F490542
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1130 | 585 | 968 | 159 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|8004695233|8004697816 |
| Length | 194 |
| Sequence | SSLAELGAATGNTNTQPAAPVHVQKLDKSGRAYATGKRKNAIARVWVKPGSGKIIVNDKEFATYFARPVLQMILNQPIIASNRAGQYDIVATVVGGGLSGQAGAVRHGISKALTYYEPTLRAVLKKGGFLTRDSRVVERKKYGKAKARRSFQFPSAKHFAASDNRKGRLRAAFLFAARQPPHPRLRRDLPIEGR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2503198000 | Mesorhizobium opportunistum WSM2075 | Isolate | Nodule |
| 2 | 2508501123 | Mesorhizobium sp. WSM3626 | Isolate | Nodule |
| 3 | 2508501127 | Mesorhizobium sp. WSM2561 | Isolate | Nodule |
| 4 | 2509276018 | Mesorhizobium ciceri CMG6 | Isolate | Nodule |
| 5 | 2509276022 | Mesorhizobium australicum WSM2073 | Isolate | Nodule |
| 6 | 2510065059 | Mesorhizobium ciceri WSM4083 | Isolate | Nodule |
| 7 | 2512875016 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 8 | 2512875024 | Mesorhizobium loti R88b | Isolate | Nodule |
| 9 | 2513237164 | Mesorhizobium loti CJ3sym | Isolate | Nodule |
| 10 | 2513237305 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 11 | 2588253730 | Mesorhizobium huakuii 7653R | Isolate | Rhizosphere |
| 12 | 2597489875 | Mesorhizobium ciceri ca181 | Isolate | Unclassified |
| 13 | 2643221580 | Devosia sp. Root635 | Isolate | Unclassified |
| 14 | 2643221591 | Devosia sp. Root685 | Isolate | Unclassified |
| 15 | 2643221595 | Mesorhizobium sp. Root695 | Isolate | Unclassified |
| 16 | 2643221627 | Mesorhizobium sp. Root102 | Isolate | Unclassified |
| 17 | 2643221674 | Devosia sp. Root436 | Isolate | Unclassified |
| 18 | 2687453392 | Mesorhizobium ciceri biserrulae WSM1284 | Isolate | Unclassified |
| 19 | 2721755686 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 20 | 2756170246 | Mesorhizobium loti DSM 2626 | Isolate | Nodule |
| 21 | 2757320392 | Phyllobacterium leguminum ORS 1419 | Isolate | Nodule |
| 22 | 2791355123 | Mesorhizobium sophorae ICMP 19535 | Isolate | Unclassified |
| 23 | 2837678835 | Jiella endophytica CBS5Q-3 | Isolate | Unclassified |
| 24 | 2841734538 | Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 | Isolate | Nodule |
| 25 | 2844002411 | Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 | Isolate | Nodule |
| 26 | 2844009547 | Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 | Isolate | Nodule |
| 27 | 2856320880 | Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 | Isolate | Nodule |
| 28 | 2856328259 | Mesorhizobium sp. Primo-B | Isolate | Nodule |
| 29 | 2856334872 | Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 | Isolate | Nodule |
| 30 | 2856342000 | Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 | Isolate | Nodule |
| 31 | 2857367948 | Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 | Isolate | Nodule |
| 32 | 2869162929 | Mesorhizobium sanjuanii BSA136 | Isolate | Nodule |
| 33 | 2869169390 | Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 | Isolate | Nodule |
| 34 | 2869234852 | Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 | Isolate | Nodule |
| 35 | 2869249662 | Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 | Isolate | Nodule |
| 36 | 2869256925 | Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 | Isolate | Nodule |
| 37 | 2869264136 | Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 | Isolate | Nodule |
| 38 | 2869271264 | Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 | Isolate | Nodule |
| 39 | 2869278585 | Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 | Isolate | Nodule |
| 40 | 2871451962 | Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 | Isolate | Nodule |
| 41 | 2871459585 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 | Isolate | Nodule |
| 42 | 2871466892 | Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 | Isolate | Nodule |
| 43 | 2871474448 | Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 | Isolate | Nodule |
| 44 | 2871481445 | Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 | Isolate | Nodule |
| 45 | 2874109183 | Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 | Isolate | Nodule |
| 46 | 2874116593 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 | Isolate | Nodule |
| 47 | 2874131515 | Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 | Isolate | Nodule |
| 48 | 2874139085 | Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 | Isolate | Nodule |
| 49 | 2874162495 | Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 | Isolate | Nodule |
| 50 | 2874168670 | Mesorhizobium kowhaii Ach-343 | Isolate | Nodule |
| 51 | 2876363079 | Mesorhizobium loti R7ANS::ICEMlSym2042 | Isolate | Nodule |
| 52 | 2876399893 | Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 | Isolate | Nodule |
| 53 | 2876406927 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 | Isolate | Nodule |
| 54 | 2876420981 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 | Isolate | Nodule |
| 55 | 2878730984 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 | Isolate | Nodule |
| 56 | 2878738818 | Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 | Isolate | Nodule |
| 57 | 2878774303 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 | Isolate | Nodule |
| 58 | 2878781027 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 | Isolate | Nodule |
| 59 | 2878788777 | Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 | Isolate | Nodule |
| 60 | 2882632389 | Mesorhizobium waimense ICMP19557 | Isolate | Unclassified |
| 61 | 2885312484 | Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 | Isolate | Nodule |
| 62 | 2888337043 | Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 | Isolate | Nodule |
| 63 | 2888343758 | Mesorhizobium sp. AA22 | Isolate | Unclassified |
| 64 | 2903448605 | Mesorhizobium japonicum Opo-235 | Isolate | Nodule |
| 65 | 2903513507 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 | Isolate | Nodule |
| 66 | 2903521522 | Mesorhizobium loti R7ANS::ICEMlSym2014 | Isolate | Nodule |
| 67 | 2903528002 | Mesorhizobium loti R7ANS::ICEMlSym2037 | Isolate | Nodule |
| 68 | 2906363423 | Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 | Isolate | Nodule |
| 69 | 2906370794 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 | Isolate | Nodule |
| 70 | 2906378014 | Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 | Isolate | Nodule |
| 71 | 2906393657 | Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 | Isolate | Nodule |
| 72 | 2906401398 | Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 | Isolate | Nodule |
| 73 | 2906408224 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 | Isolate | Nodule |
| 74 | 2906427513 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 | Isolate | Nodule |
| 75 | 2919679072 | Pseudotabrizicola sp. 4114 | Isolate | Unclassified |
| 76 | 2922151315 | Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 | Isolate | Nodule |
| 77 | 2922172374 | Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 | Isolate | Nodule |
| 78 | 2922178524 | Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 | Isolate | Nodule |
| 79 | 2924710171 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 | Isolate | Nodule |
| 80 | 2924733363 | Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 | Isolate | Nodule |
| 81 | 2924741084 | Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 | Isolate | Nodule |
| 82 | 2924748358 | Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 | Isolate | Nodule |
| 83 | 2924754689 | Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 | Isolate | Nodule |
| 84 | 2924762789 | Mesorhizobium sp. WSM4303 | Isolate | Unclassified |
| 85 | 2924776078 | Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 | Isolate | Nodule |
| 86 | 2932401849 | Devosia sp. 2618 | Isolate | Rhizosphere |
| 87 | 2937822353 | Mesorhizobium neociceri CCANP35 | Isolate | Nodule |
| 88 | 2937836603 | Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 | Isolate | Nodule |
| 89 | 2937848649 | Mesorhizobium sp. WSM4310 | Isolate | Unclassified |
| 90 | 2937861824 | Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 | Isolate | Nodule |
| 91 | 2937877337 | Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 | Isolate | Nodule |
| 92 | 2937972304 | Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 | Isolate | Nodule |
| 93 | 2937980651 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 | Isolate | Nodule |
| 94 | 2958034702 | Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 | Isolate | Nodule |
| 95 | 2958041894 | Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 | Isolate | Nodule |
| 96 | 2958064165 | Mesorhizobium sp. SARCC-RB16n | Isolate | Unclassified |
| 97 | 2958071322 | Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 | Isolate | Nodule |
| 98 | 2958084443 | Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 | Isolate | Nodule |
| 99 | 2958108152 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 | Isolate | Nodule |
| 100 | 2958122699 | Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 | Isolate | Nodule |
| 101 | 2958137437 | Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 | Isolate | Nodule |
| 102 | 2958158011 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 | Isolate | Nodule |
| 103 | 2961183825 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 | Isolate | Nodule |
| 104 | 2963644680 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 105 | 2965025482 | Mesorhizobium sp. Primo-A | Isolate | Nodule |
| 106 | 2965032056 | Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 | Isolate | Nodule |
| 107 | 2965040258 | Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 | Isolate | Nodule |
| 108 | 2965047637 | Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 | Isolate | Nodule |
| 109 | 2965089291 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 | Isolate | Nodule |
| 110 | 2965102966 | Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 | Isolate | Nodule |
| 111 | 2968016561 | Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 | Isolate | Nodule |
| 112 | 2968083720 | Mesorhizobium erdmanii Opo-242 | Isolate | Unclassified |
| 113 | 2970469710 | Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 | Isolate | Nodule |
| 114 | 2970489779 | Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 | Isolate | Nodule |
| 115 | 2970510686 | Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 | Isolate | Nodule |
| 116 | 2970524798 | Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 | Isolate | Nodule |
| 117 | 2970532167 | Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 | Isolate | Nodule |
| 118 | 2970540015 | Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 | Isolate | Nodule |
| 119 | 2970547951 | Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 | Isolate | Nodule |
| 120 | 2970593180 | Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 | Isolate | Nodule |
| 121 | 2970619444 | Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 | Isolate | Nodule |
| 122 | 2970627176 | Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 | Isolate | Nodule |
| 123 | 2977851361 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 | Isolate | Nodule |
| 124 | 2977872689 | Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 | Isolate | Nodule |
| 125 | 2977898635 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 | Isolate | Nodule |
| 126 | 2977907340 | Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 | Isolate | Nodule |
| 127 | 2977915119 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 | Isolate | Nodule |
| 128 | 2977922695 | Mesorhizobium sp. WSM4305 | Isolate | Unclassified |
| 129 | 2977935797 | Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 | Isolate | Nodule |
| 130 | 2977950692 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 | Isolate | Nodule |
| 131 | 2977957713 | Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 | Isolate | Nodule |
| 132 | 2977986579 | Mesorhizobium intechi BD68 | Isolate | Unclassified |
| 133 | 2979764755 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 | Isolate | Nodule |
| 134 | 2979772303 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 | Isolate | Nodule |
| 135 | 2979793036 | Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 | Isolate | Nodule |
| 136 | 2987645492 | Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 | Isolate | Nodule |
| 137 | 2987666974 | Mesorhizobium sp. WSM4306 | Isolate | Unclassified |
| 138 | 2987673487 | Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 | Isolate | Nodule |
| 139 | 2996348954 | Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 | Isolate | Nodule |
| 140 | 2996386984 | Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 | Isolate | Nodule |
| 141 | 3000135777 | Unclassified bacterium M00.F.Ca.ET.205.01.1.1 | Isolate | Unclassified |
| 142 | 3004167301 | Mesorhizobium loti 582 | Isolate | Unclassified |
| 143 | 3004195979 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 | Isolate | Nodule |
| 144 | 3004211236 | Mesorhizobium sp. WSM4307 | Isolate | Unclassified |
| 145 | 3004218560 | Mesorhizobium sp. WSM4315 | Isolate | Unclassified |
| 146 | 3004239961 | Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 | Isolate | Nodule |
| 147 | 3004248173 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 | Isolate | Nodule |
| 148 | 3004268573 | Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 | Isolate | Nodule |
| 149 | 3004275668 | Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 | Isolate | Nodule |
| 150 | 3004289098 | Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 | Isolate | Nodule |
| 151 | 3004334049 | Mesorhizobium huakuii 583 | Isolate | Unclassified |
| 152 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 153 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 154 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 155 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 156 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 157 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 158 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 159 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 160 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 161 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 162 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 163 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 164 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 165 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 166 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 167 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 168 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 169 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 170 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 171 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 172 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 173 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 174 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 175 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 176 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 177 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 178 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 179 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 180 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 181 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 182 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 183 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 184 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 185 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 186 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 187 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 188 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 189 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 190 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 191 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 192 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 193 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 194 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 195 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 196 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 197 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 198 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 199 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 200 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 201 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 202 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 203 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 204 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 205 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 206 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 207 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 208 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 209 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 210 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 211 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 212 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 213 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 214 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 215 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 216 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 217 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 218 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 219 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 220 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 221 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 222 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 223 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 224 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 225 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 226 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 227 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 228 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 229 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 230 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 231 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 232 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 233 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 234 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 235 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 236 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 237 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 238 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 239 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 240 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 241 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 242 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 243 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 244 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 245 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 246 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 247 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 248 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 249 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 250 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 251 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 252 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 253 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 254 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 255 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 257 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 258 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 259 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 260 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 261 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 262 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 263 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 264 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 265 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 267 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 268 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 270 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 271 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 272 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 273 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 274 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 275 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 276 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 277 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 278 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 279 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 280 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 281 | 3300012481 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 | Metagenome | Rhizosphere |
| 282 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 283 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 284 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 285 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 286 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 287 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 288 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 289 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 290 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 291 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 292 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 293 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 294 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 295 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 296 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 297 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 298 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 299 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 300 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 301 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 302 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 303 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 304 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 305 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 306 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 307 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 308 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 309 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 310 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 311 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 312 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 313 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 314 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 315 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 316 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 317 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 318 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 319 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 320 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 321 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 322 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 323 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 324 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 325 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 326 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 327 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 328 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 329 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 330 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 331 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 332 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 333 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 334 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 335 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 336 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 337 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 338 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 339 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 340 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 341 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 342 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 343 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 344 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 345 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 346 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 347 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 348 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 349 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 350 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 351 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 352 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 353 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 354 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 355 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 356 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 357 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 358 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 359 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 360 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 361 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 362 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 363 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 364 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 365 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 366 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 367 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 368 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 369 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 370 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 371 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 372 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 373 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 374 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 375 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 376 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 377 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 378 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 379 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 380 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 381 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 382 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 383 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 384 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 385 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 386 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 387 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 388 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 389 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 390 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 391 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 392 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 393 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 394 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 395 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 396 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 397 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 398 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 399 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 400 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 401 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 402 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 403 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 404 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 405 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 406 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 407 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 408 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 409 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 410 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 411 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 412 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 413 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 414 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 415 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 416 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 417 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 418 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 419 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 420 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 421 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 422 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 423 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 424 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 425 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 426 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 427 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 428 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 429 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 430 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 431 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 440 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 441 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 442 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 443 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 444 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 445 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 446 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 447 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 448 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 449 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 450 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 451 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 452 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 453 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 454 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 455 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 456 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 457 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 458 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 459 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 460 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 461 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 462 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 463 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 464 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 465 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 466 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 467 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 468 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 469 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 470 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 471 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 472 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 473 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 474 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 475 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 476 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 477 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 478 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 479 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 480 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 481 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 482 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 483 | 3300049535 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 484 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 485 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 486 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 487 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 488 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 489 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 490 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 491 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 492 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 493 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 494 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 495 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 496 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 497 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 498 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 499 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 500 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 501 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 502 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 503 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 504 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 505 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 506 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 507 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 508 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 509 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 510 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 511 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 512 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 513 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 514 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 515 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 516 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 517 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 518 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 519 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 520 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 521 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 522 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 523 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 524 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 525 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 526 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 527 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 528 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 529 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 530 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 531 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 532 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 533 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 534 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 535 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 536 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 537 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 538 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 539 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 540 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 541 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 542 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 543 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 544 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 545 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 546 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 547 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 548 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 549 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 550 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 551 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 552 | 3300059507 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 553 | 3300059509 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 554 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 555 | 3300059514 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 106R_AW_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 556 | 3300059604 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 557 | 3300059608 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 166R_SD_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 558 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 559 | 3300059625 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 560 | 3300059627 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 561 | 3300059631 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 168R_SD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 562 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 563 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 564 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 565 | 3300059646 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 566 | 3300059649 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 567 | 3300059650 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 69R_SD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 568 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 569 | 3300059655 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 570 | 3300059658 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 571 | 3300059660 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 572 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 573 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 574 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 575 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 576 | 637000159 | Mesorhizobium japonicum MAFF 303099 | Isolate | Unclassified |
| 577 | 649633066 | Mesorhizobium ciceri bv. biserrulae WSM1271 | Isolate | Nodule |
| 578 | 8004300914 | Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 | Isolate | Nodule |
| 579 | 8004312739 | Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 | Isolate | Nodule |
| 580 | 8004361976 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 | Isolate | Nodule |
| 581 | 8004395343 | Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 | Isolate | Nodule |
| 582 | 8004633249 | Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 | Isolate | Nodule |
| 583 | 8004695233 | Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 | Isolate | Nodule |
| 584 | 8004727605 | Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 | Isolate | Nodule |
| 585 | 8055617313 | Mesorhizobium onobrychidis OM4 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 82.3 |
| Metatranscriptomes | 3.36 |
| Isolates | 14.34 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.46 |
| Nodule | 11.86 |
| Rhizoplane | 4.34 |
| Rhizosphere | 71.33 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.02 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | ARSoilOldRDRAFT_c005725 | 3300000044 | Bacteria | 1047 |
| 2 | JGI24737J22298_10005558 | 3300001990 | Bacteria | 4347 |
| 3 | JGI24735J21928_10022099 | 3300002067 | Bacteria | 1939 |
| 4 | JGI24738J21930_10016180 | 3300002075 | Bacteria | 1578 |
| 5 | JGI24749J21850_1005277 | 3300002076 | Bacteria | 1813 |
| 6 | JGI24744J21845_10011991 | 3300002077 | Bacteria | 1764 |
| 7 | JGI24034J26672_10009889 | 3300002239 | Bacteria | 1412 |
| 8 | JGI25155J39150_1000019 | 3300002704 | Bacteria | 155636 |
| 9 | JGI25156J39149_1000020 | 3300002705 | Bacteria | 156628 |
| 10 | JGI25162J39368_1000891 | 3300002737 | Bacteria | 19509 |
| 11 | JGI25162J39368_1001396 | 3300002737 | Bacteria | 13209 |
| 12 | JGI25154J39366_1000102 | 3300002738 | Bacteria | 76188 |
| 13 | JGI25154J39366_1021810 | 3300002738 | Bacteria | 604 |
| 14 | JGI25157J39369_1000070 | 3300002741 | Bacteria | 92090 |
| 15 | JGI25157J39369_1000222 | 3300002741 | Bacteria | 45959 |
| 16 | JGI25159J45721_1000291 | 3300002987 | Bacteria | 23530 |
| 17 | JGI25406J46586_10006588 | 3300003203 | Bacteria | 5338 |
| 18 | JGI25165J46597_1000406 | 3300003214 | Bacteria | 45616 |
| 19 | JGI25165J46597_1000936 | 3300003214 | Bacteria | 20055 |
| 20 | JGI25165J46597_1001407 | 3300003214 | Bacteria | 13052 |
| 21 | JGI25160J50197_1000015 | 3300003354 | Bacteria | 250902 |
| 22 | JGI25161J50226_1000005 | 3300003374 | Bacteria | 292548 |
| 23 | Ga0055542_1001452 | 3300003762 | Bacteria | 11747 |
| 24 | Ga0055529_1001896 | 3300003763 | Bacteria | 4828 |
| 25 | Ga0055526_1006554 | 3300003771 | Bacteria | 6285 |
| 26 | Ga0055524_1031931 | 3300003775 | Bacteria | 1505 |
| 27 | Ga0055528_1000373 | 3300003790 | Bacteria | 36405 |
| 28 | Ga0055543_1000012 | 3300004625 | Bacteria | 186581 |
| 29 | Ga0065165_1000125 | 3300005262 | Bacteria | 130283 |
| 30 | Ga0070658_10249243 | 3300005327 | Bacteria | 1506 |
| 31 | Ga0070658_10634615 | 3300005327 | Bacteria | 927 |
| 32 | Ga0070676_10002448 | 3300005328 | Bacteria | 9510 |
| 33 | Ga0070676_10092242 | 3300005328 | Bacteria | 1857 |
| 34 | Ga0070683_100016688 | 3300005329 | Bacteria | 6479 |
| 35 | Ga0070690_100000438 | 3300005330 | Bacteria | 21088 |
| 36 | Ga0070670_100001713 | 3300005331 | Bacteria | 17855 |
| 37 | Ga0068869_100126011 | 3300005334 | Bacteria | 1964 |
| 38 | Ga0068869_100223463 | 3300005334 | Bacteria | 1493 |
| 39 | Ga0070666_10179946 | 3300005335 | Bacteria | 1483 |
| 40 | Ga0070666_10393504 | 3300005335 | Bacteria | 996 |
| 41 | Ga0070680_100002037 | 3300005336 | Bacteria | 14916 |
| 42 | Ga0070682_100000387 | 3300005337 | Bacteria | 29331 |
| 43 | Ga0068868_100007844 | 3300005338 | Bacteria | 7619 |
| 44 | Ga0070660_100142969 | 3300005339 | Bacteria | 1921 |
| 45 | Ga0070660_101039030 | 3300005339 | Bacteria | 693 |
| 46 | Ga0070689_100003836 | 3300005340 | Bacteria | 10071 |
| 47 | Ga0070691_10006920 | 3300005341 | Bacteria | 5190 |
| 48 | Ga0070687_100002483 | 3300005343 | Bacteria | 6938 |
| 49 | Ga0070687_100649982 | 3300005343 | Bacteria | 731 |
| 50 | Ga0070661_100000689 | 3300005344 | Bacteria | 24833 |
| 51 | Ga0070692_10001470 | 3300005345 | Bacteria | 8580 |
| 52 | Ga0070668_100049327 | 3300005347 | Bacteria | 3239 |
| 53 | Ga0070668_100382511 | 3300005347 | Bacteria | 1198 |
| 54 | Ga0070668_100420178 | 3300005347 | Bacteria | 1145 |
| 55 | Ga0070669_100009784 | 3300005353 | Bacteria | 6830 |
| 56 | Ga0070669_100164725 | 3300005353 | Bacteria | 1725 |
| 57 | Ga0070669_101232317 | 3300005353 | Bacteria | 647 |
| 58 | Ga0070675_100002266 | 3300005354 | Bacteria | 14278 |
| 59 | Ga0070671_100010188 | 3300005355 | Bacteria | 7543 |
| 60 | Ga0070671_100530455 | 3300005355 | Bacteria | 1014 |
| 61 | Ga0070674_100001353 | 3300005356 | Bacteria | 12917 |
| 62 | Ga0070674_100057288 | 3300005356 | Bacteria | 2705 |
| 63 | Ga0070674_100151689 | 3300005356 | Bacteria | 1749 |
| 64 | Ga0070673_100003636 | 3300005364 | Bacteria | 9649 |
| 65 | Ga0070688_100001165 | 3300005365 | Bacteria | 13089 |
| 66 | Ga0070688_100414168 | 3300005365 | Bacteria | 1000 |
| 67 | Ga0070659_100018173 | 3300005366 | Bacteria | 5304 |
| 68 | Ga0070667_100000657 | 3300005367 | Bacteria | 33552 |
| 69 | Ga0070709_10003372 | 3300005434 | Bacteria | 8586 |
| 70 | Ga0070714_100002744 | 3300005435 | Bacteria | 12973 |
| 71 | Ga0070713_100123044 | 3300005436 | Bacteria | 2278 |
| 72 | Ga0070710_10006897 | 3300005437 | Bacteria | 5481 |
| 73 | Ga0070701_10001555 | 3300005438 | Bacteria | 8515 |
| 74 | Ga0070711_100001294 | 3300005439 | Bacteria | 13600 |
| 75 | Ga0070711_100118311 | 3300005439 | Bacteria | 1955 |
| 76 | Ga0070705_100002287 | 3300005440 | Bacteria | 9684 |
| 77 | Ga0070700_100001827 | 3300005441 | Bacteria | 10741 |
| 78 | Ga0070700_100102923 | 3300005441 | Bacteria | 1885 |
| 79 | Ga0070694_100003648 | 3300005444 | Bacteria | 9186 |
| 80 | Ga0070694_100747058 | 3300005444 | Bacteria | 799 |
| 81 | Ga0070663_100003294 | 3300005455 | Bacteria | 9298 |
| 82 | Ga0070663_100109857 | 3300005455 | Bacteria | 2071 |
| 83 | Ga0070663_100133864 | 3300005455 | Bacteria | 1885 |
| 84 | Ga0070678_100030424 | 3300005456 | Bacteria | 3711 |
| 85 | Ga0070678_100347995 | 3300005456 | Bacteria | 1273 |
| 86 | Ga0070662_100001709 | 3300005457 | Bacteria | 13506 |
| 87 | Ga0070681_10092614 | 3300005458 | Bacteria | 2971 |
| 88 | Ga0068867_100043855 | 3300005459 | Bacteria | 3275 |
| 89 | Ga0068867_100318457 | 3300005459 | Bacteria | 1288 |
| 90 | Ga0070685_10050558 | 3300005466 | Bacteria | 2401 |
| 91 | Ga0070685_10404867 | 3300005466 | Bacteria | 946 |
| 92 | Ga0070699_100298224 | 3300005518 | Bacteria | 1446 |
| 93 | Ga0070679_100036086 | 3300005530 | Bacteria | 4906 |
| 94 | Ga0070679_100965837 | 3300005530 | Bacteria | 796 |
| 95 | Ga0070684_100001739 | 3300005535 | Bacteria | 15842 |
| 96 | Ga0070697_100006693 | 3300005536 | Bacteria | 8942 |
| 97 | Ga0070697_100147000 | 3300005536 | Bacteria | 1985 |
| 98 | Ga0068853_100006306 | 3300005539 | Bacteria | 9411 |
| 99 | Ga0068853_100181870 | 3300005539 | Bacteria | 1907 |
| 100 | Ga0068853_100819416 | 3300005539 | Bacteria | 892 |
| 101 | Ga0070672_100002994 | 3300005543 | Bacteria | 10885 |
| 102 | Ga0070695_100013728 | 3300005545 | Bacteria | 4869 |
| 103 | Ga0070696_100046152 | 3300005546 | Bacteria | 3020 |
| 104 | Ga0070696_100086366 | 3300005546 | Bacteria | 2227 |
| 105 | Ga0070693_100000155 | 3300005547 | Bacteria | 31196 |
| 106 | Ga0070693_100565888 | 3300005547 | Bacteria | 816 |
| 107 | Ga0070665_100016148 | 3300005548 | Bacteria | 7494 |
| 108 | Ga0070665_100025519 | 3300005548 | Bacteria | 5952 |
| 109 | Ga0070665_100342207 | 3300005548 | Bacteria | 1501 |
| 110 | Ga0070665_100698278 | 3300005548 | Bacteria | 1028 |
| 111 | Ga0070704_100000688 | 3300005549 | Bacteria | 16380 |
| 112 | Ga0068855_100015557 | 3300005563 | Bacteria | 9158 |
| 113 | Ga0068855_100197519 | 3300005563 | Bacteria | 2266 |
| 114 | Ga0068855_100308043 | 3300005563 | Bacteria | 1753 |
| 115 | Ga0070664_100000700 | 3300005564 | Bacteria | 25609 |
| 116 | Ga0070664_100339790 | 3300005564 | Bacteria | 1364 |
| 117 | Ga0068857_100010258 | 3300005577 | Bacteria | 8143 |
| 118 | Ga0068857_100094136 | 3300005577 | Bacteria | 2682 |
| 119 | Ga0068854_100002106 | 3300005578 | Bacteria | 12194 |
| 120 | Ga0068854_100033016 | 3300005578 | Bacteria | 3606 |
| 121 | Ga0068854_100063366 | 3300005578 | Bacteria | 2683 |
| 122 | Ga0068854_100600566 | 3300005578 | Bacteria | 939 |
| 123 | Ga0068856_100006075 | 3300005614 | Bacteria | 11863 |
| 124 | Ga0068856_100197529 | 3300005614 | Bacteria | 2026 |
| 125 | Ga0068856_100278424 | 3300005614 | Bacteria | 1690 |
| 126 | Ga0068856_100313025 | 3300005614 | Bacteria | 1588 |
| 127 | Ga0070702_100001131 | 3300005615 | Bacteria | 10709 |
| 128 | Ga0068852_100059841 | 3300005616 | Bacteria | 3305 |
| 129 | Ga0068852_100073723 | 3300005616 | Bacteria | 3004 |
| 130 | Ga0068852_100299278 | 3300005616 | Bacteria | 1557 |
| 131 | Ga0068859_100014016 | 3300005617 | Bacteria | 8038 |
| 132 | Ga0068859_100293109 | 3300005617 | Bacteria | 1720 |
| 133 | Ga0068864_100005168 | 3300005618 | Bacteria | 10686 |
| 134 | Ga0068866_10004281 | 3300005718 | Bacteria | 5863 |
| 135 | Ga0068861_100027027 | 3300005719 | Bacteria | 4176 |
| 136 | Ga0068851_10018385 | 3300005834 | Bacteria | 3366 |
| 137 | Ga0068863_100003165 | 3300005841 | Bacteria | 16266 |
| 138 | Ga0068858_100018872 | 3300005842 | Bacteria | 6452 |
| 139 | Ga0068858_100750720 | 3300005842 | Bacteria | 951 |
| 140 | Ga0068860_100393567 | 3300005843 | Bacteria | 1370 |
| 141 | Ga0068860_100611569 | 3300005843 | Bacteria | 1096 |
| 142 | Ga0068862_100006195 | 3300005844 | Bacteria | 9962 |
| 143 | Ga0068862_100139304 | 3300005844 | Bacteria | 2152 |
| 144 | Ga0068862_100393109 | 3300005844 | Bacteria | 1296 |
| 145 | Ga0081455_10034109 | 3300005937 | Bacteria | 4564 |
| 146 | Ga0081455_10123925 | 3300005937 | Bacteria | 2032 |
| 147 | Ga0081540_1044223 | 3300005983 | Bacteria | 2275 |
| 148 | Ga0081539_10001367 | 3300005985 | Bacteria | 42276 |
| 149 | Ga0075365_10039274 | 3300006038 | Bacteria | 3081 |
| 150 | Ga0075365_10083984 | 3300006038 | Bacteria | 2160 |
| 151 | Ga0075365_10100973 | 3300006038 | Bacteria | 1975 |
| 152 | Ga0075365_10132744 | 3300006038 | Bacteria | 1724 |
| 153 | Ga0075365_11055805 | 3300006038 | Bacteria | 572 |
| 154 | Ga0075368_10142677 | 3300006042 | Bacteria | 998 |
| 155 | Ga0075364_10454062 | 3300006051 | Bacteria | 875 |
| 156 | Ga0070715_10000219 | 3300006163 | Bacteria | 13624 |
| 157 | Ga0070715_10034114 | 3300006163 | Bacteria | 2084 |
| 158 | Ga0070716_100001864 | 3300006173 | Bacteria | 9566 |
| 159 | Ga0070712_100000382 | 3300006175 | Bacteria | 25268 |
| 160 | Ga0070712_100084684 | 3300006175 | Bacteria | 2306 |
| 161 | Ga0070712_100085109 | 3300006175 | Bacteria | 2301 |
| 162 | Ga0075362_10018661 | 3300006177 | Bacteria | 2873 |
| 163 | Ga0075362_10398728 | 3300006177 | Bacteria | 694 |
| 164 | Ga0075367_10240549 | 3300006178 | Bacteria | 1134 |
| 165 | Ga0075367_10281594 | 3300006178 | Bacteria | 1045 |
| 166 | Ga0075369_10005107 | 3300006186 | Bacteria | 4887 |
| 167 | Ga0097621_100105246 | 3300006237 | Bacteria | 2379 |
| 168 | Ga0075370_10011760 | 3300006353 | Bacteria | 4606 |
| 169 | Ga0075370_10066061 | 3300006353 | Bacteria | 2063 |
| 170 | Ga0075370_10093917 | 3300006353 | Bacteria | 1732 |
| 171 | Ga0075370_10439119 | 3300006353 | Bacteria | 785 |
| 172 | Ga0068871_101157423 | 3300006358 | Bacteria | 725 |
| 173 | Ga0075428_100005355 | 3300006844 | Bacteria | 14267 |
| 174 | Ga0075430_100196244 | 3300006846 | Bacteria | 1677 |
| 175 | Ga0075431_100033350 | 3300006847 | Bacteria | 5307 |
| 176 | Ga0075431_100314580 | 3300006847 | Bacteria | 1580 |
| 177 | Ga0075431_100362288 | 3300006847 | Bacteria | 1456 |
| 178 | Ga0075433_10079314 | 3300006852 | Bacteria | 2893 |
| 179 | Ga0075434_100467491 | 3300006871 | Bacteria | 1282 |
| 180 | Ga0068865_100002456 | 3300006881 | Bacteria | 10972 |
| 181 | Ga0068865_100364346 | 3300006881 | Bacteria | 1175 |
| 182 | Ga0075436_100011825 | 3300006914 | Bacteria | 5989 |
| 183 | Ga0097620_100014016 | 3300006931 | Bacteria | 8038 |
| 184 | Ga0097620_100293110 | 3300006931 | Bacteria | 1720 |
| 185 | Ga0075435_101058994 | 3300007076 | Bacteria | 709 |
| 186 | Ga0105240_10000032 | 3300009093 | Bacteria | 283907 |
| 187 | Ga0105240_10019313 | 3300009093 | Bacteria | 9108 |
| 188 | Ga0105240_10028048 | 3300009093 | Bacteria | 7362 |
| 189 | Ga0111539_10126417 | 3300009094 | Bacteria | 2995 |
| 190 | Ga0105245_10000729 | 3300009098 | Bacteria | 29644 |
| 191 | Ga0105247_10000684 | 3300009101 | Bacteria | 26726 |
| 192 | Ga0105247_10021678 | 3300009101 | Bacteria | 3866 |
| 193 | Ga0105247_10031011 | 3300009101 | Bacteria | 3243 |
| 194 | Ga0105247_10222109 | 3300009101 | Bacteria | 1279 |
| 195 | Ga0105247_10562908 | 3300009101 | Bacteria | 840 |
| 196 | Ga0105247_10896740 | 3300009101 | Bacteria | 684 |
| 197 | Ga0114129_10055348 | 3300009147 | Bacteria | 5560 |
| 198 | Ga0105243_10004066 | 3300009148 | Bacteria | 11653 |
| 199 | Ga0105243_10506141 | 3300009148 | Bacteria | 1145 |
| 200 | Ga0105241_10014990 | 3300009174 | Bacteria | 5677 |
| 201 | Ga0105241_10106876 | 3300009174 | Bacteria | 2234 |
| 202 | Ga0105242_10000957 | 3300009176 | Bacteria | 22525 |
| 203 | Ga0105242_10457859 | 3300009176 | Bacteria | 1204 |
| 204 | Ga0105248_10000854 | 3300009177 | Bacteria | 34286 |
| 205 | Ga0105248_10630755 | 3300009177 | Bacteria | 1209 |
| 206 | Ga0105248_10634130 | 3300009177 | Bacteria | 1206 |
| 207 | Ga0105237_10000974 | 3300009545 | Bacteria | 38484 |
| 208 | Ga0105237_10001638 | 3300009545 | Bacteria | 29067 |
| 209 | Ga0105237_10013741 | 3300009545 | Bacteria | 8479 |
| 210 | Ga0105237_10252405 | 3300009545 | Bacteria | 1766 |
| 211 | Ga0105237_10748799 | 3300009545 | Bacteria | 983 |
| 212 | Ga0105237_10829593 | 3300009545 | Bacteria | 931 |
| 213 | Ga0105237_11633432 | 3300009545 | Bacteria | 651 |
| 214 | Ga0105237_11834838 | 3300009545 | Bacteria | 614 |
| 215 | Ga0105237_12335032 | 3300009545 | Bacteria | 545 |
| 216 | Ga0105238_10005006 | 3300009551 | Bacteria | 13097 |
| 217 | Ga0105238_10077095 | 3300009551 | Bacteria | 3325 |
| 218 | Ga0105238_10284449 | 3300009551 | Bacteria | 1635 |
| 219 | Ga0105249_10000677 | 3300009553 | Bacteria | 30987 |
| 220 | Ga0105249_11005983 | 3300009553 | Bacteria | 902 |
| 221 | Ga0105239_10002346 | 3300010375 | Bacteria | 24125 |
| 222 | Ga0105239_10004667 | 3300010375 | Bacteria | 16290 |
| 223 | Ga0105239_10062542 | 3300010375 | Bacteria | 4085 |
| 224 | Ga0105239_10196398 | 3300010375 | Bacteria | 2260 |
| 225 | Ga0105239_11161568 | 3300010375 | Bacteria | 889 |
| 226 | Ga0105239_11579987 | 3300010375 | Bacteria | 758 |
| 227 | Ga0105246_10001644 | 3300011119 | Bacteria | 13331 |
| 228 | Ga0105246_10286685 | 3300011119 | Bacteria | 1323 |
| 229 | Ga0105246_11003071 | 3300011119 | Bacteria | 756 |
| 230 | Ga0157320_1011286 | 3300012481 | Bacteria | 702 |
| 231 | Ga0157373_10044718 | 3300013100 | Bacteria | 3161 |
| 232 | Ga0157373_11273311 | 3300013100 | Bacteria | 556 |
| 233 | Ga0157371_10024551 | 3300013102 | Bacteria | 4399 |
| 234 | Ga0157371_10094952 | 3300013102 | Bacteria | 2113 |
| 235 | Ga0157371_10795335 | 3300013102 | Bacteria | 712 |
| 236 | Ga0157370_10233692 | 3300013104 | Bacteria | 1701 |
| 237 | Ga0157369_10003955 | 3300013105 | Bacteria | 17571 |
| 238 | Ga0157369_10371389 | 3300013105 | Bacteria | 1485 |
| 239 | Ga0157369_10811085 | 3300013105 | Bacteria | 961 |
| 240 | Ga0157374_10029930 | 3300013296 | Bacteria | 4939 |
| 241 | Ga0157374_10268397 | 3300013296 | Bacteria | 1682 |
| 242 | Ga0157374_10694658 | 3300013296 | Bacteria | 1030 |
| 243 | Ga0157378_10006232 | 3300013297 | Bacteria | 10444 |
| 244 | Ga0157378_10144337 | 3300013297 | Bacteria | 2213 |
| 245 | Ga0163162_10005337 | 3300013306 | Bacteria | 12402 |
| 246 | Ga0163162_10592948 | 3300013306 | Bacteria | 1235 |
| 247 | Ga0157372_10010270 | 3300013307 | Bacteria | 9945 |
| 248 | Ga0157372_11577648 | 3300013307 | Bacteria | 756 |
| 249 | Ga0157375_10000519 | 3300013308 | Bacteria | 34613 |
| 250 | Ga0157375_10020497 | 3300013308 | Bacteria | 6041 |
| 251 | Ga0157375_10715486 | 3300013308 | Bacteria | 1154 |
| 252 | Ga0163163_10026341 | 3300014325 | Bacteria | 5557 |
| 253 | Ga0163163_10204954 | 3300014325 | Bacteria | 2020 |
| 254 | Ga0163163_11158065 | 3300014325 | Bacteria | 836 |
| 255 | Ga0157380_10839542 | 3300014326 | Bacteria | 939 |
| 256 | Ga0157377_10000936 | 3300014745 | Bacteria | 12226 |
| 257 | Ga0157377_10167232 | 3300014745 | Bacteria | 1372 |
| 258 | Ga0157379_10006266 | 3300014968 | Bacteria | 10244 |
| 259 | Ga0157379_10647372 | 3300014968 | Bacteria | 989 |
| 260 | Ga0157379_10823159 | 3300014968 | Bacteria | 877 |
| 261 | Ga0157376_10049794 | 3300014969 | Bacteria | 3472 |
| 262 | Ga0157376_10701575 | 3300014969 | Bacteria | 1017 |
| 263 | Ga0163161_10010203 | 3300017792 | Bacteria | 6503 |
| 264 | Ga0206353_10411292 | 3300020082 | Bacteria | 686 |
| 265 | Ga0209760_101970 | 3300025207 | Bacteria | 2002 |
| 266 | Ga0207427_106742 | 3300025231 | Bacteria | 1419 |
| 267 | Ga0209437_100033 | 3300025233 | Bacteria | 512520 |
| 268 | Ga0209437_100075 | 3300025233 | Bacteria | 297202 |
| 269 | Ga0209646_1017848 | 3300025246 | Bacteria | 1043 |
| 270 | Ga0209026_1000002 | 3300025250 | Bacteria | 1136158 |
| 271 | Ga0209148_1000038 | 3300025254 | Bacteria | 493744 |
| 272 | Ga0209148_1015732 | 3300025254 | Bacteria | 1315 |
| 273 | Ga0209233_1000064 | 3300025261 | Bacteria | 392156 |
| 274 | Ga0209233_1000223 | 3300025261 | Bacteria | 103765 |
| 275 | Ga0209233_1000342 | 3300025261 | Bacteria | 45690 |
| 276 | Ga0209455_1000678 | 3300025272 | Bacteria | 20245 |
| 277 | Ga0209130_1000018 | 3300025284 | Bacteria | 388301 |
| 278 | Ga0209025_1158021 | 3300025294 | Bacteria | 616 |
| 279 | Ga0207426_1000044 | 3300025302 | Bacteria | 428043 |
| 280 | Ga0207656_10146839 | 3300025321 | Bacteria | 1114 |
| 281 | Ga0207656_10176604 | 3300025321 | Bacteria | 1023 |
| 282 | Ga0207656_10324107 | 3300025321 | Bacteria | 766 |
| 283 | Ga0207713_1112417 | 3300025735 | Bacteria | 924 |
| 284 | Ga0207692_10010556 | 3300025898 | Bacteria | 3898 |
| 285 | Ga0207642_10031245 | 3300025899 | Bacteria | 2228 |
| 286 | Ga0207642_10057741 | 3300025899 | Bacteria | 1787 |
| 287 | Ga0207710_10006312 | 3300025900 | Bacteria | 5069 |
| 288 | Ga0207710_10039726 | 3300025900 | Bacteria | 2083 |
| 289 | Ga0207710_10195311 | 3300025900 | Bacteria | 998 |
| 290 | Ga0207688_10288285 | 3300025901 | Bacteria | 1002 |
| 291 | Ga0207688_10451551 | 3300025901 | Bacteria | 801 |
| 292 | Ga0207680_10005465 | 3300025903 | Bacteria | 6071 |
| 293 | Ga0207647_10004790 | 3300025904 | Bacteria | 10017 |
| 294 | Ga0207699_10002555 | 3300025906 | Bacteria | 8584 |
| 295 | Ga0207645_10001793 | 3300025907 | Bacteria | 17329 |
| 296 | Ga0207645_10207260 | 3300025907 | Bacteria | 1291 |
| 297 | Ga0207654_10030519 | 3300025911 | Bacteria | 2960 |
| 298 | Ga0207695_10132304 | 3300025913 | Bacteria | 2451 |
| 299 | Ga0207695_10302141 | 3300025913 | Bacteria | 1492 |
| 300 | Ga0207695_10481911 | 3300025913 | Bacteria | 1123 |
| 301 | Ga0207671_10013562 | 3300025914 | Bacteria | 6489 |
| 302 | Ga0207671_10014363 | 3300025914 | Bacteria | 6264 |
| 303 | Ga0207671_10334236 | 3300025914 | Bacteria | 1200 |
| 304 | Ga0207671_11433902 | 3300025914 | Bacteria | 534 |
| 305 | Ga0207693_10000998 | 3300025915 | Bacteria | 25439 |
| 306 | Ga0207693_10039260 | 3300025915 | Bacteria | 3727 |
| 307 | Ga0207693_10237126 | 3300025915 | Bacteria | 1432 |
| 308 | Ga0207663_10000700 | 3300025916 | Bacteria | 14899 |
| 309 | Ga0207660_10175643 | 3300025917 | Bacteria | 1661 |
| 310 | Ga0207662_10003502 | 3300025918 | Bacteria | 8088 |
| 311 | Ga0207662_10364326 | 3300025918 | Bacteria | 973 |
| 312 | Ga0207657_10000516 | 3300025919 | Bacteria | 40906 |
| 313 | Ga0207657_10056812 | 3300025919 | Bacteria | 3375 |
| 314 | Ga0207649_10053908 | 3300025920 | Bacteria | 2501 |
| 315 | Ga0207649_11063081 | 3300025920 | Bacteria | 638 |
| 316 | Ga0207652_10101949 | 3300025921 | Bacteria | 2536 |
| 317 | Ga0207681_10010302 | 3300025923 | Bacteria | 5718 |
| 318 | Ga0207681_10759971 | 3300025923 | Bacteria | 808 |
| 319 | Ga0207694_10021980 | 3300025924 | Bacteria | 4837 |
| 320 | Ga0207694_10099971 | 3300025924 | Bacteria | 2298 |
| 321 | Ga0207650_10009305 | 3300025925 | Bacteria | 6715 |
| 322 | Ga0207650_10643881 | 3300025925 | Bacteria | 893 |
| 323 | Ga0207659_10054489 | 3300025926 | Bacteria | 2856 |
| 324 | Ga0207687_10029096 | 3300025927 | Bacteria | 3715 |
| 325 | Ga0207687_10181792 | 3300025927 | Bacteria | 1630 |
| 326 | Ga0207687_11460165 | 3300025927 | Bacteria | 588 |
| 327 | Ga0207700_10128274 | 3300025928 | Bacteria | 2067 |
| 328 | Ga0207664_10034941 | 3300025929 | Bacteria | 3875 |
| 329 | Ga0207644_10080977 | 3300025931 | Bacteria | 2398 |
| 330 | Ga0207644_10676690 | 3300025931 | Bacteria | 860 |
| 331 | Ga0207690_10006538 | 3300025932 | Bacteria | 6911 |
| 332 | Ga0207690_10572885 | 3300025932 | Bacteria | 919 |
| 333 | Ga0207706_10002149 | 3300025933 | Bacteria | 19260 |
| 334 | Ga0207706_10122622 | 3300025933 | Bacteria | 2286 |
| 335 | Ga0207686_10004658 | 3300025934 | Bacteria | 7350 |
| 336 | Ga0207686_10139007 | 3300025934 | Bacteria | 1676 |
| 337 | Ga0207709_10007883 | 3300025935 | Bacteria | 5902 |
| 338 | Ga0207709_10257072 | 3300025935 | Bacteria | 1279 |
| 339 | Ga0207670_10002633 | 3300025936 | Bacteria | 9441 |
| 340 | Ga0207670_10204030 | 3300025936 | Bacteria | 1504 |
| 341 | Ga0207670_10561878 | 3300025936 | Bacteria | 933 |
| 342 | Ga0207669_10033036 | 3300025937 | Bacteria | 2914 |
| 343 | Ga0207704_10022172 | 3300025938 | Bacteria | 3397 |
| 344 | Ga0207704_10233267 | 3300025938 | Bacteria | 1370 |
| 345 | Ga0207704_10566787 | 3300025938 | Bacteria | 925 |
| 346 | Ga0207704_10718630 | 3300025938 | Bacteria | 828 |
| 347 | Ga0207665_10000327 | 3300025939 | Bacteria | 32933 |
| 348 | Ga0207691_10022661 | 3300025940 | Bacteria | 5922 |
| 349 | Ga0207711_10012217 | 3300025941 | Bacteria | 7141 |
| 350 | Ga0207711_10217681 | 3300025941 | Bacteria | 1746 |
| 351 | Ga0207689_10010763 | 3300025942 | Bacteria | 7871 |
| 352 | Ga0207689_10028650 | 3300025942 | Bacteria | 4657 |
| 353 | Ga0207689_10259346 | 3300025942 | Bacteria | 1438 |
| 354 | Ga0207679_10012249 | 3300025945 | Bacteria | 5587 |
| 355 | Ga0207679_11595088 | 3300025945 | Bacteria | 598 |
| 356 | Ga0207667_10313344 | 3300025949 | Bacteria | 1603 |
| 357 | Ga0207651_10005081 | 3300025960 | Bacteria | 6715 |
| 358 | Ga0207712_10003778 | 3300025961 | Bacteria | 9559 |
| 359 | Ga0207712_10499863 | 3300025961 | Bacteria | 1039 |
| 360 | Ga0207712_10679428 | 3300025961 | Bacteria | 897 |
| 361 | Ga0207668_10013555 | 3300025972 | Bacteria | 5024 |
| 362 | Ga0207668_10037560 | 3300025972 | Bacteria | 3243 |
| 363 | Ga0207668_10475056 | 3300025972 | Bacteria | 1071 |
| 364 | Ga0207640_10004632 | 3300025981 | Bacteria | 7463 |
| 365 | Ga0207640_10206654 | 3300025981 | Bacteria | 1492 |
| 366 | Ga0207640_11077326 | 3300025981 | Bacteria | 710 |
| 367 | Ga0207658_10019418 | 3300025986 | Bacteria | 4700 |
| 368 | Ga0207658_10123987 | 3300025986 | Bacteria | 2065 |
| 369 | Ga0207658_11265695 | 3300025986 | Bacteria | 674 |
| 370 | Ga0207677_10329516 | 3300026023 | Bacteria | 1272 |
| 371 | Ga0207703_10232561 | 3300026035 | Bacteria | 1653 |
| 372 | Ga0207703_10276225 | 3300026035 | Bacteria | 1524 |
| 373 | Ga0207639_10005217 | 3300026041 | Bacteria | 8765 |
| 374 | Ga0207639_10351053 | 3300026041 | Bacteria | 1317 |
| 375 | Ga0207678_10018943 | 3300026067 | Bacteria | 6049 |
| 376 | Ga0207678_10054088 | 3300026067 | Bacteria | 3458 |
| 377 | Ga0207678_10260940 | 3300026067 | Bacteria | 1485 |
| 378 | Ga0207708_10001427 | 3300026075 | Bacteria | 17929 |
| 379 | Ga0207702_10100362 | 3300026078 | Bacteria | 2553 |
| 380 | Ga0207641_10005966 | 3300026088 | Bacteria | 10324 |
| 381 | Ga0207648_10155357 | 3300026089 | Bacteria | 2020 |
| 382 | Ga0207648_10324822 | 3300026089 | Bacteria | 1383 |
| 383 | Ga0207676_10261959 | 3300026095 | Bacteria | 1561 |
| 384 | Ga0207676_10594010 | 3300026095 | Bacteria | 1062 |
| 385 | Ga0207674_10010004 | 3300026116 | Bacteria | 10796 |
| 386 | Ga0207674_10151163 | 3300026116 | Bacteria | 2279 |
| 387 | Ga0207674_10741057 | 3300026116 | Bacteria | 948 |
| 388 | Ga0207675_100001630 | 3300026118 | Bacteria | 22489 |
| 389 | Ga0207675_100705098 | 3300026118 | Bacteria | 1018 |
| 390 | Ga0207675_100812105 | 3300026118 | Bacteria | 949 |
| 391 | Ga0207675_101486986 | 3300026118 | Bacteria | 698 |
| 392 | Ga0207683_10000351 | 3300026121 | Bacteria | 42117 |
| 393 | Ga0207683_10051672 | 3300026121 | Bacteria | 3601 |
| 394 | Ga0207683_10416356 | 3300026121 | Bacteria | 1237 |
| 395 | Ga0207698_10009311 | 3300026142 | Bacteria | 6255 |
| 396 | Ga0207698_10169072 | 3300026142 | Bacteria | 1923 |
| 397 | Ga0207698_10756852 | 3300026142 | Bacteria | 971 |
| 398 | Ga0209371_1000420 | 3300027312 | Bacteria | 43659 |
| 399 | Ga0209998_10010305 | 3300027717 | Bacteria | 1935 |
| 400 | Ga0209974_10125394 | 3300027876 | Bacteria | 913 |
| 401 | Ga0207428_10074831 | 3300027907 | Bacteria | 2655 |
| 402 | Ga0207428_10400855 | 3300027907 | Bacteria | 1004 |
| 403 | Ga0268266_10012855 | 3300028379 | Bacteria | 7229 |
| 404 | Ga0268266_10049403 | 3300028379 | Bacteria | 3608 |
| 405 | Ga0268266_11296981 | 3300028379 | Bacteria | 703 |
| 406 | Ga0268265_10081063 | 3300028380 | Bacteria | 2561 |
| 407 | Ga0268265_10657217 | 3300028380 | Bacteria | 1008 |
| 408 | Ga0268265_11273182 | 3300028380 | Bacteria | 735 |
| 409 | Ga0268265_11641989 | 3300028380 | Bacteria | 648 |
| 410 | Ga0268264_10023577 | 3300028381 | Bacteria | 5018 |
| 411 | Ga0268264_10119195 | 3300028381 | Bacteria | 2323 |
| 412 | Ga0307515_10000070 | 3300028794 | Bacteria | 239322 |
| 413 | Ga0307515_10029068 | 3300028794 | Bacteria | 9363 |
| 414 | Ga0268256_1008134 | 3300030500 | Bacteria | 3636 |
| 415 | Ga0307513_10000404 | 3300031456 | Bacteria | 62692 |
| 416 | Ga0307513_10268229 | 3300031456 | Bacteria | 1492 |
| 417 | Ga0307513_10862518 | 3300031456 | Bacteria | 612 |
| 418 | Ga0307509_10480994 | 3300031507 | Bacteria | 930 |
| 419 | Ga0316576_10403100 | 3300031727 | Bacteria | 1013 |
| 420 | Ga0316578_10031254 | 3300031728 | Bacteria | 3033 |
| 421 | Ga0307516_10271711 | 3300031730 | Bacteria | 1381 |
| 422 | Ga0307405_10094861 | 3300031731 | Bacteria | 1985 |
| 423 | Ga0307405_10730644 | 3300031731 | Bacteria | 823 |
| 424 | Ga0307413_10114710 | 3300031824 | Bacteria | 1811 |
| 425 | Ga0307410_10363408 | 3300031852 | Bacteria | 1160 |
| 426 | Ga0307410_11082769 | 3300031852 | Bacteria | 694 |
| 427 | Ga0307407_10423169 | 3300031903 | Bacteria | 960 |
| 428 | Ga0307412_10868996 | 3300031911 | Bacteria | 788 |
| 429 | Ga0307409_100692992 | 3300031995 | Bacteria | 1017 |
| 430 | Ga0307409_100804274 | 3300031995 | Bacteria | 948 |
| 431 | Ga0307409_101550784 | 3300031995 | Bacteria | 690 |
| 432 | Ga0307414_10338865 | 3300032004 | Bacteria | 1286 |
| 433 | Ga0307414_10357464 | 3300032004 | Bacteria | 1255 |
| 434 | Ga0307411_12065141 | 3300032005 | Bacteria | 533 |
| 435 | Ga0307415_101603182 | 3300032126 | Bacteria | 625 |
| 436 | Ga0316583_10134141 | 3300032133 | Bacteria | 863 |
| 437 | Ga0316593_10134284 | 3300032168 | Bacteria | 894 |
| 438 | Ga0316596_1225925 | 3300033541 | Bacteria | 524 |
| 439 | Ga0373929_0037569 | 3300035085 | Bacteria | 1062 |
| 440 | Ga0373929_0038548 | 3300035085 | Bacteria | 1052 |
| 441 | Ga0373952_0122069 | 3300035092 | Bacteria | 708 |
| 442 | Ga0373939_0044716 | 3300035114 | Bacteria | 1349 |
| 443 | Ga0373960_0100017 | 3300035121 | Bacteria | 939 |
| 444 | Ga0373961_0006145 | 3300035241 | Bacteria | 2886 |
| 445 | Ga0373961_0028107 | 3300035241 | Bacteria | 1549 |
| 446 | Ga0373962_0015643 | 3300035242 | Bacteria | 1947 |
| 447 | Ga0373962_0108164 | 3300035242 | Bacteria | 874 |
| 448 | Ga0373931_0496595 | 3300035691 | Bacteria | 786 |
| 449 | Ga0373937_0047757 | 3300036401 | Bacteria | 3918 |
| 450 | Ga0316582_0191482 | 3300036647 | Bacteria | 1393 |
| 451 | Ga0395899_0000059 | 3300037312 | Bacteria | 213004 |
| 452 | Ga0395899_0286650 | 3300037312 | Bacteria | 1118 |
| 453 | Ga0395899_0295164 | 3300037312 | Bacteria | 1099 |
| 454 | Ga0395900_0000017 | 3300037418 | Bacteria | 369602 |
| 455 | Ga0395900_0158818 | 3300037418 | Bacteria | 2307 |
| 456 | Ga0395900_0160673 | 3300037418 | Bacteria | 2292 |
| 457 | Ga0395900_0351566 | 3300037418 | Bacteria | 1447 |
| 458 | Ga0395900_0354772 | 3300037418 | Bacteria | 1439 |
| 459 | Ga0395900_0569673 | 3300037418 | Bacteria | 1075 |
| 460 | Ga0395900_0618074 | 3300037418 | Bacteria | 1022 |
| 461 | Ga0395900_1010126 | 3300037418 | Bacteria | 751 |
| 462 | Ga0395898_0000030 | 3300037466 | Bacteria | 369577 |
| 463 | Ga0395898_0056315 | 3300037466 | Bacteria | 3832 |
| 464 | Ga0395898_0087353 | 3300037466 | Bacteria | 3004 |
| 465 | Ga0395898_0092373 | 3300037466 | Bacteria | 2911 |
| 466 | Ga0395898_0118563 | 3300037466 | Bacteria | 2535 |
| 467 | Ga0395898_1084799 | 3300037466 | Bacteria | 734 |
| 468 | Ga0395905_0000056 | 3300037471 | Bacteria | 209230 |
| 469 | Ga0395905_0223445 | 3300037471 | Bacteria | 1762 |
| 470 | Ga0395905_0524883 | 3300037471 | Bacteria | 1084 |
| 471 | Ga0395901_0000015 | 3300038443 | Bacteria | 373388 |
| 472 | Ga0395901_0018122 | 3300038443 | Bacteria | 7186 |
| 473 | Ga0395901_0418998 | 3300038443 | Bacteria | 1373 |
| 474 | Ga0395901_0449754 | 3300038443 | Bacteria | 1317 |
| 475 | Ga0395901_1859049 | 3300038443 | Bacteria | 550 |
| 476 | Ga0400486_18150 | 3300038742 | Bacteria | 1132 |
| 477 | Ga0400483_164597 | 3300039062 | Bacteria | 2620 |
| 478 | Ga0400487_31446 | 3300039110 | Bacteria | 1170 |
| 479 | Ga0439465_0044671 | 3300041413 | Bacteria | 1440 |
| 480 | Ga0439465_0048470 | 3300041413 | Bacteria | 1386 |
| 481 | Ga0439465_0384672 | 3300041413 | Bacteria | 533 |
| 482 | Ga0451797_0578826 | 3300041453 | Bacteria | 1157 |
| 483 | Ga0451800_0048927 | 3300041459 | Bacteria | 899 |
| 484 | Ga0451807_0868095 | 3300041486 | Bacteria | 617 |
| 485 | Ga0451843_1723520 | 3300041509 | Bacteria | 774 |
| 486 | Ga0439445_0031169 | 3300042004 | Bacteria | 1385 |
| 487 | Ga0439448_0204453 | 3300042005 | Bacteria | 693 |
| 488 | Ga0439448_0234825 | 3300042005 | Bacteria | 646 |
| 489 | Ga0439452_045714 | 3300042010 | Bacteria | 1018 |
| 490 | Ga0439458_0062580 | 3300042157 | Bacteria | 931 |
| 491 | Ga0439460_0253481 | 3300042461 | Bacteria | 609 |
| 492 | Ga0439440_0054677 | 3300042993 | Bacteria | 1006 |
| 493 | Ga0466965_0226700 | 3300044683 | Bacteria | 997 |
| 494 | Ga0466966_0178657 | 3300044684 | Bacteria | 1288 |
| 495 | Ga0466971_0135568 | 3300044719 | Bacteria | 1145 |
| 496 | Ga0466968_0287072 | 3300044735 | Bacteria | 789 |
| 497 | Ga0466970_0095817 | 3300044765 | Bacteria | 1613 |
| 498 | Ga0466957_0206375 | 3300044842 | Bacteria | 1292 |
| 499 | Ga0466960_0574826 | 3300044901 | Bacteria | 667 |
| 500 | Ga0466959_0168252 | 3300045049 | Bacteria | 1538 |
| 501 | Ga0466967_1130759 | 3300045976 | Bacteria | 780 |
| 502 | Ga0466967_2077699 | 3300045976 | Bacteria | 564 |
| 503 | Ga0495629_0224099 | 3300046459 | Bacteria | 1297 |
| 504 | Ga0495638_0003767 | 3300046460 | Bacteria | 11787 |
| 505 | Ga0495605_0073211 | 3300046474 | Bacteria | 1614 |
| 506 | Ga0495584_0057320 | 3300046491 | Bacteria | 1960 |
| 507 | Ga0495585_0190410 | 3300046492 | Bacteria | 1050 |
| 508 | Ga0495585_0283142 | 3300046492 | Bacteria | 819 |
| 509 | Ga0495583_0174937 | 3300046506 | Bacteria | 881 |
| 510 | Ga0495606_0004680 | 3300046507 | Bacteria | 13523 |
| 511 | Ga0495606_0054338 | 3300046507 | Bacteria | 2594 |
| 512 | Ga0495610_0049022 | 3300046512 | Bacteria | 2070 |
| 513 | Ga0495620_0062590 | 3300046515 | Bacteria | 1545 |
| 514 | Ga0495628_0487256 | 3300046516 | Bacteria | 892 |
| 515 | Ga0495632_0253414 | 3300046519 | Bacteria | 789 |
| 516 | Ga0495632_0429543 | 3300046519 | Bacteria | 575 |
| 517 | Ga0495633_0225840 | 3300046558 | Bacteria | 857 |
| 518 | Ga0495633_0437924 | 3300046558 | Bacteria | 591 |
| 519 | Ga0495656_0125425 | 3300046615 | Bacteria | 1217 |
| 520 | Ga0495656_0335498 | 3300046615 | Bacteria | 781 |
| 521 | Ga0495668_0288990 | 3300046616 | Bacteria | 898 |
| 522 | Ga0495625_0268610 | 3300046660 | Bacteria | 1101 |
| 523 | Ga0495657_0366327 | 3300046675 | Bacteria | 851 |
| 524 | Ga0495658_0061043 | 3300046683 | Bacteria | 2164 |
| 525 | Ga0495670_0313234 | 3300046691 | Bacteria | 842 |
| 526 | Ga0495660_0160239 | 3300046810 | Bacteria | 1104 |
| 527 | Ga0495672_0311182 | 3300047320 | Bacteria | 743 |
| 528 | Ga0495683_0223543 | 3300047323 | Bacteria | 838 |
| 529 | Ga0495686_0001465 | 3300047472 | Bacteria | 25695 |
| 530 | Ga0495615_0099576 | 3300048090 | Bacteria | 820 |
| 531 | Ga0495626_0170082 | 3300048091 | Bacteria | 909 |
| 532 | Ga0496100_0023101 | 3300048903 | Bacteria | 3772 |
| 533 | Ga0496100_0035960 | 3300048903 | Bacteria | 3120 |
| 534 | Ga0496100_0613345 | 3300048903 | Bacteria | 846 |
| 535 | Ga0496101_0059907 | 3300048904 | Bacteria | 2760 |
| 536 | Ga0496101_0894567 | 3300048904 | Bacteria | 699 |
| 537 | Ga0496102_0017938 | 3300048905 | Bacteria | 6209 |
| 538 | Ga0496102_0171458 | 3300048905 | Bacteria | 2042 |
| 539 | Ga0496102_0501310 | 3300048905 | Bacteria | 1136 |
| 540 | Ga0496103_0013445 | 3300048906 | Bacteria | 4854 |
| 541 | Ga0496103_0017163 | 3300048906 | Bacteria | 4328 |
| 542 | Ga0496103_0159684 | 3300048906 | Bacteria | 1446 |
| 543 | Ga0496103_0475240 | 3300048906 | Bacteria | 801 |
| 544 | Ga0496104_0085498 | 3300048907 | Bacteria | 3010 |
| 545 | Ga0496104_0297281 | 3300048907 | Bacteria | 1527 |
| 546 | Ga0496105_0009703 | 3300048908 | Bacteria | 7538 |
| 547 | Ga0496105_0402236 | 3300048908 | Bacteria | 1087 |
| 548 | Ga0496106_0050389 | 3300048909 | Bacteria | 3138 |
| 549 | Ga0496106_0416799 | 3300048909 | Bacteria | 1079 |
| 550 | Ga0496107_0481936 | 3300048910 | Bacteria | 920 |
| 551 | Ga0496107_0848028 | 3300048910 | Bacteria | 667 |
| 552 | Ga0496108_0010541 | 3300048911 | Bacteria | 7510 |
| 553 | Ga0496108_0529852 | 3300048911 | Bacteria | 1028 |
| 554 | Ga0496109_0014012 | 3300048912 | Bacteria | 6970 |
| 555 | Ga0496109_0020303 | 3300048912 | Bacteria | 5867 |
| 556 | Ga0496109_0031859 | 3300048912 | Bacteria | 4736 |
| 557 | Ga0496109_0263234 | 3300048912 | Bacteria | 1624 |
| 558 | Ga0496109_0487612 | 3300048912 | Bacteria | 1163 |
| 559 | Ga0496110_0004436 | 3300048913 | Bacteria | 10879 |
| 560 | Ga0496110_0051018 | 3300048913 | Bacteria | 3635 |
| 561 | Ga0496110_0129581 | 3300048913 | Bacteria | 2277 |
| 562 | Ga0496110_0804688 | 3300048913 | Bacteria | 844 |
| 563 | Ga0496111_0020482 | 3300048914 | Bacteria | 4604 |
| 564 | Ga0496111_0058902 | 3300048914 | Bacteria | 2782 |
| 565 | Ga0496111_0117078 | 3300048914 | Bacteria | 1965 |
| 566 | Ga0496112_0005081 | 3300048915 | Bacteria | 11309 |
| 567 | Ga0496112_0031458 | 3300048915 | Bacteria | 5147 |
| 568 | Ga0496112_0039385 | 3300048915 | Bacteria | 4619 |
| 569 | Ga0496112_0135841 | 3300048915 | Bacteria | 2430 |
| 570 | Ga0496112_0250149 | 3300048915 | Bacteria | 1724 |
| 571 | Ga0496112_0462719 | 3300048915 | Bacteria | 1206 |
| 572 | Ga0496113_0139968 | 3300048916 | Bacteria | 1903 |
| 573 | Ga0496113_0209740 | 3300048916 | Bacteria | 1550 |
| 574 | Ga0496113_1125342 | 3300048916 | Bacteria | 615 |
| 575 | Ga0496115_0067709 | 3300048918 | Bacteria | 2888 |
| 576 | Ga0496115_0346200 | 3300048918 | Bacteria | 1213 |
| 577 | Ga0496115_0905057 | 3300048918 | Bacteria | 680 |
| 578 | Ga0496117_0225334 | 3300048920 | Bacteria | 1040 |
| 579 | Ga0496117_0506246 | 3300048920 | Bacteria | 584 |
| 580 | Ga0496117_0525236 | 3300048920 | Bacteria | 569 |
| 581 | Ga0496119_0045279 | 3300048922 | Bacteria | 2760 |
| 582 | Ga0496119_0050788 | 3300048922 | Bacteria | 2553 |
| 583 | Ga0496119_0058680 | 3300048922 | Bacteria | 2317 |
| 584 | Ga0496120_0001486 | 3300048923 | Bacteria | 27853 |
| 585 | Ga0496120_0070103 | 3300048923 | Bacteria | 1929 |
| 586 | Ga0496120_0178856 | 3300048923 | Bacteria | 1043 |
| 587 | Ga0496121_0023237 | 3300048924 | Bacteria | 5980 |
| 588 | Ga0496121_0413400 | 3300048924 | Bacteria | 880 |
| 589 | Ga0496122_0064930 | 3300048925 | Bacteria | 2651 |
| 590 | Ga0496122_0311863 | 3300048925 | Bacteria | 841 |
| 591 | Ga0496123_0023865 | 3300048926 | Bacteria | 4669 |
| 592 | Ga0496123_0338621 | 3300048926 | Bacteria | 704 |
| 593 | Ga0496124_0076170 | 3300048927 | Bacteria | 2770 |
| 594 | Ga0496124_0243599 | 3300048927 | Bacteria | 1335 |
| 595 | Ga0496124_0592757 | 3300048927 | Bacteria | 723 |
| 596 | Ga0496125_0000276 | 3300048928 | Bacteria | 103024 |
| 597 | Ga0496125_0093025 | 3300048928 | Bacteria | 2252 |
| 598 | Ga0496125_0466968 | 3300048928 | Bacteria | 718 |
| 599 | Ga0496126_0179420 | 3300048929 | Bacteria | 1800 |
| 600 | Ga0496126_1208102 | 3300048929 | Bacteria | 555 |
| 601 | Ga0501305_017115 | 3300049161 | Bacteria | 1040 |
| 602 | Ga0501307_069709 | 3300049162 | Bacteria | 559 |
| 603 | Ga0501311_017035 | 3300049527 | Bacteria | 953 |
| 604 | Ga0501313_017406 | 3300049529 | Bacteria | 868 |
| 605 | Ga0501319_003996 | 3300049535 | Bacteria | 1010 |
| 606 | Ga0501320_011474 | 3300049536 | Bacteria | 918 |
| 607 | Ga0501031_0029518 | 3300049568 | Bacteria | 3577 |
| 608 | Ga0501031_0034948 | 3300049568 | Bacteria | 3279 |
| 609 | Ga0501031_0092852 | 3300049568 | Bacteria | 1970 |
| 610 | Ga0501031_0207658 | 3300049568 | Bacteria | 1277 |
| 611 | Ga0501031_0335658 | 3300049568 | Bacteria | 978 |
| 612 | Ga0501031_0368844 | 3300049568 | Bacteria | 929 |
| 613 | Ga0501031_0423601 | 3300049568 | Bacteria | 860 |
| 614 | Ga0501031_0590923 | 3300049568 | Bacteria | 714 |
| 615 | Ga0501032_0000116 | 3300049569 | Bacteria | 67350 |
| 616 | Ga0501032_0020397 | 3300049569 | Bacteria | 4616 |
| 617 | Ga0501032_0050930 | 3300049569 | Bacteria | 2792 |
| 618 | Ga0501032_0062914 | 3300049569 | Bacteria | 2485 |
| 619 | Ga0501032_0068747 | 3300049569 | Bacteria | 2364 |
| 620 | Ga0501032_0088847 | 3300049569 | Bacteria | 2051 |
| 621 | Ga0501032_0138096 | 3300049569 | Bacteria | 1606 |
| 622 | Ga0501032_0160827 | 3300049569 | Bacteria | 1475 |
| 623 | Ga0501032_0204835 | 3300049569 | Bacteria | 1287 |
| 624 | Ga0501032_0265986 | 3300049569 | Bacteria | 1111 |
| 625 | Ga0501032_0533947 | 3300049569 | Bacteria | 748 |
| 626 | Ga0501032_0795208 | 3300049569 | Bacteria | 597 |
| 627 | Ga0501032_0800361 | 3300049569 | Bacteria | 595 |
| 628 | Ga0501033_0000346 | 3300049570 | Bacteria | 44155 |
| 629 | Ga0501033_0005442 | 3300049570 | Bacteria | 10088 |
| 630 | Ga0501033_0006207 | 3300049570 | Bacteria | 9367 |
| 631 | Ga0501033_0014554 | 3300049570 | Bacteria | 5971 |
| 632 | Ga0501033_0061822 | 3300049570 | Bacteria | 2759 |
| 633 | Ga0501033_0119845 | 3300049570 | Bacteria | 1910 |
| 634 | Ga0501033_0404242 | 3300049570 | Bacteria | 952 |
| 635 | Ga0501033_0425306 | 3300049570 | Bacteria | 925 |
| 636 | Ga0501033_0463224 | 3300049570 | Bacteria | 879 |
| 637 | Ga0501033_0537174 | 3300049570 | Bacteria | 806 |
| 638 | Ga0501034_0000314 | 3300049571 | Bacteria | 86025 |
| 639 | Ga0501034_0001091 | 3300049571 | Bacteria | 38199 |
| 640 | Ga0501034_0047815 | 3300049571 | Bacteria | 4318 |
| 641 | Ga0501034_0049225 | 3300049571 | Bacteria | 4253 |
| 642 | Ga0501034_0051624 | 3300049571 | Bacteria | 4146 |
| 643 | Ga0501034_0084106 | 3300049571 | Bacteria | 3184 |
| 644 | Ga0501034_0146938 | 3300049571 | Bacteria | 2334 |
| 645 | Ga0501034_0174934 | 3300049571 | Bacteria | 2113 |
| 646 | Ga0501034_0671814 | 3300049571 | Bacteria | 936 |
| 647 | Ga0501034_0841185 | 3300049571 | Bacteria | 808 |
| 648 | Ga0501034_1144567 | 3300049571 | Bacteria | 658 |
| 649 | Ga0501036_0000117 | 3300049572 | Bacteria | 49511 |
| 650 | Ga0501036_0020419 | 3300049572 | Bacteria | 5564 |
| 651 | Ga0501036_0042203 | 3300049572 | Bacteria | 3862 |
| 652 | Ga0501036_0042676 | 3300049572 | Bacteria | 3840 |
| 653 | Ga0501036_0043949 | 3300049572 | Bacteria | 3783 |
| 654 | Ga0501036_0156648 | 3300049572 | Bacteria | 1921 |
| 655 | Ga0501036_0301549 | 3300049572 | Bacteria | 1340 |
| 656 | Ga0501036_0539702 | 3300049572 | Bacteria | 969 |
| 657 | Ga0501036_0677257 | 3300049572 | Bacteria | 853 |
| 658 | Ga0501036_1597126 | 3300049572 | Bacteria | 527 |
| 659 | Ga0501036_1660126 | 3300049572 | Bacteria | 515 |
| 660 | Ga0501037_0000108 | 3300049573 | Bacteria | 77753 |
| 661 | Ga0501037_0001070 | 3300049573 | Bacteria | 20310 |
| 662 | Ga0501037_0036243 | 3300049573 | Bacteria | 3636 |
| 663 | Ga0501037_0077620 | 3300049573 | Bacteria | 2410 |
| 664 | Ga0501037_0151827 | 3300049573 | Bacteria | 1655 |
| 665 | Ga0501037_0171344 | 3300049573 | Bacteria | 1543 |
| 666 | Ga0501037_0273574 | 3300049573 | Bacteria | 1178 |
| 667 | Ga0501037_0465129 | 3300049573 | Bacteria | 861 |
| 668 | Ga0501037_0524068 | 3300049573 | Bacteria | 802 |
| 669 | Ga0501037_0530557 | 3300049573 | Bacteria | 796 |
| 670 | Ga0501038_0000126 | 3300049574 | Bacteria | 64756 |
| 671 | Ga0501038_0096844 | 3300049574 | Bacteria | 2462 |
| 672 | Ga0501038_0236934 | 3300049574 | Bacteria | 1450 |
| 673 | Ga0501038_0304569 | 3300049574 | Bacteria | 1250 |
| 674 | Ga0501038_0358155 | 3300049574 | Bacteria | 1135 |
| 675 | Ga0501038_0390896 | 3300049574 | Bacteria | 1077 |
| 676 | Ga0501038_1235444 | 3300049574 | Bacteria | 541 |
| 677 | Ga0501039_0000003 | 3300049575 | Bacteria | 357424 |
| 678 | Ga0501039_0013679 | 3300049575 | Bacteria | 6206 |
| 679 | Ga0501039_0024319 | 3300049575 | Bacteria | 4651 |
| 680 | Ga0501039_0081359 | 3300049575 | Bacteria | 2521 |
| 681 | Ga0501039_0172074 | 3300049575 | Bacteria | 1702 |
| 682 | Ga0501039_0289200 | 3300049575 | Bacteria | 1288 |
| 683 | Ga0501039_0355124 | 3300049575 | Bacteria | 1152 |
| 684 | Ga0501039_0503767 | 3300049575 | Bacteria | 951 |
| 685 | Ga0501039_0634609 | 3300049575 | Bacteria | 837 |
| 686 | Ga0501039_0818588 | 3300049575 | Bacteria | 726 |
| 687 | Ga0501039_0900011 | 3300049575 | Bacteria | 689 |
| 688 | Ga0501040_0207776 | 3300049576 | Bacteria | 1391 |
| 689 | Ga0501040_0246648 | 3300049576 | Bacteria | 1273 |
| 690 | Ga0501040_0319660 | 3300049576 | Bacteria | 1110 |
| 691 | Ga0501040_0447364 | 3300049576 | Bacteria | 930 |
| 692 | Ga0501041_0079483 | 3300049577 | Bacteria | 2018 |
| 693 | Ga0501041_0429006 | 3300049577 | Bacteria | 838 |
| 694 | Ga0501042_0028224 | 3300049578 | Bacteria | 3951 |
| 695 | Ga0501042_0067691 | 3300049578 | Bacteria | 2553 |
| 696 | Ga0501042_0090238 | 3300049578 | Bacteria | 2199 |
| 697 | Ga0501042_0342726 | 3300049578 | Bacteria | 1080 |
| 698 | Ga0501042_0348353 | 3300049578 | Bacteria | 1071 |
| 699 | Ga0501042_0398706 | 3300049578 | Bacteria | 997 |
| 700 | Ga0501042_0441457 | 3300049578 | Bacteria | 944 |
| 701 | Ga0501042_0445465 | 3300049578 | Bacteria | 939 |
| 702 | Ga0501042_0600174 | 3300049578 | Bacteria | 800 |
| 703 | Ga0501043_0000041 | 3300049579 | Bacteria | 116876 |
| 704 | Ga0501043_0000419 | 3300049579 | Bacteria | 38173 |
| 705 | Ga0501043_0028008 | 3300049579 | Bacteria | 4422 |
| 706 | Ga0501043_0032430 | 3300049579 | Bacteria | 4107 |
| 707 | Ga0501043_0128903 | 3300049579 | Bacteria | 1983 |
| 708 | Ga0501043_0203129 | 3300049579 | Bacteria | 1537 |
| 709 | Ga0501043_0208501 | 3300049579 | Bacteria | 1515 |
| 710 | Ga0501043_0235485 | 3300049579 | Bacteria | 1413 |
| 711 | Ga0501043_0280498 | 3300049579 | Bacteria | 1277 |
| 712 | Ga0501043_0466263 | 3300049579 | Bacteria | 947 |
| 713 | Ga0501043_0521352 | 3300049579 | Bacteria | 886 |
| 714 | Ga0501043_0871379 | 3300049579 | Bacteria | 647 |
| 715 | Ga0501046_0058260 | 3300049580 | Bacteria | 3028 |
| 716 | Ga0501046_0071734 | 3300049580 | Bacteria | 2690 |
| 717 | Ga0501046_0084349 | 3300049580 | Bacteria | 2450 |
| 718 | Ga0501046_0096109 | 3300049580 | Bacteria | 2276 |
| 719 | Ga0501046_0201340 | 3300049580 | Bacteria | 1481 |
| 720 | Ga0501047_0011716 | 3300049581 | Bacteria | 8290 |
| 721 | Ga0501047_0015184 | 3300049581 | Bacteria | 7332 |
| 722 | Ga0501047_0020608 | 3300049581 | Bacteria | 6331 |
| 723 | Ga0501047_0085689 | 3300049581 | Bacteria | 3027 |
| 724 | Ga0501047_0110628 | 3300049581 | Bacteria | 2630 |
| 725 | Ga0501047_0121166 | 3300049581 | Bacteria | 2498 |
| 726 | Ga0501047_0126194 | 3300049581 | Bacteria | 2439 |
| 727 | Ga0501047_0166040 | 3300049581 | Bacteria | 2078 |
| 728 | Ga0501047_0362261 | 3300049581 | Bacteria | 1285 |
| 729 | Ga0501047_1200710 | 3300049581 | Bacteria | 572 |
| 730 | Ga0501048_0046137 | 3300049582 | Bacteria | 3111 |
| 731 | Ga0501048_0127717 | 3300049582 | Bacteria | 1798 |
| 732 | Ga0501048_0142806 | 3300049582 | Bacteria | 1693 |
| 733 | Ga0501048_0348102 | 3300049582 | Bacteria | 1057 |
| 734 | Ga0501048_0476203 | 3300049582 | Bacteria | 895 |
| 735 | Ga0501067_0334620 | 3300049583 | Bacteria | 843 |
| 736 | Ga0501067_0365449 | 3300049583 | Bacteria | 804 |
| 737 | Ga0501067_0509814 | 3300049583 | Bacteria | 673 |
| 738 | Ga0501068_0014932 | 3300049584 | Bacteria | 4450 |
| 739 | Ga0501068_0054565 | 3300049584 | Bacteria | 2421 |
| 740 | Ga0501068_0354415 | 3300049584 | Bacteria | 943 |
| 741 | Ga0501068_0371488 | 3300049584 | Bacteria | 920 |
| 742 | Ga0501069_0000018 | 3300049585 | Bacteria | 133550 |
| 743 | Ga0501069_0081794 | 3300049585 | Bacteria | 1820 |
| 744 | Ga0501069_0115854 | 3300049585 | Bacteria | 1528 |
| 745 | Ga0501069_0118879 | 3300049585 | Bacteria | 1509 |
| 746 | Ga0501069_0482068 | 3300049585 | Bacteria | 739 |
| 747 | Ga0501069_0528729 | 3300049585 | Bacteria | 705 |
| 748 | Ga0501070_0000149 | 3300049586 | Bacteria | 64277 |
| 749 | Ga0501070_0001007 | 3300049586 | Bacteria | 25257 |
| 750 | Ga0501070_0006449 | 3300049586 | Bacteria | 9990 |
| 751 | Ga0501070_0027866 | 3300049586 | Bacteria | 4738 |
| 752 | Ga0501070_0032048 | 3300049586 | Bacteria | 4400 |
| 753 | Ga0501070_0048340 | 3300049586 | Bacteria | 3534 |
| 754 | Ga0501070_0057191 | 3300049586 | Bacteria | 3233 |
| 755 | Ga0501070_0240323 | 3300049586 | Bacteria | 1482 |
| 756 | Ga0501070_0301203 | 3300049586 | Bacteria | 1306 |
| 757 | Ga0501070_0375810 | 3300049586 | Bacteria | 1151 |
| 758 | Ga0501070_0429283 | 3300049586 | Bacteria | 1067 |
| 759 | Ga0501070_0743150 | 3300049586 | Bacteria | 773 |
| 760 | Ga0501070_0843923 | 3300049586 | Bacteria | 717 |
| 761 | Ga0501070_1021542 | 3300049586 | Bacteria | 640 |
| 762 | Ga0501071_0005101 | 3300049587 | Bacteria | 8404 |
| 763 | Ga0501071_0009548 | 3300049587 | Bacteria | 6468 |
| 764 | Ga0501071_0070895 | 3300049587 | Bacteria | 2540 |
| 765 | Ga0501071_0077862 | 3300049587 | Bacteria | 2422 |
| 766 | Ga0501071_0167743 | 3300049587 | Bacteria | 1643 |
| 767 | Ga0501071_0170435 | 3300049587 | Bacteria | 1629 |
| 768 | Ga0501071_0277632 | 3300049587 | Bacteria | 1268 |
| 769 | Ga0501071_0285357 | 3300049587 | Bacteria | 1249 |
| 770 | Ga0501071_0437020 | 3300049587 | Bacteria | 1001 |
| 771 | Ga0501072_0015847 | 3300049588 | Bacteria | 5777 |
| 772 | Ga0501072_0030510 | 3300049588 | Bacteria | 4217 |
| 773 | Ga0501072_0033522 | 3300049588 | Bacteria | 4024 |
| 774 | Ga0501072_0197359 | 3300049588 | Bacteria | 1605 |
| 775 | Ga0501072_0298024 | 3300049588 | Bacteria | 1282 |
| 776 | Ga0501072_0635583 | 3300049588 | Bacteria | 841 |
| 777 | Ga0501072_1041429 | 3300049588 | Bacteria | 637 |
| 778 | Ga0501072_1154149 | 3300049588 | Bacteria | 602 |
| 779 | Ga0501073_0057178 | 3300049589 | Bacteria | 2727 |
| 780 | Ga0501073_0186435 | 3300049589 | Bacteria | 1436 |
| 781 | Ga0501073_0196681 | 3300049589 | Bacteria | 1394 |
| 782 | Ga0501073_0208571 | 3300049589 | Bacteria | 1350 |
| 783 | Ga0501073_0239201 | 3300049589 | Bacteria | 1254 |
| 784 | Ga0501073_0297390 | 3300049589 | Bacteria | 1114 |
| 785 | Ga0501073_0566948 | 3300049589 | Bacteria | 784 |
| 786 | Ga0501073_0622362 | 3300049589 | Bacteria | 745 |
| 787 | Ga0501073_0712119 | 3300049589 | Bacteria | 692 |
| 788 | Ga0501074_0015715 | 3300049590 | Bacteria | 5503 |
| 789 | Ga0501074_0036832 | 3300049590 | Bacteria | 3544 |
| 790 | Ga0501074_0044789 | 3300049590 | Bacteria | 3202 |
| 791 | Ga0501074_0060482 | 3300049590 | Bacteria | 2729 |
| 792 | Ga0501074_0134462 | 3300049590 | Bacteria | 1769 |
| 793 | Ga0501074_0138546 | 3300049590 | Bacteria | 1740 |
| 794 | Ga0501074_0279253 | 3300049590 | Bacteria | 1187 |
| 795 | Ga0501074_0358878 | 3300049590 | Bacteria | 1034 |
| 796 | Ga0501074_0506706 | 3300049590 | Bacteria | 855 |
| 797 | Ga0501075_0023025 | 3300049591 | Bacteria | 4556 |
| 798 | Ga0501075_0023194 | 3300049591 | Bacteria | 4541 |
| 799 | Ga0501075_0107810 | 3300049591 | Bacteria | 2117 |
| 800 | Ga0501075_0210889 | 3300049591 | Bacteria | 1482 |
| 801 | Ga0501076_0034396 | 3300049592 | Bacteria | 3961 |
| 802 | Ga0501076_0054536 | 3300049592 | Bacteria | 3168 |
| 803 | Ga0501076_0072340 | 3300049592 | Bacteria | 2759 |
| 804 | Ga0501076_0114666 | 3300049592 | Bacteria | 2180 |
| 805 | Ga0501077_0092221 | 3300049593 | Bacteria | 1919 |
| 806 | Ga0501077_0198439 | 3300049593 | Bacteria | 1275 |
| 807 | Ga0501077_0328500 | 3300049593 | Bacteria | 975 |
| 808 | Ga0501079_0015310 | 3300049741 | Bacteria | 5850 |
| 809 | Ga0501079_0093750 | 3300049741 | Bacteria | 2326 |
| 810 | Ga0501079_0114292 | 3300049741 | Bacteria | 2098 |
| 811 | Ga0501079_0186293 | 3300049741 | Bacteria | 1620 |
| 812 | Ga0501079_0359212 | 3300049741 | Bacteria | 1141 |
| 813 | Ga0501079_0377588 | 3300049741 | Bacteria | 1111 |
| 814 | Ga0501079_0419252 | 3300049741 | Bacteria | 1051 |
| 815 | Ga0501079_0861464 | 3300049741 | Bacteria | 713 |
| 816 | Ga0501080_0001846 | 3300049742 | Bacteria | 18181 |
| 817 | Ga0501080_0002294 | 3300049742 | Bacteria | 16667 |
| 818 | Ga0501080_0014720 | 3300049742 | Bacteria | 7203 |
| 819 | Ga0501080_0032171 | 3300049742 | Bacteria | 4890 |
| 820 | Ga0501080_0131305 | 3300049742 | Bacteria | 2319 |
| 821 | Ga0501080_0154201 | 3300049742 | Bacteria | 2122 |
| 822 | Ga0501080_0181650 | 3300049742 | Bacteria | 1935 |
| 823 | Ga0501081_0007477 | 3300049743 | Bacteria | 7083 |
| 824 | Ga0501081_0082879 | 3300049743 | Bacteria | 2247 |
| 825 | Ga0501081_0085196 | 3300049743 | Bacteria | 2217 |
| 826 | Ga0501081_0097137 | 3300049743 | Bacteria | 2078 |
| 827 | Ga0501081_0455081 | 3300049743 | Bacteria | 951 |
| 828 | Ga0501081_0902189 | 3300049743 | Bacteria | 666 |
| 829 | Ga0501083_0000524 | 3300049744 | Bacteria | 24464 |
| 830 | Ga0501083_0006866 | 3300049744 | Bacteria | 8080 |
| 831 | Ga0501083_0036097 | 3300049744 | Bacteria | 3373 |
| 832 | Ga0501083_0062836 | 3300049744 | Bacteria | 2477 |
| 833 | Ga0501083_0150125 | 3300049744 | Bacteria | 1526 |
| 834 | Ga0501083_0165973 | 3300049744 | Bacteria | 1443 |
| 835 | Ga0501083_0259894 | 3300049744 | Bacteria | 1130 |
| 836 | Ga0501083_0308575 | 3300049744 | Bacteria | 1029 |
| 837 | Ga0501035_0000032 | 3300049822 | Bacteria | 175435 |
| 838 | Ga0501035_0000061 | 3300049822 | Bacteria | 131658 |
| 839 | Ga0501035_0002052 | 3300049822 | Bacteria | 20071 |
| 840 | Ga0501035_0002566 | 3300049822 | Bacteria | 17749 |
| 841 | Ga0501035_0012273 | 3300049822 | Bacteria | 7919 |
| 842 | Ga0501035_0238711 | 3300049822 | Bacteria | 1547 |
| 843 | Ga0501035_0305392 | 3300049822 | Bacteria | 1340 |
| 844 | Ga0501035_0321314 | 3300049822 | Bacteria | 1300 |
| 845 | Ga0501035_0417741 | 3300049822 | Bacteria | 1114 |
| 846 | Ga0501035_0562695 | 3300049822 | Bacteria | 933 |
| 847 | Ga0501035_0600271 | 3300049822 | Bacteria | 897 |
| 848 | Ga0501035_0997831 | 3300049822 | Bacteria | 658 |
| 849 | Ga0501035_1104020 | 3300049822 | Bacteria | 619 |
| 850 | Ga0501044_0000003 | 3300049823 | Bacteria | 345647 |
| 851 | Ga0501044_0023419 | 3300049823 | Bacteria | 6568 |
| 852 | Ga0501044_0044387 | 3300049823 | Bacteria | 4612 |
| 853 | Ga0501044_0051125 | 3300049823 | Bacteria | 4262 |
| 854 | Ga0501044_0152284 | 3300049823 | Bacteria | 2294 |
| 855 | Ga0501044_0247188 | 3300049823 | Bacteria | 1726 |
| 856 | Ga0501044_0298762 | 3300049823 | Bacteria | 1539 |
| 857 | Ga0501044_0311223 | 3300049823 | Bacteria | 1501 |
| 858 | Ga0501044_0409254 | 3300049823 | Bacteria | 1268 |
| 859 | Ga0501044_0428309 | 3300049823 | Bacteria | 1232 |
| 860 | Ga0501044_0463960 | 3300049823 | Bacteria | 1171 |
| 861 | Ga0501044_0472122 | 3300049823 | Bacteria | 1158 |
| 862 | Ga0501044_0480636 | 3300049823 | Bacteria | 1145 |
| 863 | Ga0501044_1034380 | 3300049823 | Bacteria | 692 |
| 864 | Ga0501044_1325056 | 3300049823 | Bacteria | 586 |
| 865 | Ga0501044_1393540 | 3300049823 | Bacteria | 567 |
| 866 | Ga0501045_0019019 | 3300049824 | Bacteria | 4892 |
| 867 | Ga0501045_0055910 | 3300049824 | Bacteria | 2886 |
| 868 | Ga0501045_0119776 | 3300049824 | Bacteria | 1954 |
| 869 | Ga0501045_0195110 | 3300049824 | Bacteria | 1509 |
| 870 | Ga0501045_0289422 | 3300049824 | Bacteria | 1219 |
| 871 | Ga0501045_0306829 | 3300049824 | Bacteria | 1181 |
| 872 | Ga0501045_0604184 | 3300049824 | Bacteria | 812 |
| 873 | Ga0501045_0648256 | 3300049824 | Bacteria | 780 |
| 874 | Ga0501045_0660127 | 3300049824 | Bacteria | 773 |
| 875 | nmdc:mga03683_28037_c1 | 3300050489 | Bacteria | 2236 |
| 876 | nmdc:mga00v17_5251_c2 | 3300050491 | Bacteria | 2077 |
| 877 | nmdc:mga0yw44_1095889_c1 | 3300050492 | Bacteria | 538 |
| 878 | nmdc:mga0yw44_138395_c1 | 3300050492 | Bacteria | 1581 |
| 879 | nmdc:mga0yw44_257835_c1 | 3300050492 | Bacteria | 1162 |
| 880 | nmdc:mga0yw44_315002_c1 | 3300050492 | Bacteria | 1050 |
| 881 | nmdc:mga0yw44_64771_c1 | 3300050492 | Bacteria | 2250 |
| 882 | nmdc:mga0yw44_82110_c1 | 3300050492 | Bacteria | 995 |
| 883 | nmdc:mga06z11_129879_c1 | 3300050494 | Bacteria | 1414 |
| 884 | nmdc:mga06z11_57898_c1 | 3300050494 | Bacteria | 2009 |
| 885 | nmdc:mga06z11_59121_c1 | 3300050494 | Bacteria | 1991 |
| 886 | nmdc:mga04h51_20696_c1 | 3300050495 | Bacteria | 1968 |
| 887 | nmdc:mga04h51_276630_c1 | 3300050495 | Bacteria | 679 |
| 888 | nmdc:mga07m45_46054_c1 | 3300050496 | Bacteria | 2450 |
| 889 | nmdc:mga05p37_932744_c1 | 3300050507 | Bacteria | 932 |
| 890 | nmdc:mga05p37_99844_c1 | 3300050507 | Bacteria | 3574 |
| 891 | nmdc:mga09592_44022_c1 | 3300050508 | Bacteria | 3756 |
| 892 | nmdc:mga0qj67_248590_c1 | 3300050509 | Bacteria | 1443 |
| 893 | nmdc:mga06r32_226888_c1 | 3300050510 | Bacteria | 1856 |
| 894 | nmdc:mga06r32_330282_c1 | 3300050510 | Bacteria | 1510 |
| 895 | nmdc:mga08y16_139564_c1 | 3300050511 | Bacteria | 2520 |
| 896 | nmdc:mga0n895_390638_c1 | 3300050512 | Bacteria | 1408 |
| 897 | nmdc:mga0n895_763592_c1 | 3300050512 | Bacteria | 959 |
| 898 | nmdc:mga08x19_6006_c1 | 3300050514 | Bacteria | 7178 |
| 899 | nmdc:mga0a205_208281_c1 | 3300050515 | Bacteria | 1844 |
| 900 | nmdc:mga0a205_46652_c1 | 3300050515 | Bacteria | 4179 |
| 901 | nmdc:mga0sz30_4292_c1 | 3300050516 | Bacteria | 5142 |
| 902 | nmdc:mga0sz30_87465_c1 | 3300050516 | Bacteria | 1353 |
| 903 | Ga0495601_0036771 | 3300053077 | Bacteria | 3059 |
| 904 | Ga0495655_0000773 | 3300053083 | Bacteria | 5025 |
| 905 | Ga0495655_0020441 | 3300053083 | Bacteria | 1485 |
| 906 | Ga0495655_0028907 | 3300053083 | Bacteria | 1328 |
| 907 | Ga0495619_0060580 | 3300053085 | Bacteria | 2516 |
| 908 | Ga0500578_0512062 | 3300053086 | Bacteria | 673 |
| 909 | Ga0500643_037872 | 3300053087 | Bacteria | 1433 |
| 910 | Ga0500650_0182629 | 3300053098 | Bacteria | 961 |
| 911 | Ga0500658_0146703 | 3300053134 | Bacteria | 1061 |
| 912 | Ga0500568_0000059 | 3300053139 | Bacteria | 108096 |
| 913 | Ga0500573_0001398 | 3300053140 | Bacteria | 11530 |
| 914 | Ga0500573_0465340 | 3300053140 | Bacteria | 580 |
| 915 | Ga0500577_0159622 | 3300053142 | Bacteria | 960 |
| 916 | Ga0500616_0054412 | 3300053153 | Bacteria | 2096 |
| 917 | Ga0500624_004568 | 3300053157 | Bacteria | 1826 |
| 918 | Ga0500627_0222596 | 3300053158 | Bacteria | 841 |
| 919 | Ga0500634_0000004 | 3300053161 | Bacteria | 214946 |
| 920 | Ga0500611_175569 | 3300053727 | Bacteria | 598 |
| 921 | Ga0501084_0024909 | 3300054114 | Bacteria | 4992 |
| 922 | Ga0501084_0096312 | 3300054114 | Bacteria | 2485 |
| 923 | Ga0501084_0097519 | 3300054114 | Bacteria | 2468 |
| 924 | Ga0501084_0536815 | 3300054114 | Bacteria | 988 |
| 925 | Ga0501084_1074125 | 3300054114 | Bacteria | 676 |
| 926 | Ga0587080_018613 | 3300059503 | Bacteria | 1117 |
| 927 | Ga0587082_013800 | 3300059504 | Bacteria | 1223 |
| 928 | Ga0587082_021678 | 3300059504 | Bacteria | 1051 |
| 929 | Ga0587083_0074043 | 3300059505 | Bacteria | 797 |
| 930 | Ga0587086_061741 | 3300059507 | Bacteria | 626 |
| 931 | Ga0587089_026455 | 3300059509 | Bacteria | 833 |
| 932 | Ga0587094_015377 | 3300059513 | Bacteria | 1056 |
| 933 | Ga0587095_003995 | 3300059514 | Bacteria | 1065 |
| 934 | Ga0587095_013659 | 3300059514 | Bacteria | 719 |
| 935 | Ga0587098_064275 | 3300059604 | Bacteria | 583 |
| 936 | Ga0587129_017446 | 3300059608 | Bacteria | 613 |
| 937 | Ga0587101_014842 | 3300059623 | Bacteria | 1046 |
| 938 | Ga0587113_006331 | 3300059625 | Bacteria | 1003 |
| 939 | Ga0587117_028738 | 3300059627 | Bacteria | 825 |
| 940 | Ga0587130_024773 | 3300059631 | Bacteria | 667 |
| 941 | Ga0587067_123612 | 3300059640 | Bacteria | 624 |
| 942 | Ga0587072_026891 | 3300059643 | Bacteria | 1054 |
| 943 | Ga0587076_106917 | 3300059645 | Bacteria | 632 |
| 944 | Ga0587078_010918 | 3300059646 | Bacteria | 1048 |
| 945 | Ga0587078_013417 | 3300059646 | Bacteria | 970 |
| 946 | Ga0587102_037271 | 3300059649 | Bacteria | 616 |
| 947 | Ga0587104_015989 | 3300059650 | Bacteria | 594 |
| 948 | Ga0587107_015572 | 3300059652 | Bacteria | 994 |
| 949 | Ga0587114_085899 | 3300059655 | Bacteria | 592 |
| 950 | Ga0587119_014111 | 3300059658 | Bacteria | 954 |
| 951 | Ga0587124_031150 | 3300059660 | Bacteria | 590 |
| 952 | Ga0587071_115100 | 3300060344 | Bacteria | 637 |
| 953 | Ga0587111_0032452 | 3300060346 | Bacteria | 1074 |
| 954 | Ga0587111_0212036 | 3300060346 | Bacteria | 555 |
| 955 | Ga0501082_0033500 | 3300060353 | Bacteria | 4433 |
| 956 | Ga0501082_0042278 | 3300060353 | Bacteria | 3929 |
| 957 | Ga0501082_0068033 | 3300060353 | Bacteria | 3067 |
| 958 | Ga0501082_0083784 | 3300060353 | Bacteria | 2751 |
| 959 | Ga0501082_0164397 | 3300060353 | Bacteria | 1929 |
| 960 | Ga0501082_0185586 | 3300060353 | Bacteria | 1809 |
| 961 | Ga0501082_0203528 | 3300060353 | Bacteria | 1722 |
| 962 | Ga0501082_0221183 | 3300060353 | Bacteria | 1647 |
| 963 | Ga0501082_0618417 | 3300060353 | Bacteria | 948 |
| 964 | Ga0501082_0886486 | 3300060353 | Bacteria | 780 |
| 965 | Ga0530510_0007204 | 3300061734 | Bacteria | 7738 |
| 966 | Ga0530510_0055187 | 3300061734 | Bacteria | 2870 |
| 967 | Ga0530510_0295611 | 3300061734 | Bacteria | 1211 |
| 968 | Ga0530510_0673320 | 3300061734 | Bacteria | 788 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005614 | Ga0068856_100313025 | Ga0068856_1003130252 | 150 |
| 2 | 3300014326 | Ga0157380_10839542 | Ga0157380_108395423 | 153 |
| 3 | 3300002704 | JGI25155J39150_1000019 | JGI25155J39150_100001953 | 154 |
| 4 | 3300002705 | JGI25156J39149_1000020 | JGI25156J39149_1000020117 | 154 |
| 5 | 3300002738 | JGI25154J39366_1000102 | JGI25154J39366_100010253 | 154 |
| 6 | 3300002741 | JGI25157J39369_1000070 | JGI25157J39369_100007053 | 154 |
| 7 | 3300003771 | Ga0055526_1006554 | Ga0055526_10065544 | 154 |
| 8 | 3300003775 | Ga0055524_1031931 | Ga0055524_10319312 | 154 |
| 9 | 3300003790 | Ga0055528_1000373 | Ga0055528_10003732 | 154 |
| 10 | 3300005530 | Ga0070679_100965837 | Ga0070679_1009658371 | 154 |
| 11 | 3300005563 | Ga0068855_100197519 | Ga0068855_1001975192 | 154 |
| 12 | 3300005578 | Ga0068854_100033016 | Ga0068854_1000330166 | 154 |
| 13 | 3300005614 | Ga0068856_100197529 | Ga0068856_1001975292 | 154 |
| 14 | 3300005616 | Ga0068852_100073723 | Ga0068852_1000737233 | 154 |
| 15 | 3300005834 | Ga0068851_10018385 | Ga0068851_100183854 | 154 |
| 16 | 3300006353 | Ga0075370_10011760 | Ga0075370_100117606 | 154 |
| 17 | 3300009093 | Ga0105240_10000032 | Ga0105240_10000032106 | 154 |
| 18 | 3300009101 | Ga0105247_10562908 | Ga0105247_105629081 | 154 |
| 19 | 3300009174 | Ga0105241_10106876 | Ga0105241_101068762 | 154 |
| 20 | 3300009545 | Ga0105237_10001638 | Ga0105237_1000163834 | 154 |
| 21 | 3300009551 | Ga0105238_10284449 | Ga0105238_102844492 | 154 |
| 22 | 3300010375 | Ga0105239_10004667 | Ga0105239_100046673 | 154 |
| 23 | 3300010375 | Ga0105239_11161568 | Ga0105239_111615682 | 154 |
| 24 | 3300013102 | Ga0157371_10795335 | Ga0157371_107953352 | 154 |
| 25 | 3300013307 | Ga0157372_11577648 | Ga0157372_115776481 | 154 |
| 26 | 3300037312 | Ga0395899_0286650 | Ga0395899_0286650_69_557 | 154 |
| 27 | 3300037418 | Ga0395900_0618074 | Ga0395900_0618074_69_557 | 154 |
| 28 | 3300037466 | Ga0395898_0056315 | Ga0395898_0056315_2668_3156 | 154 |
| 29 | 3300037466 | Ga0395898_0118563 | Ga0395898_0118563_933_1421 | 154 |
| 30 | 3300038443 | Ga0395901_0449754 | Ga0395901_0449754_345_833 | 154 |
| 31 | 3300041413 | Ga0439465_0384672 | Ga0439465_0384672_37_507 | 154 |
| 32 | 3300049162 | Ga0501307_069709 | Ga0501307_069709_64_534 | 154 |
| 33 | 3300049529 | Ga0501313_017406 | Ga0501313_017406_183_653 | 154 |
| 34 | 3300049536 | Ga0501320_011474 | Ga0501320_011474_433_903 | 154 |
| 35 | 3300049568 | Ga0501031_0368844 | Ga0501031_0368844_356_826 | 154 |
| 36 | 3300049570 | Ga0501033_0463224 | Ga0501033_0463224_179_649 | 154 |
| 37 | 3300049572 | Ga0501036_0539702 | Ga0501036_0539702_28_498 | 154 |
| 38 | 3300049573 | Ga0501037_0077620 | Ga0501037_0077620_1215_1685 | 154 |
| 39 | 3300049574 | Ga0501038_0390896 | Ga0501038_0390896_277_747 | 154 |
| 40 | 3300049575 | Ga0501039_0818588 | Ga0501039_0818588_187_657 | 154 |
| 41 | 3300049578 | Ga0501042_0441457 | Ga0501042_0441457_52_531 | 154 |
| 42 | 3300049579 | Ga0501043_0028008 | Ga0501043_0028008_2951_3421 | 154 |
| 43 | 3300049581 | Ga0501047_0015184 | Ga0501047_0015184_2154_2624 | 154 |
| 44 | 3300049583 | Ga0501067_0365449 | Ga0501067_0365449_193_663 | 154 |
| 45 | 3300049586 | Ga0501070_0240323 | Ga0501070_0240323_500_970 | 154 |
| 46 | 3300049588 | Ga0501072_0298024 | Ga0501072_0298024_38_508 | 154 |
| 47 | 3300049589 | Ga0501073_0057178 | Ga0501073_0057178_1408_1878 | 154 |
| 48 | 3300049589 | Ga0501073_0239201 | Ga0501073_0239201_568_1038 | 154 |
| 49 | 3300049589 | Ga0501073_0712119 | Ga0501073_0712119_188_658 | 154 |
| 50 | 3300049590 | Ga0501074_0279253 | Ga0501074_0279253_149_619 | 154 |
| 51 | 3300049741 | Ga0501079_0419252 | Ga0501079_0419252_321_791 | 154 |
| 52 | 3300049742 | Ga0501080_0032171 | Ga0501080_0032171_3508_3978 | 154 |
| 53 | 3300049822 | Ga0501035_0321314 | Ga0501035_0321314_506_976 | 154 |
| 54 | 3300049823 | Ga0501044_0428309 | Ga0501044_0428309_501_971 | 154 |
| 55 | 3300049823 | Ga0501044_0463960 | Ga0501044_0463960_98_568 | 154 |
| 56 | 3300059504 | Ga0587082_021678 | Ga0587082_021678_19_489 | 154 |
| 57 | 3300060353 | Ga0501082_0083784 | Ga0501082_0083784_420_890 | 154 |
| 58 | 3300002737 | JGI25162J39368_1000891 | JGI25162J39368_100089120 | 155 |
| 59 | 3300002737 | JGI25162J39368_1001396 | JGI25162J39368_10013962 | 155 |
| 60 | 3300002738 | JGI25154J39366_1021810 | JGI25154J39366_10218101 | 155 |
| 61 | 3300002987 | JGI25159J45721_1000291 | JGI25159J45721_10002916 | 155 |
| 62 | 3300003214 | JGI25165J46597_1000406 | JGI25165J46597_100040631 | 155 |
| 63 | 3300003214 | JGI25165J46597_1000936 | JGI25165J46597_100093621 | 155 |
| 64 | 3300003214 | JGI25165J46597_1001407 | JGI25165J46597_100140713 | 155 |
| 65 | 3300003354 | JGI25160J50197_1000015 | JGI25160J50197_1000015119 | 155 |
| 66 | 3300003374 | JGI25161J50226_1000005 | JGI25161J50226_1000005121 | 155 |
| 67 | 3300004625 | Ga0055543_1000012 | Ga0055543_1000012120 | 155 |
| 68 | 3300005262 | Ga0065165_1000125 | Ga0065165_100012520 | 155 |
| 69 | 3300005339 | Ga0070660_101039030 | Ga0070660_1010390302 | 155 |
| 70 | 3300005937 | Ga0081455_10123925 | Ga0081455_101239253 | 155 |
| 71 | 3300006178 | Ga0075367_10281594 | Ga0075367_102815942 | 155 |
| 72 | 3300006353 | Ga0075370_10093917 | Ga0075370_100939172 | 155 |
| 73 | 3300009093 | Ga0105240_10019313 | Ga0105240_100193138 | 155 |
| 74 | 3300009545 | Ga0105237_10013741 | Ga0105237_100137412 | 155 |
| 75 | 3300009545 | Ga0105237_10748799 | Ga0105237_107487992 | 155 |
| 76 | 3300009551 | Ga0105238_10077095 | Ga0105238_100770952 | 155 |
| 77 | 3300013100 | Ga0157373_11273311 | Ga0157373_112733111 | 155 |
| 78 | 3300013102 | Ga0157371_10024551 | Ga0157371_100245512 | 155 |
| 79 | 3300013105 | Ga0157369_10811085 | Ga0157369_108110852 | 155 |
| 80 | 3300025207 | Ga0209760_101970 | Ga0209760_1019703 | 155 |
| 81 | 3300025231 | Ga0207427_106742 | Ga0207427_1067423 | 155 |
| 82 | 3300025233 | Ga0209437_100033 | Ga0209437_100033385 | 155 |
| 83 | 3300025233 | Ga0209437_100075 | Ga0209437_100075116 | 155 |
| 84 | 3300025246 | Ga0209646_1017848 | Ga0209646_10178481 | 155 |
| 85 | 3300025254 | Ga0209148_1015732 | Ga0209148_10157322 | 155 |
| 86 | 3300025261 | Ga0209233_1000064 | Ga0209233_100006437 | 155 |
| 87 | 3300025261 | Ga0209233_1000223 | Ga0209233_100022360 | 155 |
| 88 | 3300025261 | Ga0209233_1000342 | Ga0209233_100034231 | 155 |
| 89 | 3300025284 | Ga0209130_1000018 | Ga0209130_1000018152 | 155 |
| 90 | 3300025302 | Ga0207426_1000044 | Ga0207426_1000044237 | 155 |
| 91 | 3300025321 | Ga0207656_10176604 | Ga0207656_101766042 | 155 |
| 92 | 3300025913 | Ga0207695_10132304 | Ga0207695_101323044 | 155 |
| 93 | 3300025914 | Ga0207671_10013562 | Ga0207671_100135622 | 155 |
| 94 | 3300025924 | Ga0207694_10099971 | Ga0207694_100999713 | 155 |
| 95 | 3300025925 | Ga0207650_10009305 | Ga0207650_100093056 | 155 |
| 96 | 3300026118 | Ga0207675_100705098 | Ga0207675_1007050982 | 155 |
| 97 | 3300027312 | Ga0209371_1000420 | Ga0209371_10004205 | 155 |
| 98 | 3300028794 | Ga0307515_10029068 | Ga0307515_100290687 | 155 |
| 99 | 3300030500 | Ga0268256_1008134 | Ga0268256_10081343 | 155 |
| 100 | 3300031456 | Ga0307513_10268229 | Ga0307513_102682294 | 155 |
| 101 | 3300031730 | Ga0307516_10271711 | Ga0307516_102717111 | 155 |
| 102 | 3300035085 | Ga0373929_0038548 | Ga0373929_0038548_552_1022 | 155 |
| 103 | 3300037418 | Ga0395900_1010126 | Ga0395900_1010126_30_500 | 155 |
| 104 | 3300037471 | Ga0395905_0223445 | Ga0395905_0223445_851_1321 | 155 |
| 105 | 3300037471 | Ga0395905_0524883 | Ga0395905_0524883_526_996 | 155 |
| 106 | 3300038443 | Ga0395901_1859049 | Ga0395901_1859049_69_539 | 155 |
| 107 | 3300044684 | Ga0466966_0178657 | Ga0466966_0178657_51_521 | 155 |
| 108 | 3300044719 | Ga0466971_0135568 | Ga0466971_0135568_634_1104 | 155 |
| 109 | 3300044735 | Ga0466968_0287072 | Ga0466968_0287072_214_684 | 155 |
| 110 | 3300044765 | Ga0466970_0095817 | Ga0466970_0095817_202_672 | 155 |
| 111 | 3300044842 | Ga0466957_0206375 | Ga0466957_0206375_176_646 | 155 |
| 112 | 3300045049 | Ga0466959_0168252 | Ga0466959_0168252_183_653 | 155 |
| 113 | 3300045976 | Ga0466967_1130759 | Ga0466967_1130759_125_595 | 155 |
| 114 | 3300045976 | Ga0466967_2077699 | Ga0466967_2077699_70_540 | 155 |
| 115 | 3300046507 | Ga0495606_0004680 | Ga0495606_0004680_5890_6360 | 155 |
| 116 | 3300046507 | Ga0495606_0054338 | Ga0495606_0054338_2107_2577 | 155 |
| 117 | 3300048903 | Ga0496100_0613345 | Ga0496100_0613345_268_738 | 155 |
| 118 | 3300048906 | Ga0496103_0475240 | Ga0496103_0475240_163_633 | 155 |
| 119 | 3300048918 | Ga0496115_0905057 | Ga0496115_0905057_111_581 | 155 |
| 120 | 3300048920 | Ga0496117_0225334 | Ga0496117_0225334_532_1002 | 155 |
| 121 | 3300048920 | Ga0496117_0506246 | Ga0496117_0506246_42_512 | 155 |
| 122 | 3300048922 | Ga0496119_0045279 | Ga0496119_0045279_62_532 | 155 |
| 123 | 3300048922 | Ga0496119_0050788 | Ga0496119_0050788_1181_1651 | 155 |
| 124 | 3300048923 | Ga0496120_0001486 | Ga0496120_0001486_2175_2645 | 155 |
| 125 | 3300048923 | Ga0496120_0070103 | Ga0496120_0070103_71_541 | 155 |
| 126 | 3300048924 | Ga0496121_0023237 | Ga0496121_0023237_5223_5693 | 155 |
| 127 | 3300048925 | Ga0496122_0064930 | Ga0496122_0064930_2116_2586 | 155 |
| 128 | 3300048927 | Ga0496124_0076170 | Ga0496124_0076170_2191_2661 | 155 |
| 129 | 3300048928 | Ga0496125_0093025 | Ga0496125_0093025_96_566 | 155 |
| 130 | 3300048929 | Ga0496126_0179420 | Ga0496126_0179420_954_1424 | 155 |
| 131 | 3300050492 | nmdc:mga0yw44_1095889_c1 | nmdc:mga0yw44_1095889_c1_58_528 | 155 |
| 132 | 3300050494 | nmdc:mga06z11_59121_c1 | nmdc:mga06z11_59121_c1_353_823 | 155 |
| 133 | 3300050516 | nmdc:mga0sz30_87465_c1 | nmdc:mga0sz30_87465_c1_372_842 | 155 |
| 134 | 3300059514 | Ga0587095_003995 | Ga0587095_003995_18_488 | 155 |
| 135 | 3300059608 | Ga0587129_017446 | Ga0587129_017446_94_564 | 155 |
| 136 | 3300059623 | Ga0587101_014842 | Ga0587101_014842_12_482 | 155 |
| 137 | 3300059631 | Ga0587130_024773 | Ga0587130_024773_96_566 | 155 |
| 138 | 3300059640 | Ga0587067_123612 | Ga0587067_123612_142_612 | 155 |
| 139 | 3300059650 | Ga0587104_015989 | Ga0587104_015989_19_489 | 155 |
| 140 | iso_pu_bacteria | 2503198000 | 2503202938 | 155 |
| 141 | iso_pu_bacteria | 2508501123 | 2509115343 | 155 |
| 142 | iso_pu_bacteria | 2508501127 | 2509145241 | 155 |
| 143 | iso_pu_bacteria | 2509276018 | 2509372336 | 155 |
| 144 | iso_pu_bacteria | 2509276022 | 2509397418 | 155 |
| 145 | iso_pu_bacteria | 2510065059 | 2510317860 | 155 |
| 146 | iso_pu_bacteria | 2512875016 | 2512930245 | 155 |
| 147 | iso_pu_bacteria | 2512875024 | 2512957998 | 155 |
| 148 | iso_pu_bacteria | 2513237164 | 2514032862 | 155 |
| 149 | iso_pu_bacteria | 2513237305 | 2514418756 | 155 |
| 150 | iso_pu_bacteria | 2588253730 | 2588515893 | 155 |
| 151 | iso_pu_bacteria | 2597489875 | 2597814447 | 155 |
| 152 | iso_pu_bacteria | 2643221580 | 2643910260 | 155 |
| 153 | iso_pu_bacteria | 2643221591 | 2643963889 | 155 |
| 154 | iso_pu_bacteria | 2643221595 | 2643986842 | 155 |
| 155 | iso_pu_bacteria | 2643221627 | 2644157685 | 155 |
| 156 | iso_pu_bacteria | 2643221674 | 2644410816 | 155 |
| 157 | iso_pu_bacteria | 2687453392 | 2688599790 | 155 |
| 158 | iso_pu_bacteria | 2721755686 | 2723576567 | 155 |
| 159 | iso_pu_bacteria | 2756170246 | 2756676004 | 155 |
| 160 | iso_pu_bacteria | 2757320392 | 2757571656 | 155 |
| 161 | iso_pu_bacteria | 2791355123 | 2792745908 | 155 |
| 162 | iso_pu_bacteria | 2837678835 | 2837679434 | 155 |
| 163 | iso_pu_bacteria | 2837678835 | 2837682912 | 155 |
| 164 | iso_pu_bacteria | 2841734538 | 2841740747 | 155 |
| 165 | iso_pu_bacteria | 2844002411 | 2844007098 | 155 |
| 166 | iso_pu_bacteria | 2844009547 | 2844015078 | 155 |
| 167 | iso_pu_bacteria | 2856320880 | 2856324738 | 155 |
| 168 | iso_pu_bacteria | 2856328259 | 2856333069 | 155 |
| 169 | iso_pu_bacteria | 2856334872 | 2856337627 | 155 |
| 170 | iso_pu_bacteria | 2856342000 | 2856349278 | 155 |
| 171 | iso_pu_bacteria | 2857367948 | 2857368986 | 155 |
| 172 | iso_pu_bacteria | 2869162929 | 2869166880 | 155 |
| 173 | iso_pu_bacteria | 2869169390 | 2869176471 | 155 |
| 174 | iso_pu_bacteria | 2869234852 | 2869236195 | 155 |
| 175 | iso_pu_bacteria | 2869249662 | 2869255369 | 155 |
| 176 | iso_pu_bacteria | 2869256925 | 2869257053 | 155 |
| 177 | iso_pu_bacteria | 2869264136 | 2869265653 | 155 |
| 178 | iso_pu_bacteria | 2869271264 | 2869273435 | 155 |
| 179 | iso_pu_bacteria | 2869278585 | 2869281271 | 155 |
| 180 | iso_pu_bacteria | 2871451962 | 2871455053 | 155 |
| 181 | iso_pu_bacteria | 2871459585 | 2871464262 | 155 |
| 182 | iso_pu_bacteria | 2871466892 | 2871469991 | 155 |
| 183 | iso_pu_bacteria | 2871474448 | 2871478710 | 155 |
| 184 | iso_pu_bacteria | 2871481445 | 2871481926 | 155 |
| 185 | iso_pu_bacteria | 2874109183 | 2874116271 | 155 |
| 186 | iso_pu_bacteria | 2874116593 | 2874123396 | 155 |
| 187 | iso_pu_bacteria | 2874131515 | 2874138177 | 155 |
| 188 | iso_pu_bacteria | 2874139085 | 2874141063 | 155 |
| 189 | iso_pu_bacteria | 2874162495 | 2874166194 | 155 |
| 190 | iso_pu_bacteria | 2874168670 | 2874170246 | 155 |
| 191 | iso_pu_bacteria | 2876363079 | 2876366190 | 155 |
| 192 | iso_pu_bacteria | 2876399893 | 2876403470 | 155 |
| 193 | iso_pu_bacteria | 2876406927 | 2876413185 | 155 |
| 194 | iso_pu_bacteria | 2876420981 | 2876426576 | 155 |
| 195 | iso_pu_bacteria | 2878730984 | 2878735904 | 155 |
| 196 | iso_pu_bacteria | 2878738818 | 2878742845 | 155 |
| 197 | iso_pu_bacteria | 2878774303 | 2878778179 | 155 |
| 198 | iso_pu_bacteria | 2878781027 | 2878783388 | 155 |
| 199 | iso_pu_bacteria | 2878788777 | 2878789796 | 155 |
| 200 | iso_pu_bacteria | 2882632389 | 2882633371 | 155 |
| 201 | iso_pu_bacteria | 2885312484 | 2885316741 | 155 |
| 202 | iso_pu_bacteria | 2888337043 | 2888340974 | 155 |
| 203 | iso_pu_bacteria | 2888343758 | 2888348176 | 155 |
| 204 | iso_pu_bacteria | 2903448605 | 2903452394 | 155 |
| 205 | iso_pu_bacteria | 2903513507 | 2903518702 | 155 |
| 206 | iso_pu_bacteria | 2903521522 | 2903524058 | 155 |
| 207 | iso_pu_bacteria | 2903528002 | 2903533759 | 155 |
| 208 | iso_pu_bacteria | 2906363423 | 2906370069 | 155 |
| 209 | iso_pu_bacteria | 2906370794 | 2906375930 | 155 |
| 210 | iso_pu_bacteria | 2906378014 | 2906384205 | 155 |
| 211 | iso_pu_bacteria | 2906393657 | 2906398934 | 155 |
| 212 | iso_pu_bacteria | 2906401398 | 2906405845 | 155 |
| 213 | iso_pu_bacteria | 2906408224 | 2906409495 | 155 |
| 214 | iso_pu_bacteria | 2906427513 | 2906433845 | 155 |
| 215 | iso_pu_bacteria | 2919679072 | 2919682460 | 155 |
| 216 | iso_pu_bacteria | 2922151315 | 2922155018 | 155 |
| 217 | iso_pu_bacteria | 2922172374 | 2922175900 | 155 |
| 218 | iso_pu_bacteria | 2922178524 | 2922180976 | 155 |
| 219 | iso_pu_bacteria | 2924710171 | 2924714253 | 155 |
| 220 | iso_pu_bacteria | 2924733363 | 2924735031 | 155 |
| 221 | iso_pu_bacteria | 2924741084 | 2924744038 | 155 |
| 222 | iso_pu_bacteria | 2924748358 | 2924752047 | 155 |
| 223 | iso_pu_bacteria | 2924754689 | 2924756888 | 155 |
| 224 | iso_pu_bacteria | 2924762789 | 2924763445 | 155 |
| 225 | iso_pu_bacteria | 2924776078 | 2924780645 | 155 |
| 226 | iso_pu_bacteria | 2932401849 | 2932403678 | 155 |
| 227 | iso_pu_bacteria | 2937822353 | 2937823588 | 155 |
| 228 | iso_pu_bacteria | 2937836603 | 2937836918 | 155 |
| 229 | iso_pu_bacteria | 2937848649 | 2937854383 | 155 |
| 230 | iso_pu_bacteria | 2937861824 | 2937862436 | 155 |
| 231 | iso_pu_bacteria | 2937877337 | 2937879855 | 155 |
| 232 | iso_pu_bacteria | 2937972304 | 2937974549 | 155 |
| 233 | iso_pu_bacteria | 2937980651 | 2937987654 | 155 |
| 234 | iso_pu_bacteria | 2958034702 | 2958037233 | 155 |
| 235 | iso_pu_bacteria | 2958041894 | 2958046945 | 155 |
| 236 | iso_pu_bacteria | 2958064165 | 2958067457 | 155 |
| 237 | iso_pu_bacteria | 2958071322 | 2958076809 | 155 |
| 238 | iso_pu_bacteria | 2958084443 | 2958087033 | 155 |
| 239 | iso_pu_bacteria | 2958108152 | 2958111169 | 155 |
| 240 | iso_pu_bacteria | 2958122699 | 2958122703 | 155 |
| 241 | iso_pu_bacteria | 2958137437 | 2958138229 | 155 |
| 242 | iso_pu_bacteria | 2958158011 | 2958160694 | 155 |
| 243 | iso_pu_bacteria | 2961183825 | 2961188628 | 155 |
| 244 | iso_pu_bacteria | 2963644680 | 2963648986 | 155 |
| 245 | iso_pu_bacteria | 2965025482 | 2965028036 | 155 |
| 246 | iso_pu_bacteria | 2965032056 | 2965039199 | 155 |
| 247 | iso_pu_bacteria | 2965040258 | 2965045329 | 155 |
| 248 | iso_pu_bacteria | 2965047637 | 2965052072 | 155 |
| 249 | iso_pu_bacteria | 2965089291 | 2965090028 | 155 |
| 250 | iso_pu_bacteria | 2965102966 | 2965106858 | 155 |
| 251 | iso_pu_bacteria | 2968016561 | 2968019949 | 155 |
| 252 | iso_pu_bacteria | 2968083720 | 2968084174 | 155 |
| 253 | iso_pu_bacteria | 2970469710 | 2970473270 | 155 |
| 254 | iso_pu_bacteria | 2970489779 | 2970495394 | 155 |
| 255 | iso_pu_bacteria | 2970510686 | 2970510722 | 155 |
| 256 | iso_pu_bacteria | 2970524798 | 2970531499 | 155 |
| 257 | iso_pu_bacteria | 2970532167 | 2970535181 | 155 |
| 258 | iso_pu_bacteria | 2970540015 | 2970544371 | 155 |
| 259 | iso_pu_bacteria | 2970547951 | 2970549132 | 155 |
| 260 | iso_pu_bacteria | 2970593180 | 2970595875 | 155 |
| 261 | iso_pu_bacteria | 2970619444 | 2970622827 | 155 |
| 262 | iso_pu_bacteria | 2970627176 | 2970628008 | 155 |
| 263 | iso_pu_bacteria | 2977851361 | 2977852461 | 155 |
| 264 | iso_pu_bacteria | 2977872689 | 2977873121 | 155 |
| 265 | iso_pu_bacteria | 2977898635 | 2977904202 | 155 |
| 266 | iso_pu_bacteria | 2977907340 | 2977910719 | 155 |
| 267 | iso_pu_bacteria | 2977915119 | 2977922331 | 155 |
| 268 | iso_pu_bacteria | 2977922695 | 2977926796 | 155 |
| 269 | iso_pu_bacteria | 2977935797 | 2977939241 | 155 |
| 270 | iso_pu_bacteria | 2977950692 | 2977953415 | 155 |
| 271 | iso_pu_bacteria | 2977957713 | 2977958613 | 155 |
| 272 | iso_pu_bacteria | 2977986579 | 2977992559 | 155 |
| 273 | iso_pu_bacteria | 2979764755 | 2979767217 | 155 |
| 274 | iso_pu_bacteria | 2979772303 | 2979779699 | 155 |
| 275 | iso_pu_bacteria | 2979793036 | 2979797513 | 155 |
| 276 | iso_pu_bacteria | 2987645492 | 2987645997 | 155 |
| 277 | iso_pu_bacteria | 2987666974 | 2987667728 | 155 |
| 278 | iso_pu_bacteria | 2987673487 | 2987679336 | 155 |
| 279 | iso_pu_bacteria | 2996348954 | 2996351539 | 155 |
| 280 | iso_pu_bacteria | 2996386984 | 2996389433 | 155 |
| 281 | iso_pu_bacteria | 3000135777 | 3000138916 | 155 |
| 282 | iso_pu_bacteria | 3004167301 | 3004170502 | 155 |
| 283 | iso_pu_bacteria | 3004195979 | 3004197823 | 155 |
| 284 | iso_pu_bacteria | 3004211236 | 3004214992 | 155 |
| 285 | iso_pu_bacteria | 3004218560 | 3004222417 | 155 |
| 286 | iso_pu_bacteria | 3004239961 | 3004242950 | 155 |
| 287 | iso_pu_bacteria | 3004248173 | 3004249655 | 155 |
| 288 | iso_pu_bacteria | 3004268573 | 3004272377 | 155 |
| 289 | iso_pu_bacteria | 3004275668 | 3004278239 | 155 |
| 290 | iso_pu_bacteria | 3004289098 | 3004289220 | 155 |
| 291 | iso_pu_bacteria | 3004334049 | 3004339837 | 155 |
| 292 | iso_pu_bacteria | 637000159 | 637080025 | 155 |
| 293 | iso_pu_bacteria | 649633066 | 649874296 | 155 |
| 294 | iso_pu_bacteria | 8004300914 | 8004307338 | 155 |
| 295 | iso_pu_bacteria | 8004312739 | 8004315297 | 155 |
| 296 | iso_pu_bacteria | 8004361976 | 8004362133 | 155 |
| 297 | iso_pu_bacteria | 8004395343 | 8004402278 | 155 |
| 298 | iso_pu_bacteria | 8004633249 | 8004640058 | 155 |
| 299 | iso_pu_bacteria | 8004695233 | 8004697816 | 155 |
| 300 | iso_pu_bacteria | 8004727605 | 8004727945 | 155 |
| 301 | iso_pu_bacteria | 8055617313 | 8055622295 | 155 |
| 302 | 3300003203 | JGI25406J46586_10006588 | JGI25406J46586_100065886 | 156 |
| 303 | 3300005328 | Ga0070676_10092242 | Ga0070676_100922422 | 156 |
| 304 | 3300005334 | Ga0068869_100223463 | Ga0068869_1002234632 | 156 |
| 305 | 3300005343 | Ga0070687_100649982 | Ga0070687_1006499821 | 156 |
| 306 | 3300005439 | Ga0070711_100118311 | Ga0070711_1001183112 | 156 |
| 307 | 3300005466 | Ga0070685_10050558 | Ga0070685_100505582 | 156 |
| 308 | 3300005466 | Ga0070685_10404867 | Ga0070685_104048671 | 156 |
| 309 | 3300005577 | Ga0068857_100094136 | Ga0068857_1000941363 | 156 |
| 310 | 3300005985 | Ga0081539_10001367 | Ga0081539_1000136720 | 156 |
| 311 | 3300009101 | Ga0105247_10021678 | Ga0105247_100216783 | 156 |
| 312 | 3300013308 | Ga0157375_10020497 | Ga0157375_100204978 | 156 |
| 313 | 3300014325 | Ga0163163_10204954 | Ga0163163_102049542 | 156 |
| 314 | 3300025907 | Ga0207645_10207260 | Ga0207645_102072601 | 156 |
| 315 | 3300025918 | Ga0207662_10364326 | Ga0207662_103643261 | 156 |
| 316 | 3300025927 | Ga0207687_10181792 | Ga0207687_101817922 | 156 |
| 317 | 3300025936 | Ga0207670_10561878 | Ga0207670_105618781 | 156 |
| 318 | 3300025942 | Ga0207689_10028650 | Ga0207689_100286503 | 156 |
| 319 | 3300026095 | Ga0207676_10594010 | Ga0207676_105940102 | 156 |
| 320 | 3300026116 | Ga0207674_10151163 | Ga0207674_101511632 | 156 |
| 321 | 3300026142 | Ga0207698_10756852 | Ga0207698_107568522 | 156 |
| 322 | 3300028794 | Ga0307515_10000070 | Ga0307515_1000007067 | 156 |
| 323 | 3300031456 | Ga0307513_10000404 | Ga0307513_100004045 | 156 |
| 324 | 3300031852 | Ga0307410_10363408 | Ga0307410_103634082 | 156 |
| 325 | 3300037418 | Ga0395900_0160673 | Ga0395900_0160673_560_1036 | 156 |
| 326 | 3300037466 | Ga0395898_1084799 | Ga0395898_1084799_12_488 | 156 |
| 327 | 3300044683 | Ga0466965_0226700 | Ga0466965_0226700_504_980 | 156 |
| 328 | 3300046474 | Ga0495605_0073211 | Ga0495605_0073211_57_533 | 156 |
| 329 | 3300048908 | Ga0496105_0402236 | Ga0496105_0402236_382_852 | 156 |
| 330 | 3300048912 | Ga0496109_0263234 | Ga0496109_0263234_1080_1550 | 156 |
| 331 | 3300048915 | Ga0496112_0250149 | Ga0496112_0250149_911_1381 | 156 |
| 332 | 3300048925 | Ga0496122_0311863 | Ga0496122_0311863_20_493 | 156 |
| 333 | 3300048926 | Ga0496123_0023865 | Ga0496123_0023865_2653_3126 | 156 |
| 334 | 3300048928 | Ga0496125_0466968 | Ga0496125_0466968_52_525 | 156 |
| 335 | 3300049569 | Ga0501032_0050930 | Ga0501032_0050930_1295_1768 | 156 |
| 336 | 3300049569 | Ga0501032_0138096 | Ga0501032_0138096_679_1158 | 156 |
| 337 | 3300049569 | Ga0501032_0533947 | Ga0501032_0533947_78_551 | 156 |
| 338 | 3300049569 | Ga0501032_0795208 | Ga0501032_0795208_86_565 | 156 |
| 339 | 3300049572 | Ga0501036_0042676 | Ga0501036_0042676_1116_1589 | 156 |
| 340 | 3300049572 | Ga0501036_0301549 | Ga0501036_0301549_73_552 | 156 |
| 341 | 3300049573 | Ga0501037_0171344 | Ga0501037_0171344_589_1068 | 156 |
| 342 | 3300049573 | Ga0501037_0465129 | Ga0501037_0465129_129_602 | 156 |
| 343 | 3300049574 | Ga0501038_0304569 | Ga0501038_0304569_257_730 | 156 |
| 344 | 3300049574 | Ga0501038_1235444 | Ga0501038_1235444_54_527 | 156 |
| 345 | 3300049575 | Ga0501039_0634609 | Ga0501039_0634609_299_778 | 156 |
| 346 | 3300049579 | Ga0501043_0203129 | Ga0501043_0203129_426_899 | 156 |
| 347 | 3300049579 | Ga0501043_0208501 | Ga0501043_0208501_1000_1473 | 156 |
| 348 | 3300049581 | Ga0501047_1200710 | Ga0501047_1200710_82_555 | 156 |
| 349 | 3300049583 | Ga0501067_0509814 | Ga0501067_0509814_155_628 | 156 |
| 350 | 3300049589 | Ga0501073_0186435 | Ga0501073_0186435_570_1049 | 156 |
| 351 | 3300049589 | Ga0501073_0196681 | Ga0501073_0196681_669_1142 | 156 |
| 352 | 3300049589 | Ga0501073_0622362 | Ga0501073_0622362_219_692 | 156 |
| 353 | 3300049744 | Ga0501083_0006866 | Ga0501083_0006866_474_947 | 156 |
| 354 | 3300049822 | Ga0501035_0997831 | Ga0501035_0997831_98_571 | 156 |
| 355 | 3300049823 | Ga0501044_0152284 | Ga0501044_0152284_60_539 | 156 |
| 356 | 3300049823 | Ga0501044_0472122 | Ga0501044_0472122_647_1120 | 156 |
| 357 | 3300049823 | Ga0501044_1034380 | Ga0501044_1034380_74_547 | 156 |
| 358 | 3300053140 | Ga0500573_0001398 | Ga0500573_0001398_10543_11016 | 156 |
| 359 | 3300053140 | Ga0500573_0465340 | Ga0500573_0465340_95_568 | 156 |
| 360 | 3300053142 | Ga0500577_0159622 | Ga0500577_0159622_410_883 | 156 |
| 361 | 3300059507 | Ga0587086_061741 | Ga0587086_061741_20_496 | 156 |
| 362 | 3300059646 | Ga0587078_013417 | Ga0587078_013417_141_611 | 156 |
| 363 | 3300060353 | Ga0501082_0068033 | Ga0501082_0068033_267_740 | 156 |
| 364 | 3300005339 | Ga0070660_100142969 | Ga0070660_1001429692 | 157 |
| 365 | 3300005347 | Ga0070668_100382511 | Ga0070668_1003825112 | 157 |
| 366 | 3300005548 | Ga0070665_100016148 | Ga0070665_1000161484 | 157 |
| 367 | 3300005983 | Ga0081540_1044223 | Ga0081540_10442232 | 157 |
| 368 | 3300006038 | Ga0075365_10132744 | Ga0075365_101327442 | 157 |
| 369 | 3300006177 | Ga0075362_10018661 | Ga0075362_100186613 | 157 |
| 370 | 3300006186 | Ga0075369_10005107 | Ga0075369_100051077 | 157 |
| 371 | 3300006353 | Ga0075370_10439119 | Ga0075370_104391192 | 157 |
| 372 | 3300009101 | Ga0105247_10896740 | Ga0105247_108967401 | 157 |
| 373 | 3300009545 | Ga0105237_11633432 | Ga0105237_116334321 | 157 |
| 374 | 3300025914 | Ga0207671_11433902 | Ga0207671_114339021 | 157 |
| 375 | 3300026116 | Ga0207674_10741057 | Ga0207674_107410572 | 157 |
| 376 | 3300026118 | Ga0207675_101486986 | Ga0207675_1014869861 | 157 |
| 377 | 3300037312 | Ga0395899_0000059 | Ga0395899_0000059_129626_130105 | 157 |
| 378 | 3300037418 | Ga0395900_0000017 | Ga0395900_0000017_129626_130105 | 157 |
| 379 | 3300037418 | Ga0395900_0158818 | Ga0395900_0158818_891_1367 | 157 |
| 380 | 3300037418 | Ga0395900_0354772 | Ga0395900_0354772_538_1014 | 157 |
| 381 | 3300037418 | Ga0395900_0569673 | Ga0395900_0569673_527_1003 | 157 |
| 382 | 3300037466 | Ga0395898_0000030 | Ga0395898_0000030_129601_130080 | 157 |
| 383 | 3300037466 | Ga0395898_0092373 | Ga0395898_0092373_1187_1663 | 157 |
| 384 | 3300037471 | Ga0395905_0000056 | Ga0395905_0000056_79126_79605 | 157 |
| 385 | 3300038443 | Ga0395901_0000015 | Ga0395901_0000015_239498_239977 | 157 |
| 386 | 3300038443 | Ga0395901_0418998 | Ga0395901_0418998_400_876 | 157 |
| 387 | 3300041413 | Ga0439465_0044671 | Ga0439465_0044671_80_556 | 157 |
| 388 | 3300041486 | Ga0451807_0868095 | Ga0451807_0868095_106_585 | 157 |
| 389 | 3300042004 | Ga0439445_0031169 | Ga0439445_0031169_155_631 | 157 |
| 390 | 3300048915 | Ga0496112_0462719 | Ga0496112_0462719_276_752 | 157 |
| 391 | 3300048929 | Ga0496126_1208102 | Ga0496126_1208102_45_524 | 157 |
| 392 | 3300049568 | Ga0501031_0335658 | Ga0501031_0335658_436_915 | 157 |
| 393 | 3300049569 | Ga0501032_0000116 | Ga0501032_0000116_53467_53943 | 157 |
| 394 | 3300049569 | Ga0501032_0062914 | Ga0501032_0062914_886_1365 | 157 |
| 395 | 3300049569 | Ga0501032_0088847 | Ga0501032_0088847_452_931 | 157 |
| 396 | 3300049570 | Ga0501033_0000346 | Ga0501033_0000346_5842_6318 | 157 |
| 397 | 3300049570 | Ga0501033_0014554 | Ga0501033_0014554_559_1038 | 157 |
| 398 | 3300049571 | Ga0501034_0000314 | Ga0501034_0000314_68824_69300 | 157 |
| 399 | 3300049571 | Ga0501034_0047815 | Ga0501034_0047815_559_1038 | 157 |
| 400 | 3300049571 | Ga0501034_0049225 | Ga0501034_0049225_3637_4113 | 157 |
| 401 | 3300049571 | Ga0501034_0051624 | Ga0501034_0051624_337_813 | 157 |
| 402 | 3300049572 | Ga0501036_0000117 | Ga0501036_0000117_43417_43893 | 157 |
| 403 | 3300049572 | Ga0501036_0043949 | Ga0501036_0043949_416_895 | 157 |
| 404 | 3300049572 | Ga0501036_1597126 | Ga0501036_1597126_37_513 | 157 |
| 405 | 3300049573 | Ga0501037_0000108 | Ga0501037_0000108_68381_68857 | 157 |
| 406 | 3300049573 | Ga0501037_0273574 | Ga0501037_0273574_130_606 | 157 |
| 407 | 3300049574 | Ga0501038_0000126 | Ga0501038_0000126_53339_53815 | 157 |
| 408 | 3300049575 | Ga0501039_0000003 | Ga0501039_0000003_219461_219937 | 157 |
| 409 | 3300049575 | Ga0501039_0172074 | Ga0501039_0172074_134_613 | 157 |
| 410 | 3300049575 | Ga0501039_0503767 | Ga0501039_0503767_459_932 | 157 |
| 411 | 3300049576 | Ga0501040_0319660 | Ga0501040_0319660_75_554 | 157 |
| 412 | 3300049576 | Ga0501040_0447364 | Ga0501040_0447364_227_700 | 157 |
| 413 | 3300049578 | Ga0501042_0067691 | Ga0501042_0067691_1289_1768 | 157 |
| 414 | 3300049578 | Ga0501042_0445465 | Ga0501042_0445465_123_599 | 157 |
| 415 | 3300049578 | Ga0501042_0600174 | Ga0501042_0600174_295_768 | 157 |
| 416 | 3300049579 | Ga0501043_0000419 | Ga0501043_0000419_24539_25015 | 157 |
| 417 | 3300049579 | Ga0501043_0032430 | Ga0501043_0032430_1121_1600 | 157 |
| 418 | 3300049579 | Ga0501043_0128903 | Ga0501043_0128903_881_1357 | 157 |
| 419 | 3300049579 | Ga0501043_0871379 | Ga0501043_0871379_155_631 | 157 |
| 420 | 3300049580 | Ga0501046_0071734 | Ga0501046_0071734_35_511 | 157 |
| 421 | 3300049581 | Ga0501047_0011716 | Ga0501047_0011716_5994_6473 | 157 |
| 422 | 3300049581 | Ga0501047_0085689 | Ga0501047_0085689_876_1352 | 157 |
| 423 | 3300049581 | Ga0501047_0121166 | Ga0501047_0121166_671_1147 | 157 |
| 424 | 3300049581 | Ga0501047_0166040 | Ga0501047_0166040_1547_2023 | 157 |
| 425 | 3300049582 | Ga0501048_0348102 | Ga0501048_0348102_448_921 | 157 |
| 426 | 3300049584 | Ga0501068_0354415 | Ga0501068_0354415_56_535 | 157 |
| 427 | 3300049586 | Ga0501070_0048340 | Ga0501070_0048340_2863_3342 | 157 |
| 428 | 3300049587 | Ga0501071_0170435 | Ga0501071_0170435_885_1364 | 157 |
| 429 | 3300049587 | Ga0501071_0277632 | Ga0501071_0277632_315_788 | 157 |
| 430 | 3300049588 | Ga0501072_0197359 | Ga0501072_0197359_625_1098 | 157 |
| 431 | 3300049590 | Ga0501074_0138546 | Ga0501074_0138546_1033_1512 | 157 |
| 432 | 3300049741 | Ga0501079_0377588 | Ga0501079_0377588_80_559 | 157 |
| 433 | 3300049742 | Ga0501080_0181650 | Ga0501080_0181650_168_647 | 157 |
| 434 | 3300049743 | Ga0501081_0455081 | Ga0501081_0455081_459_932 | 157 |
| 435 | 3300049744 | Ga0501083_0165973 | Ga0501083_0165973_383_862 | 157 |
| 436 | 3300049822 | Ga0501035_0000032 | Ga0501035_0000032_137250_137726 | 157 |
| 437 | 3300049822 | Ga0501035_0012273 | Ga0501035_0012273_559_1038 | 157 |
| 438 | 3300049822 | Ga0501035_0238711 | Ga0501035_0238711_704_1180 | 157 |
| 439 | 3300049822 | Ga0501035_0600271 | Ga0501035_0600271_271_744 | 157 |
| 440 | 3300049823 | Ga0501044_0298762 | Ga0501044_0298762_559_1038 | 157 |
| 441 | 3300049823 | Ga0501044_0480636 | Ga0501044_0480636_413_889 | 157 |
| 442 | 3300049824 | Ga0501045_0604184 | Ga0501045_0604184_18_494 | 157 |
| 443 | 3300049824 | Ga0501045_0648256 | Ga0501045_0648256_168_647 | 157 |
| 444 | 3300050489 | nmdc:mga03683_28037_c1 | nmdc:mga03683_28037_c1_481_957 | 157 |
| 445 | 3300050492 | nmdc:mga0yw44_82110_c1 | nmdc:mga0yw44_82110_c1_336_812 | 157 |
| 446 | 3300050494 | nmdc:mga06z11_57898_c1 | nmdc:mga06z11_57898_c1_561_1037 | 157 |
| 447 | 3300050495 | nmdc:mga04h51_20696_c1 | nmdc:mga04h51_20696_c1_235_711 | 157 |
| 448 | 3300050495 | nmdc:mga04h51_276630_c1 | nmdc:mga04h51_276630_c1_115_591 | 157 |
| 449 | 3300050516 | nmdc:mga0sz30_4292_c1 | nmdc:mga0sz30_4292_c1_3864_4340 | 157 |
| 450 | 3300053139 | Ga0500568_0000059 | Ga0500568_0000059_99934_100410 | 157 |
| 451 | 3300060353 | Ga0501082_0618417 | Ga0501082_0618417_204_677 | 157 |
| 452 | 3300005455 | Ga0070663_100109857 | Ga0070663_1001098572 | 158 |
| 453 | 3300005937 | Ga0081455_10034109 | Ga0081455_100341095 | 158 |
| 454 | 3300006038 | Ga0075365_10083984 | Ga0075365_100839842 | 158 |
| 455 | 3300013102 | Ga0157371_10094952 | Ga0157371_100949522 | 158 |
| 456 | 3300025294 | Ga0209025_1158021 | Ga0209025_11580211 | 158 |
| 457 | 3300025949 | Ga0207667_10313344 | Ga0207667_103133441 | 158 |
| 458 | 3300026035 | Ga0207703_10276225 | Ga0207703_102762252 | 158 |
| 459 | 3300026067 | Ga0207678_10018943 | Ga0207678_100189432 | 158 |
| 460 | 3300031731 | Ga0307405_10094861 | Ga0307405_100948613 | 158 |
| 461 | 3300031824 | Ga0307413_10114710 | Ga0307413_101147102 | 158 |
| 462 | 3300031903 | Ga0307407_10423169 | Ga0307407_104231691 | 158 |
| 463 | 3300031995 | Ga0307409_100692992 | Ga0307409_1006929922 | 158 |
| 464 | 3300031995 | Ga0307409_100804274 | Ga0307409_1008042742 | 158 |
| 465 | 3300031995 | Ga0307409_101550784 | Ga0307409_1015507842 | 158 |
| 466 | 3300032004 | Ga0307414_10338865 | Ga0307414_103388653 | 158 |
| 467 | 3300032004 | Ga0307414_10357464 | Ga0307414_103574642 | 158 |
| 468 | 3300032005 | Ga0307411_12065141 | Ga0307411_120651411 | 158 |
| 469 | 3300032168 | Ga0316593_10134284 | Ga0316593_101342842 | 158 |
| 470 | 3300038742 | Ga0400486_18150 | Ga0400486_18150_306_788 | 158 |
| 471 | 3300039110 | Ga0400487_31446 | Ga0400487_31446_511_993 | 158 |
| 472 | 3300044901 | Ga0466960_0574826 | Ga0466960_0574826_160_642 | 158 |
| 473 | 3300046460 | Ga0495638_0003767 | Ga0495638_0003767_6825_7304 | 158 |
| 474 | 3300048913 | Ga0496110_0051018 | Ga0496110_0051018_1866_2348 | 158 |
| 475 | 3300048914 | Ga0496111_0117078 | Ga0496111_0117078_584_1066 | 158 |
| 476 | 3300048924 | Ga0496121_0413400 | Ga0496121_0413400_124_606 | 158 |
| 477 | 3300048926 | Ga0496123_0338621 | Ga0496123_0338621_197_679 | 158 |
| 478 | 3300048927 | Ga0496124_0243599 | Ga0496124_0243599_516_998 | 158 |
| 479 | 3300048928 | Ga0496125_0000276 | Ga0496125_0000276_66748_67230 | 158 |
| 480 | 3300049161 | Ga0501305_017115 | Ga0501305_017115_473_955 | 158 |
| 481 | 3300049527 | Ga0501311_017035 | Ga0501311_017035_399_881 | 158 |
| 482 | 3300049535 | Ga0501319_003996 | Ga0501319_003996_13_495 | 158 |
| 483 | 3300049568 | Ga0501031_0034948 | Ga0501031_0034948_777_1256 | 158 |
| 484 | 3300049568 | Ga0501031_0207658 | Ga0501031_0207658_769_1245 | 158 |
| 485 | 3300049569 | Ga0501032_0020397 | Ga0501032_0020397_4046_4525 | 158 |
| 486 | 3300049569 | Ga0501032_0068747 | Ga0501032_0068747_1807_2283 | 158 |
| 487 | 3300049569 | Ga0501032_0800361 | Ga0501032_0800361_61_537 | 158 |
| 488 | 3300049570 | Ga0501033_0005442 | Ga0501033_0005442_8205_8681 | 158 |
| 489 | 3300049570 | Ga0501033_0006207 | Ga0501033_0006207_5003_5482 | 158 |
| 490 | 3300049571 | Ga0501034_0001091 | Ga0501034_0001091_358_840 | 158 |
| 491 | 3300049571 | Ga0501034_0146938 | Ga0501034_0146938_358_840 | 158 |
| 492 | 3300049571 | Ga0501034_0671814 | Ga0501034_0671814_53_529 | 158 |
| 493 | 3300049571 | Ga0501034_0841185 | Ga0501034_0841185_90_566 | 158 |
| 494 | 3300049572 | Ga0501036_0156648 | Ga0501036_0156648_994_1470 | 158 |
| 495 | 3300049572 | Ga0501036_1660126 | Ga0501036_1660126_13_489 | 158 |
| 496 | 3300049573 | Ga0501037_0001070 | Ga0501037_0001070_14803_15282 | 158 |
| 497 | 3300049573 | Ga0501037_0036243 | Ga0501037_0036243_34_510 | 158 |
| 498 | 3300049574 | Ga0501038_0236934 | Ga0501038_0236934_513_989 | 158 |
| 499 | 3300049579 | Ga0501043_0000041 | Ga0501043_0000041_5041_5520 | 158 |
| 500 | 3300049579 | Ga0501043_0466263 | Ga0501043_0466263_23_499 | 158 |
| 501 | 3300049581 | Ga0501047_0020608 | Ga0501047_0020608_4693_5169 | 158 |
| 502 | 3300049581 | Ga0501047_0126194 | Ga0501047_0126194_609_1085 | 158 |
| 503 | 3300049583 | Ga0501067_0334620 | Ga0501067_0334620_205_684 | 158 |
| 504 | 3300049585 | Ga0501069_0000018 | Ga0501069_0000018_123532_124011 | 158 |
| 505 | 3300049585 | Ga0501069_0081794 | Ga0501069_0081794_695_1171 | 158 |
| 506 | 3300049585 | Ga0501069_0115854 | Ga0501069_0115854_896_1372 | 158 |
| 507 | 3300049585 | Ga0501069_0528729 | Ga0501069_0528729_152_628 | 158 |
| 508 | 3300049586 | Ga0501070_0000149 | Ga0501070_0000149_32517_32996 | 158 |
| 509 | 3300049586 | Ga0501070_0001007 | Ga0501070_0001007_16391_16867 | 158 |
| 510 | 3300049586 | Ga0501070_0006449 | Ga0501070_0006449_5340_5816 | 158 |
| 511 | 3300049586 | Ga0501070_0027866 | Ga0501070_0027866_3979_4455 | 158 |
| 512 | 3300049586 | Ga0501070_0032048 | Ga0501070_0032048_2257_2733 | 158 |
| 513 | 3300049586 | Ga0501070_0301203 | Ga0501070_0301203_772_1248 | 158 |
| 514 | 3300049586 | Ga0501070_0743150 | Ga0501070_0743150_44_520 | 158 |
| 515 | 3300049586 | Ga0501070_1021542 | Ga0501070_1021542_32_508 | 158 |
| 516 | 3300049587 | Ga0501071_0009548 | Ga0501071_0009548_2344_2823 | 158 |
| 517 | 3300049587 | Ga0501071_0070895 | Ga0501071_0070895_135_611 | 158 |
| 518 | 3300049589 | Ga0501073_0208571 | Ga0501073_0208571_637_1116 | 158 |
| 519 | 3300049590 | Ga0501074_0015715 | Ga0501074_0015715_18_494 | 158 |
| 520 | 3300049590 | Ga0501074_0060482 | Ga0501074_0060482_1148_1624 | 158 |
| 521 | 3300049590 | Ga0501074_0358878 | Ga0501074_0358878_21_497 | 158 |
| 522 | 3300049742 | Ga0501080_0001846 | Ga0501080_0001846_7458_7937 | 158 |
| 523 | 3300049742 | Ga0501080_0002294 | Ga0501080_0002294_12392_12868 | 158 |
| 524 | 3300049742 | Ga0501080_0014720 | Ga0501080_0014720_3665_4141 | 158 |
| 525 | 3300049744 | Ga0501083_0000524 | Ga0501083_0000524_12917_13396 | 158 |
| 526 | 3300049822 | Ga0501035_0000061 | Ga0501035_0000061_86722_87201 | 158 |
| 527 | 3300049822 | Ga0501035_0002052 | Ga0501035_0002052_8472_8948 | 158 |
| 528 | 3300049822 | Ga0501035_0002566 | Ga0501035_0002566_14489_14965 | 158 |
| 529 | 3300049823 | Ga0501044_0000003 | Ga0501044_0000003_340572_341051 | 158 |
| 530 | 3300049823 | Ga0501044_0023419 | Ga0501044_0023419_6024_6500 | 158 |
| 531 | 3300049823 | Ga0501044_0247188 | Ga0501044_0247188_268_744 | 158 |
| 532 | 3300049823 | Ga0501044_0311223 | Ga0501044_0311223_16_492 | 158 |
| 533 | 3300050492 | nmdc:mga0yw44_64771_c1 | nmdc:mga0yw44_64771_c1_340_819 | 158 |
| 534 | 3300053087 | Ga0500643_037872 | Ga0500643_037872_579_1058 | 158 |
| 535 | 3300053153 | Ga0500616_0054412 | Ga0500616_0054412_981_1460 | 158 |
| 536 | 3300053157 | Ga0500624_004568 | Ga0500624_004568_95_577 | 158 |
| 537 | 3300053161 | Ga0500634_0000004 | Ga0500634_0000004_212648_213130 | 158 |
| 538 | 3300054114 | Ga0501084_1074125 | Ga0501084_1074125_79_555 | 158 |
| 539 | 3300059643 | Ga0587072_026891 | Ga0587072_026891_59_541 | 158 |
| 540 | 3300060353 | Ga0501082_0886486 | Ga0501082_0886486_268_747 | 158 |
| 541 | 3300001990 | JGI24737J22298_10005558 | JGI24737J22298_100055585 | 159 |
| 542 | 3300002067 | JGI24735J21928_10022099 | JGI24735J21928_100220992 | 159 |
| 543 | 3300002075 | JGI24738J21930_10016180 | JGI24738J21930_100161802 | 159 |
| 544 | 3300002076 | JGI24749J21850_1005277 | JGI24749J21850_10052772 | 159 |
| 545 | 3300002077 | JGI24744J21845_10011991 | JGI24744J21845_100119912 | 159 |
| 546 | 3300002239 | JGI24034J26672_10009889 | JGI24034J26672_100098892 | 159 |
| 547 | 3300002741 | JGI25157J39369_1000222 | JGI25157J39369_100022255 | 159 |
| 548 | 3300003762 | Ga0055542_1001452 | Ga0055542_10014526 | 159 |
| 549 | 3300003763 | Ga0055529_1001896 | Ga0055529_10018966 | 159 |
| 550 | 3300005327 | Ga0070658_10249243 | Ga0070658_102492432 | 159 |
| 551 | 3300005327 | Ga0070658_10634615 | Ga0070658_106346151 | 159 |
| 552 | 3300005328 | Ga0070676_10002448 | Ga0070676_100024488 | 159 |
| 553 | 3300005329 | Ga0070683_100016688 | Ga0070683_1000166885 | 159 |
| 554 | 3300005330 | Ga0070690_100000438 | Ga0070690_10000043824 | 159 |
| 555 | 3300005331 | Ga0070670_100001713 | Ga0070670_10000171311 | 159 |
| 556 | 3300005334 | Ga0068869_100126011 | Ga0068869_1001260112 | 159 |
| 557 | 3300005335 | Ga0070666_10179946 | Ga0070666_101799463 | 159 |
| 558 | 3300005335 | Ga0070666_10393504 | Ga0070666_103935042 | 159 |
| 559 | 3300005336 | Ga0070680_100002037 | Ga0070680_1000020373 | 159 |
| 560 | 3300005337 | Ga0070682_100000387 | Ga0070682_10000038726 | 159 |
| 561 | 3300005338 | Ga0068868_100007844 | Ga0068868_1000078446 | 159 |
| 562 | 3300005340 | Ga0070689_100003836 | Ga0070689_10000383611 | 159 |
| 563 | 3300005341 | Ga0070691_10006920 | Ga0070691_100069203 | 159 |
| 564 | 3300005343 | Ga0070687_100002483 | Ga0070687_1000024832 | 159 |
| 565 | 3300005344 | Ga0070661_100000689 | Ga0070661_1000006899 | 159 |
| 566 | 3300005345 | Ga0070692_10001470 | Ga0070692_100014702 | 159 |
| 567 | 3300005347 | Ga0070668_100049327 | Ga0070668_1000493272 | 159 |
| 568 | 3300005353 | Ga0070669_100009784 | Ga0070669_1000097845 | 159 |
| 569 | 3300005353 | Ga0070669_101232317 | Ga0070669_1012323171 | 159 |
| 570 | 3300005354 | Ga0070675_100002266 | Ga0070675_1000022666 | 159 |
| 571 | 3300005355 | Ga0070671_100010188 | Ga0070671_1000101883 | 159 |
| 572 | 3300005356 | Ga0070674_100001353 | Ga0070674_1000013536 | 159 |
| 573 | 3300005356 | Ga0070674_100151689 | Ga0070674_1001516892 | 159 |
| 574 | 3300005364 | Ga0070673_100003636 | Ga0070673_10000363612 | 159 |
| 575 | 3300005365 | Ga0070688_100001165 | Ga0070688_10000116512 | 159 |
| 576 | 3300005366 | Ga0070659_100018173 | Ga0070659_1000181735 | 159 |
| 577 | 3300005367 | Ga0070667_100000657 | Ga0070667_10000065729 | 159 |
| 578 | 3300005434 | Ga0070709_10003372 | Ga0070709_100033722 | 159 |
| 579 | 3300005435 | Ga0070714_100002744 | Ga0070714_1000027443 | 159 |
| 580 | 3300005436 | Ga0070713_100123044 | Ga0070713_1001230442 | 159 |
| 581 | 3300005437 | Ga0070710_10006897 | Ga0070710_100068974 | 159 |
| 582 | 3300005438 | Ga0070701_10001555 | Ga0070701_100015556 | 159 |
| 583 | 3300005439 | Ga0070711_100001294 | Ga0070711_1000012947 | 159 |
| 584 | 3300005440 | Ga0070705_100002287 | Ga0070705_10000228710 | 159 |
| 585 | 3300005441 | Ga0070700_100001827 | Ga0070700_1000018273 | 159 |
| 586 | 3300005444 | Ga0070694_100003648 | Ga0070694_1000036489 | 159 |
| 587 | 3300005455 | Ga0070663_100003294 | Ga0070663_1000032948 | 159 |
| 588 | 3300005455 | Ga0070663_100133864 | Ga0070663_1001338643 | 159 |
| 589 | 3300005456 | Ga0070678_100030424 | Ga0070678_1000304243 | 159 |
| 590 | 3300005456 | Ga0070678_100347995 | Ga0070678_1003479952 | 159 |
| 591 | 3300005457 | Ga0070662_100001709 | Ga0070662_1000017096 | 159 |
| 592 | 3300005458 | Ga0070681_10092614 | Ga0070681_100926143 | 159 |
| 593 | 3300005459 | Ga0068867_100043855 | Ga0068867_1000438553 | 159 |
| 594 | 3300005518 | Ga0070699_100298224 | Ga0070699_1002982242 | 159 |
| 595 | 3300005530 | Ga0070679_100036086 | Ga0070679_1000360866 | 159 |
| 596 | 3300005535 | Ga0070684_100001739 | Ga0070684_1000017399 | 159 |
| 597 | 3300005536 | Ga0070697_100006693 | Ga0070697_1000066938 | 159 |
| 598 | 3300005539 | Ga0068853_100006306 | Ga0068853_1000063063 | 159 |
| 599 | 3300005543 | Ga0070672_100002994 | Ga0070672_1000029946 | 159 |
| 600 | 3300005545 | Ga0070695_100013728 | Ga0070695_1000137283 | 159 |
| 601 | 3300005546 | Ga0070696_100046152 | Ga0070696_1000461523 | 159 |
| 602 | 3300005547 | Ga0070693_100000155 | Ga0070693_10000015527 | 159 |
| 603 | 3300005547 | Ga0070693_100565888 | Ga0070693_1005658881 | 159 |
| 604 | 3300005548 | Ga0070665_100025519 | Ga0070665_1000255194 | 159 |
| 605 | 3300005548 | Ga0070665_100342207 | Ga0070665_1003422072 | 159 |
| 606 | 3300005549 | Ga0070704_100000688 | Ga0070704_10000068819 | 159 |
| 607 | 3300005563 | Ga0068855_100015557 | Ga0068855_1000155573 | 159 |
| 608 | 3300005563 | Ga0068855_100308043 | Ga0068855_1003080432 | 159 |
| 609 | 3300005564 | Ga0070664_100000700 | Ga0070664_10000070023 | 159 |
| 610 | 3300005564 | Ga0070664_100339790 | Ga0070664_1003397904 | 159 |
| 611 | 3300005577 | Ga0068857_100010258 | Ga0068857_1000102583 | 159 |
| 612 | 3300005578 | Ga0068854_100002106 | Ga0068854_10000210611 | 159 |
| 613 | 3300005578 | Ga0068854_100600566 | Ga0068854_1006005662 | 159 |
| 614 | 3300005614 | Ga0068856_100006075 | Ga0068856_1000060756 | 159 |
| 615 | 3300005614 | Ga0068856_100278424 | Ga0068856_1002784242 | 159 |
| 616 | 3300005615 | Ga0070702_100001131 | Ga0070702_10000113111 | 159 |
| 617 | 3300005616 | Ga0068852_100059841 | Ga0068852_1000598412 | 159 |
| 618 | 3300005616 | Ga0068852_100299278 | Ga0068852_1002992782 | 159 |
| 619 | 3300005617 | Ga0068859_100014016 | Ga0068859_1000140166 | 159 |
| 620 | 3300005618 | Ga0068864_100005168 | Ga0068864_1000051683 | 159 |
| 621 | 3300005718 | Ga0068866_10004281 | Ga0068866_100042814 | 159 |
| 622 | 3300005719 | Ga0068861_100027027 | Ga0068861_1000270273 | 159 |
| 623 | 3300005841 | Ga0068863_100003165 | Ga0068863_10000316518 | 159 |
| 624 | 3300005842 | Ga0068858_100018872 | Ga0068858_1000188726 | 159 |
| 625 | 3300005842 | Ga0068858_100750720 | Ga0068858_1007507201 | 159 |
| 626 | 3300005844 | Ga0068862_100006195 | Ga0068862_1000061958 | 159 |
| 627 | 3300005844 | Ga0068862_100393109 | Ga0068862_1003931091 | 159 |
| 628 | 3300006038 | Ga0075365_10039274 | Ga0075365_100392742 | 159 |
| 629 | 3300006038 | Ga0075365_10100973 | Ga0075365_101009732 | 159 |
| 630 | 3300006042 | Ga0075368_10142677 | Ga0075368_101426772 | 159 |
| 631 | 3300006051 | Ga0075364_10454062 | Ga0075364_104540622 | 159 |
| 632 | 3300006163 | Ga0070715_10000219 | Ga0070715_1000021911 | 159 |
| 633 | 3300006163 | Ga0070715_10034114 | Ga0070715_100341142 | 159 |
| 634 | 3300006173 | Ga0070716_100001864 | Ga0070716_10000186410 | 159 |
| 635 | 3300006175 | Ga0070712_100000382 | Ga0070712_10000038226 | 159 |
| 636 | 3300006175 | Ga0070712_100085109 | Ga0070712_1000851092 | 159 |
| 637 | 3300006177 | Ga0075362_10398728 | Ga0075362_103987281 | 159 |
| 638 | 3300006178 | Ga0075367_10240549 | Ga0075367_102405492 | 159 |
| 639 | 3300006237 | Ga0097621_100105246 | Ga0097621_1001052462 | 159 |
| 640 | 3300006353 | Ga0075370_10066061 | Ga0075370_100660611 | 159 |
| 641 | 3300006358 | Ga0068871_101157423 | Ga0068871_1011574231 | 159 |
| 642 | 3300006844 | Ga0075428_100005355 | Ga0075428_1000053552 | 159 |
| 643 | 3300006846 | Ga0075430_100196244 | Ga0075430_1001962442 | 159 |
| 644 | 3300006847 | Ga0075431_100033350 | Ga0075431_1000333506 | 159 |
| 645 | 3300006847 | Ga0075431_100362288 | Ga0075431_1003622882 | 159 |
| 646 | 3300006852 | Ga0075433_10079314 | Ga0075433_100793143 | 159 |
| 647 | 3300006871 | Ga0075434_100467491 | Ga0075434_1004674912 | 159 |
| 648 | 3300006881 | Ga0068865_100002456 | Ga0068865_1000024565 | 159 |
| 649 | 3300006914 | Ga0075436_100011825 | Ga0075436_1000118252 | 159 |
| 650 | 3300006931 | Ga0097620_100014016 | Ga0097620_1000140166 | 159 |
| 651 | 3300007076 | Ga0075435_101058994 | Ga0075435_1010589941 | 159 |
| 652 | 3300009101 | Ga0105247_10222109 | Ga0105247_102221092 | 159 |
| 653 | 3300009177 | Ga0105248_10634130 | Ga0105248_106341301 | 159 |
| 654 | 3300009545 | Ga0105237_10252405 | Ga0105237_102524052 | 159 |
| 655 | 3300009545 | Ga0105237_11834838 | Ga0105237_118348381 | 159 |
| 656 | 3300009553 | Ga0105249_11005983 | Ga0105249_110059831 | 159 |
| 657 | 3300010375 | Ga0105239_10196398 | Ga0105239_101963983 | 159 |
| 658 | 3300010375 | Ga0105239_11579987 | Ga0105239_115799872 | 159 |
| 659 | 3300011119 | Ga0105246_11003071 | Ga0105246_110030711 | 159 |
| 660 | 3300013105 | Ga0157369_10371389 | Ga0157369_103713892 | 159 |
| 661 | 3300013296 | Ga0157374_10268397 | Ga0157374_102683972 | 159 |
| 662 | 3300013306 | Ga0163162_10592948 | Ga0163162_105929481 | 159 |
| 663 | 3300013308 | Ga0157375_10715486 | Ga0157375_107154861 | 159 |
| 664 | 3300014325 | Ga0163163_11158065 | Ga0163163_111580651 | 159 |
| 665 | 3300014968 | Ga0157379_10647372 | Ga0157379_106473721 | 159 |
| 666 | 3300017792 | Ga0163161_10010203 | Ga0163161_100102032 | 159 |
| 667 | 3300020082 | Ga0206353_10411292 | Ga0206353_104112921 | 159 |
| 668 | 3300025250 | Ga0209026_1000002 | Ga0209026_1000002790 | 159 |
| 669 | 3300025254 | Ga0209148_1000038 | Ga0209148_1000038435 | 159 |
| 670 | 3300025272 | Ga0209455_1000678 | Ga0209455_100067811 | 159 |
| 671 | 3300025321 | Ga0207656_10146839 | Ga0207656_101468392 | 159 |
| 672 | 3300025321 | Ga0207656_10324107 | Ga0207656_103241071 | 159 |
| 673 | 3300025735 | Ga0207713_1112417 | Ga0207713_11124172 | 159 |
| 674 | 3300025898 | Ga0207692_10010556 | Ga0207692_100105563 | 159 |
| 675 | 3300025899 | Ga0207642_10031245 | Ga0207642_100312454 | 159 |
| 676 | 3300025900 | Ga0207710_10006312 | Ga0207710_100063123 | 159 |
| 677 | 3300025900 | Ga0207710_10195311 | Ga0207710_101953111 | 159 |
| 678 | 3300025901 | Ga0207688_10288285 | Ga0207688_102882852 | 159 |
| 679 | 3300025903 | Ga0207680_10005465 | Ga0207680_100054653 | 159 |
| 680 | 3300025904 | Ga0207647_10004790 | Ga0207647_100047909 | 159 |
| 681 | 3300025906 | Ga0207699_10002555 | Ga0207699_100025552 | 159 |
| 682 | 3300025907 | Ga0207645_10001793 | Ga0207645_1000179312 | 159 |
| 683 | 3300025911 | Ga0207654_10030519 | Ga0207654_100305193 | 159 |
| 684 | 3300025913 | Ga0207695_10302141 | Ga0207695_103021413 | 159 |
| 685 | 3300025913 | Ga0207695_10481911 | Ga0207695_104819112 | 159 |
| 686 | 3300025914 | Ga0207671_10014363 | Ga0207671_100143637 | 159 |
| 687 | 3300025914 | Ga0207671_10334236 | Ga0207671_103342362 | 159 |
| 688 | 3300025915 | Ga0207693_10000998 | Ga0207693_1000099822 | 159 |
| 689 | 3300025915 | Ga0207693_10039260 | Ga0207693_100392602 | 159 |
| 690 | 3300025916 | Ga0207663_10000700 | Ga0207663_1000070010 | 159 |
| 691 | 3300025917 | Ga0207660_10175643 | Ga0207660_101756433 | 159 |
| 692 | 3300025918 | Ga0207662_10003502 | Ga0207662_100035022 | 159 |
| 693 | 3300025919 | Ga0207657_10000516 | Ga0207657_1000051638 | 159 |
| 694 | 3300025919 | Ga0207657_10056812 | Ga0207657_100568123 | 159 |
| 695 | 3300025920 | Ga0207649_10053908 | Ga0207649_100539082 | 159 |
| 696 | 3300025921 | Ga0207652_10101949 | Ga0207652_101019491 | 159 |
| 697 | 3300025923 | Ga0207681_10010302 | Ga0207681_100103023 | 159 |
| 698 | 3300025924 | Ga0207694_10021980 | Ga0207694_100219803 | 159 |
| 699 | 3300025925 | Ga0207650_10643881 | Ga0207650_106438812 | 159 |
| 700 | 3300025926 | Ga0207659_10054489 | Ga0207659_100544892 | 159 |
| 701 | 3300025927 | Ga0207687_10029096 | Ga0207687_100290965 | 159 |
| 702 | 3300025927 | Ga0207687_11460165 | Ga0207687_114601652 | 159 |
| 703 | 3300025928 | Ga0207700_10128274 | Ga0207700_101282742 | 159 |
| 704 | 3300025929 | Ga0207664_10034941 | Ga0207664_100349413 | 159 |
| 705 | 3300025931 | Ga0207644_10080977 | Ga0207644_100809773 | 159 |
| 706 | 3300025931 | Ga0207644_10676690 | Ga0207644_106766902 | 159 |
| 707 | 3300025932 | Ga0207690_10006538 | Ga0207690_100065385 | 159 |
| 708 | 3300025933 | Ga0207706_10002149 | Ga0207706_1000214914 | 159 |
| 709 | 3300025934 | Ga0207686_10004658 | Ga0207686_100046588 | 159 |
| 710 | 3300025934 | Ga0207686_10139007 | Ga0207686_101390073 | 159 |
| 711 | 3300025935 | Ga0207709_10007883 | Ga0207709_100078835 | 159 |
| 712 | 3300025936 | Ga0207670_10002633 | Ga0207670_100026333 | 159 |
| 713 | 3300025937 | Ga0207669_10033036 | Ga0207669_100330363 | 159 |
| 714 | 3300025938 | Ga0207704_10022172 | Ga0207704_100221722 | 159 |
| 715 | 3300025938 | Ga0207704_10566787 | Ga0207704_105667872 | 159 |
| 716 | 3300025939 | Ga0207665_10000327 | Ga0207665_1000032729 | 159 |
| 717 | 3300025940 | Ga0207691_10022661 | Ga0207691_100226617 | 159 |
| 718 | 3300025941 | Ga0207711_10012217 | Ga0207711_100122175 | 159 |
| 719 | 3300025942 | Ga0207689_10010763 | Ga0207689_100107635 | 159 |
| 720 | 3300025945 | Ga0207679_10012249 | Ga0207679_100122497 | 159 |
| 721 | 3300025945 | Ga0207679_11595088 | Ga0207679_115950881 | 159 |
| 722 | 3300025960 | Ga0207651_10005081 | Ga0207651_100050811 | 159 |
| 723 | 3300025961 | Ga0207712_10003778 | Ga0207712_100037782 | 159 |
| 724 | 3300025961 | Ga0207712_10499863 | Ga0207712_104998632 | 159 |
| 725 | 3300025972 | Ga0207668_10013555 | Ga0207668_100135553 | 159 |
| 726 | 3300025972 | Ga0207668_10475056 | Ga0207668_104750561 | 159 |
| 727 | 3300025981 | Ga0207640_10004632 | Ga0207640_100046325 | 159 |
| 728 | 3300025981 | Ga0207640_11077326 | Ga0207640_110773261 | 159 |
| 729 | 3300025986 | Ga0207658_10019418 | Ga0207658_100194185 | 159 |
| 730 | 3300025986 | Ga0207658_10123987 | Ga0207658_101239873 | 159 |
| 731 | 3300026023 | Ga0207677_10329516 | Ga0207677_103295162 | 159 |
| 732 | 3300026035 | Ga0207703_10232561 | Ga0207703_102325612 | 159 |
| 733 | 3300026041 | Ga0207639_10005217 | Ga0207639_100052173 | 159 |
| 734 | 3300026067 | Ga0207678_10054088 | Ga0207678_100540882 | 159 |
| 735 | 3300026067 | Ga0207678_10260940 | Ga0207678_102609403 | 159 |
| 736 | 3300026075 | Ga0207708_10001427 | Ga0207708_1000142710 | 159 |
| 737 | 3300026078 | Ga0207702_10100362 | Ga0207702_101003624 | 159 |
| 738 | 3300026088 | Ga0207641_10005966 | Ga0207641_100059663 | 159 |
| 739 | 3300026089 | Ga0207648_10155357 | Ga0207648_101553572 | 159 |
| 740 | 3300026089 | Ga0207648_10324822 | Ga0207648_103248222 | 159 |
| 741 | 3300026095 | Ga0207676_10261959 | Ga0207676_102619591 | 159 |
| 742 | 3300026116 | Ga0207674_10010004 | Ga0207674_100100043 | 159 |
| 743 | 3300026118 | Ga0207675_100001630 | Ga0207675_10000163023 | 159 |
| 744 | 3300026118 | Ga0207675_100812105 | Ga0207675_1008121051 | 159 |
| 745 | 3300026121 | Ga0207683_10000351 | Ga0207683_1000035110 | 159 |
| 746 | 3300026121 | Ga0207683_10051672 | Ga0207683_100516723 | 159 |
| 747 | 3300026142 | Ga0207698_10009311 | Ga0207698_100093113 | 159 |
| 748 | 3300026142 | Ga0207698_10169072 | Ga0207698_101690722 | 159 |
| 749 | 3300027907 | Ga0207428_10074831 | Ga0207428_100748312 | 159 |
| 750 | 3300027907 | Ga0207428_10400855 | Ga0207428_104008552 | 159 |
| 751 | 3300028379 | Ga0268266_10012855 | Ga0268266_100128555 | 159 |
| 752 | 3300028379 | Ga0268266_10049403 | Ga0268266_100494032 | 159 |
| 753 | 3300028379 | Ga0268266_11296981 | Ga0268266_112969811 | 159 |
| 754 | 3300028380 | Ga0268265_10081063 | Ga0268265_100810634 | 159 |
| 755 | 3300028380 | Ga0268265_11273182 | Ga0268265_112731821 | 159 |
| 756 | 3300028380 | Ga0268265_11641989 | Ga0268265_116419891 | 159 |
| 757 | 3300028381 | Ga0268264_10023577 | Ga0268264_100235774 | 159 |
| 758 | 3300031456 | Ga0307513_10862518 | Ga0307513_108625181 | 159 |
| 759 | 3300031507 | Ga0307509_10480994 | Ga0307509_104809941 | 159 |
| 760 | 3300031727 | Ga0316576_10403100 | Ga0316576_104031001 | 159 |
| 761 | 3300031728 | Ga0316578_10031254 | Ga0316578_100312543 | 159 |
| 762 | 3300031731 | Ga0307405_10730644 | Ga0307405_107306441 | 159 |
| 763 | 3300031852 | Ga0307410_11082769 | Ga0307410_110827691 | 159 |
| 764 | 3300031911 | Ga0307412_10868996 | Ga0307412_108689962 | 159 |
| 765 | 3300032126 | Ga0307415_101603182 | Ga0307415_1016031821 | 159 |
| 766 | 3300032133 | Ga0316583_10134141 | Ga0316583_101341412 | 159 |
| 767 | 3300035242 | Ga0373962_0015643 | Ga0373962_0015643_1239_1718 | 159 |
| 768 | 3300037466 | Ga0395898_0087353 | Ga0395898_0087353_1865_2344 | 159 |
| 769 | 3300038443 | Ga0395901_0018122 | Ga0395901_0018122_6316_6795 | 159 |
| 770 | 3300039062 | Ga0400483_164597 | Ga0400483_164597_436_933 | 159 |
| 771 | 3300041413 | Ga0439465_0048470 | Ga0439465_0048470_555_1037 | 159 |
| 772 | 3300041459 | Ga0451800_0048927 | Ga0451800_0048927_137_619 | 159 |
| 773 | 3300041509 | Ga0451843_1723520 | Ga0451843_1723520_143_625 | 159 |
| 774 | 3300042005 | Ga0439448_0204453 | Ga0439448_0204453_168_647 | 159 |
| 775 | 3300042005 | Ga0439448_0234825 | Ga0439448_0234825_44_523 | 159 |
| 776 | 3300042010 | Ga0439452_045714 | Ga0439452_045714_70_570 | 159 |
| 777 | 3300042157 | Ga0439458_0062580 | Ga0439458_0062580_138_620 | 159 |
| 778 | 3300042461 | Ga0439460_0253481 | Ga0439460_0253481_26_505 | 159 |
| 779 | 3300042993 | Ga0439440_0054677 | Ga0439440_0054677_233_712 | 159 |
| 780 | 3300046459 | Ga0495629_0224099 | Ga0495629_0224099_53_535 | 159 |
| 781 | 3300046512 | Ga0495610_0049022 | Ga0495610_0049022_837_1319 | 159 |
| 782 | 3300046515 | Ga0495620_0062590 | Ga0495620_0062590_941_1423 | 159 |
| 783 | 3300046519 | Ga0495632_0253414 | Ga0495632_0253414_227_709 | 159 |
| 784 | 3300046558 | Ga0495633_0437924 | Ga0495633_0437924_62_544 | 159 |
| 785 | 3300046615 | Ga0495656_0125425 | Ga0495656_0125425_367_870 | 159 |
| 786 | 3300046616 | Ga0495668_0288990 | Ga0495668_0288990_163_645 | 159 |
| 787 | 3300046660 | Ga0495625_0268610 | Ga0495625_0268610_13_495 | 159 |
| 788 | 3300046683 | Ga0495658_0061043 | Ga0495658_0061043_1168_1650 | 159 |
| 789 | 3300046691 | Ga0495670_0313234 | Ga0495670_0313234_287_769 | 159 |
| 790 | 3300046810 | Ga0495660_0160239 | Ga0495660_0160239_255_737 | 159 |
| 791 | 3300047320 | Ga0495672_0311182 | Ga0495672_0311182_195_677 | 159 |
| 792 | 3300047323 | Ga0495683_0223543 | Ga0495683_0223543_340_819 | 159 |
| 793 | 3300047472 | Ga0495686_0001465 | Ga0495686_0001465_237_719 | 159 |
| 794 | 3300048090 | Ga0495615_0099576 | Ga0495615_0099576_145_627 | 159 |
| 795 | 3300048091 | Ga0495626_0170082 | Ga0495626_0170082_318_797 | 159 |
| 796 | 3300048905 | Ga0496102_0501310 | Ga0496102_0501310_367_849 | 159 |
| 797 | 3300048906 | Ga0496103_0159684 | Ga0496103_0159684_518_1000 | 159 |
| 798 | 3300048909 | Ga0496106_0416799 | Ga0496106_0416799_92_574 | 159 |
| 799 | 3300048912 | Ga0496109_0487612 | Ga0496109_0487612_584_1063 | 159 |
| 800 | 3300048913 | Ga0496110_0804688 | Ga0496110_0804688_256_738 | 159 |
| 801 | 3300048915 | Ga0496112_0039385 | Ga0496112_0039385_134_616 | 159 |
| 802 | 3300048916 | Ga0496113_0209740 | Ga0496113_0209740_445_924 | 159 |
| 803 | 3300048920 | Ga0496117_0525236 | Ga0496117_0525236_67_549 | 159 |
| 804 | 3300048922 | Ga0496119_0058680 | Ga0496119_0058680_201_683 | 159 |
| 805 | 3300048923 | Ga0496120_0178856 | Ga0496120_0178856_294_776 | 159 |
| 806 | 3300048927 | Ga0496124_0592757 | Ga0496124_0592757_37_519 | 159 |
| 807 | 3300049568 | Ga0501031_0092852 | Ga0501031_0092852_1003_1482 | 159 |
| 808 | 3300049568 | Ga0501031_0590923 | Ga0501031_0590923_194_676 | 159 |
| 809 | 3300049569 | Ga0501032_0204835 | Ga0501032_0204835_526_1008 | 159 |
| 810 | 3300049570 | Ga0501033_0061822 | Ga0501033_0061822_2022_2504 | 159 |
| 811 | 3300049570 | Ga0501033_0404242 | Ga0501033_0404242_343_822 | 159 |
| 812 | 3300049570 | Ga0501033_0537174 | Ga0501033_0537174_57_536 | 159 |
| 813 | 3300049571 | Ga0501034_0174934 | Ga0501034_0174934_1064_1546 | 159 |
| 814 | 3300049571 | Ga0501034_1144567 | Ga0501034_1144567_165_647 | 159 |
| 815 | 3300049572 | Ga0501036_0677257 | Ga0501036_0677257_125_604 | 159 |
| 816 | 3300049573 | Ga0501037_0524068 | Ga0501037_0524068_17_496 | 159 |
| 817 | 3300049573 | Ga0501037_0530557 | Ga0501037_0530557_40_522 | 159 |
| 818 | 3300049574 | Ga0501038_0096844 | Ga0501038_0096844_697_1179 | 159 |
| 819 | 3300049575 | Ga0501039_0013679 | Ga0501039_0013679_980_1459 | 159 |
| 820 | 3300049575 | Ga0501039_0900011 | Ga0501039_0900011_47_577 | 159 |
| 821 | 3300049576 | Ga0501040_0207776 | Ga0501040_0207776_759_1238 | 159 |
| 822 | 3300049577 | Ga0501041_0429006 | Ga0501041_0429006_213_692 | 159 |
| 823 | 3300049578 | Ga0501042_0342726 | Ga0501042_0342726_584_1063 | 159 |
| 824 | 3300049578 | Ga0501042_0348353 | Ga0501042_0348353_288_767 | 159 |
| 825 | 3300049579 | Ga0501043_0235485 | Ga0501043_0235485_576_1055 | 159 |
| 826 | 3300049579 | Ga0501043_0280498 | Ga0501043_0280498_248_727 | 159 |
| 827 | 3300049580 | Ga0501046_0201340 | Ga0501046_0201340_443_922 | 159 |
| 828 | 3300049581 | Ga0501047_0362261 | Ga0501047_0362261_178_660 | 159 |
| 829 | 3300049582 | Ga0501048_0127717 | Ga0501048_0127717_670_1149 | 159 |
| 830 | 3300049582 | Ga0501048_0476203 | Ga0501048_0476203_125_604 | 159 |
| 831 | 3300049584 | Ga0501068_0371488 | Ga0501068_0371488_336_815 | 159 |
| 832 | 3300049585 | Ga0501069_0118879 | Ga0501069_0118879_661_1140 | 159 |
| 833 | 3300049586 | Ga0501070_0057191 | Ga0501070_0057191_1077_1559 | 159 |
| 834 | 3300049586 | Ga0501070_0375810 | Ga0501070_0375810_514_996 | 159 |
| 835 | 3300049586 | Ga0501070_0429283 | Ga0501070_0429283_458_937 | 159 |
| 836 | 3300049587 | Ga0501071_0005101 | Ga0501071_0005101_3016_3495 | 159 |
| 837 | 3300049588 | Ga0501072_0033522 | Ga0501072_0033522_3350_3829 | 159 |
| 838 | 3300049588 | Ga0501072_0635583 | Ga0501072_0635583_168_647 | 159 |
| 839 | 3300049589 | Ga0501073_0297390 | Ga0501073_0297390_350_829 | 159 |
| 840 | 3300049590 | Ga0501074_0134462 | Ga0501074_0134462_927_1406 | 159 |
| 841 | 3300049590 | Ga0501074_0506706 | Ga0501074_0506706_92_571 | 159 |
| 842 | 3300049591 | Ga0501075_0210889 | Ga0501075_0210889_469_948 | 159 |
| 843 | 3300049592 | Ga0501076_0054536 | Ga0501076_0054536_2225_2704 | 159 |
| 844 | 3300049592 | Ga0501076_0072340 | Ga0501076_0072340_1156_1635 | 159 |
| 845 | 3300049741 | Ga0501079_0114292 | Ga0501079_0114292_186_665 | 159 |
| 846 | 3300049741 | Ga0501079_0186293 | Ga0501079_0186293_288_767 | 159 |
| 847 | 3300049743 | Ga0501081_0082879 | Ga0501081_0082879_709_1188 | 159 |
| 848 | 3300049743 | Ga0501081_0085196 | Ga0501081_0085196_981_1460 | 159 |
| 849 | 3300049743 | Ga0501081_0902189 | Ga0501081_0902189_138_617 | 159 |
| 850 | 3300049744 | Ga0501083_0150125 | Ga0501083_0150125_1028_1507 | 159 |
| 851 | 3300049744 | Ga0501083_0259894 | Ga0501083_0259894_45_527 | 159 |
| 852 | 3300049744 | Ga0501083_0308575 | Ga0501083_0308575_491_970 | 159 |
| 853 | 3300049822 | Ga0501035_0305392 | Ga0501035_0305392_558_1037 | 159 |
| 854 | 3300049822 | Ga0501035_0562695 | Ga0501035_0562695_14_493 | 159 |
| 855 | 3300049823 | Ga0501044_0044387 | Ga0501044_0044387_934_1416 | 159 |
| 856 | 3300049823 | Ga0501044_0409254 | Ga0501044_0409254_713_1195 | 159 |
| 857 | 3300049823 | Ga0501044_1393540 | Ga0501044_1393540_32_511 | 159 |
| 858 | 3300049824 | Ga0501045_0195110 | Ga0501045_0195110_77_556 | 159 |
| 859 | 3300049824 | Ga0501045_0289422 | Ga0501045_0289422_343_822 | 159 |
| 860 | 3300049824 | Ga0501045_0660127 | Ga0501045_0660127_191_670 | 159 |
| 861 | 3300050491 | nmdc:mga00v17_5251_c2 | nmdc:mga00v17_5251_c2_100_582 | 159 |
| 862 | 3300050492 | nmdc:mga0yw44_138395_c1 | nmdc:mga0yw44_138395_c1_86_568 | 159 |
| 863 | 3300050492 | nmdc:mga0yw44_257835_c1 | nmdc:mga0yw44_257835_c1_654_1136 | 159 |
| 864 | 3300050492 | nmdc:mga0yw44_315002_c1 | nmdc:mga0yw44_315002_c1_515_997 | 159 |
| 865 | 3300050494 | nmdc:mga06z11_129879_c1 | nmdc:mga06z11_129879_c1_745_1227 | 159 |
| 866 | 3300050496 | nmdc:mga07m45_46054_c1 | nmdc:mga07m45_46054_c1_1858_2340 | 159 |
| 867 | 3300050509 | nmdc:mga0qj67_248590_c1 | nmdc:mga0qj67_248590_c1_73_552 | 159 |
| 868 | 3300050510 | nmdc:mga06r32_330282_c1 | nmdc:mga06r32_330282_c1_438_917 | 159 |
| 869 | 3300050515 | nmdc:mga0a205_46652_c1 | nmdc:mga0a205_46652_c1_3262_3741 | 159 |
| 870 | 3300053083 | Ga0495655_0000773 | Ga0495655_0000773_2865_3344 | 159 |
| 871 | 3300053083 | Ga0495655_0028907 | Ga0495655_0028907_579_1061 | 159 |
| 872 | 3300053086 | Ga0500578_0512062 | Ga0500578_0512062_140_622 | 159 |
| 873 | 3300053098 | Ga0500650_0182629 | Ga0500650_0182629_80_562 | 159 |
| 874 | 3300053134 | Ga0500658_0146703 | Ga0500658_0146703_180_662 | 159 |
| 875 | 3300053158 | Ga0500627_0222596 | Ga0500627_0222596_309_791 | 159 |
| 876 | 3300053727 | Ga0500611_175569 | Ga0500611_175569_21_503 | 159 |
| 877 | 3300054114 | Ga0501084_0097519 | Ga0501084_0097519_308_787 | 159 |
| 878 | 3300059503 | Ga0587080_018613 | Ga0587080_018613_554_1036 | 159 |
| 879 | 3300059504 | Ga0587082_013800 | Ga0587082_013800_16_498 | 159 |
| 880 | 3300059505 | Ga0587083_0074043 | Ga0587083_0074043_19_501 | 159 |
| 881 | 3300059509 | Ga0587089_026455 | Ga0587089_026455_156_638 | 159 |
| 882 | 3300059513 | Ga0587094_015377 | Ga0587094_015377_561_1043 | 159 |
| 883 | 3300059514 | Ga0587095_013659 | Ga0587095_013659_174_656 | 159 |
| 884 | 3300059604 | Ga0587098_064275 | Ga0587098_064275_83_565 | 159 |
| 885 | 3300059625 | Ga0587113_006331 | Ga0587113_006331_13_495 | 159 |
| 886 | 3300059627 | Ga0587117_028738 | Ga0587117_028738_263_745 | 159 |
| 887 | 3300059645 | Ga0587076_106917 | Ga0587076_106917_80_562 | 159 |
| 888 | 3300059646 | Ga0587078_010918 | Ga0587078_010918_24_506 | 159 |
| 889 | 3300059649 | Ga0587102_037271 | Ga0587102_037271_27_509 | 159 |
| 890 | 3300059652 | Ga0587107_015572 | Ga0587107_015572_485_967 | 159 |
| 891 | 3300059655 | Ga0587114_085899 | Ga0587114_085899_19_501 | 159 |
| 892 | 3300059658 | Ga0587119_014111 | Ga0587119_014111_432_914 | 159 |
| 893 | 3300059660 | Ga0587124_031150 | Ga0587124_031150_80_562 | 159 |
| 894 | 3300060344 | Ga0587071_115100 | Ga0587071_115100_109_591 | 159 |
| 895 | 3300060346 | Ga0587111_0032452 | Ga0587111_0032452_18_500 | 159 |
| 896 | 3300060346 | Ga0587111_0212036 | Ga0587111_0212036_47_529 | 159 |
| 897 | 3300060353 | Ga0501082_0033500 | Ga0501082_0033500_2626_3105 | 159 |
| 898 | 3300060353 | Ga0501082_0164397 | Ga0501082_0164397_521_1000 | 159 |
| 899 | 3300033541 | Ga0316596_1225925 | Ga0316596_12259251 | 160 |
| 900 | 3300036647 | Ga0316582_0191482 | Ga0316582_0191482_878_1363 | 160 |
| 901 | 3300041453 | Ga0451797_0578826 | Ga0451797_0578826_425_916 | 160 |
| 902 | 3300049571 | Ga0501034_0084106 | Ga0501034_0084106_731_1216 | 160 |
| 903 | 3300049574 | Ga0501038_0358155 | Ga0501038_0358155_531_1019 | 160 |
| 904 | 3300049575 | Ga0501039_0355124 | Ga0501039_0355124_53_541 | 160 |
| 905 | 3300049579 | Ga0501043_0521352 | Ga0501043_0521352_27_515 | 160 |
| 906 | 3300049582 | Ga0501048_0142806 | Ga0501048_0142806_68_550 | 160 |
| 907 | 3300049585 | Ga0501069_0482068 | Ga0501069_0482068_67_549 | 160 |
| 908 | 3300049586 | Ga0501070_0843923 | Ga0501070_0843923_133_621 | 160 |
| 909 | 3300049591 | Ga0501075_0023194 | Ga0501075_0023194_1998_2480 | 160 |
| 910 | 3300049822 | Ga0501035_1104020 | Ga0501035_1104020_35_523 | 160 |
| 911 | 3300049823 | Ga0501044_0051125 | Ga0501044_0051125_3678_4166 | 160 |
| 912 | 3300009093 | Ga0105240_10028048 | Ga0105240_100280486 | 161 |
| 913 | 3300009094 | Ga0111539_10126417 | Ga0111539_101264171 | 161 |
| 914 | 3300009098 | Ga0105245_10000729 | Ga0105245_1000072927 | 161 |
| 915 | 3300009101 | Ga0105247_10000684 | Ga0105247_100006848 | 161 |
| 916 | 3300009147 | Ga0114129_10055348 | Ga0114129_100553484 | 161 |
| 917 | 3300009148 | Ga0105243_10004066 | Ga0105243_100040669 | 161 |
| 918 | 3300009174 | Ga0105241_10014990 | Ga0105241_100149903 | 161 |
| 919 | 3300009176 | Ga0105242_10000957 | Ga0105242_1000095718 | 161 |
| 920 | 3300009177 | Ga0105248_10000854 | Ga0105248_1000085427 | 161 |
| 921 | 3300009545 | Ga0105237_10000974 | Ga0105237_1000097436 | 161 |
| 922 | 3300009551 | Ga0105238_10005006 | Ga0105238_100050069 | 161 |
| 923 | 3300009553 | Ga0105249_10000677 | Ga0105249_1000067710 | 161 |
| 924 | 3300010375 | Ga0105239_10002346 | Ga0105239_1000234610 | 161 |
| 925 | 3300011119 | Ga0105246_10001644 | Ga0105246_100016443 | 161 |
| 926 | 3300013100 | Ga0157373_10044718 | Ga0157373_100447181 | 161 |
| 927 | 3300013104 | Ga0157370_10233692 | Ga0157370_102336922 | 161 |
| 928 | 3300013105 | Ga0157369_10003955 | Ga0157369_100039553 | 161 |
| 929 | 3300013296 | Ga0157374_10029930 | Ga0157374_100299305 | 161 |
| 930 | 3300013297 | Ga0157378_10006232 | Ga0157378_100062322 | 161 |
| 931 | 3300013306 | Ga0163162_10005337 | Ga0163162_100053375 | 161 |
| 932 | 3300013307 | Ga0157372_10010270 | Ga0157372_1001027010 | 161 |
| 933 | 3300013308 | Ga0157375_10000519 | Ga0157375_100005193 | 161 |
| 934 | 3300014325 | Ga0163163_10026341 | Ga0163163_100263412 | 161 |
| 935 | 3300014745 | Ga0157377_10000936 | Ga0157377_100009369 | 161 |
| 936 | 3300014968 | Ga0157379_10006266 | Ga0157379_100062665 | 161 |
| 937 | 3300014969 | Ga0157376_10049794 | Ga0157376_100497941 | 161 |
| 938 | 3300014969 | Ga0157376_10701575 | Ga0157376_107015752 | 161 |
| 939 | 3300035114 | Ga0373939_0044716 | Ga0373939_0044716_536_1036 | 161 |
| 940 | 3300035241 | Ga0373961_0006145 | Ga0373961_0006145_1137_1637 | 161 |
| 941 | 3300035691 | Ga0373931_0496595 | Ga0373931_0496595_86_586 | 161 |
| 942 | 3300036401 | Ga0373937_0047757 | Ga0373937_0047757_1652_2137 | 161 |
| 943 | 3300037312 | Ga0395899_0295164 | Ga0395899_0295164_342_842 | 161 |
| 944 | 3300037418 | Ga0395900_0351566 | Ga0395900_0351566_67_567 | 161 |
| 945 | 3300046516 | Ga0495628_0487256 | Ga0495628_0487256_249_734 | 161 |
| 946 | 3300046675 | Ga0495657_0366327 | Ga0495657_0366327_165_650 | 161 |
| 947 | 3300048903 | Ga0496100_0023101 | Ga0496100_0023101_1499_1999 | 161 |
| 948 | 3300048904 | Ga0496101_0059907 | Ga0496101_0059907_487_987 | 161 |
| 949 | 3300048904 | Ga0496101_0894567 | Ga0496101_0894567_105_605 | 161 |
| 950 | 3300048905 | Ga0496102_0017938 | Ga0496102_0017938_1046_1546 | 161 |
| 951 | 3300048906 | Ga0496103_0013445 | Ga0496103_0013445_2024_2524 | 161 |
| 952 | 3300048907 | Ga0496104_0085498 | Ga0496104_0085498_487_987 | 161 |
| 953 | 3300048908 | Ga0496105_0009703 | Ga0496105_0009703_2375_2875 | 161 |
| 954 | 3300048909 | Ga0496106_0050389 | Ga0496106_0050389_615_1115 | 161 |
| 955 | 3300048910 | Ga0496107_0848028 | Ga0496107_0848028_33_533 | 161 |
| 956 | 3300048911 | Ga0496108_0010541 | Ga0496108_0010541_2347_2847 | 161 |
| 957 | 3300048912 | Ga0496109_0014012 | Ga0496109_0014012_777_1277 | 161 |
| 958 | 3300048912 | Ga0496109_0020303 | Ga0496109_0020303_615_1115 | 161 |
| 959 | 3300048913 | Ga0496110_0004436 | Ga0496110_0004436_7285_7785 | 161 |
| 960 | 3300048914 | Ga0496111_0020482 | Ga0496111_0020482_2331_2831 | 161 |
| 961 | 3300048915 | Ga0496112_0005081 | Ga0496112_0005081_5119_5619 | 161 |
| 962 | 3300048915 | Ga0496112_0031458 | Ga0496112_0031458_2796_3296 | 161 |
| 963 | 3300048916 | Ga0496113_0139968 | Ga0496113_0139968_1371_1871 | 161 |
| 964 | 3300048918 | Ga0496115_0067709 | Ga0496115_0067709_615_1115 | 161 |
| 965 | 3300049568 | Ga0501031_0423601 | Ga0501031_0423601_333_818 | 161 |
| 966 | 3300049570 | Ga0501033_0425306 | Ga0501033_0425306_16_501 | 161 |
| 967 | 3300049575 | Ga0501039_0289200 | Ga0501039_0289200_574_1059 | 161 |
| 968 | 3300049578 | Ga0501042_0398706 | Ga0501042_0398706_304_789 | 161 |
| 969 | 3300049587 | Ga0501071_0167743 | Ga0501071_0167743_423_908 | 161 |
| 970 | 3300049588 | Ga0501072_1041429 | Ga0501072_1041429_20_505 | 161 |
| 971 | 3300049588 | Ga0501072_1154149 | Ga0501072_1154149_33_533 | 161 |
| 972 | 3300049590 | Ga0501074_0044789 | Ga0501074_0044789_2198_2683 | 161 |
| 973 | 3300049593 | Ga0501077_0328500 | Ga0501077_0328500_473_958 | 161 |
| 974 | 3300049824 | Ga0501045_0306829 | Ga0501045_0306829_68_553 | 161 |
| 975 | 3300050507 | nmdc:mga05p37_932744_c1 | nmdc:mga05p37_932744_c1_292_792 | 161 |
| 976 | 3300050508 | nmdc:mga09592_44022_c1 | nmdc:mga09592_44022_c1_59_559 | 161 |
| 977 | 3300050511 | nmdc:mga08y16_139564_c1 | nmdc:mga08y16_139564_c1_1074_1574 | 161 |
| 978 | 3300050512 | nmdc:mga0n895_390638_c1 | nmdc:mga0n895_390638_c1_776_1276 | 161 |
| 979 | 3300050514 | nmdc:mga08x19_6006_c1 | nmdc:mga08x19_6006_c1_1611_2111 | 161 |
| 980 | 3300053077 | Ga0495601_0036771 | Ga0495601_0036771_1618_2103 | 161 |
| 981 | 3300053085 | Ga0495619_0060580 | Ga0495619_0060580_229_714 | 161 |
| 982 | 3300060353 | Ga0501082_0042278 | Ga0501082_0042278_221_706 | 161 |
| 983 | 3300061734 | Ga0530510_0673320 | Ga0530510_0673320_261_746 | 161 |
| 984 | 3300000044 | ARSoilOldRDRAFT_c005725 | ARSoilOldRDRAFT_0057252 | 162 |
| 985 | 3300005347 | Ga0070668_100420178 | Ga0070668_1004201782 | 162 |
| 986 | 3300005353 | Ga0070669_100164725 | Ga0070669_1001647252 | 162 |
| 987 | 3300005355 | Ga0070671_100530455 | Ga0070671_1005304552 | 162 |
| 988 | 3300005356 | Ga0070674_100057288 | Ga0070674_1000572885 | 162 |
| 989 | 3300005365 | Ga0070688_100414168 | Ga0070688_1004141682 | 162 |
| 990 | 3300005441 | Ga0070700_100102923 | Ga0070700_1001029232 | 162 |
| 991 | 3300005444 | Ga0070694_100747058 | Ga0070694_1007470581 | 162 |
| 992 | 3300005459 | Ga0068867_100318457 | Ga0068867_1003184572 | 162 |
| 993 | 3300005536 | Ga0070697_100147000 | Ga0070697_1001470003 | 162 |
| 994 | 3300005539 | Ga0068853_100181870 | Ga0068853_1001818702 | 162 |
| 995 | 3300005539 | Ga0068853_100819416 | Ga0068853_1008194161 | 162 |
| 996 | 3300005546 | Ga0070696_100086366 | Ga0070696_1000863662 | 162 |
| 997 | 3300005548 | Ga0070665_100698278 | Ga0070665_1006982782 | 162 |
| 998 | 3300005578 | Ga0068854_100063366 | Ga0068854_1000633664 | 162 |
| 999 | 3300005617 | Ga0068859_100293109 | Ga0068859_1002931092 | 162 |
| 1000 | 3300005843 | Ga0068860_100393567 | Ga0068860_1003935672 | 162 |
| 1001 | 3300005843 | Ga0068860_100611569 | Ga0068860_1006115692 | 162 |
| 1002 | 3300005844 | Ga0068862_100139304 | Ga0068862_1001393044 | 162 |
| 1003 | 3300006038 | Ga0075365_11055805 | Ga0075365_110558051 | 162 |
| 1004 | 3300006175 | Ga0070712_100084684 | Ga0070712_1000846843 | 162 |
| 1005 | 3300006847 | Ga0075431_100314580 | Ga0075431_1003145802 | 162 |
| 1006 | 3300006881 | Ga0068865_100364346 | Ga0068865_1003643462 | 162 |
| 1007 | 3300006931 | Ga0097620_100293110 | Ga0097620_1002931102 | 162 |
| 1008 | 3300009101 | Ga0105247_10031011 | Ga0105247_100310112 | 162 |
| 1009 | 3300009148 | Ga0105243_10506141 | Ga0105243_105061412 | 162 |
| 1010 | 3300009176 | Ga0105242_10457859 | Ga0105242_104578592 | 162 |
| 1011 | 3300009177 | Ga0105248_10630755 | Ga0105248_106307552 | 162 |
| 1012 | 3300009545 | Ga0105237_10829593 | Ga0105237_108295932 | 162 |
| 1013 | 3300009545 | Ga0105237_12335032 | Ga0105237_123350321 | 162 |
| 1014 | 3300010375 | Ga0105239_10062542 | Ga0105239_100625423 | 162 |
| 1015 | 3300011119 | Ga0105246_10286685 | Ga0105246_102866852 | 162 |
| 1016 | 3300012481 | Ga0157320_1011286 | Ga0157320_10112862 | 162 |
| 1017 | 3300013296 | Ga0157374_10694658 | Ga0157374_106946582 | 162 |
| 1018 | 3300013297 | Ga0157378_10144337 | Ga0157378_101443372 | 162 |
| 1019 | 3300014745 | Ga0157377_10167232 | Ga0157377_101672322 | 162 |
| 1020 | 3300014968 | Ga0157379_10823159 | Ga0157379_108231592 | 162 |
| 1021 | 3300025899 | Ga0207642_10057741 | Ga0207642_100577412 | 162 |
| 1022 | 3300025900 | Ga0207710_10039726 | Ga0207710_100397264 | 162 |
| 1023 | 3300025901 | Ga0207688_10451551 | Ga0207688_104515511 | 162 |
| 1024 | 3300025915 | Ga0207693_10237126 | Ga0207693_102371262 | 162 |
| 1025 | 3300025920 | Ga0207649_11063081 | Ga0207649_110630811 | 162 |
| 1026 | 3300025923 | Ga0207681_10759971 | Ga0207681_107599712 | 162 |
| 1027 | 3300025932 | Ga0207690_10572885 | Ga0207690_105728851 | 162 |
| 1028 | 3300025933 | Ga0207706_10122622 | Ga0207706_101226222 | 162 |
| 1029 | 3300025935 | Ga0207709_10257072 | Ga0207709_102570722 | 162 |
| 1030 | 3300025936 | Ga0207670_10204030 | Ga0207670_102040301 | 162 |
| 1031 | 3300025938 | Ga0207704_10233267 | Ga0207704_102332672 | 162 |
| 1032 | 3300025938 | Ga0207704_10718630 | Ga0207704_107186302 | 162 |
| 1033 | 3300025941 | Ga0207711_10217681 | Ga0207711_102176813 | 162 |
| 1034 | 3300025942 | Ga0207689_10259346 | Ga0207689_102593462 | 162 |
| 1035 | 3300025961 | Ga0207712_10679428 | Ga0207712_106794282 | 162 |
| 1036 | 3300025972 | Ga0207668_10037560 | Ga0207668_100375602 | 162 |
| 1037 | 3300025981 | Ga0207640_10206654 | Ga0207640_102066542 | 162 |
| 1038 | 3300025986 | Ga0207658_11265695 | Ga0207658_112656951 | 162 |
| 1039 | 3300026041 | Ga0207639_10351053 | Ga0207639_103510532 | 162 |
| 1040 | 3300026121 | Ga0207683_10416356 | Ga0207683_104163561 | 162 |
| 1041 | 3300027717 | Ga0209998_10010305 | Ga0209998_100103052 | 162 |
| 1042 | 3300027876 | Ga0209974_10125394 | Ga0209974_101253941 | 162 |
| 1043 | 3300028380 | Ga0268265_10657217 | Ga0268265_106572172 | 162 |
| 1044 | 3300028381 | Ga0268264_10119195 | Ga0268264_101191951 | 162 |
| 1045 | 3300035085 | Ga0373929_0037569 | Ga0373929_0037569_391_900 | 162 |
| 1046 | 3300035092 | Ga0373952_0122069 | Ga0373952_0122069_97_585 | 162 |
| 1047 | 3300035121 | Ga0373960_0100017 | Ga0373960_0100017_377_886 | 162 |
| 1048 | 3300035241 | Ga0373961_0028107 | Ga0373961_0028107_828_1316 | 162 |
| 1049 | 3300035242 | Ga0373962_0108164 | Ga0373962_0108164_260_748 | 162 |
| 1050 | 3300046491 | Ga0495584_0057320 | Ga0495584_0057320_458_946 | 162 |
| 1051 | 3300046492 | Ga0495585_0190410 | Ga0495585_0190410_525_1013 | 162 |
| 1052 | 3300046492 | Ga0495585_0283142 | Ga0495585_0283142_171_659 | 162 |
| 1053 | 3300046506 | Ga0495583_0174937 | Ga0495583_0174937_145_633 | 162 |
| 1054 | 3300046519 | Ga0495632_0429543 | Ga0495632_0429543_13_522 | 162 |
| 1055 | 3300046558 | Ga0495633_0225840 | Ga0495633_0225840_241_729 | 162 |
| 1056 | 3300046615 | Ga0495656_0335498 | Ga0495656_0335498_162_650 | 162 |
| 1057 | 3300048903 | Ga0496100_0035960 | Ga0496100_0035960_1277_1786 | 162 |
| 1058 | 3300048905 | Ga0496102_0171458 | Ga0496102_0171458_1073_1561 | 162 |
| 1059 | 3300048906 | Ga0496103_0017163 | Ga0496103_0017163_1044_1532 | 162 |
| 1060 | 3300048907 | Ga0496104_0297281 | Ga0496104_0297281_493_981 | 162 |
| 1061 | 3300048910 | Ga0496107_0481936 | Ga0496107_0481936_239_727 | 162 |
| 1062 | 3300048911 | Ga0496108_0529852 | Ga0496108_0529852_126_614 | 162 |
| 1063 | 3300048912 | Ga0496109_0031859 | Ga0496109_0031859_4103_4591 | 162 |
| 1064 | 3300048913 | Ga0496110_0129581 | Ga0496110_0129581_890_1378 | 162 |
| 1065 | 3300048914 | Ga0496111_0058902 | Ga0496111_0058902_1622_2110 | 162 |
| 1066 | 3300048915 | Ga0496112_0135841 | Ga0496112_0135841_285_773 | 162 |
| 1067 | 3300048916 | Ga0496113_1125342 | Ga0496113_1125342_64_573 | 162 |
| 1068 | 3300048918 | Ga0496115_0346200 | Ga0496115_0346200_598_1086 | 162 |
| 1069 | 3300049568 | Ga0501031_0029518 | Ga0501031_0029518_594_1082 | 162 |
| 1070 | 3300049569 | Ga0501032_0160827 | Ga0501032_0160827_770_1258 | 162 |
| 1071 | 3300049569 | Ga0501032_0265986 | Ga0501032_0265986_498_986 | 162 |
| 1072 | 3300049570 | Ga0501033_0119845 | Ga0501033_0119845_401_889 | 162 |
| 1073 | 3300049572 | Ga0501036_0020419 | Ga0501036_0020419_1605_2093 | 162 |
| 1074 | 3300049572 | Ga0501036_0042203 | Ga0501036_0042203_2256_2744 | 162 |
| 1075 | 3300049573 | Ga0501037_0151827 | Ga0501037_0151827_644_1132 | 162 |
| 1076 | 3300049575 | Ga0501039_0024319 | Ga0501039_0024319_1396_1884 | 162 |
| 1077 | 3300049575 | Ga0501039_0081359 | Ga0501039_0081359_686_1174 | 162 |
| 1078 | 3300049576 | Ga0501040_0246648 | Ga0501040_0246648_600_1088 | 162 |
| 1079 | 3300049577 | Ga0501041_0079483 | Ga0501041_0079483_1135_1623 | 162 |
| 1080 | 3300049578 | Ga0501042_0028224 | Ga0501042_0028224_1243_1731 | 162 |
| 1081 | 3300049578 | Ga0501042_0090238 | Ga0501042_0090238_705_1193 | 162 |
| 1082 | 3300049580 | Ga0501046_0058260 | Ga0501046_0058260_2273_2761 | 162 |
| 1083 | 3300049580 | Ga0501046_0084349 | Ga0501046_0084349_840_1328 | 162 |
| 1084 | 3300049580 | Ga0501046_0096109 | Ga0501046_0096109_1252_1740 | 162 |
| 1085 | 3300049581 | Ga0501047_0110628 | Ga0501047_0110628_894_1382 | 162 |
| 1086 | 3300049582 | Ga0501048_0046137 | Ga0501048_0046137_1251_1739 | 162 |
| 1087 | 3300049584 | Ga0501068_0014932 | Ga0501068_0014932_3363_3851 | 162 |
| 1088 | 3300049584 | Ga0501068_0054565 | Ga0501068_0054565_1111_1599 | 162 |
| 1089 | 3300049587 | Ga0501071_0077862 | Ga0501071_0077862_784_1272 | 162 |
| 1090 | 3300049587 | Ga0501071_0285357 | Ga0501071_0285357_424_912 | 162 |
| 1091 | 3300049587 | Ga0501071_0437020 | Ga0501071_0437020_85_594 | 162 |
| 1092 | 3300049588 | Ga0501072_0015847 | Ga0501072_0015847_4347_4835 | 162 |
| 1093 | 3300049588 | Ga0501072_0030510 | Ga0501072_0030510_1147_1635 | 162 |
| 1094 | 3300049589 | Ga0501073_0566948 | Ga0501073_0566948_201_710 | 162 |
| 1095 | 3300049590 | Ga0501074_0036832 | Ga0501074_0036832_1808_2296 | 162 |
| 1096 | 3300049591 | Ga0501075_0023025 | Ga0501075_0023025_3364_3852 | 162 |
| 1097 | 3300049591 | Ga0501075_0107810 | Ga0501075_0107810_1356_1844 | 162 |
| 1098 | 3300049592 | Ga0501076_0034396 | Ga0501076_0034396_3210_3698 | 162 |
| 1099 | 3300049592 | Ga0501076_0114666 | Ga0501076_0114666_280_768 | 162 |
| 1100 | 3300049593 | Ga0501077_0092221 | Ga0501077_0092221_1281_1769 | 162 |
| 1101 | 3300049593 | Ga0501077_0198439 | Ga0501077_0198439_759_1247 | 162 |
| 1102 | 3300049741 | Ga0501079_0015310 | Ga0501079_0015310_3879_4367 | 162 |
| 1103 | 3300049741 | Ga0501079_0093750 | Ga0501079_0093750_976_1464 | 162 |
| 1104 | 3300049741 | Ga0501079_0359212 | Ga0501079_0359212_598_1089 | 162 |
| 1105 | 3300049741 | Ga0501079_0861464 | Ga0501079_0861464_47_535 | 162 |
| 1106 | 3300049742 | Ga0501080_0131305 | Ga0501080_0131305_129_617 | 162 |
| 1107 | 3300049742 | Ga0501080_0154201 | Ga0501080_0154201_295_783 | 162 |
| 1108 | 3300049743 | Ga0501081_0007477 | Ga0501081_0007477_4140_4628 | 162 |
| 1109 | 3300049743 | Ga0501081_0097137 | Ga0501081_0097137_292_780 | 162 |
| 1110 | 3300049744 | Ga0501083_0036097 | Ga0501083_0036097_1341_1829 | 162 |
| 1111 | 3300049744 | Ga0501083_0062836 | Ga0501083_0062836_101_589 | 162 |
| 1112 | 3300049822 | Ga0501035_0417741 | Ga0501035_0417741_598_1089 | 162 |
| 1113 | 3300049823 | Ga0501044_1325056 | Ga0501044_1325056_24_512 | 162 |
| 1114 | 3300049824 | Ga0501045_0019019 | Ga0501045_0019019_62_571 | 162 |
| 1115 | 3300049824 | Ga0501045_0055910 | Ga0501045_0055910_1317_1805 | 162 |
| 1116 | 3300049824 | Ga0501045_0119776 | Ga0501045_0119776_1284_1772 | 162 |
| 1117 | 3300050507 | nmdc:mga05p37_99844_c1 | nmdc:mga05p37_99844_c1_770_1258 | 162 |
| 1118 | 3300050510 | nmdc:mga06r32_226888_c1 | nmdc:mga06r32_226888_c1_579_1067 | 162 |
| 1119 | 3300050512 | nmdc:mga0n895_763592_c1 | nmdc:mga0n895_763592_c1_365_874 | 162 |
| 1120 | 3300050515 | nmdc:mga0a205_208281_c1 | nmdc:mga0a205_208281_c1_570_1079 | 162 |
| 1121 | 3300053083 | Ga0495655_0020441 | Ga0495655_0020441_496_987 | 162 |
| 1122 | 3300054114 | Ga0501084_0024909 | Ga0501084_0024909_1630_2118 | 162 |
| 1123 | 3300054114 | Ga0501084_0096312 | Ga0501084_0096312_651_1139 | 162 |
| 1124 | 3300054114 | Ga0501084_0536815 | Ga0501084_0536815_14_502 | 162 |
| 1125 | 3300060353 | Ga0501082_0185586 | Ga0501082_0185586_211_699 | 162 |
| 1126 | 3300060353 | Ga0501082_0203528 | Ga0501082_0203528_549_1037 | 162 |
| 1127 | 3300060353 | Ga0501082_0221183 | Ga0501082_0221183_777_1265 | 162 |
| 1128 | 3300061734 | Ga0530510_0007204 | Ga0530510_0007204_963_1451 | 162 |
| 1129 | 3300061734 | Ga0530510_0055187 | Ga0530510_0055187_1192_1680 | 162 |
| 1130 | 3300061734 | Ga0530510_0295611 | Ga0530510_0295611_701_1192 | 162 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7m4u-assembly1.cif.gz_i | a. baumannii ribosome-eravacycline complex: 30s | 0.9785 | 38 | 140 |
| 7nhn-assembly1.cif.gz_j | vgal, an antibiotic resistance abcf, in complex with 70s ribosome from listeria monocytogenes | 0.9763 | 38 | 141 |
| 8d8k-assembly1.cif.gz_I | yeast mitochondrial small subunit assembly intermediate (state 2) | 0.9748 | 29 | 140 |
| 8d8l-assembly1.cif.gz_I | yeast mitochondrial small subunit assembly intermediate (state 3) | 0.9737 | 29 | 140 |
| 5mrf-assembly1.cif.gz_II | structure of the yeast mitochondrial ribosome - class c | 0.9698 | 29 | 140 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q7XAM9_269_415_3.30.230.10 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; | 0.9964 | 29 | 140 | 3.30.230.10 |
| af_O14006_146_271_3.30.230.10 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; | 0.9898 | 38 | 140 | 3.30.230.10 |
| af_O94150_208_336_3.30.230.10 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; | 0.9872 | 36 | 140 | 3.30.230.10 |
| af_Q54CK4_214_339_3.30.230.10 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; | 0.9867 | 38 | 140 | 3.30.230.10 |
| af_Q8IHZ4_170_300_3.30.230.10 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; | 0.9715 | 37 | 140 | 3.30.230.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-D8QWR9-F1-model_v4 | 30S ribosomal protein S9, chloroplastic | 0.9994 | 28 | 140 |
GO:0003723
GO:0003735 GO:0006412 GO:0022627 |
| AF-A0A6D2KP69-F1-model_v4 | 30S ribosomal protein S9, chloroplastic | 0.9979 | 28 | 140 |
GO:0003723
GO:0003735 GO:0006412 GO:0022627 |
| AF-A0A7J6WZV8-F1-model_v4 | 30S ribosomal protein S9 protein | 0.9978 | 28 | 140 |
GO:0003723
GO:0003735 GO:0006412 GO:0022627 |
| AF-A0A6D2JVG9-F1-model_v4 | 30S ribosomal protein S9 | 0.9967 | 28 | 140 |
GO:0003723
GO:0003735 GO:0006412 GO:0022627 |
| AF-A0A0G4AM87-F1-model_v4 | Ribosomal protein S5 domain 2-like superfamily protein | 0.9966 | 28 | 140 |
GO:0003723
GO:0003735 GO:0006412 GO:0022627 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar