F490550
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1131 | 608 | 965 | 294 |
Family's Representative Sequence
| Representative Sequence | 3300039447|Ga0436361_0143802|Ga0436361_0143802_205_1320 |
| Length | 350 |
| Sequence | MCQAARDGPMLPSSVRLGRSESAGRSNISQVGKLVKCSRKYMADIGFIGLGIMGGPMALNLQKGGHRLFLHSRSGVKEKALLDGGGTECGSPAEVAARAEYIIMMLPNTPDVEAVLFGERGVAAGLTGAGRPAPGREAKLVIDMSSISPLVTRTFAKRISELGADYLDAPVSGGDVGAKNATLTIMVGGSEQAFSRAKPLFELMGKNITLVGGIGDGQTTKVANQIIVALTIEAISEALVFAAKAGADPAKVREALMGGFASSRILEVHGERLLKRNFAPGFRIELHQKDLNLALEGAKSLGVSLPNTASCQELFNACVANGLAKSDHSAMVRALELLANFAIDGSNGKT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501127 | Mesorhizobium sp. WSM2561 | Isolate | Nodule |
| 2 | 2510065019 | Rhizobium leguminosarum bv. trifolii WSM1689 | Isolate | Nodule |
| 3 | 2511231003 | Herbaspirillum sp. CF444 | Isolate | Rhizosphere |
| 4 | 2513237305 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 5 | 2515075009 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 6 | 2521172590 | Herbaspirillum sp. GW103 | Isolate | Rhizosphere |
| 7 | 2534681796 | Rhizobium grahamii CCGE 502 | Isolate | Nodule |
| 8 | 2548876994 | Herbaspirillum lusitanum P6-12 | Isolate | Nodule |
| 9 | 2582581294 | Rhizobium sp. CF394 | Isolate | Rhizosphere |
| 10 | 2582581298 | Rhizobium alamii YR540 | Isolate | Rhizosphere |
| 11 | 2582581867 | Rhizobium sp. OV201 | Isolate | Rhizosphere |
| 12 | 2585427529 | Rhizobium alamii YR584 | Isolate | Rhizosphere |
| 13 | 2585427590 | Rhizobium sp. CF048 | Isolate | Rhizosphere |
| 14 | 2597489875 | Mesorhizobium ciceri ca181 | Isolate | Unclassified |
| 15 | 2597490356 | Azospirillum brasilense sp7 | Isolate | Unclassified |
| 16 | 2615840624 | Rhizobium aethiopicum HBR26 | Isolate | Nodule |
| 17 | 2643221550 | Mesorhizobium sp. Root552 | Isolate | Unclassified |
| 18 | 2643221554 | Duganella sp. Root1480D1 | Isolate | Unclassified |
| 19 | 2643221555 | Mesorhizobium sp. Root554 | Isolate | Unclassified |
| 20 | 2643221580 | Devosia sp. Root635 | Isolate | Unclassified |
| 21 | 2643221603 | Noviherbaspirillum sp. Root189 | Isolate | Unclassified |
| 22 | 2643221629 | Devosia sp. Root105 | Isolate | Unclassified |
| 23 | 2643221638 | Duganella sp. Root336D2 | Isolate | Unclassified |
| 24 | 2643221645 | Massilia sp. Root351 | Isolate | Unclassified |
| 25 | 2643221662 | Devosia sp. Root413D1 | Isolate | Unclassified |
| 26 | 2643221664 | Massilia sp. Root418 | Isolate | Unclassified |
| 27 | 2643221674 | Devosia sp. Root436 | Isolate | Unclassified |
| 28 | 2675903060 | Nonomuraea wenchangensis CGMCC 4.5598 | Isolate | Rhizosphere |
| 29 | 2693429783 | Mesorhizobium sp. LCM 4577 | Isolate | Rhizosphere |
| 30 | 2693429784 | Mesorhizobium sp. LCM 4576 | Isolate | Rhizosphere |
| 31 | 2721755686 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 32 | 2724679232 | Rhizobium leguminosarum Vaf12 | Isolate | Unclassified |
| 33 | 2738541280 | Massilia sp. GV090 | Isolate | Unclassified |
| 34 | 2738541300 | Massilia sp. GV016 | Isolate | Unclassified |
| 35 | 2738543018 | Massilia sp. GV045 | Isolate | Unclassified |
| 36 | 2738543030 | Massilia sp. GV097 | Isolate | Unclassified |
| 37 | 2738543031 | Pleomorphomonas sp. CF100 | Isolate | Unclassified |
| 38 | 2765235838 | Herbaspirillum robiniae AA6 | Isolate | Unclassified |
| 39 | 2791355267 | Rhizobium sp. L18 | Isolate | Nodule |
| 40 | 2808606386 | Herbaspirillum sp. SJZ099 | Isolate | Rhizosphere |
| 41 | 2808606415 | Herbaspirillum sp. SJZ130 | Isolate | Rhizosphere |
| 42 | 2808606418 | Herbaspirillum sp. SJZ107 | Isolate | Rhizosphere |
| 43 | 2808606419 | Herbaspirillum sp. SJZ106 | Isolate | Rhizosphere |
| 44 | 2816332139 | Pseudonocardia kunmingensis DSM 45301 | Isolate | Unclassified |
| 45 | 2818991436 | Collimonas arenae 515 | Isolate | Unclassified |
| 46 | 2818991439 | Agrobacterium tumefaciens 1187 | Isolate | Unclassified |
| 47 | 2818991445 | Herbaspirillum hiltneri 3195 | Isolate | Unclassified |
| 48 | 2818991449 | Herbaspirillum huttiense 1147 | Isolate | Unclassified |
| 49 | 2821123053 | Rhizobium cellulosilyticum 1193 | Isolate | Unclassified |
| 50 | 2839094727 | Herbaspirillum robiniae HZ10 | Isolate | Nodule |
| 51 | 2841734538 | Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 | Isolate | Nodule |
| 52 | 2842395702 | Rhizobium ecuadorense SEMIA 4029 | Isolate | Nodule |
| 53 | 2842711865 | Duganella sp. R-73148 | Isolate | Unclassified |
| 54 | 2842922631 | Pararhizobium sp. R-72066 | Isolate | Unclassified |
| 55 | 2847686936 | Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 | Isolate | Nodule |
| 56 | 2852618963 | Herbaspirillum sp. SJZ102 | Isolate | Rhizosphere |
| 57 | 2854916844 | Neorhizobium huautlense DSM 21817 | Isolate | Unclassified |
| 58 | 2856342000 | Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 | Isolate | Nodule |
| 59 | 2856364286 | Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 | Isolate | Nodule |
| 60 | 2869169390 | Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 | Isolate | Nodule |
| 61 | 2869285874 | Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 | Isolate | Nodule |
| 62 | 2870721527 | Saccharothrix ecbatanensis DSM 45486 | Isolate | Rhizosphere |
| 63 | 2871429161 | Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 | Isolate | Nodule |
| 64 | 2871444079 | Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 | Isolate | Nodule |
| 65 | 2871474448 | Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 | Isolate | Nodule |
| 66 | 2871488783 | Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 | Isolate | Nodule |
| 67 | 2874102143 | Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 | Isolate | Nodule |
| 68 | 2874146452 | Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 | Isolate | Nodule |
| 69 | 2874155637 | Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 | Isolate | Nodule |
| 70 | 2876369609 | Mesorhizobium sp. USDA-HM6 | Isolate | Unclassified |
| 71 | 2876392853 | Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 | Isolate | Nodule |
| 72 | 2876413966 | Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 | Isolate | Nodule |
| 73 | 2878745973 | Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 | Isolate | Nodule |
| 74 | 2878753008 | Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 | Isolate | Nodule |
| 75 | 2881161766 | Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 | Isolate | Nodule |
| 76 | 2881845957 | Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 | Isolate | Nodule |
| 77 | 2881861095 | Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 | Isolate | Nodule |
| 78 | 2882632389 | Mesorhizobium waimense ICMP19557 | Isolate | Unclassified |
| 79 | 2882912400 | Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 | Isolate | Nodule |
| 80 | 2884811622 | Herbaspirillum sp. 3C11 | Isolate | Unclassified |
| 81 | 2884836552 | Herbaspirillum sp. 3R-11 | Isolate | Unclassified |
| 82 | 2884852848 | Herbaspirillum sp. 3R11 | Isolate | Unclassified |
| 83 | 2885318864 | Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 | Isolate | Nodule |
| 84 | 2887443736 | Ruania rhizosphaerae LNNU 22110 | Isolate | Rhizosphere |
| 85 | 2888343758 | Mesorhizobium sp. AA22 | Isolate | Unclassified |
| 86 | 2889010040 | Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 | Isolate | Nodule |
| 87 | 2891048133 | Martelella lutilitoris GH2-6 | Isolate | Rhizosphere |
| 88 | 2895427314 | Nonomuraea sp. PA05 | Isolate | Unclassified |
| 89 | 2895442618 | Nonomuraea phyllanthi PA1-10 | Isolate | Unclassified |
| 90 | 2896154374 | Herbaspirillum sp. 3R-3a1 | Isolate | Nodule |
| 91 | 2897803580 | Azospirillum doebereinerae GSF71 | Isolate | Unclassified |
| 92 | 2903492973 | Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 | Isolate | Nodule |
| 93 | 2904439833 | Herbaspirillum sp. 1589 | Isolate | Rhizosphere |
| 94 | 2904530477 | Herbaspirillum huttiense 611 | Isolate | Unclassified |
| 95 | 2904584206 | Herbaspirillum sp. 1050 | Isolate | Unclassified |
| 96 | 2904589729 | Herbaspirillum sp. 1130 | Isolate | Unclassified |
| 97 | 2904601388 | Herbaspirillum sp. 1273 | Isolate | Rhizosphere |
| 98 | 2904659560 | Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 | Isolate | Nodule |
| 99 | 2906308376 | Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 | Isolate | Nodule |
| 100 | 2906321335 | Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 | Isolate | Nodule |
| 101 | 2906328253 | Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 | Isolate | Nodule |
| 102 | 2915358134 | Pseudonocardia pini CAP47R | Isolate | Unclassified |
| 103 | 2919046199 | Herbaspirillum frisingense 596 | Isolate | Unclassified |
| 104 | 2919079590 | Herbaspirillum sp. 1173 | Isolate | Unclassified |
| 105 | 2919100787 | Rhizobium sp. 1399 | Isolate | Rhizosphere |
| 106 | 2919171160 | Neorhizobium sp. 2083 | Isolate | Unclassified |
| 107 | 2922158528 | Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 | Isolate | Nodule |
| 108 | 2924733363 | Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 | Isolate | Nodule |
| 109 | 2924754689 | Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 | Isolate | Nodule |
| 110 | 2924784321 | Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 | Isolate | Nodule |
| 111 | 2929138655 | Agrobacterium sp. R-72433 Hybrid assembly | Isolate | Unclassified |
| 112 | 2937813078 | Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 | Isolate | Nodule |
| 113 | 2937836603 | Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 | Isolate | Nodule |
| 114 | 2937891427 | Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 | Isolate | Nodule |
| 115 | 2958115193 | Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 | Isolate | Nodule |
| 116 | 2958130278 | Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 | Isolate | Nodule |
| 117 | 2958179912 | Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 | Isolate | Nodule |
| 118 | 2961077736 | Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 | Isolate | Nodule |
| 119 | 2961114664 | Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 | Isolate | Nodule |
| 120 | 2961170736 | Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 | Isolate | Nodule |
| 121 | 2965062239 | Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 | Isolate | Nodule |
| 122 | 2967996073 | Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 | Isolate | Nodule |
| 123 | 2968003550 | Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 | Isolate | Nodule |
| 124 | 2968091066 | Mesorhizobium sp. AA23 | Isolate | Unclassified |
| 125 | 2968097103 | Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 | Isolate | Nodule |
| 126 | 2968110612 | Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 | Isolate | Nodule |
| 127 | 2968117919 | Mesorhizobium atlanticum CNPSo 3140 | Isolate | Unclassified |
| 128 | 2968128360 | Mesorhizobium sp. WSM3873 | Isolate | Unclassified |
| 129 | 2970503327 | Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 | Isolate | Nodule |
| 130 | 2970524798 | Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 | Isolate | Nodule |
| 131 | 2970540015 | Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 | Isolate | Nodule |
| 132 | 2977821940 | Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 | Isolate | Nodule |
| 133 | 2977843712 | Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 | Isolate | Nodule |
| 134 | 2977858184 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 | Isolate | Nodule |
| 135 | 2979100975 | Agrobacterium pusense SORGH_AS 755 | Isolate | Unclassified |
| 136 | 2979808191 | Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 | Isolate | Nodule |
| 137 | 2984509177 | Agrobacterium pusense SORGH_AS260 | Isolate | Aerial Root |
| 138 | 2984518228 | Agrobacterium pusense SORGH_AS285 | Isolate | Aerial Root |
| 139 | 2984537506 | Agrobacterium sp. SORGH_AS440 | Isolate | Aerial Root |
| 140 | 2984601300 | Rhizobium pusense SORGH_AS1083 | Isolate | Aerial Root |
| 141 | 2987652177 | Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 | Isolate | Nodule |
| 142 | 2989349275 | Shinella kummerowiae CCBAU 25048 | Isolate | Unclassified |
| 143 | 2995392953 | Martelella limonii NBRC 109441 | Isolate | Unclassified |
| 144 | 2996336353 | Mesorhizobium sp. YM1C-6-2 | Isolate | Unclassified |
| 145 | 2996341866 | Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 | Isolate | Nodule |
| 146 | 3000135777 | Unclassified bacterium M00.F.Ca.ET.205.01.1.1 | Isolate | Unclassified |
| 147 | 3005445848 | Rhizobium sp. WYJ-E13 | Isolate | Unclassified |
| 148 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 149 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 150 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 151 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 152 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 153 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 154 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 155 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 156 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 157 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 158 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 159 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 160 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 161 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 162 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 163 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 164 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 165 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 166 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 167 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 168 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 169 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 170 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 171 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 172 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 173 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 174 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 175 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 176 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 177 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 178 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 179 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 180 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 181 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 182 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 183 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 184 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 185 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 186 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 187 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 188 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 189 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 190 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 191 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 192 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 193 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 194 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 195 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 196 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 197 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 198 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 199 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 200 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 201 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 202 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 203 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 204 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 205 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 206 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 207 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 208 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 209 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 210 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 211 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 212 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 213 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 214 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 215 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 216 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 217 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 218 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 219 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 220 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 221 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 222 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 223 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 224 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 225 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 226 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 227 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 228 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 229 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 230 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 231 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 232 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 233 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 234 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 235 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 236 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 237 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 238 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 239 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 240 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 241 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 242 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 243 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 244 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 245 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 246 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 247 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 248 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 249 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 250 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 251 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 252 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 253 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 254 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 256 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 257 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 259 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 260 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 261 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 262 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 263 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 264 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 265 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 266 | 3300009765 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule | Metagenome | Nodule |
| 267 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 268 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 269 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 270 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 271 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 272 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 273 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 274 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 275 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 276 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 277 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 278 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 279 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 280 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 281 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 282 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 283 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 284 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 285 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 286 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 287 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 288 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 289 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 290 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 291 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 292 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 293 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 294 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 295 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 296 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 297 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 298 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 299 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 300 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 301 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 302 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 303 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 304 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 305 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 306 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 307 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 308 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 309 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 310 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 311 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 312 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 313 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 314 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 315 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 316 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 317 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 318 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 319 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 320 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 321 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 322 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 323 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 324 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 325 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 326 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 327 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 328 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 329 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 330 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 331 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 332 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 333 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 334 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 335 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 336 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 337 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 338 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 339 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 340 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 341 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 342 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 343 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 344 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 345 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 346 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 347 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 348 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 349 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 350 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 351 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 352 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 353 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 354 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 355 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 356 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 357 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 358 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 359 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 360 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 361 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 362 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 363 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 364 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 365 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 366 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 367 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 368 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 369 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 370 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 371 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 372 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 373 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 374 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 375 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 376 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 377 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 378 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 379 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 380 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 381 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 382 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 383 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 384 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 385 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 386 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 387 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 388 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 389 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 390 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 391 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 392 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 393 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 394 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 395 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 396 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 397 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 398 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 399 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 400 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 401 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 402 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 403 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 404 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 405 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 406 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 407 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 408 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 409 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 410 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 411 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 412 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 413 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 414 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 415 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 416 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 417 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 418 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 419 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 420 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 421 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 422 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 423 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 424 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 425 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 426 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 427 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 428 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 429 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 430 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 431 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 440 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 441 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 442 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 443 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 444 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 445 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 446 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 447 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 448 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 449 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 450 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 451 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 452 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 453 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 454 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 455 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 456 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 457 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 458 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 459 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 460 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 461 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 462 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 463 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 464 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 465 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 466 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 467 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 468 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 469 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 470 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 471 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 472 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 473 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 474 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 475 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 476 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 477 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 478 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 479 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 480 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 481 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 482 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 483 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 484 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 485 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 486 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 487 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 488 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 489 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 490 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 491 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 492 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 493 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 494 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 495 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 496 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 497 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 498 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 499 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 500 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 501 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 502 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 503 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 504 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 505 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 506 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 507 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 508 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 509 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 510 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 511 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 512 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 513 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 514 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 515 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 516 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 517 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 518 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 519 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 520 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 521 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 522 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 523 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 524 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 525 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 526 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 527 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 528 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 529 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 530 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 531 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 532 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 533 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 534 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 535 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 536 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 537 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 538 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 539 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 540 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 541 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 542 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 543 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 544 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 545 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 546 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 547 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 548 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 549 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 550 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 551 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 552 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 553 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 554 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 555 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 556 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 557 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 558 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 559 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 560 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 561 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 562 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 563 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 564 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 565 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 566 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 567 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 568 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 569 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 570 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 571 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 572 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 573 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 574 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 575 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 576 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 577 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 578 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 579 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 580 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 581 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 582 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 583 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 584 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 585 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 586 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 587 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 588 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 589 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 590 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 591 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 592 | 641522639 | Methylobacterium sp. 4-46 | Isolate | Nodule |
| 593 | 8004374579 | Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 | Isolate | Nodule |
| 594 | 8004387939 | Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 | Isolate | Nodule |
| 595 | 8004445564 | Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 | Isolate | Nodule |
| 596 | 8004703790 | Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 | Isolate | Nodule |
| 597 | 8004714634 | Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 | Isolate | Nodule |
| 598 | 8005301065 | Rhizobium bangladeshense 1017 | Isolate | Nodule |
| 599 | 8005460587 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 600 | 8005542996 | Rhizobium grahamii CCGM3 | Isolate | Unclassified |
| 601 | 8005688590 | Rhizobium bangladeshense 1024 | Isolate | Nodule |
| 602 | 8018127388 | Rhizobium aegyptiacum 950 | Isolate | Nodule |
| 603 | 8047710418 | Umezawaea endophytica DSM 103496 | Isolate | Unclassified |
| 604 | 8048746797 | Alcaligenes endophyticus DSM 100498 | Isolate | Unclassified |
| 605 | 8055066027 | Sphaerisporangium corydalis NEAU-YHS15 | Isolate | Unclassified |
| 606 | 8055172936 | Sphaerisporangium perillae NEAU-ZS1 | Isolate | Unclassified |
| 607 | 8055617313 | Mesorhizobium onobrychidis OM4 | Isolate | Nodule |
| 608 | 8057575449 | Rhizobium mayense CCGE526 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 85.06 |
| Metatranscriptomes | 0.27 |
| Isolates | 14.68 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.35 |
| Bulb | 0 |
| Endosphere | 14.68 |
| Nodule | 7.16 |
| Rhizoplane | 2.21 |
| Rhizosphere | 64.54 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.05 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24749J21850_1000008 | 3300002076 | Bacteria | 45410 |
| 2 | JGI25155J39150_1000898 | 3300002704 | Bacteria | 4161 |
| 3 | JGI25155J39150_1000924 | 3300002704 | Bacteria | 3829 |
| 4 | JGI25156J39149_1004604 | 3300002705 | Bacteria | 4161 |
| 5 | JGI25162J39368_1000420 | 3300002737 | Bacteria | 34477 |
| 6 | JGI25162J39368_1006253 | 3300002737 | Bacteria | 2100 |
| 7 | JGI25154J39366_1000840 | 3300002738 | Bacteria | 13349 |
| 8 | JGI25154J39366_1004395 | 3300002738 | Bacteria | 2541 |
| 9 | JGI25157J39369_1000918 | 3300002741 | Bacteria | 14047 |
| 10 | JGI25163J39215_1002583 | 3300002771 | Bacteria | 1783 |
| 11 | JGI25152J39213_1000181 | 3300002773 | Bacteria | 42307 |
| 12 | JGI25152J39213_1002643 | 3300002773 | Bacteria | 6644 |
| 13 | JGI25152J39213_1002734 | 3300002773 | Bacteria | 6436 |
| 14 | JGI25152J39213_1011499 | 3300002773 | Bacteria | 1954 |
| 15 | JGI25150J39212_1000357 | 3300002774 | Bacteria | 22438 |
| 16 | JGI25150J39212_1004088 | 3300002774 | Bacteria | 3299 |
| 17 | JGI25159J45721_1001272 | 3300002987 | Bacteria | 10656 |
| 18 | JGI25159J45721_1001631 | 3300002987 | Bacteria | 9123 |
| 19 | JGI25159J45721_1006561 | 3300002987 | Bacteria | 3467 |
| 20 | JGI25151J46595_10001104 | 3300003187 | Bacteria | 19829 |
| 21 | JGI25151J46595_10004657 | 3300003187 | Bacteria | 7216 |
| 22 | JGI25151J46595_10045182 | 3300003187 | Bacteria | 1557 |
| 23 | JGI25165J46597_1000303 | 3300003214 | Bacteria | 61420 |
| 24 | JGI25165J46597_1000547 | 3300003214 | Bacteria | 34477 |
| 25 | JGI25153J46596_10004410 | 3300003215 | Bacteria | 7596 |
| 26 | JGI25153J46596_10004839 | 3300003215 | Bacteria | 7176 |
| 27 | JGI25153J46596_10005483 | 3300003215 | Bacteria | 6644 |
| 28 | JGI25153J46596_10030291 | 3300003215 | Bacteria | 1843 |
| 29 | rootH2_10032358 | 3300003320 | Bacteria | 11896 |
| 30 | rootH1_10108747 | 3300003323 | Bacteria | 1072 |
| 31 | JGI25160J50197_1006241 | 3300003354 | Bacteria | 4843 |
| 32 | JGI25160J50197_1009997 | 3300003354 | Bacteria | 3467 |
| 33 | JGI25161J50226_1000079 | 3300003374 | Bacteria | 83375 |
| 34 | JGI25161J50226_1000409 | 3300003374 | Bacteria | 21021 |
| 35 | JGI25161J50226_1006338 | 3300003374 | Bacteria | 2157 |
| 36 | JGI25404J52841_10014882 | 3300003659 | Bacteria | 1689 |
| 37 | JGI25404J52841_10045227 | 3300003659 | Bacteria | 928 |
| 38 | Ga0055538_1000209 | 3300003751 | Bacteria | 34477 |
| 39 | Ga0055538_1000664 | 3300003751 | Bacteria | 10790 |
| 40 | Ga0055539_1000251 | 3300003752 | Bacteria | 34462 |
| 41 | Ga0055539_1000557 | 3300003752 | Bacteria | 10790 |
| 42 | Ga0055533_1000242 | 3300003756 | Bacteria | 34477 |
| 43 | Ga0055533_1000718 | 3300003756 | Bacteria | 10790 |
| 44 | Ga0055532_1000097 | 3300003758 | Bacteria | 98781 |
| 45 | Ga0055525_1000338 | 3300003759 | Bacteria | 34336 |
| 46 | Ga0055525_1000759 | 3300003759 | Bacteria | 10790 |
| 47 | Ga0055535_1005969 | 3300003761 | Bacteria | 2553 |
| 48 | Ga0055529_1000032 | 3300003763 | Bacteria | 255895 |
| 49 | Ga0055526_1000402 | 3300003771 | Bacteria | 35007 |
| 50 | Ga0055526_1000951 | 3300003771 | Bacteria | 21419 |
| 51 | Ga0055526_1001247 | 3300003771 | Bacteria | 18251 |
| 52 | Ga0055526_1007163 | 3300003771 | Bacteria | 5870 |
| 53 | Ga0055526_1009071 | 3300003771 | Bacteria | 4852 |
| 54 | Ga0055526_1014548 | 3300003771 | Bacteria | 3227 |
| 55 | Ga0055537_1000030 | 3300003773 | Bacteria | 100491 |
| 56 | Ga0055537_1003332 | 3300003773 | Bacteria | 4969 |
| 57 | Ga0055524_1000851 | 3300003775 | Bacteria | 20015 |
| 58 | Ga0055524_1002689 | 3300003775 | Bacteria | 8994 |
| 59 | Ga0055524_1016960 | 3300003775 | Bacteria | 2586 |
| 60 | Ga0055524_1017942 | 3300003775 | Bacteria | 2478 |
| 61 | Ga0055534_1000203 | 3300003784 | Bacteria | 43799 |
| 62 | Ga0055534_1001261 | 3300003784 | Bacteria | 10366 |
| 63 | Ga0055534_1012691 | 3300003784 | Bacteria | 1653 |
| 64 | Ga0055528_1000439 | 3300003790 | Bacteria | 33348 |
| 65 | Ga0055528_1005416 | 3300003790 | Bacteria | 5949 |
| 66 | Ga0055528_1029743 | 3300003790 | Bacteria | 1469 |
| 67 | Ga0055530_10000604 | 3300003791 | Bacteria | 31118 |
| 68 | Ga0055540_1024817 | 3300003792 | Bacteria | 1481 |
| 69 | Ga0055531_10001184 | 3300003794 | Bacteria | 20028 |
| 70 | Ga0055531_10002864 | 3300003794 | Bacteria | 11242 |
| 71 | Ga0055541_1000149 | 3300003841 | Bacteria | 34336 |
| 72 | Ga0055541_1000513 | 3300003841 | Bacteria | 10790 |
| 73 | Ga0058692_1000086 | 3300003856 | Bacteria | 64977 |
| 74 | Ga0055543_1000031 | 3300004625 | Bacteria | 130583 |
| 75 | Ga0055543_1000550 | 3300004625 | Bacteria | 21059 |
| 76 | Ga0065165_1001805 | 3300005262 | Bacteria | 21038 |
| 77 | Ga0065165_1005147 | 3300005262 | Bacteria | 7568 |
| 78 | Ga0065707_10002796 | 3300005295 | Bacteria | 6684 |
| 79 | Ga0070658_10185638 | 3300005327 | Bacteria | 1751 |
| 80 | Ga0070676_10178179 | 3300005328 | Bacteria | 1380 |
| 81 | Ga0070683_100175519 | 3300005329 | Bacteria | 2034 |
| 82 | Ga0070690_100000109 | 3300005330 | Bacteria | 42695 |
| 83 | Ga0070690_100236319 | 3300005330 | Bacteria | 1287 |
| 84 | Ga0070670_100029086 | 3300005331 | Bacteria | 4755 |
| 85 | Ga0070670_100371130 | 3300005331 | Bacteria | 1259 |
| 86 | Ga0068869_100000272 | 3300005334 | Bacteria | 27189 |
| 87 | Ga0070680_100265547 | 3300005336 | Bacteria | 1453 |
| 88 | Ga0070682_100038780 | 3300005337 | Bacteria | 2924 |
| 89 | Ga0070660_100038243 | 3300005339 | Bacteria | 3642 |
| 90 | Ga0070689_100012618 | 3300005340 | Bacteria | 6092 |
| 91 | Ga0070691_10015476 | 3300005341 | Bacteria | 3505 |
| 92 | Ga0070687_100011426 | 3300005343 | Bacteria | 3885 |
| 93 | Ga0070661_100397586 | 3300005344 | Bacteria | 1089 |
| 94 | Ga0070671_100053527 | 3300005355 | Bacteria | 3355 |
| 95 | Ga0070659_100112112 | 3300005366 | Bacteria | 2202 |
| 96 | Ga0070667_100000667 | 3300005367 | Bacteria | 33258 |
| 97 | Ga0070667_100031798 | 3300005367 | Bacteria | 4399 |
| 98 | Ga0070667_100080860 | 3300005367 | Bacteria | 2780 |
| 99 | Ga0070667_100237047 | 3300005367 | Bacteria | 1628 |
| 100 | Ga0070714_100001359 | 3300005435 | Bacteria | 17702 |
| 101 | Ga0070713_100305292 | 3300005436 | Bacteria | 1466 |
| 102 | Ga0070701_10000446 | 3300005438 | Bacteria | 14104 |
| 103 | Ga0070711_100175933 | 3300005439 | Bacteria | 1635 |
| 104 | Ga0070711_100341124 | 3300005439 | Bacteria | 1202 |
| 105 | Ga0070700_100000237 | 3300005441 | Bacteria | 30204 |
| 106 | Ga0070700_100004413 | 3300005441 | Bacteria | 7350 |
| 107 | Ga0070694_100141182 | 3300005444 | Bacteria | 1750 |
| 108 | Ga0070708_100155966 | 3300005445 | Bacteria | 2126 |
| 109 | Ga0070678_100147827 | 3300005456 | Bacteria | 1889 |
| 110 | Ga0070681_10219589 | 3300005458 | Bacteria | 1816 |
| 111 | Ga0068867_100001174 | 3300005459 | Bacteria | 17935 |
| 112 | Ga0070707_100005918 | 3300005468 | Bacteria | 11411 |
| 113 | Ga0070698_100006326 | 3300005471 | Bacteria | 12859 |
| 114 | Ga0070698_100098284 | 3300005471 | Bacteria | 2902 |
| 115 | Ga0070698_100376174 | 3300005471 | Bacteria | 1353 |
| 116 | Ga0070699_100028974 | 3300005518 | Bacteria | 4773 |
| 117 | Ga0070679_100058363 | 3300005530 | Bacteria | 3845 |
| 118 | Ga0070679_100091532 | 3300005530 | Bacteria | 3029 |
| 119 | Ga0070679_100461289 | 3300005530 | Bacteria | 1215 |
| 120 | Ga0070684_100112266 | 3300005535 | Bacteria | 2445 |
| 121 | Ga0070697_100022227 | 3300005536 | Bacteria | 5033 |
| 122 | Ga0068853_100309034 | 3300005539 | Bacteria | 1463 |
| 123 | Ga0070672_100009322 | 3300005543 | Bacteria | 6764 |
| 124 | Ga0070686_100000464 | 3300005544 | Bacteria | 24551 |
| 125 | Ga0070686_100390150 | 3300005544 | Bacteria | 1056 |
| 126 | Ga0070695_100024435 | 3300005545 | Bacteria | 3722 |
| 127 | Ga0070696_100280000 | 3300005546 | Bacteria | 1271 |
| 128 | Ga0070704_100077821 | 3300005549 | Bacteria | 2431 |
| 129 | Ga0068855_100000951 | 3300005563 | Bacteria | 36038 |
| 130 | Ga0068855_100153432 | 3300005563 | Bacteria | 2618 |
| 131 | Ga0070664_100000682 | 3300005564 | Bacteria | 25899 |
| 132 | Ga0068857_100002406 | 3300005577 | Bacteria | 15253 |
| 133 | Ga0068857_100263262 | 3300005577 | Bacteria | 1583 |
| 134 | Ga0068854_100017008 | 3300005578 | Bacteria | 4859 |
| 135 | Ga0068856_100026055 | 3300005614 | Bacteria | 5703 |
| 136 | Ga0068856_100106259 | 3300005614 | Bacteria | 2801 |
| 137 | Ga0068856_100562433 | 3300005614 | Bacteria | 1162 |
| 138 | Ga0070702_100026943 | 3300005615 | Bacteria | 3096 |
| 139 | Ga0068852_100131398 | 3300005616 | Bacteria | 2306 |
| 140 | Ga0068852_100204790 | 3300005616 | Bacteria | 1868 |
| 141 | Ga0068859_100005767 | 3300005617 | Bacteria | 12590 |
| 142 | Ga0068866_10001195 | 3300005718 | Bacteria | 11324 |
| 143 | Ga0068861_100000333 | 3300005719 | Bacteria | 26666 |
| 144 | Ga0068861_100013959 | 3300005719 | Bacteria | 5631 |
| 145 | Ga0068870_10039634 | 3300005840 | Bacteria | 2438 |
| 146 | Ga0068863_100004683 | 3300005841 | Bacteria | 13479 |
| 147 | Ga0068863_100331272 | 3300005841 | Bacteria | 1480 |
| 148 | Ga0068858_100025288 | 3300005842 | Bacteria | 5525 |
| 149 | Ga0068860_100020873 | 3300005843 | Bacteria | 6345 |
| 150 | Ga0068862_100001937 | 3300005844 | Bacteria | 18793 |
| 151 | Ga0068862_100002549 | 3300005844 | Bacteria | 16113 |
| 152 | Ga0068862_100021490 | 3300005844 | Bacteria | 5393 |
| 153 | Ga0068862_100056436 | 3300005844 | Bacteria | 3365 |
| 154 | Ga0081455_10151879 | 3300005937 | Bacteria | 1784 |
| 155 | Ga0081538_10004456 | 3300005981 | Bacteria | 12903 |
| 156 | Ga0081538_10005813 | 3300005981 | Bacteria | 10994 |
| 157 | Ga0081540_1000201 | 3300005983 | Bacteria | 62353 |
| 158 | Ga0081540_1003632 | 3300005983 | Bacteria | 12108 |
| 159 | Ga0081540_1015179 | 3300005983 | Bacteria | 4889 |
| 160 | Ga0081539_10008288 | 3300005985 | Bacteria | 9106 |
| 161 | Ga0081539_10045778 | 3300005985 | Bacteria | 2513 |
| 162 | Ga0070717_10048879 | 3300006028 | Bacteria | 3471 |
| 163 | Ga0075365_10023666 | 3300006038 | Bacteria | 3866 |
| 164 | Ga0070712_100002440 | 3300006175 | Bacteria | 11455 |
| 165 | Ga0075366_10005655 | 3300006195 | Bacteria | 6780 |
| 166 | Ga0068871_100179316 | 3300006358 | Bacteria | 1820 |
| 167 | Ga0075428_100002468 | 3300006844 | Bacteria | 20071 |
| 168 | Ga0075430_100013887 | 3300006846 | Bacteria | 6864 |
| 169 | Ga0075430_100042004 | 3300006846 | Bacteria | 3867 |
| 170 | Ga0075430_100258100 | 3300006846 | Bacteria | 1444 |
| 171 | Ga0075433_10039571 | 3300006852 | Bacteria | 4077 |
| 172 | Ga0075434_100003847 | 3300006871 | Bacteria | 13425 |
| 173 | Ga0075434_100300126 | 3300006871 | Bacteria | 1627 |
| 174 | Ga0075429_100032506 | 3300006880 | Bacteria | 4535 |
| 175 | Ga0068865_100000379 | 3300006881 | Bacteria | 24707 |
| 176 | Ga0097620_100005767 | 3300006931 | Bacteria | 12590 |
| 177 | Ga0075435_100019943 | 3300007076 | Bacteria | 5126 |
| 178 | Ga0105240_10013457 | 3300009093 | Bacteria | 11236 |
| 179 | Ga0105240_10060062 | 3300009093 | Bacteria | 4741 |
| 180 | Ga0105240_10066905 | 3300009093 | Bacteria | 4456 |
| 181 | Ga0105240_10297170 | 3300009093 | Bacteria | 1849 |
| 182 | Ga0105240_10363333 | 3300009093 | Bacteria | 1639 |
| 183 | Ga0111539_10001915 | 3300009094 | Bacteria | 27718 |
| 184 | Ga0111539_10005209 | 3300009094 | Bacteria | 16838 |
| 185 | Ga0105245_10001340 | 3300009098 | Bacteria | 22300 |
| 186 | Ga0105245_10003250 | 3300009098 | Bacteria | 14573 |
| 187 | Ga0105247_10005532 | 3300009101 | Bacteria | 7948 |
| 188 | Ga0105243_10000789 | 3300009148 | Bacteria | 30347 |
| 189 | Ga0105243_10013742 | 3300009148 | Bacteria | 6126 |
| 190 | Ga0105242_10001855 | 3300009176 | Bacteria | 16575 |
| 191 | Ga0105248_10000157 | 3300009177 | Bacteria | 79064 |
| 192 | Ga0105248_10026867 | 3300009177 | Bacteria | 6402 |
| 193 | Ga0105248_10075531 | 3300009177 | Bacteria | 3788 |
| 194 | Ga0105237_10033514 | 3300009545 | Bacteria | 5204 |
| 195 | Ga0105237_10048394 | 3300009545 | Bacteria | 4273 |
| 196 | Ga0105238_10010332 | 3300009551 | Bacteria | 9366 |
| 197 | Ga0105238_10074378 | 3300009551 | Bacteria | 3390 |
| 198 | Ga0105238_10118544 | 3300009551 | Bacteria | 2627 |
| 199 | Ga0105238_10262191 | 3300009551 | Bacteria | 1708 |
| 200 | Ga0105238_10298273 | 3300009551 | Bacteria | 1595 |
| 201 | Ga0105249_10006020 | 3300009553 | Bacteria | 10509 |
| 202 | Ga0105249_10399582 | 3300009553 | Bacteria | 1404 |
| 203 | Ga0123341_1000059 | 3300009765 | Bacteria | 46893 |
| 204 | Ga0105239_10109019 | 3300010375 | Bacteria | 3068 |
| 205 | Ga0105239_10252141 | 3300010375 | Bacteria | 1982 |
| 206 | Ga0157373_10287131 | 3300013100 | Bacteria | 1167 |
| 207 | Ga0157370_10213080 | 3300013104 | Bacteria | 1790 |
| 208 | Ga0157369_10235678 | 3300013105 | Bacteria | 1912 |
| 209 | Ga0157369_10332877 | 3300013105 | Bacteria | 1577 |
| 210 | Ga0157378_10001061 | 3300013297 | Bacteria | 25145 |
| 211 | Ga0163162_10005600 | 3300013306 | Bacteria | 12149 |
| 212 | Ga0163162_10059762 | 3300013306 | Bacteria | 3844 |
| 213 | Ga0163162_10359516 | 3300013306 | Bacteria | 1589 |
| 214 | Ga0157375_10058395 | 3300013308 | Bacteria | 3816 |
| 215 | Ga0157375_10081781 | 3300013308 | Bacteria | 3270 |
| 216 | Ga0157375_10100144 | 3300013308 | Bacteria | 2978 |
| 217 | Ga0157375_10911938 | 3300013308 | Bacteria | 1022 |
| 218 | Ga0157380_10020480 | 3300014326 | Bacteria | 4944 |
| 219 | Ga0157379_10022456 | 3300014968 | Bacteria | 5589 |
| 220 | Ga0157379_10368054 | 3300014968 | Bacteria | 1318 |
| 221 | Ga0157376_10509653 | 3300014969 | Bacteria | 1184 |
| 222 | Ga0182006_1001104 | 3300015261 | Bacteria | 17230 |
| 223 | Ga0182006_1018185 | 3300015261 | Bacteria | 2974 |
| 224 | Ga0182007_10002870 | 3300015262 | Bacteria | 8381 |
| 225 | Ga0182007_10005932 | 3300015262 | Bacteria | 5304 |
| 226 | Ga0163161_10070365 | 3300017792 | Bacteria | 2558 |
| 227 | Ga0163161_10106602 | 3300017792 | Bacteria | 2091 |
| 228 | Ga0206356_10261284 | 3300020070 | Bacteria | 1778 |
| 229 | Ga0206354_10465120 | 3300020081 | Bacteria | 1084 |
| 230 | Ga0206353_10609877 | 3300020082 | Bacteria | 1471 |
| 231 | Ga0213873_10001831 | 3300021358 | Bacteria | 3598 |
| 232 | Ga0213873_10041559 | 3300021358 | Bacteria | 1186 |
| 233 | Ga0213872_10000600 | 3300021361 | Bacteria | 27447 |
| 234 | Ga0213872_10004201 | 3300021361 | Bacteria | 7731 |
| 235 | Ga0213872_10005734 | 3300021361 | Bacteria | 6321 |
| 236 | Ga0213872_10008921 | 3300021361 | Bacteria | 4828 |
| 237 | Ga0213872_10010382 | 3300021361 | Bacteria | 4436 |
| 238 | Ga0213872_10031458 | 3300021361 | Bacteria | 2432 |
| 239 | Ga0213872_10036269 | 3300021361 | Bacteria | 2254 |
| 240 | Ga0213872_10067952 | 3300021361 | Bacteria | 1608 |
| 241 | Ga0213876_10000781 | 3300021384 | Bacteria | 21705 |
| 242 | Ga0213871_10004755 | 3300021441 | Bacteria | 2745 |
| 243 | Ga0213871_10007967 | 3300021441 | Bacteria | 2315 |
| 244 | Ga0213871_10015781 | 3300021441 | Bacteria | 1811 |
| 245 | Ga0213871_10040704 | 3300021441 | Bacteria | 1247 |
| 246 | Ga0209435_100040 | 3300025206 | Bacteria | 115475 |
| 247 | Ga0209436_100110 | 3300025208 | Bacteria | 41189 |
| 248 | Ga0209436_100343 | 3300025208 | Bacteria | 21073 |
| 249 | Ga0209436_101709 | 3300025208 | Bacteria | 7232 |
| 250 | Ga0209784_100002 | 3300025224 | Bacteria | 1753105 |
| 251 | Ga0209784_100020 | 3300025224 | Bacteria | 412353 |
| 252 | Ga0209566_100003 | 3300025225 | Bacteria | 1753105 |
| 253 | Ga0209566_100020 | 3300025225 | Bacteria | 412353 |
| 254 | Ga0209674_100004 | 3300025226 | Bacteria | 1753105 |
| 255 | Ga0209674_100035 | 3300025226 | Bacteria | 412353 |
| 256 | Ga0209147_100141 | 3300025229 | Bacteria | 115466 |
| 257 | Ga0209563_100006 | 3300025230 | Bacteria | 1753105 |
| 258 | Ga0209563_100038 | 3300025230 | Bacteria | 412353 |
| 259 | Ga0207427_101174 | 3300025231 | Bacteria | 10235 |
| 260 | Ga0209437_100066 | 3300025233 | Bacteria | 327883 |
| 261 | Ga0209437_100229 | 3300025233 | Bacteria | 95900 |
| 262 | Ga0209258_100346 | 3300025242 | Bacteria | 66811 |
| 263 | Ga0207425_1000001 | 3300025245 | Bacteria | 2525432 |
| 264 | Ga0207425_1000039 | 3300025245 | Bacteria | 219078 |
| 265 | Ga0207425_1000730 | 3300025245 | Bacteria | 17415 |
| 266 | Ga0209646_1000218 | 3300025246 | Bacteria | 62078 |
| 267 | Ga0209646_1000235 | 3300025246 | Bacteria | 57627 |
| 268 | Ga0209026_1000725 | 3300025250 | Bacteria | 19335 |
| 269 | Ga0209026_1009785 | 3300025250 | Bacteria | 1850 |
| 270 | Ga0209677_100003 | 3300025253 | Bacteria | 1753105 |
| 271 | Ga0209677_100031 | 3300025253 | Bacteria | 329719 |
| 272 | Ga0209759_1000447 | 3300025256 | Bacteria | 47749 |
| 273 | Ga0209759_1001334 | 3300025256 | Bacteria | 14473 |
| 274 | Ga0209129_1000001 | 3300025258 | Bacteria | 1452436 |
| 275 | Ga0209129_1000300 | 3300025258 | Bacteria | 46275 |
| 276 | Ga0209129_1000370 | 3300025258 | Bacteria | 36660 |
| 277 | Ga0209129_1000786 | 3300025258 | Bacteria | 20051 |
| 278 | Ga0209129_1001338 | 3300025258 | Bacteria | 13934 |
| 279 | Ga0209129_1003963 | 3300025258 | Bacteria | 6106 |
| 280 | Ga0209233_1000060 | 3300025261 | Bacteria | 412379 |
| 281 | Ga0209233_1000188 | 3300025261 | Bacteria | 132904 |
| 282 | Ga0209233_1033544 | 3300025261 | Bacteria | 1178 |
| 283 | Ga0209565_1000017 | 3300025263 | Bacteria | 462438 |
| 284 | Ga0209565_1000410 | 3300025263 | Bacteria | 35519 |
| 285 | Ga0209565_1000440 | 3300025263 | Bacteria | 33208 |
| 286 | Ga0209455_1000043 | 3300025272 | Bacteria | 413928 |
| 287 | Ga0209455_1004598 | 3300025272 | Bacteria | 4468 |
| 288 | Ga0209673_1000007 | 3300025273 | Bacteria | 634477 |
| 289 | Ga0209673_1008713 | 3300025273 | Bacteria | 4485 |
| 290 | Ga0209673_1011374 | 3300025273 | Bacteria | 3674 |
| 291 | Ga0209130_1000023 | 3300025284 | Bacteria | 359355 |
| 292 | Ga0209130_1000534 | 3300025284 | Bacteria | 38300 |
| 293 | Ga0209130_1001866 | 3300025284 | Bacteria | 12051 |
| 294 | Ga0209130_1002660 | 3300025284 | Bacteria | 8535 |
| 295 | Ga0209130_1002808 | 3300025284 | Bacteria | 8124 |
| 296 | Ga0209675_1000009 | 3300025291 | Bacteria | 562872 |
| 297 | Ga0209675_1000630 | 3300025291 | Bacteria | 25153 |
| 298 | Ga0209675_1002116 | 3300025291 | Bacteria | 10503 |
| 299 | Ga0209675_1003002 | 3300025291 | Bacteria | 8302 |
| 300 | Ga0209676_1006467 | 3300025292 | Bacteria | 5774 |
| 301 | Ga0209025_1000505 | 3300025294 | Bacteria | 74909 |
| 302 | Ga0209025_1000594 | 3300025294 | Bacteria | 65297 |
| 303 | Ga0209025_1006291 | 3300025294 | Bacteria | 9281 |
| 304 | Ga0209025_1007217 | 3300025294 | Bacteria | 8366 |
| 305 | Ga0209564_1000055 | 3300025295 | Bacteria | 343782 |
| 306 | Ga0209564_1000109 | 3300025295 | Bacteria | 212912 |
| 307 | Ga0209564_1000393 | 3300025295 | Bacteria | 78338 |
| 308 | Ga0209564_1000879 | 3300025295 | Bacteria | 39962 |
| 309 | Ga0209564_1001055 | 3300025295 | Bacteria | 33601 |
| 310 | Ga0209564_1018582 | 3300025295 | Bacteria | 2641 |
| 311 | Ga0209564_1021373 | 3300025295 | Bacteria | 2330 |
| 312 | Ga0209758_1000020 | 3300025297 | Bacteria | 734220 |
| 313 | Ga0209758_1000390 | 3300025297 | Bacteria | 75869 |
| 314 | Ga0209758_1000422 | 3300025297 | Bacteria | 71804 |
| 315 | Ga0209758_1000766 | 3300025297 | Bacteria | 46275 |
| 316 | Ga0209758_1004936 | 3300025297 | Bacteria | 10712 |
| 317 | Ga0209050_1000074 | 3300025298 | Bacteria | 289334 |
| 318 | Ga0209050_1000116 | 3300025298 | Bacteria | 204164 |
| 319 | Ga0209050_1029605 | 3300025298 | Bacteria | 1746 |
| 320 | Ga0209256_1000028 | 3300025299 | Bacteria | 420213 |
| 321 | Ga0209256_1000559 | 3300025299 | Bacteria | 53325 |
| 322 | Ga0209256_1000640 | 3300025299 | Bacteria | 47611 |
| 323 | Ga0209256_1002555 | 3300025299 | Bacteria | 14561 |
| 324 | Ga0209256_1003461 | 3300025299 | Bacteria | 11043 |
| 325 | Ga0209256_1006115 | 3300025299 | Bacteria | 6532 |
| 326 | Ga0207426_1000087 | 3300025302 | Bacteria | 288870 |
| 327 | Ga0207426_1001693 | 3300025302 | Bacteria | 17025 |
| 328 | Ga0207426_1007150 | 3300025302 | Bacteria | 4713 |
| 329 | Ga0209051_1011200 | 3300025303 | Bacteria | 4451 |
| 330 | Ga0209051_1012329 | 3300025303 | Bacteria | 4143 |
| 331 | Ga0209257_1000003 | 3300025304 | Bacteria | 1702593 |
| 332 | Ga0209257_1003961 | 3300025304 | Bacteria | 12012 |
| 333 | Ga0209257_1005314 | 3300025304 | Bacteria | 9137 |
| 334 | Ga0209257_1005865 | 3300025304 | Bacteria | 8305 |
| 335 | Ga0207710_10003876 | 3300025900 | Bacteria | 6611 |
| 336 | Ga0207688_10086663 | 3300025901 | Bacteria | 1794 |
| 337 | Ga0207688_10193029 | 3300025901 | Bacteria | 1219 |
| 338 | Ga0207647_10098630 | 3300025904 | Bacteria | 1736 |
| 339 | Ga0207643_10191094 | 3300025908 | Bacteria | 1243 |
| 340 | Ga0207705_10005885 | 3300025909 | Bacteria | 9120 |
| 341 | Ga0207705_10081138 | 3300025909 | Bacteria | 2364 |
| 342 | Ga0207695_10003541 | 3300025913 | Bacteria | 21873 |
| 343 | Ga0207695_10007058 | 3300025913 | Bacteria | 14407 |
| 344 | Ga0207695_10024767 | 3300025913 | Bacteria | 6739 |
| 345 | Ga0207695_10136764 | 3300025913 | Bacteria | 2403 |
| 346 | Ga0207695_10273950 | 3300025913 | Bacteria | 1583 |
| 347 | Ga0207671_10005962 | 3300025914 | Bacteria | 11041 |
| 348 | Ga0207693_10004734 | 3300025915 | Bacteria | 11440 |
| 349 | Ga0207663_10135445 | 3300025916 | Bacteria | 1708 |
| 350 | Ga0207657_10007073 | 3300025919 | Bacteria | 11528 |
| 351 | Ga0207657_10028029 | 3300025919 | Bacteria | 5147 |
| 352 | Ga0207652_10046407 | 3300025921 | Bacteria | 3707 |
| 353 | Ga0207646_10028674 | 3300025922 | Bacteria | 5065 |
| 354 | Ga0207681_10136039 | 3300025923 | Bacteria | 1824 |
| 355 | Ga0207681_10221384 | 3300025923 | Bacteria | 1464 |
| 356 | Ga0207694_10004415 | 3300025924 | Bacteria | 10994 |
| 357 | Ga0207694_10201131 | 3300025924 | Bacteria | 1621 |
| 358 | Ga0207694_10450320 | 3300025924 | Bacteria | 1074 |
| 359 | Ga0207650_10022230 | 3300025925 | Bacteria | 4488 |
| 360 | Ga0207687_10271563 | 3300025927 | Bacteria | 1356 |
| 361 | Ga0207664_10001050 | 3300025929 | Bacteria | 18469 |
| 362 | Ga0207644_10053125 | 3300025931 | Bacteria | 2915 |
| 363 | Ga0207690_10096390 | 3300025932 | Bacteria | 2103 |
| 364 | Ga0207690_10304884 | 3300025932 | Bacteria | 1247 |
| 365 | Ga0207686_10048830 | 3300025934 | Bacteria | 2624 |
| 366 | Ga0207709_10031585 | 3300025935 | Bacteria | 3095 |
| 367 | Ga0207709_10039433 | 3300025935 | Bacteria | 2821 |
| 368 | Ga0207670_10042894 | 3300025936 | Bacteria | 2984 |
| 369 | Ga0207704_10396443 | 3300025938 | Bacteria | 1088 |
| 370 | Ga0207691_10017651 | 3300025940 | Bacteria | 6763 |
| 371 | Ga0207711_10004750 | 3300025941 | Bacteria | 11535 |
| 372 | Ga0207711_10066381 | 3300025941 | Bacteria | 3120 |
| 373 | Ga0207711_10136841 | 3300025941 | Bacteria | 2200 |
| 374 | Ga0207689_10001544 | 3300025942 | Bacteria | 21884 |
| 375 | Ga0207679_10094998 | 3300025945 | Bacteria | 2316 |
| 376 | Ga0207667_10000642 | 3300025949 | Bacteria | 45282 |
| 377 | Ga0207667_10059595 | 3300025949 | Bacteria | 3997 |
| 378 | Ga0207667_10159921 | 3300025949 | Bacteria | 2317 |
| 379 | Ga0207712_10000454 | 3300025961 | Bacteria | 34905 |
| 380 | Ga0207712_10336234 | 3300025961 | Bacteria | 1251 |
| 381 | Ga0207668_10003087 | 3300025972 | Bacteria | 9763 |
| 382 | Ga0207640_10136932 | 3300025981 | Bacteria | 1779 |
| 383 | Ga0207658_10112244 | 3300025986 | Bacteria | 2157 |
| 384 | Ga0207658_10184262 | 3300025986 | Bacteria | 1730 |
| 385 | Ga0207677_10394712 | 3300026023 | Bacteria | 1172 |
| 386 | Ga0207639_10033066 | 3300026041 | Bacteria | 3812 |
| 387 | Ga0207678_10108275 | 3300026067 | Bacteria | 2371 |
| 388 | Ga0207678_10484957 | 3300026067 | Bacteria | 1077 |
| 389 | Ga0207708_10000219 | 3300026075 | Bacteria | 45553 |
| 390 | Ga0207708_10003595 | 3300026075 | Bacteria | 11426 |
| 391 | Ga0207702_10093230 | 3300026078 | Bacteria | 2641 |
| 392 | Ga0207702_10116526 | 3300026078 | Bacteria | 2384 |
| 393 | Ga0207702_10247205 | 3300026078 | Bacteria | 1674 |
| 394 | Ga0207641_10003687 | 3300026088 | Bacteria | 13496 |
| 395 | Ga0207641_10176140 | 3300026088 | Bacteria | 1956 |
| 396 | Ga0207648_10000534 | 3300026089 | Bacteria | 42312 |
| 397 | Ga0207648_10233419 | 3300026089 | Bacteria | 1637 |
| 398 | Ga0207674_10186817 | 3300026116 | Bacteria | 2022 |
| 399 | Ga0207675_100001097 | 3300026118 | Bacteria | 26813 |
| 400 | Ga0207675_100025791 | 3300026118 | Bacteria | 5470 |
| 401 | Ga0207683_10039784 | 3300026121 | Bacteria | 4102 |
| 402 | Ga0207683_10065908 | 3300026121 | Bacteria | 3193 |
| 403 | Ga0207683_10380651 | 3300026121 | Bacteria | 1297 |
| 404 | Ga0207698_10029821 | 3300026142 | Bacteria | 3913 |
| 405 | Ga0209371_1000003 | 3300027312 | Bacteria | 1122971 |
| 406 | Ga0209999_1002328 | 3300027543 | Bacteria | 3347 |
| 407 | Ga0209971_1004191 | 3300027682 | Bacteria | 3420 |
| 408 | Ga0207428_10006458 | 3300027907 | Bacteria | 10827 |
| 409 | Ga0207428_10011331 | 3300027907 | Bacteria | 7885 |
| 410 | Ga0268266_10323767 | 3300028379 | Bacteria | 1443 |
| 411 | Ga0268265_10000535 | 3300028380 | Bacteria | 38794 |
| 412 | Ga0268265_10007131 | 3300028380 | Bacteria | 7544 |
| 413 | Ga0268265_10060805 | 3300028380 | Bacteria | 2896 |
| 414 | Ga0268265_10139117 | 3300028380 | Bacteria | 2030 |
| 415 | Ga0268264_10006442 | 3300028381 | Bacteria | 9884 |
| 416 | Ga0268264_10025052 | 3300028381 | Bacteria | 4875 |
| 417 | Ga0265319_1002495 | 3300028563 | Bacteria | 10000 |
| 418 | Ga0265319_1005869 | 3300028563 | Bacteria | 5790 |
| 419 | Ga0265319_1057627 | 3300028563 | Bacteria | 1267 |
| 420 | Ga0265318_10002650 | 3300028577 | Bacteria | 9427 |
| 421 | Ga0265318_10004899 | 3300028577 | Bacteria | 6384 |
| 422 | Ga0265318_10034601 | 3300028577 | Bacteria | 1947 |
| 423 | Ga0265338_10000415 | 3300028800 | Bacteria | 76424 |
| 424 | Ga0268256_1000004 | 3300030500 | Bacteria | 1122967 |
| 425 | Ga0307511_10001889 | 3300030521 | Bacteria | 21986 |
| 426 | Ga0265330_10002740 | 3300031235 | Bacteria | 9482 |
| 427 | Ga0265332_10001710 | 3300031238 | Bacteria | 11958 |
| 428 | Ga0265332_10043875 | 3300031238 | Bacteria | 1930 |
| 429 | Ga0265332_10081829 | 3300031238 | Bacteria | 1369 |
| 430 | Ga0265328_10014547 | 3300031239 | Bacteria | 3098 |
| 431 | Ga0265320_10001869 | 3300031240 | Bacteria | 14891 |
| 432 | Ga0265320_10027214 | 3300031240 | Bacteria | 2984 |
| 433 | Ga0265329_10000886 | 3300031242 | Bacteria | 15097 |
| 434 | Ga0265340_10002506 | 3300031247 | Bacteria | 10436 |
| 435 | Ga0265331_10002480 | 3300031250 | Bacteria | 12472 |
| 436 | Ga0265316_10003173 | 3300031344 | Bacteria | 16718 |
| 437 | Ga0265316_10042225 | 3300031344 | Bacteria | 3646 |
| 438 | Ga0307513_10007045 | 3300031456 | Bacteria | 14623 |
| 439 | Ga0307513_10082402 | 3300031456 | Bacteria | 3312 |
| 440 | Ga0307509_10361386 | 3300031507 | Bacteria | 1171 |
| 441 | Ga0307408_100000157 | 3300031548 | Bacteria | 75915 |
| 442 | Ga0307408_100004977 | 3300031548 | Bacteria | 8927 |
| 443 | Ga0307408_100182846 | 3300031548 | Bacteria | 1683 |
| 444 | Ga0307408_100368771 | 3300031548 | Bacteria | 1224 |
| 445 | Ga0265313_10000186 | 3300031595 | Bacteria | 66090 |
| 446 | Ga0265313_10000483 | 3300031595 | Bacteria | 41854 |
| 447 | Ga0265313_10009885 | 3300031595 | Bacteria | 6132 |
| 448 | Ga0265314_10005273 | 3300031711 | Bacteria | 11698 |
| 449 | Ga0265314_10079508 | 3300031711 | Bacteria | 2167 |
| 450 | Ga0265342_10000054 | 3300031712 | Bacteria | 121080 |
| 451 | Ga0265342_10007237 | 3300031712 | Bacteria | 8158 |
| 452 | Ga0316578_10016320 | 3300031728 | Bacteria | 4016 |
| 453 | Ga0307516_10001334 | 3300031730 | Bacteria | 34247 |
| 454 | Ga0307516_10040735 | 3300031730 | Bacteria | 4622 |
| 455 | Ga0307516_10258941 | 3300031730 | Bacteria | 1431 |
| 456 | Ga0307405_10163203 | 3300031731 | Bacteria | 1581 |
| 457 | Ga0307405_10486539 | 3300031731 | Bacteria | 986 |
| 458 | Ga0307410_10031802 | 3300031852 | Bacteria | 3390 |
| 459 | Ga0307410_10035744 | 3300031852 | Bacteria | 3230 |
| 460 | Ga0307406_10239874 | 3300031901 | Bacteria | 1359 |
| 461 | Ga0307409_100095333 | 3300031995 | Bacteria | 2451 |
| 462 | Ga0307409_100484635 | 3300031995 | Bacteria | 1201 |
| 463 | Ga0307416_100011348 | 3300032002 | Bacteria | 5933 |
| 464 | Ga0307416_100572593 | 3300032002 | Bacteria | 1205 |
| 465 | Ga0307414_10017306 | 3300032004 | Bacteria | 4407 |
| 466 | Ga0307414_10325576 | 3300032004 | Bacteria | 1310 |
| 467 | Ga0307411_10208175 | 3300032005 | Bacteria | 1508 |
| 468 | Ga0307415_100074023 | 3300032126 | Bacteria | 2405 |
| 469 | Ga0307507_10116066 | 3300033179 | Bacteria | 2163 |
| 470 | Ga0373931_0009078 | 3300035691 | Bacteria | 4742 |
| 471 | Ga0373931_0347032 | 3300035691 | Bacteria | 928 |
| 472 | Ga0373947_0148638 | 3300035725 | Bacteria | 1508 |
| 473 | Ga0395899_0003202 | 3300037312 | Bacteria | 12977 |
| 474 | Ga0395899_0020447 | 3300037312 | Bacteria | 5018 |
| 475 | Ga0395899_0021263 | 3300037312 | Bacteria | 4922 |
| 476 | Ga0395899_0026047 | 3300037312 | Bacteria | 4413 |
| 477 | Ga0395899_0064179 | 3300037312 | Bacteria | 2700 |
| 478 | Ga0395899_0309664 | 3300037312 | Bacteria | 1066 |
| 479 | Ga0395900_0005113 | 3300037418 | Bacteria | 13777 |
| 480 | Ga0395900_0018578 | 3300037418 | Bacteria | 7090 |
| 481 | Ga0395900_0046716 | 3300037418 | Bacteria | 4458 |
| 482 | Ga0395900_0171737 | 3300037418 | Bacteria | 2206 |
| 483 | Ga0395898_0007720 | 3300037466 | Bacteria | 11421 |
| 484 | Ga0395898_0098827 | 3300037466 | Bacteria | 2802 |
| 485 | Ga0395905_0005608 | 3300037471 | Bacteria | 12776 |
| 486 | Ga0395905_0013373 | 3300037471 | Bacteria | 7863 |
| 487 | Ga0395905_0024852 | 3300037471 | Bacteria | 5653 |
| 488 | Ga0395905_0026178 | 3300037471 | Bacteria | 5501 |
| 489 | Ga0436364_1350694 | 3300037853 | Bacteria | 4828 |
| 490 | Ga0395901_0001319 | 3300038443 | Bacteria | 26126 |
| 491 | Ga0395901_0046081 | 3300038443 | Bacteria | 4527 |
| 492 | Ga0395901_0090830 | 3300038443 | Bacteria | 3196 |
| 493 | Ga0395901_0169333 | 3300038443 | Bacteria | 2292 |
| 494 | Ga0395901_0254415 | 3300038443 | Bacteria | 1829 |
| 495 | Ga0436365_0090629 | 3300039437 | Bacteria | 57501 |
| 496 | Ga0436365_0342453 | 3300039437 | Bacteria | 2981 |
| 497 | Ga0436360_0022124 | 3300039438 | Bacteria | 2684 |
| 498 | Ga0436360_0350415 | 3300039438 | Bacteria | 1672 |
| 499 | Ga0436360_0369614 | 3300039438 | Bacteria | 1005 |
| 500 | Ga0436360_0481236 | 3300039438 | Bacteria | 2752 |
| 501 | Ga0436360_0989059 | 3300039438 | Bacteria | 6814 |
| 502 | Ga0436361_0002397 | 3300039447 | Bacteria | 4007 |
| 503 | Ga0436361_0014834 | 3300039447 | Bacteria | 7524 |
| 504 | Ga0436361_0065044 | 3300039447 | Bacteria | 3112 |
| 505 | Ga0436361_0143802 | 3300039447 | Bacteria | 2109 |
| 506 | Ga0436361_0148264 | 3300039447 | Bacteria | 57652 |
| 507 | Ga0436361_0273252 | 3300039447 | Bacteria | 20849 |
| 508 | Ga0436361_0316723 | 3300039447 | Bacteria | 34024 |
| 509 | Ga0436361_0362138 | 3300039447 | Bacteria | 1634 |
| 510 | Ga0436361_0495212 | 3300039447 | Bacteria | 2761 |
| 511 | Ga0436361_0699509 | 3300039447 | Bacteria | 1217 |
| 512 | Ga0436361_0769001 | 3300039447 | Bacteria | 1563 |
| 513 | Ga0436361_0879465 | 3300039447 | Bacteria | 1803 |
| 514 | Ga0436363_0089457 | 3300039450 | Bacteria | 1280 |
| 515 | Ga0436362_0984138 | 3300039453 | Bacteria | 8617 |
| 516 | Ga0436362_1085390 | 3300039453 | Bacteria | 6879 |
| 517 | Ga0451807_1740877 | 3300041486 | Bacteria | 1325 |
| 518 | Ga0439431_0053006 | 3300041997 | Bacteria | 1055 |
| 519 | Ga0450916_005623 | 3300042530 | Bacteria | 1455 |
| 520 | Ga0451577_0077478 | 3300042876 | Bacteria | 2964 |
| 521 | Ga0466969_0007082 | 3300044656 | Bacteria | 5965 |
| 522 | Ga0466969_0009508 | 3300044656 | Bacteria | 5155 |
| 523 | Ga0466969_0025919 | 3300044656 | Bacteria | 3010 |
| 524 | Ga0466965_0000149 | 3300044683 | Bacteria | 20618 |
| 525 | Ga0466965_0000613 | 3300044683 | Bacteria | 13026 |
| 526 | Ga0466965_0024249 | 3300044683 | Bacteria | 2933 |
| 527 | Ga0466965_0058929 | 3300044683 | Bacteria | 1915 |
| 528 | Ga0466966_0003879 | 3300044684 | Bacteria | 9877 |
| 529 | Ga0466961_0004681 | 3300044693 | Bacteria | 8595 |
| 530 | Ga0466961_0081899 | 3300044693 | Bacteria | 2042 |
| 531 | Ga0466961_0211566 | 3300044693 | Bacteria | 1197 |
| 532 | Ga0466963_0020651 | 3300044694 | Bacteria | 4142 |
| 533 | Ga0466963_0319334 | 3300044694 | Bacteria | 1093 |
| 534 | Ga0466964_0004214 | 3300044706 | Bacteria | 5294 |
| 535 | Ga0466964_0004520 | 3300044706 | Bacteria | 5137 |
| 536 | Ga0466964_0081259 | 3300044706 | Bacteria | 1392 |
| 537 | Ga0453684_0006630 | 3300044712 | Bacteria | 21884 |
| 538 | Ga0453684_0055940 | 3300044712 | Bacteria | 5123 |
| 539 | Ga0453684_0090090 | 3300044712 | Bacteria | 3791 |
| 540 | Ga0466971_0053133 | 3300044719 | Bacteria | 1825 |
| 541 | Ga0466968_0007816 | 3300044735 | Bacteria | 4080 |
| 542 | Ga0466970_0008418 | 3300044765 | Bacteria | 5190 |
| 543 | Ga0466970_0182426 | 3300044765 | Bacteria | 1165 |
| 544 | Ga0466957_0001149 | 3300044842 | Bacteria | 13693 |
| 545 | Ga0466957_0014213 | 3300044842 | Bacteria | 4633 |
| 546 | Ga0466960_0267178 | 3300044901 | Bacteria | 955 |
| 547 | Ga0466959_0000216 | 3300045049 | Bacteria | 37434 |
| 548 | Ga0466959_0002489 | 3300045049 | Bacteria | 11797 |
| 549 | Ga0451576_0071705 | 3300045051 | Bacteria | 3606 |
| 550 | Ga0451576_0195537 | 3300045051 | Bacteria | 2112 |
| 551 | Ga0466958_0022819 | 3300045836 | Bacteria | 3668 |
| 552 | Ga0466958_0056808 | 3300045836 | Bacteria | 2378 |
| 553 | Ga0466958_0109418 | 3300045836 | Bacteria | 1724 |
| 554 | Ga0466958_0110732 | 3300045836 | Bacteria | 1714 |
| 555 | Ga0466967_0064330 | 3300045976 | Bacteria | 3262 |
| 556 | Ga0466967_0314178 | 3300045976 | Bacteria | 1510 |
| 557 | Ga0495617_002431 | 3300046452 | Bacteria | 7407 |
| 558 | Ga0495617_070500 | 3300046452 | Bacteria | 1149 |
| 559 | Ga0495603_0000760 | 3300046455 | Bacteria | 18426 |
| 560 | Ga0495629_0001443 | 3300046459 | Bacteria | 18744 |
| 561 | Ga0495638_0001700 | 3300046460 | Bacteria | 19365 |
| 562 | Ga0495638_0128977 | 3300046460 | Bacteria | 1488 |
| 563 | Ga0495641_0007642 | 3300046461 | Bacteria | 6715 |
| 564 | Ga0495651_0006073 | 3300046462 | Bacteria | 9224 |
| 565 | Ga0495651_0044913 | 3300046462 | Bacteria | 3423 |
| 566 | Ga0495653_0000578 | 3300046463 | Bacteria | 28112 |
| 567 | Ga0495653_0008170 | 3300046463 | Bacteria | 8568 |
| 568 | Ga0495650_0000383 | 3300046471 | Bacteria | 75998 |
| 569 | Ga0495650_0000846 | 3300046471 | Bacteria | 36806 |
| 570 | Ga0495580_0000763 | 3300046472 | Bacteria | 27666 |
| 571 | Ga0495580_0018601 | 3300046472 | Bacteria | 5171 |
| 572 | Ga0495580_0263420 | 3300046472 | Bacteria | 1179 |
| 573 | Ga0495582_0000320 | 3300046473 | Bacteria | 26238 |
| 574 | Ga0495605_0000665 | 3300046474 | Bacteria | 26127 |
| 575 | Ga0495605_0011008 | 3300046474 | Bacteria | 5053 |
| 576 | Ga0495605_0022422 | 3300046474 | Bacteria | 3335 |
| 577 | Ga0495605_0037838 | 3300046474 | Bacteria | 2423 |
| 578 | Ga0495664_0000261 | 3300046477 | Bacteria | 25528 |
| 579 | Ga0495584_0000573 | 3300046491 | Bacteria | 24792 |
| 580 | Ga0495584_0005997 | 3300046491 | Bacteria | 6400 |
| 581 | Ga0495584_0014222 | 3300046491 | Bacteria | 4056 |
| 582 | Ga0495584_0044014 | 3300046491 | Bacteria | 2253 |
| 583 | Ga0495585_0000911 | 3300046492 | Bacteria | 25062 |
| 584 | Ga0495585_0001878 | 3300046492 | Bacteria | 15827 |
| 585 | Ga0495585_0019615 | 3300046492 | Bacteria | 3897 |
| 586 | Ga0495594_0052422 | 3300046499 | Bacteria | 2246 |
| 587 | Ga0495596_0000801 | 3300046500 | Bacteria | 19061 |
| 588 | Ga0495596_0003413 | 3300046500 | Bacteria | 8055 |
| 589 | Ga0495596_0008939 | 3300046500 | Bacteria | 4427 |
| 590 | Ga0495607_0001240 | 3300046501 | Bacteria | 22879 |
| 591 | Ga0495607_0001824 | 3300046501 | Bacteria | 18169 |
| 592 | Ga0495607_0045539 | 3300046501 | Bacteria | 2579 |
| 593 | Ga0495607_0049484 | 3300046501 | Bacteria | 2450 |
| 594 | Ga0495607_0054906 | 3300046501 | Bacteria | 2294 |
| 595 | Ga0495583_0000045 | 3300046506 | Bacteria | 220503 |
| 596 | Ga0495583_0002856 | 3300046506 | Bacteria | 14055 |
| 597 | Ga0495583_0019164 | 3300046506 | Bacteria | 3578 |
| 598 | Ga0495583_0023795 | 3300046506 | Bacteria | 3090 |
| 599 | Ga0495583_0069462 | 3300046506 | Bacteria | 1551 |
| 600 | Ga0495606_0000360 | 3300046507 | Bacteria | 77832 |
| 601 | Ga0495606_0005329 | 3300046507 | Bacteria | 12362 |
| 602 | Ga0495606_0011366 | 3300046507 | Bacteria | 7269 |
| 603 | Ga0495606_0034029 | 3300046507 | Bacteria | 3504 |
| 604 | Ga0495606_0057561 | 3300046507 | Bacteria | 2503 |
| 605 | Ga0495608_0007822 | 3300046511 | Bacteria | 7520 |
| 606 | Ga0495608_0009704 | 3300046511 | Bacteria | 6718 |
| 607 | Ga0495610_0007706 | 3300046512 | Bacteria | 7104 |
| 608 | Ga0495610_0046016 | 3300046512 | Bacteria | 2156 |
| 609 | Ga0495610_0056385 | 3300046512 | Bacteria | 1889 |
| 610 | Ga0495616_0001927 | 3300046513 | Bacteria | 13959 |
| 611 | Ga0495616_0008633 | 3300046513 | Bacteria | 6017 |
| 612 | Ga0495616_0011082 | 3300046513 | Bacteria | 5180 |
| 613 | Ga0495616_0016974 | 3300046513 | Bacteria | 4020 |
| 614 | Ga0495618_0001870 | 3300046514 | Bacteria | 13883 |
| 615 | Ga0495618_0002893 | 3300046514 | Bacteria | 10875 |
| 616 | Ga0495618_0214361 | 3300046514 | Bacteria | 1216 |
| 617 | Ga0495620_0001594 | 3300046515 | Bacteria | 13443 |
| 618 | Ga0495628_0002356 | 3300046516 | Bacteria | 17046 |
| 619 | Ga0495628_0005561 | 3300046516 | Bacteria | 11033 |
| 620 | Ga0495628_0012017 | 3300046516 | Bacteria | 7303 |
| 621 | Ga0495630_0000512 | 3300046517 | Bacteria | 28672 |
| 622 | Ga0495631_0000752 | 3300046518 | Bacteria | 20761 |
| 623 | Ga0495631_0011543 | 3300046518 | Bacteria | 4341 |
| 624 | Ga0495632_0114174 | 3300046519 | Bacteria | 1266 |
| 625 | Ga0495643_0000099 | 3300046522 | Bacteria | 145425 |
| 626 | Ga0495643_0002592 | 3300046522 | Bacteria | 14095 |
| 627 | Ga0495643_0038482 | 3300046522 | Bacteria | 2619 |
| 628 | Ga0495643_0071574 | 3300046522 | Bacteria | 1820 |
| 629 | Ga0495644_0000135 | 3300046523 | Bacteria | 35398 |
| 630 | Ga0495644_0004017 | 3300046523 | Bacteria | 5785 |
| 631 | Ga0495648_0000659 | 3300046524 | Bacteria | 36898 |
| 632 | Ga0495648_0006023 | 3300046524 | Bacteria | 9959 |
| 633 | Ga0495648_0030027 | 3300046524 | Bacteria | 3600 |
| 634 | Ga0495648_0030583 | 3300046524 | Bacteria | 3557 |
| 635 | Ga0495648_0032605 | 3300046524 | Bacteria | 3415 |
| 636 | Ga0495648_0047035 | 3300046524 | Bacteria | 2670 |
| 637 | Ga0495666_0000103 | 3300046526 | Bacteria | 34502 |
| 638 | Ga0495642_0007016 | 3300046528 | Bacteria | 4323 |
| 639 | Ga0495642_0071270 | 3300046528 | Bacteria | 1454 |
| 640 | Ga0495652_0001284 | 3300046529 | Bacteria | 28084 |
| 641 | Ga0495652_0003297 | 3300046529 | Bacteria | 16061 |
| 642 | Ga0495652_0018130 | 3300046529 | Bacteria | 6282 |
| 643 | Ga0495652_0020184 | 3300046529 | Bacteria | 5922 |
| 644 | Ga0495665_0000233 | 3300046531 | Bacteria | 28084 |
| 645 | Ga0495640_0004376 | 3300046533 | Bacteria | 11274 |
| 646 | Ga0495586_0000365 | 3300046535 | Bacteria | 28006 |
| 647 | Ga0495609_0000582 | 3300046538 | Bacteria | 28727 |
| 648 | Ga0495609_0000604 | 3300046538 | Bacteria | 28136 |
| 649 | Ga0495609_0000972 | 3300046538 | Bacteria | 20539 |
| 650 | Ga0495609_0000992 | 3300046538 | Bacteria | 20251 |
| 651 | Ga0495609_0034183 | 3300046538 | Bacteria | 2305 |
| 652 | Ga0495597_0000172 | 3300046542 | Bacteria | 57536 |
| 653 | Ga0495597_0005843 | 3300046542 | Bacteria | 6435 |
| 654 | Ga0495597_0008165 | 3300046542 | Bacteria | 5265 |
| 655 | Ga0495597_0015880 | 3300046542 | Bacteria | 3561 |
| 656 | Ga0495597_0053820 | 3300046542 | Bacteria | 1769 |
| 657 | Ga0495597_0073931 | 3300046542 | Bacteria | 1464 |
| 658 | Ga0495645_0000480 | 3300046543 | Bacteria | 27638 |
| 659 | Ga0495645_0018286 | 3300046543 | Bacteria | 5032 |
| 660 | Ga0495622_0028162 | 3300046557 | Bacteria | 2623 |
| 661 | Ga0495622_0107420 | 3300046557 | Bacteria | 1278 |
| 662 | Ga0495633_0000349 | 3300046558 | Bacteria | 50979 |
| 663 | Ga0495633_0002318 | 3300046558 | Bacteria | 13555 |
| 664 | Ga0495633_0011431 | 3300046558 | Bacteria | 4787 |
| 665 | Ga0495633_0012066 | 3300046558 | Bacteria | 4614 |
| 666 | Ga0495633_0057090 | 3300046558 | Bacteria | 1834 |
| 667 | Ga0495656_0028944 | 3300046615 | Bacteria | 2226 |
| 668 | Ga0495656_0105906 | 3300046615 | Bacteria | 1308 |
| 669 | Ga0495656_0209464 | 3300046615 | Bacteria | 971 |
| 670 | Ga0495668_0000285 | 3300046616 | Bacteria | 70023 |
| 671 | Ga0495668_0038149 | 3300046616 | Bacteria | 2686 |
| 672 | Ga0495634_0000937 | 3300046642 | Bacteria | 27650 |
| 673 | Ga0495611_0005392 | 3300046648 | Bacteria | 5473 |
| 674 | Ga0495611_0006605 | 3300046648 | Bacteria | 4941 |
| 675 | Ga0495611_0025671 | 3300046648 | Bacteria | 2569 |
| 676 | Ga0495625_0001004 | 3300046660 | Bacteria | 37269 |
| 677 | Ga0495625_0001275 | 3300046660 | Bacteria | 31649 |
| 678 | Ga0495625_0003651 | 3300046660 | Bacteria | 15089 |
| 679 | Ga0495625_0009741 | 3300046660 | Bacteria | 7997 |
| 680 | Ga0495625_0013489 | 3300046660 | Bacteria | 6563 |
| 681 | Ga0495625_0014512 | 3300046660 | Bacteria | 6280 |
| 682 | Ga0495625_0027666 | 3300046660 | Bacteria | 4262 |
| 683 | Ga0495625_0151120 | 3300046660 | Bacteria | 1561 |
| 684 | Ga0495635_0001129 | 3300046663 | Bacteria | 17790 |
| 685 | Ga0495635_0032334 | 3300046663 | Bacteria | 3630 |
| 686 | Ga0495659_0000033 | 3300046664 | Bacteria | 64915 |
| 687 | Ga0495659_0000294 | 3300046664 | Bacteria | 19839 |
| 688 | Ga0495659_0021743 | 3300046664 | Bacteria | 2164 |
| 689 | Ga0495659_0077394 | 3300046664 | Bacteria | 1256 |
| 690 | Ga0495661_0000603 | 3300046665 | Bacteria | 36732 |
| 691 | Ga0495661_0001041 | 3300046665 | Bacteria | 24617 |
| 692 | Ga0495661_0002078 | 3300046665 | Bacteria | 15711 |
| 693 | Ga0495661_0009392 | 3300046665 | Bacteria | 6713 |
| 694 | Ga0495661_0012466 | 3300046665 | Bacteria | 5739 |
| 695 | Ga0495661_0023083 | 3300046665 | Bacteria | 4042 |
| 696 | Ga0495657_0159426 | 3300046675 | Bacteria | 1396 |
| 697 | Ga0495599_0018939 | 3300046678 | Bacteria | 4290 |
| 698 | Ga0495623_0002075 | 3300046679 | Bacteria | 13422 |
| 699 | Ga0495623_0109893 | 3300046679 | Bacteria | 1672 |
| 700 | Ga0495646_0000233 | 3300046680 | Bacteria | 27641 |
| 701 | Ga0495646_0007025 | 3300046680 | Bacteria | 7149 |
| 702 | Ga0495669_0061554 | 3300046684 | Bacteria | 1699 |
| 703 | Ga0495669_0070356 | 3300046684 | Bacteria | 1594 |
| 704 | Ga0495613_0001368 | 3300046689 | Bacteria | 18584 |
| 705 | Ga0495624_0000625 | 3300046690 | Bacteria | 27666 |
| 706 | Ga0495624_0024039 | 3300046690 | Bacteria | 4012 |
| 707 | Ga0495670_0000252 | 3300046691 | Bacteria | 24908 |
| 708 | Ga0495670_0000525 | 3300046691 | Bacteria | 18162 |
| 709 | Ga0495670_0052519 | 3300046691 | Bacteria | 2041 |
| 710 | Ga0495670_0058753 | 3300046691 | Bacteria | 1930 |
| 711 | Ga0495671_0000398 | 3300046692 | Bacteria | 35463 |
| 712 | Ga0495671_0008654 | 3300046692 | Bacteria | 5716 |
| 713 | Ga0495649_0011261 | 3300046694 | Bacteria | 5255 |
| 714 | Ga0495649_0075720 | 3300046694 | Bacteria | 1802 |
| 715 | Ga0495649_0230265 | 3300046694 | Bacteria | 956 |
| 716 | Ga0495589_0018258 | 3300046794 | Bacteria | 3598 |
| 717 | Ga0495600_0000670 | 3300046809 | Bacteria | 17832 |
| 718 | Ga0495660_0002258 | 3300046810 | Bacteria | 12399 |
| 719 | Ga0495660_0018980 | 3300046810 | Bacteria | 3948 |
| 720 | Ga0495581_0000632 | 3300047315 | Bacteria | 18401 |
| 721 | Ga0495604_0003604 | 3300047317 | Bacteria | 12339 |
| 722 | Ga0495604_0012180 | 3300047317 | Bacteria | 6836 |
| 723 | Ga0495636_0000318 | 3300047318 | Bacteria | 18481 |
| 724 | Ga0495674_0000945 | 3300047319 | Bacteria | 27666 |
| 725 | Ga0495672_0000191 | 3300047320 | Bacteria | 88319 |
| 726 | Ga0495672_0000257 | 3300047320 | Bacteria | 74176 |
| 727 | Ga0495672_0000277 | 3300047320 | Bacteria | 71082 |
| 728 | Ga0495672_0003583 | 3300047320 | Bacteria | 13203 |
| 729 | Ga0495672_0038522 | 3300047320 | Bacteria | 2915 |
| 730 | Ga0495676_0001514 | 3300047321 | Bacteria | 20095 |
| 731 | Ga0495676_0042526 | 3300047321 | Bacteria | 3729 |
| 732 | Ga0495680_0001203 | 3300047322 | Bacteria | 28389 |
| 733 | Ga0495683_0000720 | 3300047323 | Bacteria | 24107 |
| 734 | Ga0495683_0004676 | 3300047323 | Bacteria | 7712 |
| 735 | Ga0495683_0007383 | 3300047323 | Bacteria | 5954 |
| 736 | Ga0495683_0088482 | 3300047323 | Bacteria | 1503 |
| 737 | Ga0495687_000666 | 3300047443 | Bacteria | 39241 |
| 738 | Ga0495687_000677 | 3300047443 | Bacteria | 38715 |
| 739 | Ga0495687_000710 | 3300047443 | Bacteria | 36977 |
| 740 | Ga0495687_005170 | 3300047443 | Bacteria | 8445 |
| 741 | Ga0495687_040707 | 3300047443 | Bacteria | 2044 |
| 742 | Ga0495687_064105 | 3300047443 | Bacteria | 1501 |
| 743 | Ga0495675_0002319 | 3300047444 | Bacteria | 11374 |
| 744 | Ga0495677_0003824 | 3300047445 | Bacteria | 5823 |
| 745 | Ga0495677_0004961 | 3300047445 | Bacteria | 5075 |
| 746 | Ga0495677_0005822 | 3300047445 | Bacteria | 4665 |
| 747 | Ga0495677_0010120 | 3300047445 | Bacteria | 3469 |
| 748 | Ga0495677_0034066 | 3300047445 | Bacteria | 1857 |
| 749 | Ga0495679_000820 | 3300047446 | Bacteria | 19744 |
| 750 | Ga0495679_016535 | 3300047446 | Bacteria | 2667 |
| 751 | Ga0495679_033145 | 3300047446 | Bacteria | 1652 |
| 752 | Ga0495685_000093 | 3300047447 | Bacteria | 32265 |
| 753 | Ga0495685_034250 | 3300047447 | Bacteria | 1745 |
| 754 | Ga0495681_0001920 | 3300047470 | Bacteria | 15243 |
| 755 | Ga0495681_0012266 | 3300047470 | Bacteria | 5048 |
| 756 | Ga0495684_0003654 | 3300047471 | Bacteria | 11986 |
| 757 | Ga0495684_0052760 | 3300047471 | Bacteria | 3103 |
| 758 | Ga0495686_0000456 | 3300047472 | Bacteria | 61394 |
| 759 | Ga0495686_0014904 | 3300047472 | Bacteria | 5333 |
| 760 | Ga0495686_0017210 | 3300047472 | Bacteria | 4876 |
| 761 | Ga0495686_0054385 | 3300047472 | Bacteria | 2506 |
| 762 | Ga0495686_0065032 | 3300047472 | Bacteria | 2256 |
| 763 | Ga0495686_0091814 | 3300047472 | Bacteria | 1842 |
| 764 | Ga0495593_0001495 | 3300047673 | Bacteria | 13755 |
| 765 | Ga0495602_0002606 | 3300048088 | Bacteria | 18420 |
| 766 | Ga0495602_0025709 | 3300048088 | Bacteria | 5692 |
| 767 | Ga0495602_0061370 | 3300048088 | Bacteria | 3269 |
| 768 | Ga0495614_0000346 | 3300048089 | Bacteria | 18425 |
| 769 | Ga0495626_0008206 | 3300048091 | Bacteria | 5751 |
| 770 | Ga0496100_0117164 | 3300048903 | Bacteria | 1859 |
| 771 | Ga0496102_0003649 | 3300048905 | Bacteria | 13020 |
| 772 | Ga0496102_0034973 | 3300048905 | Bacteria | 4522 |
| 773 | Ga0496102_0047852 | 3300048905 | Bacteria | 3888 |
| 774 | Ga0496102_0099073 | 3300048905 | Bacteria | 2705 |
| 775 | Ga0496102_0162044 | 3300048905 | Bacteria | 2104 |
| 776 | Ga0496104_0010683 | 3300048907 | Bacteria | 8208 |
| 777 | Ga0496106_0001363 | 3300048909 | Bacteria | 18291 |
| 778 | Ga0496106_0283210 | 3300048909 | Bacteria | 1328 |
| 779 | Ga0496106_0300261 | 3300048909 | Bacteria | 1288 |
| 780 | Ga0496108_0149830 | 3300048911 | Unclassified | 2013 |
| 781 | Ga0496108_0441164 | 3300048911 | Bacteria | 1137 |
| 782 | Ga0496109_0060212 | 3300048912 | Bacteria | 3469 |
| 783 | Ga0496109_0629302 | 3300048912 | Bacteria | 1010 |
| 784 | Ga0496109_0715053 | 3300048912 | Bacteria | 939 |
| 785 | Ga0496110_0023439 | 3300048913 | Bacteria | 5250 |
| 786 | Ga0496110_0051847 | 3300048913 | Bacteria | 3606 |
| 787 | Ga0496110_0125930 | 3300048913 | Bacteria | 2311 |
| 788 | Ga0496110_0436027 | 3300048913 | Bacteria | 1194 |
| 789 | Ga0496111_0122001 | 3300048914 | Bacteria | 1925 |
| 790 | Ga0496111_0192227 | 3300048914 | Bacteria | 1517 |
| 791 | Ga0496114_0001116 | 3300048917 | Bacteria | 20279 |
| 792 | Ga0496114_0003346 | 3300048917 | Bacteria | 12323 |
| 793 | Ga0496115_0030663 | 3300048918 | Bacteria | 4232 |
| 794 | Ga0496116_0020463 | 3300048919 | Bacteria | 5025 |
| 795 | Ga0496116_0051416 | 3300048919 | Bacteria | 2737 |
| 796 | Ga0496116_0150357 | 3300048919 | Bacteria | 1294 |
| 797 | Ga0496116_0158076 | 3300048919 | Bacteria | 1248 |
| 798 | Ga0496117_0001889 | 3300048920 | Bacteria | 28087 |
| 799 | Ga0496117_0009659 | 3300048920 | Bacteria | 8927 |
| 800 | Ga0496117_0128318 | 3300048920 | Bacteria | 1542 |
| 801 | Ga0496118_0000253 | 3300048921 | Bacteria | 94328 |
| 802 | Ga0496118_0004703 | 3300048921 | Bacteria | 15996 |
| 803 | Ga0496119_0033581 | 3300048922 | Bacteria | 3398 |
| 804 | Ga0496120_0050446 | 3300048923 | Bacteria | 2383 |
| 805 | Ga0496121_0005876 | 3300048924 | Bacteria | 15543 |
| 806 | Ga0496121_0007911 | 3300048924 | Bacteria | 12718 |
| 807 | Ga0496121_0029120 | 3300048924 | Bacteria | 5119 |
| 808 | Ga0496121_0032418 | 3300048924 | Bacteria | 4749 |
| 809 | Ga0496121_0053101 | 3300048924 | Bacteria | 3397 |
| 810 | Ga0496121_0055122 | 3300048924 | Bacteria | 3315 |
| 811 | Ga0496122_0000892 | 3300048925 | Bacteria | 55236 |
| 812 | Ga0496122_0003634 | 3300048925 | Bacteria | 20065 |
| 813 | Ga0496122_0128015 | 3300048925 | Bacteria | 1621 |
| 814 | Ga0496123_0000842 | 3300048926 | Bacteria | 48999 |
| 815 | Ga0496123_0016384 | 3300048926 | Bacteria | 6022 |
| 816 | Ga0496124_0028640 | 3300048927 | Bacteria | 4980 |
| 817 | Ga0496124_0034886 | 3300048927 | Bacteria | 4407 |
| 818 | Ga0496124_0159830 | 3300048927 | Bacteria | 1757 |
| 819 | Ga0496124_0168487 | 3300048927 | Bacteria | 1699 |
| 820 | Ga0496124_0270532 | 3300048927 | Bacteria | 1245 |
| 821 | Ga0496124_0537855 | 3300048927 | Bacteria | 774 |
| 822 | Ga0496125_0000625 | 3300048928 | Bacteria | 59353 |
| 823 | Ga0496125_0002058 | 3300048928 | Bacteria | 27177 |
| 824 | Ga0496125_0002222 | 3300048928 | Bacteria | 25860 |
| 825 | Ga0496125_0017830 | 3300048928 | Bacteria | 6755 |
| 826 | Ga0496125_0021869 | 3300048928 | Bacteria | 5952 |
| 827 | Ga0496125_0199133 | 3300048928 | Bacteria | 1313 |
| 828 | Ga0496126_0007582 | 3300048929 | Bacteria | 11860 |
| 829 | Ga0496126_0235461 | 3300048929 | Bacteria | 1532 |
| 830 | Ga0495678_000262 | 3300049459 | Bacteria | 58570 |
| 831 | Ga0495678_002136 | 3300049459 | Bacteria | 13979 |
| 832 | Ga0495678_017397 | 3300049459 | Bacteria | 3260 |
| 833 | Ga0495682_0000121 | 3300049460 | Bacteria | 68179 |
| 834 | Ga0495682_0000195 | 3300049460 | Bacteria | 48762 |
| 835 | Ga0495682_0016139 | 3300049460 | Bacteria | 2825 |
| 836 | Ga0501031_0000250 | 3300049568 | Bacteria | 30138 |
| 837 | Ga0501031_0008977 | 3300049568 | Bacteria | 6503 |
| 838 | Ga0501031_0070194 | 3300049568 | Bacteria | 2282 |
| 839 | Ga0501031_0260778 | 3300049568 | Bacteria | 1126 |
| 840 | Ga0501032_0000524 | 3300049569 | Bacteria | 31194 |
| 841 | Ga0501032_0002272 | 3300049569 | Bacteria | 15101 |
| 842 | Ga0501032_0032528 | 3300049569 | Bacteria | 3574 |
| 843 | Ga0501032_0065600 | 3300049569 | Bacteria | 2428 |
| 844 | Ga0501032_0253693 | 3300049569 | Bacteria | 1141 |
| 845 | Ga0501033_0000496 | 3300049570 | Bacteria | 37079 |
| 846 | Ga0501033_0000732 | 3300049570 | Bacteria | 30126 |
| 847 | Ga0501033_0002920 | 3300049570 | Bacteria | 14304 |
| 848 | Ga0501033_0013435 | 3300049570 | Bacteria | 6236 |
| 849 | Ga0501033_0123952 | 3300049570 | Bacteria | 1874 |
| 850 | Ga0501034_0000067 | 3300049571 | Bacteria | 184398 |
| 851 | Ga0501034_0001550 | 3300049571 | Bacteria | 30141 |
| 852 | Ga0501034_0004537 | 3300049571 | Bacteria | 15432 |
| 853 | Ga0501034_0008308 | 3300049571 | Bacteria | 10988 |
| 854 | Ga0501036_0000414 | 3300049572 | Bacteria | 30141 |
| 855 | Ga0501036_0033559 | 3300049572 | Bacteria | 4340 |
| 856 | Ga0501036_0042011 | 3300049572 | Bacteria | 3870 |
| 857 | Ga0501036_0053394 | 3300049572 | Bacteria | 3422 |
| 858 | Ga0501037_0000509 | 3300049573 | Bacteria | 31179 |
| 859 | Ga0501037_0015087 | 3300049573 | Bacteria | 5682 |
| 860 | Ga0501037_0062584 | 3300049573 | Bacteria | 2712 |
| 861 | Ga0501037_0203139 | 3300049573 | Bacteria | 1400 |
| 862 | Ga0501037_0266015 | 3300049573 | Bacteria | 1197 |
| 863 | Ga0501038_0000684 | 3300049574 | Bacteria | 30141 |
| 864 | Ga0501038_0002220 | 3300049574 | Bacteria | 18066 |
| 865 | Ga0501038_0085052 | 3300049574 | Bacteria | 2660 |
| 866 | Ga0501038_0102723 | 3300049574 | Bacteria | 2378 |
| 867 | Ga0501038_0350878 | 3300049574 | Bacteria | 1149 |
| 868 | Ga0501038_0423320 | 3300049574 | Unclassified | 1027 |
| 869 | Ga0501039_0000437 | 3300049575 | Bacteria | 30141 |
| 870 | Ga0501039_0003748 | 3300049575 | Bacteria | 11423 |
| 871 | Ga0501039_0017758 | 3300049575 | Bacteria | 5457 |
| 872 | Ga0501039_0044986 | 3300049575 | Bacteria | 3410 |
| 873 | Ga0501039_0074276 | 3300049575 | Bacteria | 2642 |
| 874 | Ga0501039_0117362 | 3300049575 | Bacteria | 2084 |
| 875 | Ga0501039_0150106 | 3300049575 | Bacteria | 1831 |
| 876 | Ga0501039_0173563 | 3300049575 | Bacteria | 1695 |
| 877 | Ga0501041_0084519 | 3300049577 | Bacteria | 1956 |
| 878 | Ga0501042_0003635 | 3300049578 | Bacteria | 9726 |
| 879 | Ga0501042_0020439 | 3300049578 | Bacteria | 4608 |
| 880 | Ga0501043_0001892 | 3300049579 | Bacteria | 17933 |
| 881 | Ga0501043_0003432 | 3300049579 | Bacteria | 13012 |
| 882 | Ga0501043_0004152 | 3300049579 | Bacteria | 11835 |
| 883 | Ga0501043_0064219 | 3300049579 | Bacteria | 2882 |
| 884 | Ga0501043_0075340 | 3300049579 | Bacteria | 2650 |
| 885 | Ga0501046_0002701 | 3300049580 | Bacteria | 16514 |
| 886 | Ga0501046_0013687 | 3300049580 | Bacteria | 6858 |
| 887 | Ga0501046_0069716 | 3300049580 | Bacteria | 2735 |
| 888 | Ga0501046_0073183 | 3300049580 | Bacteria | 2660 |
| 889 | Ga0501046_0111786 | 3300049580 | Bacteria | 2086 |
| 890 | Ga0501046_0291857 | 3300049580 | Bacteria | 1193 |
| 891 | Ga0501047_0003701 | 3300049581 | Bacteria | 14396 |
| 892 | Ga0501047_0029100 | 3300049581 | Bacteria | 5327 |
| 893 | Ga0501047_0034333 | 3300049581 | Bacteria | 4897 |
| 894 | Ga0501047_0036793 | 3300049581 | Bacteria | 4731 |
| 895 | Ga0501047_0249111 | 3300049581 | Bacteria | 1625 |
| 896 | Ga0501048_0001718 | 3300049582 | Bacteria | 16695 |
| 897 | Ga0501048_0048570 | 3300049582 | Bacteria | 3026 |
| 898 | Ga0501067_0043773 | 3300049583 | Bacteria | 2487 |
| 899 | Ga0501067_0102170 | 3300049583 | Bacteria | 1593 |
| 900 | Ga0501067_0118711 | 3300049583 | Bacteria | 1471 |
| 901 | Ga0501068_0016294 | 3300049584 | Bacteria | 4283 |
| 902 | Ga0501068_0097685 | 3300049584 | Bacteria | 1818 |
| 903 | Ga0501068_0135446 | 3300049584 | Bacteria | 1542 |
| 904 | Ga0501070_0013356 | 3300049586 | Bacteria | 6926 |
| 905 | Ga0501070_0070810 | 3300049586 | Bacteria | 2887 |
| 906 | Ga0501071_0026754 | 3300049587 | Bacteria | 4052 |
| 907 | Ga0501073_0032666 | 3300049589 | Bacteria | 3710 |
| 908 | Ga0501073_0061722 | 3300049589 | Bacteria | 2615 |
| 909 | Ga0501074_0171385 | 3300049590 | Bacteria | 1549 |
| 910 | Ga0501075_0028419 | 3300049591 | Bacteria | 4128 |
| 911 | Ga0501076_0018511 | 3300049592 | Bacteria | 5312 |
| 912 | Ga0501079_0027185 | 3300049741 | Bacteria | 4386 |
| 913 | Ga0501080_0005558 | 3300049742 | Bacteria | 11259 |
| 914 | Ga0501080_0106730 | 3300049742 | Bacteria | 2595 |
| 915 | Ga0501081_0025842 | 3300049743 | Bacteria | 3955 |
| 916 | Ga0501083_0031591 | 3300049744 | Bacteria | 3634 |
| 917 | Ga0501083_0257937 | 3300049744 | Bacteria | 1134 |
| 918 | Ga0501035_0000986 | 3300049822 | Bacteria | 30120 |
| 919 | Ga0501035_0003398 | 3300049822 | Bacteria | 15227 |
| 920 | Ga0501035_0004909 | 3300049822 | Bacteria | 12691 |
| 921 | Ga0501035_0051270 | 3300049822 | Bacteria | 3695 |
| 922 | Ga0501035_0088823 | 3300049822 | Bacteria | 2722 |
| 923 | Ga0501035_0240368 | 3300049822 | Bacteria | 1540 |
| 924 | Ga0501044_0001253 | 3300049823 | Bacteria | 30141 |
| 925 | Ga0501044_0005251 | 3300049823 | Bacteria | 14405 |
| 926 | Ga0501044_0011708 | 3300049823 | Bacteria | 9503 |
| 927 | Ga0501044_0186860 | 3300049823 | Bacteria | 2036 |
| 928 | Ga0501044_0233358 | 3300049823 | Bacteria | 1786 |
| 929 | Ga0501044_0325647 | 3300049823 | Bacteria | 1460 |
| 930 | Ga0501045_0001489 | 3300049824 | Bacteria | 15588 |
| 931 | Ga0501045_0051789 | 3300049824 | Bacteria | 2996 |
| 932 | Ga0501045_0446303 | 3300049824 | Bacteria | 962 |
| 933 | nmdc:mga00v17_253234_c1 | 3300050491 | Bacteria | 1142 |
| 934 | nmdc:mga0yw44_10037_c1 | 3300050492 | Bacteria | 4817 |
| 935 | nmdc:mga0yw44_63346_c1 | 3300050492 | Bacteria | 2273 |
| 936 | nmdc:mga0k408_5452_c1 | 3300050493 | Bacteria | 4194 |
| 937 | nmdc:mga05p37_57829_c1 | 3300050507 | Bacteria | 4775 |
| 938 | nmdc:mga09592_61376_c1 | 3300050508 | Bacteria | 3180 |
| 939 | nmdc:mga0qj67_7112_c1 | 3300050509 | Bacteria | 8257 |
| 940 | nmdc:mga08y16_15476_c1 | 3300050511 | Bacteria | 8023 |
| 941 | nmdc:mga08y16_332787_c1 | 3300050511 | Bacteria | 1562 |
| 942 | nmdc:mga08y16_8074_c1 | 3300050511 | Bacteria | 11012 |
| 943 | nmdc:mga0n895_102351_c1 | 3300050512 | Bacteria | 2875 |
| 944 | nmdc:mga0n895_483991_c1 | 3300050512 | Bacteria | 1248 |
| 945 | nmdc:mga0rr50_7235_c1 | 3300050513 | Bacteria | 6825 |
| 946 | nmdc:mga0a205_5917_c1 | 3300050515 | Bacteria | 11021 |
| 947 | Ga0495601_0071566 | 3300053077 | Bacteria | 2214 |
| 948 | Ga0495612_0153355 | 3300053078 | Bacteria | 1004 |
| 949 | Ga0500618_002522 | 3300053125 | Bacteria | 6835 |
| 950 | Ga0500618_011796 | 3300053125 | Bacteria | 2308 |
| 951 | Ga0500559_0000006 | 3300053136 | Bacteria | 229895 |
| 952 | Ga0500568_0000226 | 3300053139 | Bacteria | 48324 |
| 953 | Ga0500573_0171058 | 3300053140 | Bacteria | 1175 |
| 954 | Ga0500604_0000948 | 3300053151 | Bacteria | 8035 |
| 955 | Ga0500604_0028278 | 3300053151 | Bacteria | 1627 |
| 956 | Ga0500619_000976 | 3300053154 | Bacteria | 4912 |
| 957 | Ga0500622_0008388 | 3300053156 | Bacteria | 5784 |
| 958 | Ga0500633_0000417 | 3300053160 | Bacteria | 6621 |
| 959 | Ga0500634_0000006 | 3300053161 | Bacteria | 171639 |
| 960 | Ga0500634_0171321 | 3300053161 | Bacteria | 988 |
| 961 | Ga0500637_0211295 | 3300053178 | Bacteria | 1101 |
| 962 | Ga0501084_0043075 | 3300054114 | Bacteria | 3776 |
| 963 | Ga0501082_0056858 | 3300060353 | Bacteria | 3370 |
| 964 | Ga0466962_0032555 | 3300061719 | Bacteria | 2495 |
| 965 | Ga0530510_0033778 | 3300061734 | Bacteria | 3683 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048927 | Ga0496124_0537855 | Ga0496124_0537855_20_754 | 240 |
| 2 | 3300031711 | Ga0265314_10079508 | Ga0265314_100795082 | 250 |
| 3 | 3300048912 | Ga0496109_0715053 | Ga0496109_0715053_141_920 | 255 |
| 4 | 3300053151 | Ga0500604_0000948 | Ga0500604_0000948_4383_5165 | 259 |
| 5 | 3300048919 | Ga0496116_0150357 | Ga0496116_0150357_176_997 | 262 |
| 6 | 3300050491 | nmdc:mga00v17_253234_c1 | nmdc:mga00v17_253234_c1_72_893 | 262 |
| 7 | 3300046684 | Ga0495669_0070356 | Ga0495669_0070356_225_1028 | 264 |
| 8 | 3300046615 | Ga0495656_0105906 | Ga0495656_0105906_10_819 | 266 |
| 9 | 3300048922 | Ga0496119_0033581 | Ga0496119_0033581_237_1046 | 269 |
| 10 | 3300048927 | Ga0496124_0168487 | Ga0496124_0168487_325_1134 | 269 |
| 11 | 3300049568 | Ga0501031_0000250 | Ga0501031_0000250_26921_27805 | 270 |
| 12 | 3300049569 | Ga0501032_0000524 | Ga0501032_0000524_26921_27805 | 270 |
| 13 | 3300049570 | Ga0501033_0000732 | Ga0501033_0000732_2322_3206 | 270 |
| 14 | 3300049571 | Ga0501034_0001550 | Ga0501034_0001550_26921_27805 | 270 |
| 15 | 3300049572 | Ga0501036_0000414 | Ga0501036_0000414_26921_27805 | 270 |
| 16 | 3300049573 | Ga0501037_0000509 | Ga0501037_0000509_3390_4274 | 270 |
| 17 | 3300049574 | Ga0501038_0000684 | Ga0501038_0000684_26921_27805 | 270 |
| 18 | 3300049575 | Ga0501039_0000437 | Ga0501039_0000437_2337_3221 | 270 |
| 19 | 3300049579 | Ga0501043_0003432 | Ga0501043_0003432_1357_2241 | 270 |
| 20 | 3300049580 | Ga0501046_0111786 | Ga0501046_0111786_1079_1963 | 270 |
| 21 | 3300049581 | Ga0501047_0034333 | Ga0501047_0034333_2337_3221 | 270 |
| 22 | 3300049822 | Ga0501035_0000986 | Ga0501035_0000986_26921_27805 | 270 |
| 23 | 3300049823 | Ga0501044_0001253 | Ga0501044_0001253_26921_27805 | 270 |
| 24 | 3300028577 | Ga0265318_10034601 | Ga0265318_100346012 | 273 |
| 25 | 3300031238 | Ga0265332_10043875 | Ga0265332_100438752 | 273 |
| 26 | 3300031240 | Ga0265320_10027214 | Ga0265320_100272143 | 273 |
| 27 | 3300031344 | Ga0265316_10042225 | Ga0265316_100422254 | 273 |
| 28 | 3300028563 | Ga0265319_1005869 | Ga0265319_10058694 | 277 |
| 29 | 3300031595 | Ga0265313_10009885 | Ga0265313_100098856 | 277 |
| 30 | 3300031712 | Ga0265342_10007237 | Ga0265342_100072375 | 277 |
| 31 | 3300035691 | Ga0373931_0347032 | Ga0373931_0347032_46_888 | 277 |
| 32 | 3300039450 | Ga0436363_0089457 | Ga0436363_0089457_117_1061 | 277 |
| 33 | 3300042876 | Ga0451577_0077478 | Ga0451577_0077478_838_1698 | 277 |
| 34 | 3300044712 | Ga0453684_0090090 | Ga0453684_0090090_217_1077 | 277 |
| 35 | 3300045051 | Ga0451576_0195537 | Ga0451576_0195537_1012_1872 | 277 |
| 36 | 3300046491 | Ga0495584_0014222 | Ga0495584_0014222_2944_3786 | 277 |
| 37 | 3300046500 | Ga0495596_0008939 | Ga0495596_0008939_2660_3502 | 277 |
| 38 | 3300046501 | Ga0495607_0001240 | Ga0495607_0001240_16505_17347 | 277 |
| 39 | 3300046506 | Ga0495583_0069462 | Ga0495583_0069462_683_1525 | 277 |
| 40 | 3300046507 | Ga0495606_0005329 | Ga0495606_0005329_1201_2043 | 277 |
| 41 | 3300046542 | Ga0495597_0005843 | Ga0495597_0005843_4197_5039 | 277 |
| 42 | 3300046694 | Ga0495649_0230265 | Ga0495649_0230265_27_869 | 277 |
| 43 | 3300049584 | Ga0501068_0135446 | Ga0501068_0135446_682_1524 | 277 |
| 44 | 3300031731 | Ga0307405_10486539 | Ga0307405_104865391 | 279 |
| 45 | 3300031852 | Ga0307410_10031802 | Ga0307410_100318022 | 279 |
| 46 | 3300031995 | Ga0307409_100095333 | Ga0307409_1000953332 | 279 |
| 47 | 3300032002 | Ga0307416_100572593 | Ga0307416_1005725932 | 279 |
| 48 | 3300032126 | Ga0307415_100074023 | Ga0307415_1000740232 | 279 |
| 49 | iso_pu_bacteria | 2818991439 | 2819561715 | 279 |
| 50 | iso_pu_bacteria | 2821123053 | 2821130565 | 279 |
| 51 | iso_pu_bacteria | 2842922631 | 2842927458 | 279 |
| 52 | iso_pu_bacteria | 2929138655 | 2929143919 | 279 |
| 53 | iso_pu_bacteria | 2979100975 | 2979102933 | 279 |
| 54 | iso_pu_bacteria | 2984509177 | 2984513979 | 279 |
| 55 | iso_pu_bacteria | 2984518228 | 2984523012 | 279 |
| 56 | iso_pu_bacteria | 2984537506 | 2984542452 | 279 |
| 57 | iso_pu_bacteria | 2984601300 | 2984606244 | 279 |
| 58 | 3300021384 | Ga0213876_10000781 | Ga0213876_1000078118 | 280 |
| 59 | 3300039437 | Ga0436365_0090629 | Ga0436365_0090629_36904_37842 | 280 |
| 60 | 3300003659 | JGI25404J52841_10045227 | JGI25404J52841_100452271 | 281 |
| 61 | 3300028800 | Ga0265338_10000415 | Ga0265338_1000041511 | 281 |
| 62 | 3300037312 | Ga0395899_0309664 | Ga0395899_0309664_183_1037 | 281 |
| 63 | 3300039447 | Ga0436361_0699509 | Ga0436361_0699509_11_868 | 281 |
| 64 | 3300046471 | Ga0495650_0000846 | Ga0495650_0000846_5791_6645 | 281 |
| 65 | 3300046492 | Ga0495585_0000911 | Ga0495585_0000911_13777_14631 | 281 |
| 66 | 3300046499 | Ga0495594_0052422 | Ga0495594_0052422_33_887 | 281 |
| 67 | 3300046538 | Ga0495609_0000972 | Ga0495609_0000972_352_1206 | 281 |
| 68 | 3300046557 | Ga0495622_0028162 | Ga0495622_0028162_1434_2288 | 281 |
| 69 | 3300047443 | Ga0495687_000666 | Ga0495687_000666_10765_11619 | 281 |
| 70 | 3300053151 | Ga0500604_0028278 | Ga0500604_0028278_329_1207 | 281 |
| 71 | iso_pu_bacteria | 2643221580 | 2643909592 | 281 |
| 72 | iso_pu_bacteria | 2643221674 | 2644413724 | 281 |
| 73 | 3300021441 | Ga0213871_10040704 | Ga0213871_100407042 | 282 |
| 74 | 3300039438 | Ga0436360_0350415 | Ga0436360_0350415_488_1387 | 282 |
| 75 | 3300049569 | Ga0501032_0253693 | Ga0501032_0253693_14_865 | 282 |
| 76 | iso_pu_bacteria | 2675903060 | 2676491636 | 282 |
| 77 | iso_pu_bacteria | 2895427314 | 2895428175 | 282 |
| 78 | iso_pu_bacteria | 2895442618 | 2895449614 | 282 |
| 79 | 3300003856 | Ga0058692_1000086 | Ga0058692_100008652 | 283 |
| 80 | 3300027312 | Ga0209371_1000003 | Ga0209371_100000339 | 283 |
| 81 | 3300030500 | Ga0268256_1000004 | Ga0268256_10000041012 | 283 |
| 82 | 3300048924 | Ga0496121_0029120 | Ga0496121_0029120_3736_4587 | 283 |
| 83 | iso_pu_bacteria | 2887443736 | 2887447787 | 283 |
| 84 | 3300005367 | Ga0070667_100080860 | Ga0070667_1000808602 | 284 |
| 85 | 3300009765 | Ga0123341_1000059 | Ga0123341_100005917 | 284 |
| 86 | 3300025924 | Ga0207694_10450320 | Ga0207694_104503202 | 284 |
| 87 | 3300025986 | Ga0207658_10184262 | Ga0207658_101842622 | 284 |
| 88 | 3300044683 | Ga0466965_0058929 | Ga0466965_0058929_381_1238 | 284 |
| 89 | 3300044693 | Ga0466961_0081899 | Ga0466961_0081899_306_1175 | 284 |
| 90 | 3300044765 | Ga0466970_0182426 | Ga0466970_0182426_211_1080 | 284 |
| 91 | 3300049583 | Ga0501067_0118711 | Ga0501067_0118711_45_971 | 284 |
| 92 | 3300053156 | Ga0500622_0008388 | Ga0500622_0008388_3805_4683 | 284 |
| 93 | iso_pu_bacteria | 2891048133 | 2891050586 | 284 |
| 94 | iso_pu_bacteria | 2995392953 | 2995396088 | 284 |
| 95 | 3300005841 | Ga0068863_100331272 | Ga0068863_1003312722 | 285 |
| 96 | 3300025923 | Ga0207681_10136039 | Ga0207681_101360392 | 285 |
| 97 | 3300026088 | Ga0207641_10176140 | Ga0207641_101761402 | 285 |
| 98 | 3300048920 | Ga0496117_0001889 | Ga0496117_0001889_13869_14768 | 285 |
| 99 | 3300048921 | Ga0496118_0004703 | Ga0496118_0004703_13948_14847 | 285 |
| 100 | iso_pu_bacteria | 2842395702 | 2842396844 | 285 |
| 101 | iso_pu_bacteria | 8055172936 | 8055177136 | 285 |
| 102 | 3300044656 | Ga0466969_0009508 | Ga0466969_0009508_840_1706 | 286 |
| 103 | iso_pu_bacteria | 2510065019 | 2510134471 | 286 |
| 104 | iso_pu_bacteria | 2515075009 | 2515113634 | 286 |
| 105 | iso_pu_bacteria | 2534681796 | 2535518098 | 286 |
| 106 | iso_pu_bacteria | 2582581294 | 2585202643 | 286 |
| 107 | iso_pu_bacteria | 2582581298 | 2585225146 | 286 |
| 108 | iso_pu_bacteria | 2582581867 | 2585403056 | 286 |
| 109 | iso_pu_bacteria | 2585427529 | 2585547702 | 286 |
| 110 | iso_pu_bacteria | 2585427590 | 2585823880 | 286 |
| 111 | iso_pu_bacteria | 2615840624 | 2616297803 | 286 |
| 112 | iso_pu_bacteria | 2643221629 | 2644169634 | 286 |
| 113 | iso_pu_bacteria | 2643221662 | 2644350270 | 286 |
| 114 | iso_pu_bacteria | 2724679232 | 2725949314 | 286 |
| 115 | iso_pu_bacteria | 2791355267 | 2793366589 | 286 |
| 116 | iso_pu_bacteria | 2854916844 | 2854919350 | 286 |
| 117 | iso_pu_bacteria | 2870721527 | 2870726697 | 286 |
| 118 | iso_pu_bacteria | 2919100787 | 2919105702 | 286 |
| 119 | iso_pu_bacteria | 2919171160 | 2919173795 | 286 |
| 120 | iso_pu_bacteria | 3005445848 | 3005448941 | 286 |
| 121 | iso_pu_bacteria | 8005301065 | 8005306218 | 286 |
| 122 | iso_pu_bacteria | 8005460587 | 8005464321 | 286 |
| 123 | iso_pu_bacteria | 8005542996 | 8005548982 | 286 |
| 124 | iso_pu_bacteria | 8005688590 | 8005694085 | 286 |
| 125 | iso_pu_bacteria | 8018127388 | 8018132072 | 286 |
| 126 | 3300005330 | Ga0070690_100236319 | Ga0070690_1002363192 | 287 |
| 127 | 3300006846 | Ga0075430_100042004 | Ga0075430_1000420046 | 287 |
| 128 | 3300006846 | Ga0075430_100258100 | Ga0075430_1002581002 | 287 |
| 129 | 3300028563 | Ga0265319_1057627 | Ga0265319_10576272 | 287 |
| 130 | 3300031238 | Ga0265332_10081829 | Ga0265332_100818292 | 287 |
| 131 | 3300035725 | Ga0373947_0148638 | Ga0373947_0148638_56_943 | 287 |
| 132 | 3300044683 | Ga0466965_0024249 | Ga0466965_0024249_1448_2320 | 287 |
| 133 | 3300049580 | Ga0501046_0073183 | Ga0501046_0073183_1641_2516 | 287 |
| 134 | 3300049744 | Ga0501083_0031591 | Ga0501083_0031591_654_1529 | 287 |
| 135 | 3300050509 | nmdc:mga0qj67_7112_c1 | nmdc:mga0qj67_7112_c1_2120_3031 | 287 |
| 136 | iso_pu_bacteria | 2597490356 | 2599101275 | 287 |
| 137 | iso_pu_bacteria | 2897803580 | 2897805890 | 287 |
| 138 | iso_pu_bacteria | 641522639 | 641646303 | 287 |
| 139 | 3300027682 | Ga0209971_1004191 | Ga0209971_10041913 | 288 |
| 140 | 3300031548 | Ga0307408_100182846 | Ga0307408_1001828462 | 288 |
| 141 | 3300032004 | Ga0307414_10017306 | Ga0307414_100173062 | 288 |
| 142 | 3300041997 | Ga0439431_0053006 | Ga0439431_0053006_102_1040 | 288 |
| 143 | 3300042530 | Ga0450916_005623 | Ga0450916_005623_436_1380 | 288 |
| 144 | iso_pu_bacteria | 2511231003 | 2511251825 | 288 |
| 145 | iso_pu_bacteria | 2521172590 | 2521559185 | 288 |
| 146 | iso_pu_bacteria | 2548876994 | 2550693862 | 288 |
| 147 | iso_pu_bacteria | 2643221550 | 2643772267 | 288 |
| 148 | iso_pu_bacteria | 2643221554 | 2643790612 | 288 |
| 149 | iso_pu_bacteria | 2643221603 | 2644026741 | 288 |
| 150 | iso_pu_bacteria | 2643221638 | 2644211550 | 288 |
| 151 | iso_pu_bacteria | 2643221645 | 2644251843 | 288 |
| 152 | iso_pu_bacteria | 2643221664 | 2644360503 | 288 |
| 153 | iso_pu_bacteria | 2738541280 | 2738740457 | 288 |
| 154 | iso_pu_bacteria | 2738541300 | 2738843290 | 288 |
| 155 | iso_pu_bacteria | 2738543018 | 2739272073 | 288 |
| 156 | iso_pu_bacteria | 2738543030 | 2739341117 | 288 |
| 157 | iso_pu_bacteria | 2738543031 | 2739347184 | 288 |
| 158 | iso_pu_bacteria | 2765235838 | 2765570387 | 288 |
| 159 | iso_pu_bacteria | 2808606386 | 2808981361 | 288 |
| 160 | iso_pu_bacteria | 2808606415 | 2809128947 | 288 |
| 161 | iso_pu_bacteria | 2808606418 | 2809146308 | 288 |
| 162 | iso_pu_bacteria | 2808606419 | 2809148568 | 288 |
| 163 | iso_pu_bacteria | 2816332139 | 2816510022 | 288 |
| 164 | iso_pu_bacteria | 2818991436 | 2819542895 | 288 |
| 165 | iso_pu_bacteria | 2818991445 | 2819595135 | 288 |
| 166 | iso_pu_bacteria | 2818991449 | 2819615699 | 288 |
| 167 | iso_pu_bacteria | 2839094727 | 2839097933 | 288 |
| 168 | iso_pu_bacteria | 2842711865 | 2842715639 | 288 |
| 169 | iso_pu_bacteria | 2852618963 | 2852621101 | 288 |
| 170 | iso_pu_bacteria | 2884811622 | 2884811635 | 288 |
| 171 | iso_pu_bacteria | 2884836552 | 2884836841 | 288 |
| 172 | iso_pu_bacteria | 2884852848 | 2884853132 | 288 |
| 173 | iso_pu_bacteria | 2896154374 | 2896155750 | 288 |
| 174 | iso_pu_bacteria | 2904439833 | 2904443505 | 288 |
| 175 | iso_pu_bacteria | 2904530477 | 2904532487 | 288 |
| 176 | iso_pu_bacteria | 2904584206 | 2904584956 | 288 |
| 177 | iso_pu_bacteria | 2904589729 | 2904591478 | 288 |
| 178 | iso_pu_bacteria | 2904601388 | 2904605498 | 288 |
| 179 | iso_pu_bacteria | 2915358134 | 2915359440 | 288 |
| 180 | iso_pu_bacteria | 2919046199 | 2919048253 | 288 |
| 181 | iso_pu_bacteria | 2919079590 | 2919081272 | 288 |
| 182 | iso_pu_bacteria | 8047710418 | 8047718016 | 288 |
| 183 | iso_pu_bacteria | 8048746797 | 8048747050 | 288 |
| 184 | iso_pu_bacteria | 8055066027 | 8055068709 | 288 |
| 185 | iso_pu_bacteria | 8057575449 | 8057581411 | 288 |
| 186 | 3300003794 | Ga0055531_10002864 | Ga0055531_1000286411 | 289 |
| 187 | 3300005445 | Ga0070708_100155966 | Ga0070708_1001559662 | 289 |
| 188 | 3300005985 | Ga0081539_10008288 | Ga0081539_100082883 | 289 |
| 189 | 3300006028 | Ga0070717_10048879 | Ga0070717_100488792 | 289 |
| 190 | 3300021358 | Ga0213873_10001831 | Ga0213873_100018313 | 289 |
| 191 | 3300021361 | Ga0213872_10004201 | Ga0213872_100042013 | 289 |
| 192 | 3300021441 | Ga0213871_10007967 | Ga0213871_100079671 | 289 |
| 193 | 3300025304 | Ga0209257_1003961 | Ga0209257_100396111 | 289 |
| 194 | 3300039437 | Ga0436365_0342453 | Ga0436365_0342453_482_1381 | 289 |
| 195 | 3300039438 | Ga0436360_0989059 | Ga0436360_0989059_3144_4043 | 289 |
| 196 | 3300039453 | Ga0436362_0984138 | Ga0436362_0984138_2034_2933 | 289 |
| 197 | iso_pu_bacteria | 2508501127 | 2509144038 | 289 |
| 198 | iso_pu_bacteria | 2513237305 | 2514419881 | 289 |
| 199 | iso_pu_bacteria | 2597489875 | 2597813623 | 289 |
| 200 | iso_pu_bacteria | 2643221555 | 2643793604 | 289 |
| 201 | iso_pu_bacteria | 2693429783 | 2694631878 | 289 |
| 202 | iso_pu_bacteria | 2693429784 | 2694634703 | 289 |
| 203 | iso_pu_bacteria | 2721755686 | 2723576033 | 289 |
| 204 | iso_pu_bacteria | 2841734538 | 2841740488 | 289 |
| 205 | iso_pu_bacteria | 2847686936 | 2847687104 | 289 |
| 206 | iso_pu_bacteria | 2856342000 | 2856345868 | 289 |
| 207 | iso_pu_bacteria | 2856364286 | 2856367152 | 289 |
| 208 | iso_pu_bacteria | 2869169390 | 2869173381 | 289 |
| 209 | iso_pu_bacteria | 2869285874 | 2869287519 | 289 |
| 210 | iso_pu_bacteria | 2871429161 | 2871431046 | 289 |
| 211 | iso_pu_bacteria | 2871444079 | 2871448820 | 289 |
| 212 | iso_pu_bacteria | 2871474448 | 2871481028 | 289 |
| 213 | iso_pu_bacteria | 2871488783 | 2871495286 | 289 |
| 214 | iso_pu_bacteria | 2874102143 | 2874108385 | 289 |
| 215 | iso_pu_bacteria | 2874146452 | 2874150215 | 289 |
| 216 | iso_pu_bacteria | 2874155637 | 2874157285 | 289 |
| 217 | iso_pu_bacteria | 2876369609 | 2876371359 | 289 |
| 218 | iso_pu_bacteria | 2876392853 | 2876395299 | 289 |
| 219 | iso_pu_bacteria | 2876413966 | 2876415668 | 289 |
| 220 | iso_pu_bacteria | 2878745973 | 2878747667 | 289 |
| 221 | iso_pu_bacteria | 2878753008 | 2878758047 | 289 |
| 222 | iso_pu_bacteria | 2881161766 | 2881161827 | 289 |
| 223 | iso_pu_bacteria | 2881845957 | 2881851108 | 289 |
| 224 | iso_pu_bacteria | 2881861095 | 2881865138 | 289 |
| 225 | iso_pu_bacteria | 2882632389 | 2882633028 | 289 |
| 226 | iso_pu_bacteria | 2882912400 | 2882914953 | 289 |
| 227 | iso_pu_bacteria | 2885318864 | 2885323972 | 289 |
| 228 | iso_pu_bacteria | 2888343758 | 2888347905 | 289 |
| 229 | iso_pu_bacteria | 2889010040 | 2889011969 | 289 |
| 230 | iso_pu_bacteria | 2903492973 | 2903501570 | 289 |
| 231 | iso_pu_bacteria | 2903492973 | 2903502053 | 289 |
| 232 | iso_pu_bacteria | 2904659560 | 2904661929 | 289 |
| 233 | iso_pu_bacteria | 2906308376 | 2906310059 | 289 |
| 234 | iso_pu_bacteria | 2906321335 | 2906322932 | 289 |
| 235 | iso_pu_bacteria | 2906328253 | 2906332882 | 289 |
| 236 | iso_pu_bacteria | 2922158528 | 2922159671 | 289 |
| 237 | iso_pu_bacteria | 2924733363 | 2924736099 | 289 |
| 238 | iso_pu_bacteria | 2924754689 | 2924754870 | 289 |
| 239 | iso_pu_bacteria | 2924784321 | 2924784760 | 289 |
| 240 | iso_pu_bacteria | 2937813078 | 2937813358 | 289 |
| 241 | iso_pu_bacteria | 2937836603 | 2937839956 | 289 |
| 242 | iso_pu_bacteria | 2937891427 | 2937895343 | 289 |
| 243 | iso_pu_bacteria | 2958115193 | 2958122459 | 289 |
| 244 | iso_pu_bacteria | 2958130278 | 2958131922 | 289 |
| 245 | iso_pu_bacteria | 2958179912 | 2958181725 | 289 |
| 246 | iso_pu_bacteria | 2961077736 | 2961079568 | 289 |
| 247 | iso_pu_bacteria | 2961114664 | 2961117083 | 289 |
| 248 | iso_pu_bacteria | 2961170736 | 2961174677 | 289 |
| 249 | iso_pu_bacteria | 2965062239 | 2965066711 | 289 |
| 250 | iso_pu_bacteria | 2967996073 | 2968000612 | 289 |
| 251 | iso_pu_bacteria | 2968003550 | 2968010015 | 289 |
| 252 | iso_pu_bacteria | 2968091066 | 2968092541 | 289 |
| 253 | iso_pu_bacteria | 2968097103 | 2968101690 | 289 |
| 254 | iso_pu_bacteria | 2968110612 | 2968112991 | 289 |
| 255 | iso_pu_bacteria | 2968117919 | 2968123844 | 289 |
| 256 | iso_pu_bacteria | 2968128360 | 2968128729 | 289 |
| 257 | iso_pu_bacteria | 2970503327 | 2970507263 | 289 |
| 258 | iso_pu_bacteria | 2970524798 | 2970529977 | 289 |
| 259 | iso_pu_bacteria | 2970540015 | 2970546948 | 289 |
| 260 | iso_pu_bacteria | 2977821940 | 2977828879 | 289 |
| 261 | iso_pu_bacteria | 2977843712 | 2977845358 | 289 |
| 262 | iso_pu_bacteria | 2977858184 | 2977862239 | 289 |
| 263 | iso_pu_bacteria | 2979808191 | 2979812459 | 289 |
| 264 | iso_pu_bacteria | 2987652177 | 2987658258 | 289 |
| 265 | iso_pu_bacteria | 2989349275 | 2989352049 | 289 |
| 266 | iso_pu_bacteria | 2996336353 | 2996340618 | 289 |
| 267 | iso_pu_bacteria | 2996341866 | 2996347131 | 289 |
| 268 | iso_pu_bacteria | 3000135777 | 3000136133 | 289 |
| 269 | iso_pu_bacteria | 8004374579 | 8004379559 | 289 |
| 270 | iso_pu_bacteria | 8004387939 | 8004390258 | 289 |
| 271 | iso_pu_bacteria | 8004445564 | 8004451748 | 289 |
| 272 | iso_pu_bacteria | 8004703790 | 8004714419 | 289 |
| 273 | iso_pu_bacteria | 8004714634 | 8004716321 | 289 |
| 274 | iso_pu_bacteria | 8055617313 | 8055622041 | 289 |
| 275 | 3300002773 | JGI25152J39213_1002643 | JGI25152J39213_10026431 | 290 |
| 276 | 3300002773 | JGI25152J39213_1002734 | JGI25152J39213_10027343 | 290 |
| 277 | 3300002773 | JGI25152J39213_1011499 | JGI25152J39213_10114992 | 290 |
| 278 | 3300002774 | JGI25150J39212_1004088 | JGI25150J39212_10040881 | 290 |
| 279 | 3300002987 | JGI25159J45721_1001272 | JGI25159J45721_10012724 | 290 |
| 280 | 3300003187 | JGI25151J46595_10001104 | JGI25151J46595_100011045 | 290 |
| 281 | 3300003187 | JGI25151J46595_10045182 | JGI25151J46595_100451821 | 290 |
| 282 | 3300003215 | JGI25153J46596_10004410 | JGI25153J46596_100044107 | 290 |
| 283 | 3300003215 | JGI25153J46596_10005483 | JGI25153J46596_100054836 | 290 |
| 284 | 3300003215 | JGI25153J46596_10030291 | JGI25153J46596_100302911 | 290 |
| 285 | 3300003320 | rootH2_10032358 | rootH2_100323587 | 290 |
| 286 | 3300003323 | rootH1_10108747 | rootH1_101087471 | 290 |
| 287 | 3300003354 | JGI25160J50197_1006241 | JGI25160J50197_10062411 | 290 |
| 288 | 3300003374 | JGI25161J50226_1000079 | JGI25161J50226_100007922 | 290 |
| 289 | 3300003771 | Ga0055526_1007163 | Ga0055526_10071632 | 290 |
| 290 | 3300003771 | Ga0055526_1009071 | Ga0055526_10090714 | 290 |
| 291 | 3300003790 | Ga0055528_1029743 | Ga0055528_10297432 | 290 |
| 292 | 3300003792 | Ga0055540_1024817 | Ga0055540_10248172 | 290 |
| 293 | 3300004625 | Ga0055543_1000031 | Ga0055543_10000317 | 290 |
| 294 | 3300005262 | Ga0065165_1005147 | Ga0065165_10051474 | 290 |
| 295 | 3300005327 | Ga0070658_10185638 | Ga0070658_101856382 | 290 |
| 296 | 3300005458 | Ga0070681_10219589 | Ga0070681_102195891 | 290 |
| 297 | 3300005468 | Ga0070707_100005918 | Ga0070707_1000059184 | 290 |
| 298 | 3300005471 | Ga0070698_100098284 | Ga0070698_1000982844 | 290 |
| 299 | 3300005471 | Ga0070698_100376174 | Ga0070698_1003761742 | 290 |
| 300 | 3300005518 | Ga0070699_100028974 | Ga0070699_1000289743 | 290 |
| 301 | 3300005530 | Ga0070679_100058363 | Ga0070679_1000583634 | 290 |
| 302 | 3300005536 | Ga0070697_100022227 | Ga0070697_1000222274 | 290 |
| 303 | 3300006175 | Ga0070712_100002440 | Ga0070712_1000024408 | 290 |
| 304 | 3300013105 | Ga0157369_10235678 | Ga0157369_102356782 | 290 |
| 305 | 3300021361 | Ga0213872_10036269 | Ga0213872_100362691 | 290 |
| 306 | 3300025208 | Ga0209436_100110 | Ga0209436_1001107 | 290 |
| 307 | 3300025245 | Ga0207425_1000730 | Ga0207425_10007305 | 290 |
| 308 | 3300025258 | Ga0209129_1000300 | Ga0209129_10003006 | 290 |
| 309 | 3300025258 | Ga0209129_1000370 | Ga0209129_10003703 | 290 |
| 310 | 3300025258 | Ga0209129_1000786 | Ga0209129_10007866 | 290 |
| 311 | 3300025258 | Ga0209129_1001338 | Ga0209129_10013388 | 290 |
| 312 | 3300025273 | Ga0209673_1008713 | Ga0209673_10087133 | 290 |
| 313 | 3300025284 | Ga0209130_1000023 | Ga0209130_1000023242 | 290 |
| 314 | 3300025294 | Ga0209025_1000505 | Ga0209025_100050553 | 290 |
| 315 | 3300025294 | Ga0209025_1006291 | Ga0209025_10062913 | 290 |
| 316 | 3300025294 | Ga0209025_1007217 | Ga0209025_10072172 | 290 |
| 317 | 3300025295 | Ga0209564_1000393 | Ga0209564_10003933 | 290 |
| 318 | 3300025297 | Ga0209758_1000390 | Ga0209758_100039025 | 290 |
| 319 | 3300025297 | Ga0209758_1000422 | Ga0209758_100042225 | 290 |
| 320 | 3300025297 | Ga0209758_1000766 | Ga0209758_10007666 | 290 |
| 321 | 3300025299 | Ga0209256_1002555 | Ga0209256_10025555 | 290 |
| 322 | 3300025302 | Ga0207426_1000087 | Ga0207426_1000087120 | 290 |
| 323 | 3300025302 | Ga0207426_1007150 | Ga0207426_10071502 | 290 |
| 324 | 3300025303 | Ga0209051_1012329 | Ga0209051_10123293 | 290 |
| 325 | 3300025304 | Ga0209257_1005314 | Ga0209257_10053143 | 290 |
| 326 | 3300025901 | Ga0207688_10193029 | Ga0207688_101930292 | 290 |
| 327 | 3300025915 | Ga0207693_10004734 | Ga0207693_100047344 | 290 |
| 328 | 3300025921 | Ga0207652_10046407 | Ga0207652_100464072 | 290 |
| 329 | 3300025922 | Ga0207646_10028674 | Ga0207646_100286743 | 290 |
| 330 | 3300026121 | Ga0207683_10380651 | Ga0207683_103806512 | 290 |
| 331 | 3300030521 | Ga0307511_10001889 | Ga0307511_1000188917 | 290 |
| 332 | 3300031548 | Ga0307408_100368771 | Ga0307408_1003687712 | 290 |
| 333 | 3300031730 | Ga0307516_10258941 | Ga0307516_102589412 | 290 |
| 334 | 3300031901 | Ga0307406_10239874 | Ga0307406_102398742 | 290 |
| 335 | 3300031995 | Ga0307409_100484635 | Ga0307409_1004846351 | 290 |
| 336 | 3300035691 | Ga0373931_0009078 | Ga0373931_0009078_311_1186 | 290 |
| 337 | 3300037853 | Ga0436364_1350694 | Ga0436364_1350694_314_1201 | 290 |
| 338 | 3300039447 | Ga0436361_0143802 | Ga0436361_0143802_205_1320 | 290 |
| 339 | 3300041486 | Ga0451807_1740877 | Ga0451807_1740877_310_1185 | 290 |
| 340 | 3300044694 | Ga0466963_0319334 | Ga0466963_0319334_25_909 | 290 |
| 341 | 3300044901 | Ga0466960_0267178 | Ga0466960_0267178_14_898 | 290 |
| 342 | 3300046474 | Ga0495605_0011008 | Ga0495605_0011008_1700_2575 | 290 |
| 343 | 3300046506 | Ga0495583_0002856 | Ga0495583_0002856_10717_11592 | 290 |
| 344 | 3300046506 | Ga0495583_0023795 | Ga0495583_0023795_298_1173 | 290 |
| 345 | 3300046512 | Ga0495610_0056385 | Ga0495610_0056385_687_1562 | 290 |
| 346 | 3300046513 | Ga0495616_0001927 | Ga0495616_0001927_2386_3261 | 290 |
| 347 | 3300046515 | Ga0495620_0001594 | Ga0495620_0001594_2493_3368 | 290 |
| 348 | 3300046522 | Ga0495643_0002592 | Ga0495643_0002592_2510_3385 | 290 |
| 349 | 3300046542 | Ga0495597_0008165 | Ga0495597_0008165_1989_2864 | 290 |
| 350 | 3300046660 | Ga0495625_0009741 | Ga0495625_0009741_2430_3305 | 290 |
| 351 | 3300046694 | Ga0495649_0075720 | Ga0495649_0075720_348_1223 | 290 |
| 352 | 3300047323 | Ga0495683_0004676 | Ga0495683_0004676_812_1687 | 290 |
| 353 | 3300047443 | Ga0495687_005170 | Ga0495687_005170_6240_7115 | 290 |
| 354 | 3300047471 | Ga0495684_0052760 | Ga0495684_0052760_1608_2498 | 290 |
| 355 | 3300047472 | Ga0495686_0017210 | Ga0495686_0017210_1695_2570 | 290 |
| 356 | 3300048091 | Ga0495626_0008206 | Ga0495626_0008206_2484_3359 | 290 |
| 357 | 3300048920 | Ga0496117_0128318 | Ga0496117_0128318_637_1512 | 290 |
| 358 | 3300048923 | Ga0496120_0050446 | Ga0496120_0050446_702_1592 | 290 |
| 359 | 3300048924 | Ga0496121_0007911 | Ga0496121_0007911_321_1196 | 290 |
| 360 | 3300048928 | Ga0496125_0021869 | Ga0496125_0021869_4095_4970 | 290 |
| 361 | 3300049459 | Ga0495678_017397 | Ga0495678_017397_99_974 | 290 |
| 362 | 3300049569 | Ga0501032_0002272 | Ga0501032_0002272_4315_5223 | 290 |
| 363 | 3300049570 | Ga0501033_0000496 | Ga0501033_0000496_26997_27905 | 290 |
| 364 | 3300049571 | Ga0501034_0004537 | Ga0501034_0004537_10210_11118 | 290 |
| 365 | 3300049572 | Ga0501036_0033559 | Ga0501036_0033559_2684_3583 | 290 |
| 366 | 3300049573 | Ga0501037_0015087 | Ga0501037_0015087_4221_5129 | 290 |
| 367 | 3300049574 | Ga0501038_0002220 | Ga0501038_0002220_4287_5195 | 290 |
| 368 | 3300049575 | Ga0501039_0003748 | Ga0501039_0003748_1645_2553 | 290 |
| 369 | 3300049579 | Ga0501043_0001892 | Ga0501043_0001892_10595_11503 | 290 |
| 370 | 3300049581 | Ga0501047_0003701 | Ga0501047_0003701_9174_10082 | 290 |
| 371 | 3300049581 | Ga0501047_0249111 | Ga0501047_0249111_447_1346 | 290 |
| 372 | 3300049584 | Ga0501068_0097685 | Ga0501068_0097685_343_1218 | 290 |
| 373 | 3300049590 | Ga0501074_0171385 | Ga0501074_0171385_121_1020 | 290 |
| 374 | 3300049744 | Ga0501083_0257937 | Ga0501083_0257937_220_1095 | 290 |
| 375 | 3300049822 | Ga0501035_0003398 | Ga0501035_0003398_9183_10091 | 290 |
| 376 | 3300049823 | Ga0501044_0005251 | Ga0501044_0005251_9183_10091 | 290 |
| 377 | 3300050511 | nmdc:mga08y16_332787_c1 | nmdc:mga08y16_332787_c1_115_1008 | 290 |
| 378 | 3300050512 | nmdc:mga0n895_483991_c1 | nmdc:mga0n895_483991_c1_321_1205 | 290 |
| 379 | 3300053161 | Ga0500634_0000006 | Ga0500634_0000006_83730_84605 | 290 |
| 380 | 3300053161 | Ga0500634_0171321 | Ga0500634_0171321_81_956 | 290 |
| 381 | 3300053178 | Ga0500637_0211295 | Ga0500637_0211295_169_1086 | 290 |
| 382 | 3300002704 | JGI25155J39150_1000898 | JGI25155J39150_10008982 | 291 |
| 383 | 3300002704 | JGI25155J39150_1000924 | JGI25155J39150_10009243 | 291 |
| 384 | 3300002705 | JGI25156J39149_1004604 | JGI25156J39149_10046042 | 291 |
| 385 | 3300002737 | JGI25162J39368_1000420 | JGI25162J39368_100042016 | 291 |
| 386 | 3300002737 | JGI25162J39368_1006253 | JGI25162J39368_10062532 | 291 |
| 387 | 3300002738 | JGI25154J39366_1000840 | JGI25154J39366_10008403 | 291 |
| 388 | 3300002738 | JGI25154J39366_1004395 | JGI25154J39366_10043953 | 291 |
| 389 | 3300002741 | JGI25157J39369_1000918 | JGI25157J39369_100091811 | 291 |
| 390 | 3300002771 | JGI25163J39215_1002583 | JGI25163J39215_10025832 | 291 |
| 391 | 3300002773 | JGI25152J39213_1000181 | JGI25152J39213_100018131 | 291 |
| 392 | 3300002774 | JGI25150J39212_1000357 | JGI25150J39212_10003573 | 291 |
| 393 | 3300002987 | JGI25159J45721_1001631 | JGI25159J45721_10016315 | 291 |
| 394 | 3300002987 | JGI25159J45721_1006561 | JGI25159J45721_10065612 | 291 |
| 395 | 3300003187 | JGI25151J46595_10004657 | JGI25151J46595_100046576 | 291 |
| 396 | 3300003214 | JGI25165J46597_1000547 | JGI25165J46597_100054716 | 291 |
| 397 | 3300003215 | JGI25153J46596_10004839 | JGI25153J46596_100048393 | 291 |
| 398 | 3300003354 | JGI25160J50197_1009997 | JGI25160J50197_10099972 | 291 |
| 399 | 3300003374 | JGI25161J50226_1000409 | JGI25161J50226_100040913 | 291 |
| 400 | 3300003374 | JGI25161J50226_1006338 | JGI25161J50226_10063382 | 291 |
| 401 | 3300003659 | JGI25404J52841_10014882 | JGI25404J52841_100148822 | 291 |
| 402 | 3300003751 | Ga0055538_1000209 | Ga0055538_100020916 | 291 |
| 403 | 3300003751 | Ga0055538_1000664 | Ga0055538_10006644 | 291 |
| 404 | 3300003752 | Ga0055539_1000251 | Ga0055539_100025116 | 291 |
| 405 | 3300003752 | Ga0055539_1000557 | Ga0055539_10005574 | 291 |
| 406 | 3300003756 | Ga0055533_1000242 | Ga0055533_100024216 | 291 |
| 407 | 3300003756 | Ga0055533_1000718 | Ga0055533_10007184 | 291 |
| 408 | 3300003758 | Ga0055532_1000097 | Ga0055532_10000971 | 291 |
| 409 | 3300003759 | Ga0055525_1000338 | Ga0055525_100033816 | 291 |
| 410 | 3300003759 | Ga0055525_1000759 | Ga0055525_10007594 | 291 |
| 411 | 3300003761 | Ga0055535_1005969 | Ga0055535_10059691 | 291 |
| 412 | 3300003763 | Ga0055529_1000032 | Ga0055529_1000032144 | 291 |
| 413 | 3300003771 | Ga0055526_1000402 | Ga0055526_100040232 | 291 |
| 414 | 3300003771 | Ga0055526_1000951 | Ga0055526_10009517 | 291 |
| 415 | 3300003771 | Ga0055526_1001247 | Ga0055526_10012473 | 291 |
| 416 | 3300003771 | Ga0055526_1014548 | Ga0055526_10145483 | 291 |
| 417 | 3300003773 | Ga0055537_1000030 | Ga0055537_100003065 | 291 |
| 418 | 3300003773 | Ga0055537_1003332 | Ga0055537_10033323 | 291 |
| 419 | 3300003775 | Ga0055524_1000851 | Ga0055524_100085110 | 291 |
| 420 | 3300003775 | Ga0055524_1002689 | Ga0055524_10026896 | 291 |
| 421 | 3300003775 | Ga0055524_1016960 | Ga0055524_10169602 | 291 |
| 422 | 3300003775 | Ga0055524_1017942 | Ga0055524_10179423 | 291 |
| 423 | 3300003784 | Ga0055534_1000203 | Ga0055534_100020331 | 291 |
| 424 | 3300003784 | Ga0055534_1001261 | Ga0055534_100126111 | 291 |
| 425 | 3300003784 | Ga0055534_1012691 | Ga0055534_10126912 | 291 |
| 426 | 3300003790 | Ga0055528_1000439 | Ga0055528_100043926 | 291 |
| 427 | 3300003790 | Ga0055528_1005416 | Ga0055528_10054163 | 291 |
| 428 | 3300003791 | Ga0055530_10000604 | Ga0055530_100006043 | 291 |
| 429 | 3300003794 | Ga0055531_10001184 | Ga0055531_1000118414 | 291 |
| 430 | 3300003841 | Ga0055541_1000149 | Ga0055541_100014916 | 291 |
| 431 | 3300003841 | Ga0055541_1000513 | Ga0055541_10005134 | 291 |
| 432 | 3300004625 | Ga0055543_1000550 | Ga0055543_100055013 | 291 |
| 433 | 3300005262 | Ga0065165_1001805 | Ga0065165_10018053 | 291 |
| 434 | 3300005330 | Ga0070690_100000109 | Ga0070690_10000010922 | 291 |
| 435 | 3300005331 | Ga0070670_100371130 | Ga0070670_1003711301 | 291 |
| 436 | 3300005334 | Ga0068869_100000272 | Ga0068869_1000002724 | 291 |
| 437 | 3300005336 | Ga0070680_100265547 | Ga0070680_1002655471 | 291 |
| 438 | 3300005340 | Ga0070689_100012618 | Ga0070689_1000126182 | 291 |
| 439 | 3300005341 | Ga0070691_10015476 | Ga0070691_100154763 | 291 |
| 440 | 3300005343 | Ga0070687_100011426 | Ga0070687_1000114261 | 291 |
| 441 | 3300005344 | Ga0070661_100397586 | Ga0070661_1003975861 | 291 |
| 442 | 3300005366 | Ga0070659_100112112 | Ga0070659_1001121122 | 291 |
| 443 | 3300005367 | Ga0070667_100031798 | Ga0070667_1000317984 | 291 |
| 444 | 3300005367 | Ga0070667_100237047 | Ga0070667_1002370472 | 291 |
| 445 | 3300005436 | Ga0070713_100305292 | Ga0070713_1003052921 | 291 |
| 446 | 3300005438 | Ga0070701_10000446 | Ga0070701_100004469 | 291 |
| 447 | 3300005439 | Ga0070711_100175933 | Ga0070711_1001759332 | 291 |
| 448 | 3300005439 | Ga0070711_100341124 | Ga0070711_1003411241 | 291 |
| 449 | 3300005441 | Ga0070700_100000237 | Ga0070700_10000023724 | 291 |
| 450 | 3300005441 | Ga0070700_100004413 | Ga0070700_1000044135 | 291 |
| 451 | 3300005444 | Ga0070694_100141182 | Ga0070694_1001411821 | 291 |
| 452 | 3300005456 | Ga0070678_100147827 | Ga0070678_1001478272 | 291 |
| 453 | 3300005459 | Ga0068867_100001174 | Ga0068867_1000011742 | 291 |
| 454 | 3300005530 | Ga0070679_100091532 | Ga0070679_1000915323 | 291 |
| 455 | 3300005539 | Ga0068853_100309034 | Ga0068853_1003090342 | 291 |
| 456 | 3300005543 | Ga0070672_100009322 | Ga0070672_1000093223 | 291 |
| 457 | 3300005544 | Ga0070686_100000464 | Ga0070686_1000004645 | 291 |
| 458 | 3300005545 | Ga0070695_100024435 | Ga0070695_1000244353 | 291 |
| 459 | 3300005546 | Ga0070696_100280000 | Ga0070696_1002800002 | 291 |
| 460 | 3300005549 | Ga0070704_100077821 | Ga0070704_1000778212 | 291 |
| 461 | 3300005563 | Ga0068855_100000951 | Ga0068855_10000095110 | 291 |
| 462 | 3300005563 | Ga0068855_100153432 | Ga0068855_1001534322 | 291 |
| 463 | 3300005564 | Ga0070664_100000682 | Ga0070664_10000068227 | 291 |
| 464 | 3300005577 | Ga0068857_100002406 | Ga0068857_10000240615 | 291 |
| 465 | 3300005577 | Ga0068857_100263262 | Ga0068857_1002632622 | 291 |
| 466 | 3300005578 | Ga0068854_100017008 | Ga0068854_1000170084 | 291 |
| 467 | 3300005614 | Ga0068856_100026055 | Ga0068856_1000260552 | 291 |
| 468 | 3300005614 | Ga0068856_100106259 | Ga0068856_1001062594 | 291 |
| 469 | 3300005615 | Ga0070702_100026943 | Ga0070702_1000269433 | 291 |
| 470 | 3300005616 | Ga0068852_100131398 | Ga0068852_1001313983 | 291 |
| 471 | 3300005616 | Ga0068852_100204790 | Ga0068852_1002047902 | 291 |
| 472 | 3300005718 | Ga0068866_10001195 | Ga0068866_100011954 | 291 |
| 473 | 3300005719 | Ga0068861_100013959 | Ga0068861_1000139594 | 291 |
| 474 | 3300005840 | Ga0068870_10039634 | Ga0068870_100396342 | 291 |
| 475 | 3300005842 | Ga0068858_100025288 | Ga0068858_1000252883 | 291 |
| 476 | 3300005843 | Ga0068860_100020873 | Ga0068860_1000208735 | 291 |
| 477 | 3300005844 | Ga0068862_100021490 | Ga0068862_1000214901 | 291 |
| 478 | 3300005844 | Ga0068862_100056436 | Ga0068862_1000564363 | 291 |
| 479 | 3300005981 | Ga0081538_10004456 | Ga0081538_100044567 | 291 |
| 480 | 3300005983 | Ga0081540_1000201 | Ga0081540_100020129 | 291 |
| 481 | 3300005983 | Ga0081540_1003632 | Ga0081540_100363214 | 291 |
| 482 | 3300005983 | Ga0081540_1015179 | Ga0081540_10151791 | 291 |
| 483 | 3300006195 | Ga0075366_10005655 | Ga0075366_100056552 | 291 |
| 484 | 3300006358 | Ga0068871_100179316 | Ga0068871_1001793162 | 291 |
| 485 | 3300006844 | Ga0075428_100002468 | Ga0075428_10000246811 | 291 |
| 486 | 3300006846 | Ga0075430_100013887 | Ga0075430_1000138877 | 291 |
| 487 | 3300006871 | Ga0075434_100300126 | Ga0075434_1003001261 | 291 |
| 488 | 3300006880 | Ga0075429_100032506 | Ga0075429_1000325062 | 291 |
| 489 | 3300006881 | Ga0068865_100000379 | Ga0068865_1000003796 | 291 |
| 490 | 3300009093 | Ga0105240_10013457 | Ga0105240_100134575 | 291 |
| 491 | 3300009093 | Ga0105240_10060062 | Ga0105240_100600622 | 291 |
| 492 | 3300009093 | Ga0105240_10066905 | Ga0105240_100669052 | 291 |
| 493 | 3300009093 | Ga0105240_10297170 | Ga0105240_102971702 | 291 |
| 494 | 3300009093 | Ga0105240_10363333 | Ga0105240_103633331 | 291 |
| 495 | 3300009094 | Ga0111539_10001915 | Ga0111539_1000191516 | 291 |
| 496 | 3300009098 | Ga0105245_10001340 | Ga0105245_100013402 | 291 |
| 497 | 3300009148 | Ga0105243_10000789 | Ga0105243_1000078922 | 291 |
| 498 | 3300009148 | Ga0105243_10013742 | Ga0105243_100137423 | 291 |
| 499 | 3300009176 | Ga0105242_10001855 | Ga0105242_100018556 | 291 |
| 500 | 3300009177 | Ga0105248_10075531 | Ga0105248_100755312 | 291 |
| 501 | 3300009545 | Ga0105237_10033514 | Ga0105237_100335144 | 291 |
| 502 | 3300009545 | Ga0105237_10048394 | Ga0105237_100483944 | 291 |
| 503 | 3300009551 | Ga0105238_10010332 | Ga0105238_100103326 | 291 |
| 504 | 3300009551 | Ga0105238_10118544 | Ga0105238_101185443 | 291 |
| 505 | 3300009551 | Ga0105238_10262191 | Ga0105238_102621912 | 291 |
| 506 | 3300009551 | Ga0105238_10298273 | Ga0105238_102982732 | 291 |
| 507 | 3300009553 | Ga0105249_10399582 | Ga0105249_103995822 | 291 |
| 508 | 3300010375 | Ga0105239_10109019 | Ga0105239_101090192 | 291 |
| 509 | 3300010375 | Ga0105239_10252141 | Ga0105239_102521412 | 291 |
| 510 | 3300013100 | Ga0157373_10287131 | Ga0157373_102871312 | 291 |
| 511 | 3300013104 | Ga0157370_10213080 | Ga0157370_102130802 | 291 |
| 512 | 3300013297 | Ga0157378_10001061 | Ga0157378_1000106112 | 291 |
| 513 | 3300013306 | Ga0163162_10005600 | Ga0163162_100056007 | 291 |
| 514 | 3300013306 | Ga0163162_10059762 | Ga0163162_100597623 | 291 |
| 515 | 3300013306 | Ga0163162_10359516 | Ga0163162_103595162 | 291 |
| 516 | 3300013308 | Ga0157375_10081781 | Ga0157375_100817813 | 291 |
| 517 | 3300013308 | Ga0157375_10100144 | Ga0157375_101001442 | 291 |
| 518 | 3300014326 | Ga0157380_10020480 | Ga0157380_100204802 | 291 |
| 519 | 3300014968 | Ga0157379_10022456 | Ga0157379_100224564 | 291 |
| 520 | 3300014969 | Ga0157376_10509653 | Ga0157376_105096532 | 291 |
| 521 | 3300015261 | Ga0182006_1001104 | Ga0182006_100110410 | 291 |
| 522 | 3300015261 | Ga0182006_1018185 | Ga0182006_10181852 | 291 |
| 523 | 3300015262 | Ga0182007_10002870 | Ga0182007_100028706 | 291 |
| 524 | 3300015262 | Ga0182007_10005932 | Ga0182007_100059322 | 291 |
| 525 | 3300017792 | Ga0163161_10070365 | Ga0163161_100703652 | 291 |
| 526 | 3300021358 | Ga0213873_10041559 | Ga0213873_100415592 | 291 |
| 527 | 3300021361 | Ga0213872_10000600 | Ga0213872_1000060010 | 291 |
| 528 | 3300021361 | Ga0213872_10005734 | Ga0213872_100057347 | 291 |
| 529 | 3300021361 | Ga0213872_10008921 | Ga0213872_100089213 | 291 |
| 530 | 3300021361 | Ga0213872_10010382 | Ga0213872_100103824 | 291 |
| 531 | 3300021361 | Ga0213872_10031458 | Ga0213872_100314582 | 291 |
| 532 | 3300021361 | Ga0213872_10067952 | Ga0213872_100679521 | 291 |
| 533 | 3300021441 | Ga0213871_10004755 | Ga0213871_100047552 | 291 |
| 534 | 3300021441 | Ga0213871_10015781 | Ga0213871_100157812 | 291 |
| 535 | 3300025206 | Ga0209435_100040 | Ga0209435_10004085 | 291 |
| 536 | 3300025208 | Ga0209436_100343 | Ga0209436_1003433 | 291 |
| 537 | 3300025208 | Ga0209436_101709 | Ga0209436_1017093 | 291 |
| 538 | 3300025224 | Ga0209784_100002 | Ga0209784_1000021485 | 291 |
| 539 | 3300025224 | Ga0209784_100020 | Ga0209784_100020366 | 291 |
| 540 | 3300025225 | Ga0209566_100003 | Ga0209566_1000031485 | 291 |
| 541 | 3300025225 | Ga0209566_100020 | Ga0209566_100020366 | 291 |
| 542 | 3300025226 | Ga0209674_100004 | Ga0209674_1000041485 | 291 |
| 543 | 3300025226 | Ga0209674_100035 | Ga0209674_100035366 | 291 |
| 544 | 3300025229 | Ga0209147_100141 | Ga0209147_10014115 | 291 |
| 545 | 3300025230 | Ga0209563_100006 | Ga0209563_1000061485 | 291 |
| 546 | 3300025230 | Ga0209563_100038 | Ga0209563_100038366 | 291 |
| 547 | 3300025231 | Ga0207427_101174 | Ga0207427_1011743 | 291 |
| 548 | 3300025233 | Ga0209437_100066 | Ga0209437_10006615 | 291 |
| 549 | 3300025233 | Ga0209437_100229 | Ga0209437_10022971 | 291 |
| 550 | 3300025242 | Ga0209258_100346 | Ga0209258_10034648 | 291 |
| 551 | 3300025245 | Ga0207425_1000001 | Ga0207425_1000001912 | 291 |
| 552 | 3300025245 | Ga0207425_1000039 | Ga0207425_100003929 | 291 |
| 553 | 3300025246 | Ga0209646_1000218 | Ga0209646_100021838 | 291 |
| 554 | 3300025246 | Ga0209646_1000235 | Ga0209646_100023516 | 291 |
| 555 | 3300025250 | Ga0209026_1000725 | Ga0209026_10007251 | 291 |
| 556 | 3300025250 | Ga0209026_1009785 | Ga0209026_10097852 | 291 |
| 557 | 3300025253 | Ga0209677_100003 | Ga0209677_1000031485 | 291 |
| 558 | 3300025253 | Ga0209677_100031 | Ga0209677_100031306 | 291 |
| 559 | 3300025256 | Ga0209759_1000447 | Ga0209759_100044738 | 291 |
| 560 | 3300025256 | Ga0209759_1001334 | Ga0209759_100133412 | 291 |
| 561 | 3300025258 | Ga0209129_1000001 | Ga0209129_100000189 | 291 |
| 562 | 3300025258 | Ga0209129_1003963 | Ga0209129_10039636 | 291 |
| 563 | 3300025261 | Ga0209233_1000060 | Ga0209233_1000060366 | 291 |
| 564 | 3300025261 | Ga0209233_1033544 | Ga0209233_10335441 | 291 |
| 565 | 3300025263 | Ga0209565_1000017 | Ga0209565_100001741 | 291 |
| 566 | 3300025263 | Ga0209565_1000410 | Ga0209565_100041013 | 291 |
| 567 | 3300025263 | Ga0209565_1000440 | Ga0209565_100044011 | 291 |
| 568 | 3300025272 | Ga0209455_1000043 | Ga0209455_1000043235 | 291 |
| 569 | 3300025272 | Ga0209455_1004598 | Ga0209455_10045983 | 291 |
| 570 | 3300025273 | Ga0209673_1000007 | Ga0209673_1000007388 | 291 |
| 571 | 3300025273 | Ga0209673_1011374 | Ga0209673_10113743 | 291 |
| 572 | 3300025284 | Ga0209130_1000534 | Ga0209130_10005345 | 291 |
| 573 | 3300025284 | Ga0209130_1001866 | Ga0209130_10018665 | 291 |
| 574 | 3300025284 | Ga0209130_1002660 | Ga0209130_10026607 | 291 |
| 575 | 3300025284 | Ga0209130_1002808 | Ga0209130_10028084 | 291 |
| 576 | 3300025291 | Ga0209675_1000009 | Ga0209675_1000009130 | 291 |
| 577 | 3300025291 | Ga0209675_1000630 | Ga0209675_100063011 | 291 |
| 578 | 3300025291 | Ga0209675_1002116 | Ga0209675_10021163 | 291 |
| 579 | 3300025291 | Ga0209675_1003002 | Ga0209675_10030023 | 291 |
| 580 | 3300025292 | Ga0209676_1006467 | Ga0209676_10064676 | 291 |
| 581 | 3300025294 | Ga0209025_1000594 | Ga0209025_100059419 | 291 |
| 582 | 3300025295 | Ga0209564_1000055 | Ga0209564_100005565 | 291 |
| 583 | 3300025295 | Ga0209564_1000109 | Ga0209564_100010927 | 291 |
| 584 | 3300025295 | Ga0209564_1000879 | Ga0209564_100087932 | 291 |
| 585 | 3300025295 | Ga0209564_1001055 | Ga0209564_100105528 | 291 |
| 586 | 3300025295 | Ga0209564_1018582 | Ga0209564_10185822 | 291 |
| 587 | 3300025295 | Ga0209564_1021373 | Ga0209564_10213733 | 291 |
| 588 | 3300025297 | Ga0209758_1000020 | Ga0209758_1000020364 | 291 |
| 589 | 3300025298 | Ga0209050_1000074 | Ga0209050_100007428 | 291 |
| 590 | 3300025298 | Ga0209050_1000116 | Ga0209050_1000116104 | 291 |
| 591 | 3300025298 | Ga0209050_1029605 | Ga0209050_10296052 | 291 |
| 592 | 3300025299 | Ga0209256_1000028 | Ga0209256_1000028337 | 291 |
| 593 | 3300025299 | Ga0209256_1000559 | Ga0209256_100055915 | 291 |
| 594 | 3300025299 | Ga0209256_1000640 | Ga0209256_100064012 | 291 |
| 595 | 3300025299 | Ga0209256_1003461 | Ga0209256_10034616 | 291 |
| 596 | 3300025299 | Ga0209256_1006115 | Ga0209256_10061153 | 291 |
| 597 | 3300025302 | Ga0207426_1001693 | Ga0207426_10016939 | 291 |
| 598 | 3300025303 | Ga0209051_1011200 | Ga0209051_10112003 | 291 |
| 599 | 3300025304 | Ga0209257_1000003 | Ga0209257_1000003192 | 291 |
| 600 | 3300025304 | Ga0209257_1005865 | Ga0209257_100586510 | 291 |
| 601 | 3300025909 | Ga0207705_10081138 | Ga0207705_100811383 | 291 |
| 602 | 3300025913 | Ga0207695_10003541 | Ga0207695_1000354113 | 291 |
| 603 | 3300025913 | Ga0207695_10007058 | Ga0207695_100070582 | 291 |
| 604 | 3300025913 | Ga0207695_10024767 | Ga0207695_100247672 | 291 |
| 605 | 3300025913 | Ga0207695_10136764 | Ga0207695_101367643 | 291 |
| 606 | 3300025913 | Ga0207695_10273950 | Ga0207695_102739502 | 291 |
| 607 | 3300025914 | Ga0207671_10005962 | Ga0207671_100059626 | 291 |
| 608 | 3300025916 | Ga0207663_10135445 | Ga0207663_101354452 | 291 |
| 609 | 3300025919 | Ga0207657_10028029 | Ga0207657_100280293 | 291 |
| 610 | 3300025923 | Ga0207681_10221384 | Ga0207681_102213842 | 291 |
| 611 | 3300025924 | Ga0207694_10004415 | Ga0207694_100044155 | 291 |
| 612 | 3300025924 | Ga0207694_10201131 | Ga0207694_102011312 | 291 |
| 613 | 3300025927 | Ga0207687_10271563 | Ga0207687_102715631 | 291 |
| 614 | 3300025932 | Ga0207690_10304884 | Ga0207690_103048841 | 291 |
| 615 | 3300025934 | Ga0207686_10048830 | Ga0207686_100488302 | 291 |
| 616 | 3300025935 | Ga0207709_10031585 | Ga0207709_100315853 | 291 |
| 617 | 3300025935 | Ga0207709_10039433 | Ga0207709_100394332 | 291 |
| 618 | 3300025936 | Ga0207670_10042894 | Ga0207670_100428942 | 291 |
| 619 | 3300025938 | Ga0207704_10396443 | Ga0207704_103964432 | 291 |
| 620 | 3300025940 | Ga0207691_10017651 | Ga0207691_100176514 | 291 |
| 621 | 3300025941 | Ga0207711_10066381 | Ga0207711_100663813 | 291 |
| 622 | 3300025942 | Ga0207689_10001544 | Ga0207689_1000154410 | 291 |
| 623 | 3300025945 | Ga0207679_10094998 | Ga0207679_100949982 | 291 |
| 624 | 3300025949 | Ga0207667_10000642 | Ga0207667_1000064219 | 291 |
| 625 | 3300025949 | Ga0207667_10159921 | Ga0207667_101599211 | 291 |
| 626 | 3300025961 | Ga0207712_10336234 | Ga0207712_103362342 | 291 |
| 627 | 3300025981 | Ga0207640_10136932 | Ga0207640_101369322 | 291 |
| 628 | 3300025986 | Ga0207658_10112244 | Ga0207658_101122442 | 291 |
| 629 | 3300026023 | Ga0207677_10394712 | Ga0207677_103947121 | 291 |
| 630 | 3300026041 | Ga0207639_10033066 | Ga0207639_100330662 | 291 |
| 631 | 3300026067 | Ga0207678_10108275 | Ga0207678_101082752 | 291 |
| 632 | 3300026075 | Ga0207708_10000219 | Ga0207708_1000021941 | 291 |
| 633 | 3300026075 | Ga0207708_10003595 | Ga0207708_100035954 | 291 |
| 634 | 3300026078 | Ga0207702_10093230 | Ga0207702_100932303 | 291 |
| 635 | 3300026078 | Ga0207702_10116526 | Ga0207702_101165261 | 291 |
| 636 | 3300026078 | Ga0207702_10247205 | Ga0207702_102472052 | 291 |
| 637 | 3300026089 | Ga0207648_10000534 | Ga0207648_100005343 | 291 |
| 638 | 3300026089 | Ga0207648_10233419 | Ga0207648_102334192 | 291 |
| 639 | 3300026116 | Ga0207674_10186817 | Ga0207674_101868173 | 291 |
| 640 | 3300026118 | Ga0207675_100025791 | Ga0207675_1000257912 | 291 |
| 641 | 3300026121 | Ga0207683_10039784 | Ga0207683_100397844 | 291 |
| 642 | 3300026121 | Ga0207683_10065908 | Ga0207683_100659083 | 291 |
| 643 | 3300026142 | Ga0207698_10029821 | Ga0207698_100298213 | 291 |
| 644 | 3300027543 | Ga0209999_1002328 | Ga0209999_10023282 | 291 |
| 645 | 3300027907 | Ga0207428_10011331 | Ga0207428_100113312 | 291 |
| 646 | 3300028380 | Ga0268265_10007131 | Ga0268265_100071311 | 291 |
| 647 | 3300028380 | Ga0268265_10139117 | Ga0268265_101391172 | 291 |
| 648 | 3300028381 | Ga0268264_10025052 | Ga0268264_100250522 | 291 |
| 649 | 3300028563 | Ga0265319_1002495 | Ga0265319_10024952 | 291 |
| 650 | 3300028577 | Ga0265318_10002650 | Ga0265318_100026502 | 291 |
| 651 | 3300028577 | Ga0265318_10004899 | Ga0265318_100048995 | 291 |
| 652 | 3300031235 | Ga0265330_10002740 | Ga0265330_100027406 | 291 |
| 653 | 3300031238 | Ga0265332_10001710 | Ga0265332_100017109 | 291 |
| 654 | 3300031239 | Ga0265328_10014547 | Ga0265328_100145472 | 291 |
| 655 | 3300031240 | Ga0265320_10001869 | Ga0265320_100018692 | 291 |
| 656 | 3300031242 | Ga0265329_10000886 | Ga0265329_100008867 | 291 |
| 657 | 3300031247 | Ga0265340_10002506 | Ga0265340_100025064 | 291 |
| 658 | 3300031250 | Ga0265331_10002480 | Ga0265331_100024809 | 291 |
| 659 | 3300031344 | Ga0265316_10003173 | Ga0265316_100031739 | 291 |
| 660 | 3300031456 | Ga0307513_10007045 | Ga0307513_100070458 | 291 |
| 661 | 3300031507 | Ga0307509_10361386 | Ga0307509_103613862 | 291 |
| 662 | 3300031548 | Ga0307408_100000157 | Ga0307408_10000015773 | 291 |
| 663 | 3300031548 | Ga0307408_100004977 | Ga0307408_1000049773 | 291 |
| 664 | 3300031595 | Ga0265313_10000186 | Ga0265313_1000018611 | 291 |
| 665 | 3300031595 | Ga0265313_10000483 | Ga0265313_100004839 | 291 |
| 666 | 3300031711 | Ga0265314_10005273 | Ga0265314_100052738 | 291 |
| 667 | 3300031712 | Ga0265342_10000054 | Ga0265342_100000549 | 291 |
| 668 | 3300031730 | Ga0307516_10040735 | Ga0307516_100407353 | 291 |
| 669 | 3300031731 | Ga0307405_10163203 | Ga0307405_101632031 | 291 |
| 670 | 3300032002 | Ga0307416_100011348 | Ga0307416_1000113484 | 291 |
| 671 | 3300032004 | Ga0307414_10325576 | Ga0307414_103255761 | 291 |
| 672 | 3300032005 | Ga0307411_10208175 | Ga0307411_102081752 | 291 |
| 673 | 3300033179 | Ga0307507_10116066 | Ga0307507_101160662 | 291 |
| 674 | 3300037312 | Ga0395899_0003202 | Ga0395899_0003202_9021_9917 | 291 |
| 675 | 3300037312 | Ga0395899_0020447 | Ga0395899_0020447_2643_3521 | 291 |
| 676 | 3300037312 | Ga0395899_0021263 | Ga0395899_0021263_3911_4813 | 291 |
| 677 | 3300037312 | Ga0395899_0026047 | Ga0395899_0026047_335_1282 | 291 |
| 678 | 3300037312 | Ga0395899_0064179 | Ga0395899_0064179_1539_2438 | 291 |
| 679 | 3300037418 | Ga0395900_0005113 | Ga0395900_0005113_10165_11055 | 291 |
| 680 | 3300037418 | Ga0395900_0018578 | Ga0395900_0018578_5724_6623 | 291 |
| 681 | 3300037418 | Ga0395900_0046716 | Ga0395900_0046716_333_1280 | 291 |
| 682 | 3300037418 | Ga0395900_0171737 | Ga0395900_0171737_601_1479 | 291 |
| 683 | 3300037466 | Ga0395898_0007720 | Ga0395898_0007720_1604_2482 | 291 |
| 684 | 3300037466 | Ga0395898_0098827 | Ga0395898_0098827_1013_1912 | 291 |
| 685 | 3300037471 | Ga0395905_0005608 | Ga0395905_0005608_11518_12405 | 291 |
| 686 | 3300037471 | Ga0395905_0013373 | Ga0395905_0013373_3990_4868 | 291 |
| 687 | 3300037471 | Ga0395905_0024852 | Ga0395905_0024852_3956_4843 | 291 |
| 688 | 3300037471 | Ga0395905_0026178 | Ga0395905_0026178_2789_3685 | 291 |
| 689 | 3300038443 | Ga0395901_0001319 | Ga0395901_0001319_19082_20038 | 291 |
| 690 | 3300038443 | Ga0395901_0046081 | Ga0395901_0046081_2790_3689 | 291 |
| 691 | 3300038443 | Ga0395901_0090830 | Ga0395901_0090830_1130_2008 | 291 |
| 692 | 3300038443 | Ga0395901_0169333 | Ga0395901_0169333_804_1688 | 291 |
| 693 | 3300038443 | Ga0395901_0254415 | Ga0395901_0254415_378_1271 | 291 |
| 694 | 3300039438 | Ga0436360_0022124 | Ga0436360_0022124_656_1555 | 291 |
| 695 | 3300039438 | Ga0436360_0369614 | Ga0436360_0369614_45_935 | 291 |
| 696 | 3300039438 | Ga0436360_0481236 | Ga0436360_0481236_1284_2198 | 291 |
| 697 | 3300039447 | Ga0436361_0002397 | Ga0436361_0002397_95_994 | 291 |
| 698 | 3300039447 | Ga0436361_0014834 | Ga0436361_0014834_2586_3473 | 291 |
| 699 | 3300039447 | Ga0436361_0065044 | Ga0436361_0065044_478_1377 | 291 |
| 700 | 3300039447 | Ga0436361_0148264 | Ga0436361_0148264_41849_42736 | 291 |
| 701 | 3300039447 | Ga0436361_0273252 | Ga0436361_0273252_14356_15243 | 291 |
| 702 | 3300039447 | Ga0436361_0316723 | Ga0436361_0316723_5326_6213 | 291 |
| 703 | 3300039447 | Ga0436361_0362138 | Ga0436361_0362138_145_1035 | 291 |
| 704 | 3300039447 | Ga0436361_0495212 | Ga0436361_0495212_1336_2223 | 291 |
| 705 | 3300039447 | Ga0436361_0769001 | Ga0436361_0769001_445_1344 | 291 |
| 706 | 3300039447 | Ga0436361_0879465 | Ga0436361_0879465_589_1488 | 291 |
| 707 | 3300039453 | Ga0436362_1085390 | Ga0436362_1085390_1948_2862 | 291 |
| 708 | 3300044656 | Ga0466969_0007082 | Ga0466969_0007082_464_1384 | 291 |
| 709 | 3300044656 | Ga0466969_0025919 | Ga0466969_0025919_1908_2798 | 291 |
| 710 | 3300044683 | Ga0466965_0000149 | Ga0466965_0000149_13104_14003 | 291 |
| 711 | 3300044683 | Ga0466965_0000613 | Ga0466965_0000613_10120_11040 | 291 |
| 712 | 3300044684 | Ga0466966_0003879 | Ga0466966_0003879_4187_5107 | 291 |
| 713 | 3300044693 | Ga0466961_0004681 | Ga0466961_0004681_4515_5435 | 291 |
| 714 | 3300044693 | Ga0466961_0211566 | Ga0466961_0211566_267_1154 | 291 |
| 715 | 3300044694 | Ga0466963_0020651 | Ga0466963_0020651_235_1125 | 291 |
| 716 | 3300044706 | Ga0466964_0004214 | Ga0466964_0004214_3939_4829 | 291 |
| 717 | 3300044706 | Ga0466964_0004520 | Ga0466964_0004520_2549_3469 | 291 |
| 718 | 3300044706 | Ga0466964_0081259 | Ga0466964_0081259_229_1110 | 291 |
| 719 | 3300044712 | Ga0453684_0006630 | Ga0453684_0006630_3517_4419 | 291 |
| 720 | 3300044712 | Ga0453684_0055940 | Ga0453684_0055940_4220_5104 | 291 |
| 721 | 3300044719 | Ga0466971_0053133 | Ga0466971_0053133_679_1569 | 291 |
| 722 | 3300044735 | Ga0466968_0007816 | Ga0466968_0007816_2892_3791 | 291 |
| 723 | 3300044765 | Ga0466970_0008418 | Ga0466970_0008418_3456_4376 | 291 |
| 724 | 3300044842 | Ga0466957_0001149 | Ga0466957_0001149_9566_10486 | 291 |
| 725 | 3300044842 | Ga0466957_0014213 | Ga0466957_0014213_1790_2680 | 291 |
| 726 | 3300045049 | Ga0466959_0000216 | Ga0466959_0000216_3792_4682 | 291 |
| 727 | 3300045049 | Ga0466959_0002489 | Ga0466959_0002489_7494_8387 | 291 |
| 728 | 3300045051 | Ga0451576_0071705 | Ga0451576_0071705_1253_2137 | 291 |
| 729 | 3300045836 | Ga0466958_0022819 | Ga0466958_0022819_1466_2386 | 291 |
| 730 | 3300045836 | Ga0466958_0056808 | Ga0466958_0056808_1138_2049 | 291 |
| 731 | 3300045836 | Ga0466958_0109418 | Ga0466958_0109418_369_1259 | 291 |
| 732 | 3300045836 | Ga0466958_0110732 | Ga0466958_0110732_619_1512 | 291 |
| 733 | 3300046452 | Ga0495617_002431 | Ga0495617_002431_4620_5507 | 291 |
| 734 | 3300046452 | Ga0495617_070500 | Ga0495617_070500_27_914 | 291 |
| 735 | 3300046455 | Ga0495603_0000760 | Ga0495603_0000760_6710_7597 | 291 |
| 736 | 3300046459 | Ga0495629_0001443 | Ga0495629_0001443_11708_12595 | 291 |
| 737 | 3300046460 | Ga0495638_0001700 | Ga0495638_0001700_6082_6969 | 291 |
| 738 | 3300046460 | Ga0495638_0128977 | Ga0495638_0128977_400_1284 | 291 |
| 739 | 3300046461 | Ga0495641_0007642 | Ga0495641_0007642_2606_3493 | 291 |
| 740 | 3300046462 | Ga0495651_0006073 | Ga0495651_0006073_5101_5988 | 291 |
| 741 | 3300046462 | Ga0495651_0044913 | Ga0495651_0044913_2125_3012 | 291 |
| 742 | 3300046463 | Ga0495653_0000578 | Ga0495653_0000578_6150_7037 | 291 |
| 743 | 3300046463 | Ga0495653_0008170 | Ga0495653_0008170_6877_7764 | 291 |
| 744 | 3300046471 | Ga0495650_0000383 | Ga0495650_0000383_27451_28338 | 291 |
| 745 | 3300046472 | Ga0495580_0000763 | Ga0495580_0000763_6710_7597 | 291 |
| 746 | 3300046472 | Ga0495580_0018601 | Ga0495580_0018601_2302_3189 | 291 |
| 747 | 3300046472 | Ga0495580_0263420 | Ga0495580_0263420_187_1074 | 291 |
| 748 | 3300046473 | Ga0495582_0000320 | Ga0495582_0000320_6682_7569 | 291 |
| 749 | 3300046474 | Ga0495605_0000665 | Ga0495605_0000665_11511_12398 | 291 |
| 750 | 3300046474 | Ga0495605_0022422 | Ga0495605_0022422_1132_2019 | 291 |
| 751 | 3300046474 | Ga0495605_0037838 | Ga0495605_0037838_1145_2035 | 291 |
| 752 | 3300046477 | Ga0495664_0000261 | Ga0495664_0000261_19892_20779 | 291 |
| 753 | 3300046491 | Ga0495584_0000573 | Ga0495584_0000573_22567_23508 | 291 |
| 754 | 3300046491 | Ga0495584_0005997 | Ga0495584_0005997_1853_2743 | 291 |
| 755 | 3300046491 | Ga0495584_0044014 | Ga0495584_0044014_28_915 | 291 |
| 756 | 3300046492 | Ga0495585_0001878 | Ga0495585_0001878_10431_11318 | 291 |
| 757 | 3300046492 | Ga0495585_0019615 | Ga0495585_0019615_1049_1936 | 291 |
| 758 | 3300046500 | Ga0495596_0000801 | Ga0495596_0000801_9825_10715 | 291 |
| 759 | 3300046500 | Ga0495596_0003413 | Ga0495596_0003413_5619_6506 | 291 |
| 760 | 3300046501 | Ga0495607_0001824 | Ga0495607_0001824_13529_14416 | 291 |
| 761 | 3300046501 | Ga0495607_0045539 | Ga0495607_0045539_1262_2149 | 291 |
| 762 | 3300046501 | Ga0495607_0049484 | Ga0495607_0049484_240_1127 | 291 |
| 763 | 3300046501 | Ga0495607_0054906 | Ga0495607_0054906_453_1343 | 291 |
| 764 | 3300046506 | Ga0495583_0000045 | Ga0495583_0000045_215353_216240 | 291 |
| 765 | 3300046506 | Ga0495583_0019164 | Ga0495583_0019164_774_1661 | 291 |
| 766 | 3300046507 | Ga0495606_0000360 | Ga0495606_0000360_73444_74334 | 291 |
| 767 | 3300046507 | Ga0495606_0011366 | Ga0495606_0011366_1756_2643 | 291 |
| 768 | 3300046507 | Ga0495606_0034029 | Ga0495606_0034029_353_1240 | 291 |
| 769 | 3300046507 | Ga0495606_0057561 | Ga0495606_0057561_526_1413 | 291 |
| 770 | 3300046511 | Ga0495608_0007822 | Ga0495608_0007822_1411_2298 | 291 |
| 771 | 3300046511 | Ga0495608_0009704 | Ga0495608_0009704_303_1190 | 291 |
| 772 | 3300046512 | Ga0495610_0007706 | Ga0495610_0007706_1883_2770 | 291 |
| 773 | 3300046512 | Ga0495610_0046016 | Ga0495610_0046016_1220_2107 | 291 |
| 774 | 3300046513 | Ga0495616_0008633 | Ga0495616_0008633_2404_3291 | 291 |
| 775 | 3300046513 | Ga0495616_0011082 | Ga0495616_0011082_48_935 | 291 |
| 776 | 3300046513 | Ga0495616_0016974 | Ga0495616_0016974_512_1399 | 291 |
| 777 | 3300046514 | Ga0495618_0001870 | Ga0495618_0001870_3556_4443 | 291 |
| 778 | 3300046514 | Ga0495618_0002893 | Ga0495618_0002893_6699_7586 | 291 |
| 779 | 3300046514 | Ga0495618_0214361 | Ga0495618_0214361_149_1036 | 291 |
| 780 | 3300046516 | Ga0495628_0002356 | Ga0495628_0002356_5329_6216 | 291 |
| 781 | 3300046516 | Ga0495628_0005561 | Ga0495628_0005561_1566_2453 | 291 |
| 782 | 3300046516 | Ga0495628_0012017 | Ga0495628_0012017_3009_3896 | 291 |
| 783 | 3300046517 | Ga0495630_0000512 | Ga0495630_0000512_6710_7597 | 291 |
| 784 | 3300046518 | Ga0495631_0000752 | Ga0495631_0000752_5247_6134 | 291 |
| 785 | 3300046518 | Ga0495631_0011543 | Ga0495631_0011543_342_1232 | 291 |
| 786 | 3300046519 | Ga0495632_0114174 | Ga0495632_0114174_364_1248 | 291 |
| 787 | 3300046522 | Ga0495643_0000099 | Ga0495643_0000099_28740_29627 | 291 |
| 788 | 3300046522 | Ga0495643_0038482 | Ga0495643_0038482_920_1810 | 291 |
| 789 | 3300046522 | Ga0495643_0071574 | Ga0495643_0071574_390_1286 | 291 |
| 790 | 3300046523 | Ga0495644_0000135 | Ga0495644_0000135_19685_20572 | 291 |
| 791 | 3300046523 | Ga0495644_0004017 | Ga0495644_0004017_3767_4654 | 291 |
| 792 | 3300046524 | Ga0495648_0000659 | Ga0495648_0000659_22154_23041 | 291 |
| 793 | 3300046524 | Ga0495648_0006023 | Ga0495648_0006023_4378_5265 | 291 |
| 794 | 3300046524 | Ga0495648_0030027 | Ga0495648_0030027_2337_3224 | 291 |
| 795 | 3300046524 | Ga0495648_0030583 | Ga0495648_0030583_2491_3378 | 291 |
| 796 | 3300046524 | Ga0495648_0032605 | Ga0495648_0032605_75_962 | 291 |
| 797 | 3300046524 | Ga0495648_0047035 | Ga0495648_0047035_682_1569 | 291 |
| 798 | 3300046526 | Ga0495666_0000103 | Ga0495666_0000103_6688_7575 | 291 |
| 799 | 3300046528 | Ga0495642_0007016 | Ga0495642_0007016_2740_3636 | 291 |
| 800 | 3300046528 | Ga0495642_0071270 | Ga0495642_0071270_484_1377 | 291 |
| 801 | 3300046529 | Ga0495652_0001284 | Ga0495652_0001284_20488_21375 | 291 |
| 802 | 3300046529 | Ga0495652_0003297 | Ga0495652_0003297_11388_12275 | 291 |
| 803 | 3300046529 | Ga0495652_0018130 | Ga0495652_0018130_2812_3699 | 291 |
| 804 | 3300046529 | Ga0495652_0020184 | Ga0495652_0020184_2860_3747 | 291 |
| 805 | 3300046531 | Ga0495665_0000233 | Ga0495665_0000233_20488_21375 | 291 |
| 806 | 3300046533 | Ga0495640_0004376 | Ga0495640_0004376_6572_7459 | 291 |
| 807 | 3300046535 | Ga0495586_0000365 | Ga0495586_0000365_20410_21297 | 291 |
| 808 | 3300046538 | Ga0495609_0000582 | Ga0495609_0000582_9103_9990 | 291 |
| 809 | 3300046538 | Ga0495609_0000604 | Ga0495609_0000604_1549_2436 | 291 |
| 810 | 3300046538 | Ga0495609_0000992 | Ga0495609_0000992_13254_14141 | 291 |
| 811 | 3300046538 | Ga0495609_0034183 | Ga0495609_0034183_61_948 | 291 |
| 812 | 3300046542 | Ga0495597_0000172 | Ga0495597_0000172_22144_23031 | 291 |
| 813 | 3300046542 | Ga0495597_0015880 | Ga0495597_0015880_1440_2327 | 291 |
| 814 | 3300046542 | Ga0495597_0053820 | Ga0495597_0053820_588_1475 | 291 |
| 815 | 3300046542 | Ga0495597_0073931 | Ga0495597_0073931_51_938 | 291 |
| 816 | 3300046543 | Ga0495645_0000480 | Ga0495645_0000480_20070_20957 | 291 |
| 817 | 3300046543 | Ga0495645_0018286 | Ga0495645_0018286_49_936 | 291 |
| 818 | 3300046557 | Ga0495622_0107420 | Ga0495622_0107420_290_1177 | 291 |
| 819 | 3300046558 | Ga0495633_0000349 | Ga0495633_0000349_18605_19492 | 291 |
| 820 | 3300046558 | Ga0495633_0002318 | Ga0495633_0002318_8605_9492 | 291 |
| 821 | 3300046558 | Ga0495633_0011431 | Ga0495633_0011431_2163_3050 | 291 |
| 822 | 3300046558 | Ga0495633_0012066 | Ga0495633_0012066_2760_3647 | 291 |
| 823 | 3300046558 | Ga0495633_0057090 | Ga0495633_0057090_932_1819 | 291 |
| 824 | 3300046615 | Ga0495656_0028944 | Ga0495656_0028944_617_1504 | 291 |
| 825 | 3300046615 | Ga0495656_0209464 | Ga0495656_0209464_11_910 | 291 |
| 826 | 3300046616 | Ga0495668_0000285 | Ga0495668_0000285_28679_29566 | 291 |
| 827 | 3300046616 | Ga0495668_0038149 | Ga0495668_0038149_1702_2589 | 291 |
| 828 | 3300046642 | Ga0495634_0000937 | Ga0495634_0000937_6694_7581 | 291 |
| 829 | 3300046648 | Ga0495611_0005392 | Ga0495611_0005392_4264_5151 | 291 |
| 830 | 3300046648 | Ga0495611_0006605 | Ga0495611_0006605_3800_4687 | 291 |
| 831 | 3300046648 | Ga0495611_0025671 | Ga0495611_0025671_752_1639 | 291 |
| 832 | 3300046660 | Ga0495625_0001004 | Ga0495625_0001004_278_1165 | 291 |
| 833 | 3300046660 | Ga0495625_0001275 | Ga0495625_0001275_29750_30637 | 291 |
| 834 | 3300046660 | Ga0495625_0003651 | Ga0495625_0003651_1122_2009 | 291 |
| 835 | 3300046660 | Ga0495625_0013489 | Ga0495625_0013489_1413_2300 | 291 |
| 836 | 3300046660 | Ga0495625_0014512 | Ga0495625_0014512_4897_5784 | 291 |
| 837 | 3300046660 | Ga0495625_0027666 | Ga0495625_0027666_1171_2058 | 291 |
| 838 | 3300046660 | Ga0495625_0151120 | Ga0495625_0151120_645_1523 | 291 |
| 839 | 3300046663 | Ga0495635_0001129 | Ga0495635_0001129_6672_7559 | 291 |
| 840 | 3300046663 | Ga0495635_0032334 | Ga0495635_0032334_1129_2016 | 291 |
| 841 | 3300046664 | Ga0495659_0000033 | Ga0495659_0000033_33740_34627 | 291 |
| 842 | 3300046664 | Ga0495659_0000294 | Ga0495659_0000294_16543_17430 | 291 |
| 843 | 3300046664 | Ga0495659_0021743 | Ga0495659_0021743_386_1276 | 291 |
| 844 | 3300046664 | Ga0495659_0077394 | Ga0495659_0077394_136_1023 | 291 |
| 845 | 3300046665 | Ga0495661_0000603 | Ga0495661_0000603_30404_31291 | 291 |
| 846 | 3300046665 | Ga0495661_0001041 | Ga0495661_0001041_17044_17931 | 291 |
| 847 | 3300046665 | Ga0495661_0002078 | Ga0495661_0002078_4039_4935 | 291 |
| 848 | 3300046665 | Ga0495661_0009392 | Ga0495661_0009392_1440_2327 | 291 |
| 849 | 3300046665 | Ga0495661_0012466 | Ga0495661_0012466_4352_5239 | 291 |
| 850 | 3300046665 | Ga0495661_0023083 | Ga0495661_0023083_1754_2641 | 291 |
| 851 | 3300046675 | Ga0495657_0159426 | Ga0495657_0159426_441_1328 | 291 |
| 852 | 3300046678 | Ga0495599_0018939 | Ga0495599_0018939_258_1145 | 291 |
| 853 | 3300046679 | Ga0495623_0002075 | Ga0495623_0002075_6404_7291 | 291 |
| 854 | 3300046679 | Ga0495623_0109893 | Ga0495623_0109893_144_1031 | 291 |
| 855 | 3300046680 | Ga0495646_0000233 | Ga0495646_0000233_20057_20944 | 291 |
| 856 | 3300046680 | Ga0495646_0007025 | Ga0495646_0007025_3573_4460 | 291 |
| 857 | 3300046684 | Ga0495669_0061554 | Ga0495669_0061554_428_1312 | 291 |
| 858 | 3300046689 | Ga0495613_0001368 | Ga0495613_0001368_10830_11717 | 291 |
| 859 | 3300046690 | Ga0495624_0000625 | Ga0495624_0000625_20070_20957 | 291 |
| 860 | 3300046690 | Ga0495624_0024039 | Ga0495624_0024039_1381_2268 | 291 |
| 861 | 3300046691 | Ga0495670_0000252 | Ga0495670_0000252_13640_14527 | 291 |
| 862 | 3300046691 | Ga0495670_0000525 | Ga0495670_0000525_5224_6111 | 291 |
| 863 | 3300046691 | Ga0495670_0052519 | Ga0495670_0052519_778_1665 | 291 |
| 864 | 3300046691 | Ga0495670_0058753 | Ga0495670_0058753_37_924 | 291 |
| 865 | 3300046692 | Ga0495671_0000398 | Ga0495671_0000398_28346_29233 | 291 |
| 866 | 3300046692 | Ga0495671_0008654 | Ga0495671_0008654_566_1453 | 291 |
| 867 | 3300046694 | Ga0495649_0011261 | Ga0495649_0011261_1071_1958 | 291 |
| 868 | 3300046794 | Ga0495589_0018258 | Ga0495589_0018258_403_1290 | 291 |
| 869 | 3300046809 | Ga0495600_0000670 | Ga0495600_0000670_15620_16507 | 291 |
| 870 | 3300046810 | Ga0495660_0002258 | Ga0495660_0002258_856_1743 | 291 |
| 871 | 3300046810 | Ga0495660_0018980 | Ga0495660_0018980_1233_2120 | 291 |
| 872 | 3300047315 | Ga0495581_0000632 | Ga0495581_0000632_6685_7572 | 291 |
| 873 | 3300047317 | Ga0495604_0003604 | Ga0495604_0003604_2872_3759 | 291 |
| 874 | 3300047317 | Ga0495604_0012180 | Ga0495604_0012180_2740_3627 | 291 |
| 875 | 3300047318 | Ga0495636_0000318 | Ga0495636_0000318_13869_14756 | 291 |
| 876 | 3300047319 | Ga0495674_0000945 | Ga0495674_0000945_20070_20957 | 291 |
| 877 | 3300047320 | Ga0495672_0000191 | Ga0495672_0000191_53126_54013 | 291 |
| 878 | 3300047320 | Ga0495672_0000257 | Ga0495672_0000257_25467_26354 | 291 |
| 879 | 3300047320 | Ga0495672_0000277 | Ga0495672_0000277_16663_17550 | 291 |
| 880 | 3300047320 | Ga0495672_0003583 | Ga0495672_0003583_86_973 | 291 |
| 881 | 3300047320 | Ga0495672_0038522 | Ga0495672_0038522_775_1662 | 291 |
| 882 | 3300047321 | Ga0495676_0001514 | Ga0495676_0001514_6188_7075 | 291 |
| 883 | 3300047321 | Ga0495676_0042526 | Ga0495676_0042526_1935_2822 | 291 |
| 884 | 3300047322 | Ga0495680_0001203 | Ga0495680_0001203_7433_8320 | 291 |
| 885 | 3300047323 | Ga0495683_0007383 | Ga0495683_0007383_449_1336 | 291 |
| 886 | 3300047323 | Ga0495683_0088482 | Ga0495683_0088482_314_1201 | 291 |
| 887 | 3300047443 | Ga0495687_000677 | Ga0495687_000677_33910_34797 | 291 |
| 888 | 3300047443 | Ga0495687_000710 | Ga0495687_000710_24735_25622 | 291 |
| 889 | 3300047443 | Ga0495687_040707 | Ga0495687_040707_132_1019 | 291 |
| 890 | 3300047443 | Ga0495687_064105 | Ga0495687_064105_42_938 | 291 |
| 891 | 3300047444 | Ga0495675_0002319 | Ga0495675_0002319_8010_8897 | 291 |
| 892 | 3300047445 | Ga0495677_0003824 | Ga0495677_0003824_573_1460 | 291 |
| 893 | 3300047445 | Ga0495677_0004961 | Ga0495677_0004961_3354_4241 | 291 |
| 894 | 3300047445 | Ga0495677_0005822 | Ga0495677_0005822_1838_2725 | 291 |
| 895 | 3300047445 | Ga0495677_0010120 | Ga0495677_0010120_222_1112 | 291 |
| 896 | 3300047445 | Ga0495677_0034066 | Ga0495677_0034066_378_1265 | 291 |
| 897 | 3300047446 | Ga0495679_000820 | Ga0495679_000820_12148_13035 | 291 |
| 898 | 3300047446 | Ga0495679_016535 | Ga0495679_016535_847_1734 | 291 |
| 899 | 3300047446 | Ga0495679_033145 | Ga0495679_033145_561_1448 | 291 |
| 900 | 3300047447 | Ga0495685_000093 | Ga0495685_000093_19682_20569 | 291 |
| 901 | 3300047447 | Ga0495685_034250 | Ga0495685_034250_846_1733 | 291 |
| 902 | 3300047470 | Ga0495681_0001920 | Ga0495681_0001920_5399_6286 | 291 |
| 903 | 3300047470 | Ga0495681_0012266 | Ga0495681_0012266_1113_2000 | 291 |
| 904 | 3300047471 | Ga0495684_0003654 | Ga0495684_0003654_5924_6811 | 291 |
| 905 | 3300047472 | Ga0495686_0000456 | Ga0495686_0000456_48504_49391 | 291 |
| 906 | 3300047472 | Ga0495686_0014904 | Ga0495686_0014904_4266_5153 | 291 |
| 907 | 3300047472 | Ga0495686_0054385 | Ga0495686_0054385_1019_1906 | 291 |
| 908 | 3300047472 | Ga0495686_0065032 | Ga0495686_0065032_469_1356 | 291 |
| 909 | 3300047472 | Ga0495686_0091814 | Ga0495686_0091814_699_1589 | 291 |
| 910 | 3300047673 | Ga0495593_0001495 | Ga0495593_0001495_9404_10291 | 291 |
| 911 | 3300048088 | Ga0495602_0002606 | Ga0495602_0002606_6710_7597 | 291 |
| 912 | 3300048088 | Ga0495602_0025709 | Ga0495602_0025709_1005_1892 | 291 |
| 913 | 3300048088 | Ga0495602_0061370 | Ga0495602_0061370_258_1145 | 291 |
| 914 | 3300048089 | Ga0495614_0000346 | Ga0495614_0000346_10830_11717 | 291 |
| 915 | 3300048903 | Ga0496100_0117164 | Ga0496100_0117164_407_1306 | 291 |
| 916 | 3300048905 | Ga0496102_0003649 | Ga0496102_0003649_2855_3742 | 291 |
| 917 | 3300048905 | Ga0496102_0034973 | Ga0496102_0034973_1780_2667 | 291 |
| 918 | 3300048905 | Ga0496102_0099073 | Ga0496102_0099073_1000_1899 | 291 |
| 919 | 3300048905 | Ga0496102_0162044 | Ga0496102_0162044_666_1565 | 291 |
| 920 | 3300048907 | Ga0496104_0010683 | Ga0496104_0010683_1817_2716 | 291 |
| 921 | 3300048909 | Ga0496106_0001363 | Ga0496106_0001363_15680_16558 | 291 |
| 922 | 3300048909 | Ga0496106_0283210 | Ga0496106_0283210_395_1294 | 291 |
| 923 | 3300048909 | Ga0496106_0300261 | Ga0496106_0300261_104_991 | 291 |
| 924 | 3300048911 | Ga0496108_0149830 | Ga0496108_0149830_132_1226 | 291 |
| 925 | 3300048912 | Ga0496109_0060212 | Ga0496109_0060212_1232_2119 | 291 |
| 926 | 3300048912 | Ga0496109_0629302 | Ga0496109_0629302_40_978 | 291 |
| 927 | 3300048913 | Ga0496110_0051847 | Ga0496110_0051847_1875_2774 | 291 |
| 928 | 3300048913 | Ga0496110_0125930 | Ga0496110_0125930_129_1016 | 291 |
| 929 | 3300048913 | Ga0496110_0436027 | Ga0496110_0436027_85_969 | 291 |
| 930 | 3300048914 | Ga0496111_0192227 | Ga0496111_0192227_450_1334 | 291 |
| 931 | 3300048917 | Ga0496114_0003346 | Ga0496114_0003346_9529_10407 | 291 |
| 932 | 3300048918 | Ga0496115_0030663 | Ga0496115_0030663_2526_3425 | 291 |
| 933 | 3300048919 | Ga0496116_0020463 | Ga0496116_0020463_1117_2007 | 291 |
| 934 | 3300048919 | Ga0496116_0051416 | Ga0496116_0051416_537_1424 | 291 |
| 935 | 3300048919 | Ga0496116_0158076 | Ga0496116_0158076_352_1236 | 291 |
| 936 | 3300048924 | Ga0496121_0005876 | Ga0496121_0005876_540_1424 | 291 |
| 937 | 3300048924 | Ga0496121_0032418 | Ga0496121_0032418_1249_2136 | 291 |
| 938 | 3300048924 | Ga0496121_0053101 | Ga0496121_0053101_526_1413 | 291 |
| 939 | 3300048925 | Ga0496122_0000892 | Ga0496122_0000892_44264_45151 | 291 |
| 940 | 3300048925 | Ga0496122_0128015 | Ga0496122_0128015_324_1217 | 291 |
| 941 | 3300048926 | Ga0496123_0000842 | Ga0496123_0000842_37978_38865 | 291 |
| 942 | 3300048927 | Ga0496124_0034886 | Ga0496124_0034886_438_1322 | 291 |
| 943 | 3300048927 | Ga0496124_0159830 | Ga0496124_0159830_711_1598 | 291 |
| 944 | 3300048927 | Ga0496124_0270532 | Ga0496124_0270532_12_911 | 291 |
| 945 | 3300048928 | Ga0496125_0000625 | Ga0496125_0000625_45978_46862 | 291 |
| 946 | 3300048928 | Ga0496125_0002058 | Ga0496125_0002058_4332_5219 | 291 |
| 947 | 3300048928 | Ga0496125_0002222 | Ga0496125_0002222_8941_9828 | 291 |
| 948 | 3300048928 | Ga0496125_0017830 | Ga0496125_0017830_1931_2815 | 291 |
| 949 | 3300048928 | Ga0496125_0199133 | Ga0496125_0199133_279_1163 | 291 |
| 950 | 3300048929 | Ga0496126_0007582 | Ga0496126_0007582_5082_5969 | 291 |
| 951 | 3300048929 | Ga0496126_0235461 | Ga0496126_0235461_363_1247 | 291 |
| 952 | 3300049459 | Ga0495678_000262 | Ga0495678_000262_30708_31595 | 291 |
| 953 | 3300049459 | Ga0495678_002136 | Ga0495678_002136_8834_9721 | 291 |
| 954 | 3300049460 | Ga0495682_0000121 | Ga0495682_0000121_17969_18856 | 291 |
| 955 | 3300049460 | Ga0495682_0000195 | Ga0495682_0000195_13985_14872 | 291 |
| 956 | 3300049460 | Ga0495682_0016139 | Ga0495682_0016139_1070_1957 | 291 |
| 957 | 3300049568 | Ga0501031_0260778 | Ga0501031_0260778_151_1038 | 291 |
| 958 | 3300049570 | Ga0501033_0013435 | Ga0501033_0013435_1809_2696 | 291 |
| 959 | 3300049571 | Ga0501034_0000067 | Ga0501034_0000067_138283_139164 | 291 |
| 960 | 3300049574 | Ga0501038_0350878 | Ga0501038_0350878_203_1108 | 291 |
| 961 | 3300049575 | Ga0501039_0044986 | Ga0501039_0044986_226_1131 | 291 |
| 962 | 3300049575 | Ga0501039_0117362 | Ga0501039_0117362_545_1429 | 291 |
| 963 | 3300049575 | Ga0501039_0150106 | Ga0501039_0150106_622_1509 | 291 |
| 964 | 3300049580 | Ga0501046_0002701 | Ga0501046_0002701_6154_7050 | 291 |
| 965 | 3300049580 | Ga0501046_0291857 | Ga0501046_0291857_106_990 | 291 |
| 966 | 3300049583 | Ga0501067_0102170 | Ga0501067_0102170_443_1330 | 291 |
| 967 | 3300049742 | Ga0501080_0106730 | Ga0501080_0106730_695_1582 | 291 |
| 968 | 3300049823 | Ga0501044_0233358 | Ga0501044_0233358_90_977 | 291 |
| 969 | 3300049824 | Ga0501045_0051789 | Ga0501045_0051789_1864_2769 | 291 |
| 970 | 3300050493 | nmdc:mga0k408_5452_c1 | nmdc:mga0k408_5452_c1_240_1130 | 291 |
| 971 | 3300050508 | nmdc:mga09592_61376_c1 | nmdc:mga09592_61376_c1_1700_2587 | 291 |
| 972 | 3300050511 | nmdc:mga08y16_8074_c1 | nmdc:mga08y16_8074_c1_1712_2599 | 291 |
| 973 | 3300053077 | Ga0495601_0071566 | Ga0495601_0071566_1194_2081 | 291 |
| 974 | 3300053078 | Ga0495612_0153355 | Ga0495612_0153355_21_914 | 291 |
| 975 | 3300053125 | Ga0500618_002522 | Ga0500618_002522_210_1097 | 291 |
| 976 | 3300053125 | Ga0500618_011796 | Ga0500618_011796_1059_1949 | 291 |
| 977 | 3300053139 | Ga0500568_0000226 | Ga0500568_0000226_40636_41514 | 291 |
| 978 | 3300053140 | Ga0500573_0171058 | Ga0500573_0171058_31_918 | 291 |
| 979 | 3300053154 | Ga0500619_000976 | Ga0500619_000976_1719_2606 | 291 |
| 980 | 3300053160 | Ga0500633_0000417 | Ga0500633_0000417_2609_3487 | 291 |
| 981 | 3300061719 | Ga0466962_0032555 | Ga0466962_0032555_257_1147 | 291 |
| 982 | iso_pu_bacteria | 2643221645 | 2644251954 | 291 |
| 983 | 3300002076 | JGI24749J21850_1000008 | JGI24749J21850_100000814 | 292 |
| 984 | 3300003214 | JGI25165J46597_1000303 | JGI25165J46597_10003037 | 292 |
| 985 | 3300005295 | Ga0065707_10002796 | Ga0065707_100027964 | 292 |
| 986 | 3300005328 | Ga0070676_10178179 | Ga0070676_101781792 | 292 |
| 987 | 3300005329 | Ga0070683_100175519 | Ga0070683_1001755192 | 292 |
| 988 | 3300005331 | Ga0070670_100029086 | Ga0070670_1000290866 | 292 |
| 989 | 3300005337 | Ga0070682_100038780 | Ga0070682_1000387802 | 292 |
| 990 | 3300005339 | Ga0070660_100038243 | Ga0070660_1000382433 | 292 |
| 991 | 3300005355 | Ga0070671_100053527 | Ga0070671_1000535272 | 292 |
| 992 | 3300005367 | Ga0070667_100000667 | Ga0070667_10000066736 | 292 |
| 993 | 3300005435 | Ga0070714_100001359 | Ga0070714_1000013596 | 292 |
| 994 | 3300005471 | Ga0070698_100006326 | Ga0070698_1000063266 | 292 |
| 995 | 3300005530 | Ga0070679_100461289 | Ga0070679_1004612892 | 292 |
| 996 | 3300005535 | Ga0070684_100112266 | Ga0070684_1001122662 | 292 |
| 997 | 3300005544 | Ga0070686_100390150 | Ga0070686_1003901501 | 292 |
| 998 | 3300005614 | Ga0068856_100562433 | Ga0068856_1005624331 | 292 |
| 999 | 3300005617 | Ga0068859_100005767 | Ga0068859_1000057674 | 292 |
| 1000 | 3300005719 | Ga0068861_100000333 | Ga0068861_1000003336 | 292 |
| 1001 | 3300005841 | Ga0068863_100004683 | Ga0068863_1000046832 | 292 |
| 1002 | 3300005844 | Ga0068862_100001937 | Ga0068862_1000019378 | 292 |
| 1003 | 3300005844 | Ga0068862_100002549 | Ga0068862_1000025493 | 292 |
| 1004 | 3300005937 | Ga0081455_10151879 | Ga0081455_101518792 | 292 |
| 1005 | 3300005981 | Ga0081538_10005813 | Ga0081538_100058135 | 292 |
| 1006 | 3300005985 | Ga0081539_10045778 | Ga0081539_100457782 | 292 |
| 1007 | 3300006038 | Ga0075365_10023666 | Ga0075365_100236663 | 292 |
| 1008 | 3300006852 | Ga0075433_10039571 | Ga0075433_100395713 | 292 |
| 1009 | 3300006871 | Ga0075434_100003847 | Ga0075434_1000038473 | 292 |
| 1010 | 3300006931 | Ga0097620_100005767 | Ga0097620_1000057674 | 292 |
| 1011 | 3300007076 | Ga0075435_100019943 | Ga0075435_1000199432 | 292 |
| 1012 | 3300009094 | Ga0111539_10005209 | Ga0111539_1000520914 | 292 |
| 1013 | 3300009098 | Ga0105245_10003250 | Ga0105245_100032506 | 292 |
| 1014 | 3300009101 | Ga0105247_10005532 | Ga0105247_100055324 | 292 |
| 1015 | 3300009177 | Ga0105248_10000157 | Ga0105248_1000015726 | 292 |
| 1016 | 3300009177 | Ga0105248_10026867 | Ga0105248_100268672 | 292 |
| 1017 | 3300009551 | Ga0105238_10074378 | Ga0105238_100743783 | 292 |
| 1018 | 3300009553 | Ga0105249_10006020 | Ga0105249_100060202 | 292 |
| 1019 | 3300013105 | Ga0157369_10332877 | Ga0157369_103328772 | 292 |
| 1020 | 3300013308 | Ga0157375_10058395 | Ga0157375_100583954 | 292 |
| 1021 | 3300013308 | Ga0157375_10911938 | Ga0157375_109119381 | 292 |
| 1022 | 3300014968 | Ga0157379_10368054 | Ga0157379_103680542 | 292 |
| 1023 | 3300017792 | Ga0163161_10106602 | Ga0163161_101066022 | 292 |
| 1024 | 3300020070 | Ga0206356_10261284 | Ga0206356_102612843 | 292 |
| 1025 | 3300020081 | Ga0206354_10465120 | Ga0206354_104651201 | 292 |
| 1026 | 3300020082 | Ga0206353_10609877 | Ga0206353_106098772 | 292 |
| 1027 | 3300025261 | Ga0209233_1000188 | Ga0209233_100018885 | 292 |
| 1028 | 3300025297 | Ga0209758_1004936 | Ga0209758_100493613 | 292 |
| 1029 | 3300025900 | Ga0207710_10003876 | Ga0207710_100038764 | 292 |
| 1030 | 3300025901 | Ga0207688_10086663 | Ga0207688_100866632 | 292 |
| 1031 | 3300025904 | Ga0207647_10098630 | Ga0207647_100986301 | 292 |
| 1032 | 3300025908 | Ga0207643_10191094 | Ga0207643_101910942 | 292 |
| 1033 | 3300025909 | Ga0207705_10005885 | Ga0207705_100058858 | 292 |
| 1034 | 3300025919 | Ga0207657_10007073 | Ga0207657_100070733 | 292 |
| 1035 | 3300025925 | Ga0207650_10022230 | Ga0207650_100222305 | 292 |
| 1036 | 3300025929 | Ga0207664_10001050 | Ga0207664_1000105016 | 292 |
| 1037 | 3300025931 | Ga0207644_10053125 | Ga0207644_100531252 | 292 |
| 1038 | 3300025932 | Ga0207690_10096390 | Ga0207690_100963902 | 292 |
| 1039 | 3300025941 | Ga0207711_10004750 | Ga0207711_100047504 | 292 |
| 1040 | 3300025941 | Ga0207711_10136841 | Ga0207711_101368413 | 292 |
| 1041 | 3300025949 | Ga0207667_10059595 | Ga0207667_100595953 | 292 |
| 1042 | 3300025961 | Ga0207712_10000454 | Ga0207712_1000045416 | 292 |
| 1043 | 3300025972 | Ga0207668_10003087 | Ga0207668_100030874 | 292 |
| 1044 | 3300026067 | Ga0207678_10484957 | Ga0207678_104849571 | 292 |
| 1045 | 3300026088 | Ga0207641_10003687 | Ga0207641_100036872 | 292 |
| 1046 | 3300026118 | Ga0207675_100001097 | Ga0207675_1000010976 | 292 |
| 1047 | 3300027907 | Ga0207428_10006458 | Ga0207428_100064588 | 292 |
| 1048 | 3300028379 | Ga0268266_10323767 | Ga0268266_103237671 | 292 |
| 1049 | 3300028380 | Ga0268265_10000535 | Ga0268265_1000053518 | 292 |
| 1050 | 3300028380 | Ga0268265_10060805 | Ga0268265_100608051 | 292 |
| 1051 | 3300028381 | Ga0268264_10006442 | Ga0268264_100064424 | 292 |
| 1052 | 3300031456 | Ga0307513_10082402 | Ga0307513_100824022 | 292 |
| 1053 | 3300031728 | Ga0316578_10016320 | Ga0316578_100163202 | 292 |
| 1054 | 3300031730 | Ga0307516_10001334 | Ga0307516_1000133410 | 292 |
| 1055 | 3300031852 | Ga0307410_10035744 | Ga0307410_100357442 | 292 |
| 1056 | 3300045976 | Ga0466967_0064330 | Ga0466967_0064330_604_1500 | 292 |
| 1057 | 3300045976 | Ga0466967_0314178 | Ga0466967_0314178_281_1171 | 292 |
| 1058 | 3300047323 | Ga0495683_0000720 | Ga0495683_0000720_18761_19645 | 292 |
| 1059 | 3300048905 | Ga0496102_0047852 | Ga0496102_0047852_951_1862 | 292 |
| 1060 | 3300048911 | Ga0496108_0441164 | Ga0496108_0441164_187_1080 | 292 |
| 1061 | 3300048913 | Ga0496110_0023439 | Ga0496110_0023439_4349_5239 | 292 |
| 1062 | 3300048914 | Ga0496111_0122001 | Ga0496111_0122001_18_911 | 292 |
| 1063 | 3300048917 | Ga0496114_0001116 | Ga0496114_0001116_15085_15993 | 292 |
| 1064 | 3300048920 | Ga0496117_0009659 | Ga0496117_0009659_3502_4392 | 292 |
| 1065 | 3300048921 | Ga0496118_0000253 | Ga0496118_0000253_78159_79049 | 292 |
| 1066 | 3300048924 | Ga0496121_0055122 | Ga0496121_0055122_1266_2156 | 292 |
| 1067 | 3300048925 | Ga0496122_0003634 | Ga0496122_0003634_8775_9662 | 292 |
| 1068 | 3300048926 | Ga0496123_0016384 | Ga0496123_0016384_4648_5535 | 292 |
| 1069 | 3300048927 | Ga0496124_0028640 | Ga0496124_0028640_248_1135 | 292 |
| 1070 | 3300049568 | Ga0501031_0008977 | Ga0501031_0008977_1270_2154 | 292 |
| 1071 | 3300049568 | Ga0501031_0070194 | Ga0501031_0070194_270_1166 | 292 |
| 1072 | 3300049569 | Ga0501032_0032528 | Ga0501032_0032528_497_1381 | 292 |
| 1073 | 3300049569 | Ga0501032_0065600 | Ga0501032_0065600_727_1611 | 292 |
| 1074 | 3300049570 | Ga0501033_0002920 | Ga0501033_0002920_4122_5006 | 292 |
| 1075 | 3300049570 | Ga0501033_0123952 | Ga0501033_0123952_629_1516 | 292 |
| 1076 | 3300049571 | Ga0501034_0008308 | Ga0501034_0008308_7596_8480 | 292 |
| 1077 | 3300049572 | Ga0501036_0042011 | Ga0501036_0042011_1047_1931 | 292 |
| 1078 | 3300049572 | Ga0501036_0053394 | Ga0501036_0053394_1754_2638 | 292 |
| 1079 | 3300049573 | Ga0501037_0062584 | Ga0501037_0062584_1142_2026 | 292 |
| 1080 | 3300049573 | Ga0501037_0203139 | Ga0501037_0203139_468_1355 | 292 |
| 1081 | 3300049573 | Ga0501037_0266015 | Ga0501037_0266015_262_1146 | 292 |
| 1082 | 3300049574 | Ga0501038_0085052 | Ga0501038_0085052_1270_2154 | 292 |
| 1083 | 3300049574 | Ga0501038_0102723 | Ga0501038_0102723_1386_2270 | 292 |
| 1084 | 3300049574 | Ga0501038_0423320 | Ga0501038_0423320_52_948 | 292 |
| 1085 | 3300049575 | Ga0501039_0017758 | Ga0501039_0017758_4067_4951 | 292 |
| 1086 | 3300049575 | Ga0501039_0074276 | Ga0501039_0074276_750_1646 | 292 |
| 1087 | 3300049575 | Ga0501039_0173563 | Ga0501039_0173563_110_994 | 292 |
| 1088 | 3300049577 | Ga0501041_0084519 | Ga0501041_0084519_1042_1938 | 292 |
| 1089 | 3300049578 | Ga0501042_0003635 | Ga0501042_0003635_8356_9240 | 292 |
| 1090 | 3300049578 | Ga0501042_0020439 | Ga0501042_0020439_1631_2515 | 292 |
| 1091 | 3300049579 | Ga0501043_0004152 | Ga0501043_0004152_6825_7709 | 292 |
| 1092 | 3300049579 | Ga0501043_0064219 | Ga0501043_0064219_785_1669 | 292 |
| 1093 | 3300049579 | Ga0501043_0075340 | Ga0501043_0075340_1270_2154 | 292 |
| 1094 | 3300049580 | Ga0501046_0013687 | Ga0501046_0013687_4349_5233 | 292 |
| 1095 | 3300049580 | Ga0501046_0069716 | Ga0501046_0069716_1141_2037 | 292 |
| 1096 | 3300049581 | Ga0501047_0029100 | Ga0501047_0029100_2009_2893 | 292 |
| 1097 | 3300049581 | Ga0501047_0036793 | Ga0501047_0036793_1066_1950 | 292 |
| 1098 | 3300049582 | Ga0501048_0001718 | Ga0501048_0001718_10555_11439 | 292 |
| 1099 | 3300049582 | Ga0501048_0048570 | Ga0501048_0048570_1066_1950 | 292 |
| 1100 | 3300049583 | Ga0501067_0043773 | Ga0501067_0043773_912_1796 | 292 |
| 1101 | 3300049584 | Ga0501068_0016294 | Ga0501068_0016294_2569_3453 | 292 |
| 1102 | 3300049586 | Ga0501070_0013356 | Ga0501070_0013356_4350_5234 | 292 |
| 1103 | 3300049586 | Ga0501070_0070810 | Ga0501070_0070810_943_1830 | 292 |
| 1104 | 3300049587 | Ga0501071_0026754 | Ga0501071_0026754_496_1380 | 292 |
| 1105 | 3300049589 | Ga0501073_0032666 | Ga0501073_0032666_2136_3020 | 292 |
| 1106 | 3300049589 | Ga0501073_0061722 | Ga0501073_0061722_1021_1905 | 292 |
| 1107 | 3300049591 | Ga0501075_0028419 | Ga0501075_0028419_976_1872 | 292 |
| 1108 | 3300049592 | Ga0501076_0018511 | Ga0501076_0018511_17_913 | 292 |
| 1109 | 3300049741 | Ga0501079_0027185 | Ga0501079_0027185_1047_1943 | 292 |
| 1110 | 3300049742 | Ga0501080_0005558 | Ga0501080_0005558_939_1823 | 292 |
| 1111 | 3300049743 | Ga0501081_0025842 | Ga0501081_0025842_420_1316 | 292 |
| 1112 | 3300049822 | Ga0501035_0004909 | Ga0501035_0004909_2509_3393 | 292 |
| 1113 | 3300049822 | Ga0501035_0051270 | Ga0501035_0051270_2530_3417 | 292 |
| 1114 | 3300049822 | Ga0501035_0088823 | Ga0501035_0088823_365_1249 | 292 |
| 1115 | 3300049822 | Ga0501035_0240368 | Ga0501035_0240368_427_1314 | 292 |
| 1116 | 3300049823 | Ga0501044_0011708 | Ga0501044_0011708_4122_5006 | 292 |
| 1117 | 3300049823 | Ga0501044_0186860 | Ga0501044_0186860_86_973 | 292 |
| 1118 | 3300049823 | Ga0501044_0325647 | Ga0501044_0325647_319_1200 | 292 |
| 1119 | 3300049824 | Ga0501045_0001489 | Ga0501045_0001489_10378_11262 | 292 |
| 1120 | 3300049824 | Ga0501045_0446303 | Ga0501045_0446303_35_943 | 292 |
| 1121 | 3300050492 | nmdc:mga0yw44_10037_c1 | nmdc:mga0yw44_10037_c1_3529_4416 | 292 |
| 1122 | 3300050492 | nmdc:mga0yw44_63346_c1 | nmdc:mga0yw44_63346_c1_1246_2133 | 292 |
| 1123 | 3300050507 | nmdc:mga05p37_57829_c1 | nmdc:mga05p37_57829_c1_3860_4756 | 292 |
| 1124 | 3300050511 | nmdc:mga08y16_15476_c1 | nmdc:mga08y16_15476_c1_2979_3887 | 292 |
| 1125 | 3300050512 | nmdc:mga0n895_102351_c1 | nmdc:mga0n895_102351_c1_1390_2298 | 292 |
| 1126 | 3300050513 | nmdc:mga0rr50_7235_c1 | nmdc:mga0rr50_7235_c1_3484_4392 | 292 |
| 1127 | 3300050515 | nmdc:mga0a205_5917_c1 | nmdc:mga0a205_5917_c1_3069_3977 | 292 |
| 1128 | 3300053136 | Ga0500559_0000006 | Ga0500559_0000006_48268_49179 | 292 |
| 1129 | 3300054114 | Ga0501084_0043075 | Ga0501084_0043075_1006_1902 | 292 |
| 1130 | 3300060353 | Ga0501082_0056858 | Ga0501082_0056858_1049_1945 | 292 |
| 1131 | 3300061734 | Ga0530510_0033778 | Ga0530510_0033778_2652_3548 | 292 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
PF14833
NAD_binding_11
NAD-binding of NADP-dependent 3-hydroxyisobutyrate dehydrogenase
215
335
0.97
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1yb4-assembly1.cif.gz_A | crystal structure of the tartronic semialdehyde reductase from salmonella typhimurium lt2 | 0.9573 | 1 | 292 |
| 1yb4-assembly1.cif.gz_A | crystal structure of the tartronic semialdehyde reductase from salmonella typhimurium lt2 | 0.9542 | 1 | 292 |
| 3pdu-assembly1.cif.gz_D | crystal structure of gamma-hydroxybutyrate dehydrogenase from geobacter sulfurreducens in complex with nadp+ | 0.9539 | 2 | 284 |
| 4dll-assembly1.cif.gz_A | error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) | 0.9527 | 2 | 286 |
| 3cky-assembly2.cif.gz_D | structural and kinetic properties of a beta-hydroxyacid dehydrogenase involved in nicotinate fermentation | 0.9498 | 57 | 291 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P77161_159_292_1.10.1040.10 | Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 | 0.9959 | 164 | 291 | 1.10.1040.10 |
| 1yb4B02 | Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 | 0.9915 | 164 | 292 | 1.10.1040.10 |
| af_A0A1D6NCX6_182_311_1.10.1040.10 | Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 | 0.9861 | 164 | 291 | 1.10.1040.10 |
| af_Q4DFE2_166_292_1.10.1040.10 | Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 | 0.9839 | 163 | 289 | 1.10.1040.10 |
| 1yb4B01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9809 | 3 | 159 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A352S2Q2-F1-model_v4 | 2-hydroxy-3-oxopropionate reductase | 0.9988 | 69 | 158 |
GO:0050661
|
| AF-U4V4P8-F1-model_v4 | 2-hydroxy-3-oxopropionate reductase | 0.996 | 93 | 291 |
GO:0016054
GO:0050661 GO:0051287 |
| AF-A0A4V1U4W9-F1-model_v4 | deleted | 0.9943 | 193 | 291 |
|
| AF-A0A529ZR79-F1-model_v4 | 2-hydroxy-3-oxopropionate reductase | 0.9939 | 134 | 291 |
GO:0016054
GO:0050661 GO:0051287 |
| AF-A0A529UY52-F1-model_v4 | deleted | 0.9926 | 2 | 276 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar