 292
1120 3300049824 Ga0501045_0446303 Ga0501045_0446303_35_943 292
1121 3300050492 nmdc:mga0yw44_10037_c1 nmdc:mga0yw44_10037_c1_3529_4416 292
1122 3300050492 nmdc:mga0yw44_63346_c1 nmdc:mga0yw44_63346_c1_1246_2133 292
1123 3300050507 nmdc:mga05p37_57829_c1 nmdc:mga05p37_57829_c1_3860_4756 292
1124 3300050511 nmdc:mga08y16_15476_c1 nmdc:mga08y16_15476_c1_2979_3887 292
1125 3300050512 nmdc:mga0n895_102351_c1 nmdc:mga0n895_102351_c1_1390_2298 292
1126 3300050513 nmdc:mga0rr50_7235_c1 nmdc:mga0rr50_7235_c1_3484_4392 292
1127 3300050515 nmdc:mga0a205_5917_c1 nmdc:mga0a205_5917_c1_3069_3977 292
1128 3300053136 Ga0500559_0000006 Ga0500559_0000006_48268_49179 292
1129 3300054114 Ga0501084_0043075 Ga0501084_0043075_1006_1902 292
1130 3300060353 Ga0501082_0056858 Ga0501082_0056858_1049_1945 292
1131 3300061734 Ga0530510_0033778 Ga0530510_0033778_2652_3548 292

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03446

NAD_binding_2

NAD binding domain of 6-phosphogluconate dehydrogenase

44

213

0.98

PF14833

NAD_binding_11

NAD-binding of NADP-dependent 3-hydroxyisobutyrate dehydrogenase

215

335

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1yb4-assembly1.cif.gz_A crystal structure of the tartronic semialdehyde reductase from salmonella typhimurium lt2 0.9573 1 292
1yb4-assembly1.cif.gz_A crystal structure of the tartronic semialdehyde reductase from salmonella typhimurium lt2 0.9542 1 292
3pdu-assembly1.cif.gz_D crystal structure of gamma-hydroxybutyrate dehydrogenase from geobacter sulfurreducens in complex with nadp+ 0.9539 2 284
4dll-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9527 2 286
3cky-assembly2.cif.gz_D structural and kinetic properties of a beta-hydroxyacid dehydrogenase involved in nicotinate fermentation 0.9498 57 291
ID Description Score Start End Superfamily
af_P77161_159_292_1.10.1040.10 Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 0.9959 164 291 1.10.1040.10
1yb4B02 Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 0.9915 164 292 1.10.1040.10
af_A0A1D6NCX6_182_311_1.10.1040.10 Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 0.9861 164 291 1.10.1040.10
af_Q4DFE2_166_292_1.10.1040.10 Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 0.9839 163 289 1.10.1040.10
1yb4B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9809 3 159 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A352S2Q2-F1-model_v4 2-hydroxy-3-oxopropionate reductase 0.9988 69 158 GO:0050661
AF-U4V4P8-F1-model_v4 2-hydroxy-3-oxopropionate reductase 0.996 93 291 GO:0016054
GO:0050661
GO:0051287
AF-A0A4V1U4W9-F1-model_v4 deleted 0.9943 193 291
AF-A0A529ZR79-F1-model_v4 2-hydroxy-3-oxopropionate reductase 0.9939 134 291 GO:0016054
GO:0050661
GO:0051287
AF-A0A529UY52-F1-model_v4 deleted 0.9926 2 276

Feature Viewer

pLDDT pTM Quality
96.92 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map