F490542

General Info

Members Datasets Scaffolds Average Seq Length
1130 585 968 159

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|8004695233|8004697816
Length 194
Sequence SSLAELGAATGNTNTQPAAPVHVQKLDKSGRAYATGKRKNAIARVWVKPGSGKIIVNDKEFATYFARPVLQMILNQPIIASNRAGQYDIVATVVGGGLSGQAGAVRHGISKALTYYEPTLRAVLKKGGFLTRDSRVVERKKYGKAKARRSFQFPSAKHFAASDNRKGRLRAAFLFAARQPPHPRLRRDLPIEGR

Samples

Sample ID Description Type Environment
1 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
2 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
3 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
4 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
5 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
6 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
7 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
8 2512875024 Mesorhizobium loti R88b Isolate Nodule
9 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
10 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
11 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
12 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
13 2643221580 Devosia sp. Root635 Isolate Unclassified
14 2643221591 Devosia sp. Root685 Isolate Unclassified
15 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
16 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
17 2643221674 Devosia sp. Root436 Isolate Unclassified
18 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
19 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
20 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
21 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
22 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
23 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
24 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
25 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
26 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
27 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
28 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
29 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
30 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
31 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
32 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
33 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
34 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
35 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
36 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
37 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
38 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
39 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
40 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
41 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
42 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
43 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
44 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
45 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
46 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
47 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
48 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
49 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
50 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
51 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
52 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
53 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
54 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
55 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
56 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
57 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
58 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
59 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
60 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
61 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
62 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
63 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
64 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
65 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
66 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
67 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
68 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
69 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
70 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
71 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
72 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
73 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
74 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
75 2919679072 Pseudotabrizicola sp. 4114 Isolate Unclassified
76 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
77 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
78 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
79 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
80 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
81 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
82 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
83 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
84 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
85 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
86 2932401849 Devosia sp. 2618 Isolate Rhizosphere
87 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
88 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
89 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
90 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
91 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
92 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
93 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
94 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
95 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
96 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
97 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
98 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
99 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
100 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
101 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
102 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
103 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
104 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
105 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
106 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
107 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
108 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
109 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
110 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
111 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
112 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
113 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
114 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
115 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
116 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
117 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
118 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
119 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
120 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
121 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
122 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
123 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
124 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
125 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
126 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
127 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
128 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
129 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
130 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
131 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
132 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
133 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
134 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
135 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
136 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
137 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
138 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
139 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
140 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
141 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
142 3004167301 Mesorhizobium loti 582 Isolate Unclassified
143 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
144 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
145 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
146 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
147 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
148 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
149 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
150 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
151 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
152 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
153 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
154 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
155 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
156 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
157 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
158 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
159 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
160 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
161 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
162 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
163 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
164 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
165 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
166 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
167 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
168 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
169 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
170 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
171 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
172 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
173 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
174 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
175 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
176 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
177 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
178 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
179 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
180 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
181 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
182 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
183 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
184 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
185 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
186 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
187 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
188 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
189 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
190 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
191 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
192 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
193 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
194 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
195 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
196 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
197 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
198 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
199 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
200 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
201 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
202 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
203 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
204 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
205 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
206 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
207 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
208 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
209 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
210 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
211 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
212 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
213 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
214 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
215 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
216 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
217 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
218 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
219 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
220 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
221 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
222 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
223 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
224 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
225 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
226 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
227 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
228 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
229 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
230 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
231 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
232 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
233 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
234 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
235 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
236 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
237 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
238 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
239 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
240 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
241 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
242 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
243 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
244 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
245 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
246 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
247 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
248 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
249 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
250 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
251 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
252 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
253 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
254 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
255 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
256 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
257 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
258 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
259 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
260 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
261 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
262 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
263 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
264 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
265 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
266 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
267 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
268 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
269 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
270 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
271 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
272 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
273 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
274 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
275 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
276 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
277 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
278 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
279 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
280 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
281 3300012481 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 Metagenome Rhizosphere
282 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
283 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
284 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
285 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
286 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
287 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
288 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
289 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
290 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
291 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
292 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
293 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
294 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
295 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
296 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
297 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
298 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
299 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
300 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
301 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
302 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
303 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
304 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
305 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
306 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
307 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
308 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
309 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
310 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
311 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
312 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
313 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
314 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
315 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
316 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
317 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
318 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
319 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
320 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
321 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
322 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
323 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
324 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
325 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
326 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
327 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
328 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
329 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
330 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
331 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
332 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
333 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
334 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
335 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
336 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
337 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
338 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
339 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
340 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
341 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
342 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
343 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
344 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
345 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
346 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
347 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
348 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
349 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
350 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
351 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
352 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
353 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
354 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
355 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
356 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
357 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
358 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
359 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
360 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
361 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
362 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
363 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
364 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
365 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
366 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
367 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
368 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
369 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
370 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
371 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
372 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
373 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
374 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
375 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
376 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
377 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
378 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
379 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
380 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
381 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
382 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
383 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
384 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
385 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
386 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
387 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
388 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
389 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
390 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
391 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
392 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
393 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
394 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
395 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
396 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
397 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
398 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
399 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
400 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
401 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
402 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
403 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
404 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
405 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
406 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
407 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
408 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
409 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
410 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
411 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
412 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
413 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
414 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
415 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
416 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
417 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
418 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
419 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
420 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
421 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
422 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
423 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
424 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
425 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
426 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
427 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
428 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
429 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
430 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
431 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
432 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
433 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
434 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
435 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
436 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
437 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
438 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
439 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
440 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
441 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
442 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
443 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
444 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
445 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
446 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
447 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
448 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
449 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
450 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
451 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
452 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
453 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
454 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
455 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
456 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
457 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
458 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
459 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
460 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
461 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
462 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
463 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
464 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
465 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
466 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
467 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
468 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
469 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
470 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
471 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
472 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
473 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
474 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
475 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
476 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
477 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
478 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
479 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
480 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
481 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
482 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
483 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
484 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
485 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
486 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
487 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
488 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
489 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
490 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
491 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
492 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
493 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
494 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
495 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
496 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
497 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
498 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
499 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
500 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
501 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
502 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
503 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
504 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
505 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
506 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
507 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
508 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
509 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
510 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
511 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
512 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
513 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
514 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
515 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
516 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
517 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
518 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
519 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
520 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
521 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
522 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
523 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
524 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
525 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
526 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
527 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
528 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
529 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
530 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
531 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
532 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
533 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
534 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
535 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
536 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
537 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
538 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
539 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
540 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
541 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
542 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
543 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
544 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
545 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
546 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
547 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
548 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
549 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
550 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
551 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
552 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
553 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
554 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
555 3300059514 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 106R_AW_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
556 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
557 3300059608 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 166R_SD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
558 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
559 3300059625 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
560 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
561 3300059631 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 168R_SD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
562 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
563 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
564 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
565 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
566 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
567 3300059650 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 69R_SD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
568 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
569 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
570 3300059658 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
571 3300059660 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
572 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
573 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
574 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
575 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
576 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
577 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
578 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
579 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
580 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
581 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
582 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
583 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
584 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
585 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 82.3
Metatranscriptomes 3.36
Isolates 14.34

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.46
Nodule 11.86
Rhizoplane 4.34
Rhizosphere 71.33
Stem 0
Stem Tuber 0
Unclassified 6.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 ARSoilOldRDRAFT_c005725 3300000044 Bacteria 1047
2 JGI24737J22298_10005558 3300001990 Bacteria 4347
3 JGI24735J21928_10022099 3300002067 Bacteria 1939
4 JGI24738J21930_10016180 3300002075 Bacteria 1578
5 JGI24749J21850_1005277 3300002076 Bacteria 1813
6 JGI24744J21845_10011991 3300002077 Bacteria 1764
7 JGI24034J26672_10009889 3300002239 Bacteria 1412
8 JGI25155J39150_1000019 3300002704 Bacteria 155636
9 JGI25156J39149_1000020 3300002705 Bacteria 156628
10 JGI25162J39368_1000891 3300002737 Bacteria 19509
11 JGI25162J39368_1001396 3300002737 Bacteria 13209
12 JGI25154J39366_1000102 3300002738 Bacteria 76188
13 JGI25154J39366_1021810 3300002738 Bacteria 604
14 JGI25157J39369_1000070 3300002741 Bacteria 92090
15 JGI25157J39369_1000222 3300002741 Bacteria 45959
16 JGI25159J45721_1000291 3300002987 Bacteria 23530
17 JGI25406J46586_10006588 3300003203 Bacteria 5338
18 JGI25165J46597_1000406 3300003214 Bacteria 45616
19 JGI25165J46597_1000936 3300003214 Bacteria 20055
20 JGI25165J46597_1001407 3300003214 Bacteria 13052
21 JGI25160J50197_1000015 3300003354 Bacteria 250902
22 JGI25161J50226_1000005 3300003374 Bacteria 292548
23 Ga0055542_1001452 3300003762 Bacteria 11747
24 Ga0055529_1001896 3300003763 Bacteria 4828
25 Ga0055526_1006554 3300003771 Bacteria 6285
26 Ga0055524_1031931 3300003775 Bacteria 1505
27 Ga0055528_1000373 3300003790 Bacteria 36405
28 Ga0055543_1000012 3300004625 Bacteria 186581
29 Ga0065165_1000125 3300005262 Bacteria 130283
30 Ga0070658_10249243 3300005327 Bacteria 1506
31 Ga0070658_10634615 3300005327 Bacteria 927
32 Ga0070676_10002448 3300005328 Bacteria 9510
33 Ga0070676_10092242 3300005328 Bacteria 1857
34 Ga0070683_100016688 3300005329 Bacteria 6479
35 Ga0070690_100000438 3300005330 Bacteria 21088
36 Ga0070670_100001713 3300005331 Bacteria 17855
37 Ga0068869_100126011 3300005334 Bacteria 1964
38 Ga0068869_100223463 3300005334 Bacteria 1493
39 Ga0070666_10179946 3300005335 Bacteria 1483
40 Ga0070666_10393504 3300005335 Bacteria 996
41 Ga0070680_100002037 3300005336 Bacteria 14916
42 Ga0070682_100000387 3300005337 Bacteria 29331
43 Ga0068868_100007844 3300005338 Bacteria 7619
44 Ga0070660_100142969 3300005339 Bacteria 1921
45 Ga0070660_101039030 3300005339 Bacteria 693
46 Ga0070689_100003836 3300005340 Bacteria 10071
47 Ga0070691_10006920 3300005341 Bacteria 5190
48 Ga0070687_100002483 3300005343 Bacteria 6938
49 Ga0070687_100649982 3300005343 Bacteria 731
50 Ga0070661_100000689 3300005344 Bacteria 24833
51 Ga0070692_10001470 3300005345 Bacteria 8580
52 Ga0070668_100049327 3300005347 Bacteria 3239
53 Ga0070668_100382511 3300005347 Bacteria 1198
54 Ga0070668_100420178 3300005347 Bacteria 1145
55 Ga0070669_100009784 3300005353 Bacteria 6830
56 Ga0070669_100164725 3300005353 Bacteria 1725
57 Ga0070669_101232317 3300005353 Bacteria 647
58 Ga0070675_100002266 3300005354 Bacteria 14278
59 Ga0070671_100010188 3300005355 Bacteria 7543
60 Ga0070671_100530455 3300005355 Bacteria 1014
61 Ga0070674_100001353 3300005356 Bacteria 12917
62 Ga0070674_100057288 3300005356 Bacteria 2705
63 Ga0070674_100151689 3300005356 Bacteria 1749
64 Ga0070673_100003636 3300005364 Bacteria 9649
65 Ga0070688_100001165 3300005365 Bacteria 13089
66 Ga0070688_100414168 3300005365 Bacteria 1000
67 Ga0070659_100018173 3300005366 Bacteria 5304
68 Ga0070667_100000657 3300005367 Bacteria 33552
69 Ga0070709_10003372 3300005434 Bacteria 8586
70 Ga0070714_100002744 3300005435 Bacteria 12973
71 Ga0070713_100123044 3300005436 Bacteria 2278
72 Ga0070710_10006897 3300005437 Bacteria 5481
73 Ga0070701_10001555 3300005438 Bacteria 8515
74 Ga0070711_100001294 3300005439 Bacteria 13600
75 Ga0070711_100118311 3300005439 Bacteria 1955
76 Ga0070705_100002287 3300005440 Bacteria 9684
77 Ga0070700_100001827 3300005441 Bacteria 10741
78 Ga0070700_100102923 3300005441 Bacteria 1885
79 Ga0070694_100003648 3300005444 Bacteria 9186
80 Ga0070694_100747058 3300005444 Bacteria 799
81 Ga0070663_100003294 3300005455 Bacteria 9298
82 Ga0070663_100109857 3300005455 Bacteria 2071
83 Ga0070663_100133864 3300005455 Bacteria 1885
84 Ga0070678_100030424 3300005456 Bacteria 3711
85 Ga0070678_100347995 3300005456 Bacteria 1273
86 Ga0070662_100001709 3300005457 Bacteria 13506
87 Ga0070681_10092614 3300005458 Bacteria 2971
88 Ga0068867_100043855 3300005459 Bacteria 3275
89 Ga0068867_100318457 3300005459 Bacteria 1288
90 Ga0070685_10050558 3300005466 Bacteria 2401
91 Ga0070685_10404867 3300005466 Bacteria 946
92 Ga0070699_100298224 3300005518 Bacteria 1446
93 Ga0070679_100036086 3300005530 Bacteria 4906
94 Ga0070679_100965837 3300005530 Bacteria 796
95 Ga0070684_100001739 3300005535 Bacteria 15842
96 Ga0070697_100006693 3300005536 Bacteria 8942
97 Ga0070697_100147000 3300005536 Bacteria 1985
98 Ga0068853_100006306 3300005539 Bacteria 9411
99 Ga0068853_100181870 3300005539 Bacteria 1907
100 Ga0068853_100819416 3300005539 Bacteria 892
101 Ga0070672_100002994 3300005543 Bacteria 10885
102 Ga0070695_100013728 3300005545 Bacteria 4869
103 Ga0070696_100046152 3300005546 Bacteria 3020
104 Ga0070696_100086366 3300005546 Bacteria 2227
105 Ga0070693_100000155 3300005547 Bacteria 31196
106 Ga0070693_100565888 3300005547 Bacteria 816
107 Ga0070665_100016148 3300005548 Bacteria 7494
108 Ga0070665_100025519 3300005548 Bacteria 5952
109 Ga0070665_100342207 3300005548 Bacteria 1501
110 Ga0070665_100698278 3300005548 Bacteria 1028
111 Ga0070704_100000688 3300005549 Bacteria 16380
112 Ga0068855_100015557 3300005563 Bacteria 9158
113 Ga0068855_100197519 3300005563 Bacteria 2266
114 Ga0068855_100308043 3300005563 Bacteria 1753
115 Ga0070664_100000700 3300005564 Bacteria 25609
116 Ga0070664_100339790 3300005564 Bacteria 1364
117 Ga0068857_100010258 3300005577 Bacteria 8143
118 Ga0068857_100094136 3300005577 Bacteria 2682
119 Ga0068854_100002106 3300005578 Bacteria 12194
120 Ga0068854_100033016 3300005578 Bacteria 3606
121 Ga0068854_100063366 3300005578 Bacteria 2683
122 Ga0068854_100600566 3300005578 Bacteria 939
123 Ga0068856_100006075 3300005614 Bacteria 11863
124 Ga0068856_100197529 3300005614 Bacteria 2026
125 Ga0068856_100278424 3300005614 Bacteria 1690
126 Ga0068856_100313025 3300005614 Bacteria 1588
127 Ga0070702_100001131 3300005615 Bacteria 10709
128 Ga0068852_100059841 3300005616 Bacteria 3305
129 Ga0068852_100073723 3300005616 Bacteria 3004
130 Ga0068852_100299278 3300005616 Bacteria 1557
131 Ga0068859_100014016 3300005617 Bacteria 8038
132 Ga0068859_100293109 3300005617 Bacteria 1720
133 Ga0068864_100005168 3300005618 Bacteria 10686
134 Ga0068866_10004281 3300005718 Bacteria 5863
135 Ga0068861_100027027 3300005719 Bacteria 4176
136 Ga0068851_10018385 3300005834 Bacteria 3366
137 Ga0068863_100003165 3300005841 Bacteria 16266
138 Ga0068858_100018872 3300005842 Bacteria 6452
139 Ga0068858_100750720 3300005842 Bacteria 951
140 Ga0068860_100393567 3300005843 Bacteria 1370
141 Ga0068860_100611569 3300005843 Bacteria 1096
142 Ga0068862_100006195 3300005844 Bacteria 9962
143 Ga0068862_100139304 3300005844 Bacteria 2152
144 Ga0068862_100393109 3300005844 Bacteria 1296
145 Ga0081455_10034109 3300005937 Bacteria 4564
146 Ga0081455_10123925 3300005937 Bacteria 2032
147 Ga0081540_1044223 3300005983 Bacteria 2275
148 Ga0081539_10001367 3300005985 Bacteria 42276
149 Ga0075365_10039274 3300006038 Bacteria 3081
150 Ga0075365_10083984 3300006038 Bacteria 2160
151 Ga0075365_10100973 3300006038 Bacteria 1975
152 Ga0075365_10132744 3300006038 Bacteria 1724
153 Ga0075365_11055805 3300006038 Bacteria 572
154 Ga0075368_10142677 3300006042 Bacteria 998
155 Ga0075364_10454062 3300006051 Bacteria 875
156 Ga0070715_10000219 3300006163 Bacteria 13624
157 Ga0070715_10034114 3300006163 Bacteria 2084
158 Ga0070716_100001864 3300006173 Bacteria 9566
159 Ga0070712_100000382 3300006175 Bacteria 25268
160 Ga0070712_100084684 3300006175 Bacteria 2306
161 Ga0070712_100085109 3300006175 Bacteria 2301
162 Ga0075362_10018661 3300006177 Bacteria 2873
163 Ga0075362_10398728 3300006177 Bacteria 694
164 Ga0075367_10240549 3300006178 Bacteria 1134
165 Ga0075367_10281594 3300006178 Bacteria 1045
166 Ga0075369_10005107 3300006186 Bacteria 4887
167 Ga0097621_100105246 3300006237 Bacteria 2379
168 Ga0075370_10011760 3300006353 Bacteria 4606
169 Ga0075370_10066061 3300006353 Bacteria 2063
170 Ga0075370_10093917 3300006353 Bacteria 1732
171 Ga0075370_10439119 3300006353 Bacteria 785
172 Ga0068871_101157423 3300006358 Bacteria 725
173 Ga0075428_100005355 3300006844 Bacteria 14267
174 Ga0075430_100196244 3300006846 Bacteria 1677
175 Ga0075431_100033350 3300006847 Bacteria 5307
176 Ga0075431_100314580 3300006847 Bacteria 1580
177 Ga0075431_100362288 3300006847 Bacteria 1456
178 Ga0075433_10079314 3300006852 Bacteria 2893
179 Ga0075434_100467491 3300006871 Bacteria 1282
180 Ga0068865_100002456 3300006881 Bacteria 10972
181 Ga0068865_100364346 3300006881 Bacteria 1175
182 Ga0075436_100011825 3300006914 Bacteria 5989
183 Ga0097620_100014016 3300006931 Bacteria 8038
184 Ga0097620_100293110 3300006931 Bacteria 1720
185 Ga0075435_101058994 3300007076 Bacteria 709
186 Ga0105240_10000032 3300009093 Bacteria 283907
187 Ga0105240_10019313 3300009093 Bacteria 9108
188 Ga0105240_10028048 3300009093 Bacteria 7362
189 Ga0111539_10126417 3300009094 Bacteria 2995
190 Ga0105245_10000729 3300009098 Bacteria 29644
191 Ga0105247_10000684 3300009101 Bacteria 26726
192 Ga0105247_10021678 3300009101 Bacteria 3866
193 Ga0105247_10031011 3300009101 Bacteria 3243
194 Ga0105247_10222109 3300009101 Bacteria 1279
195 Ga0105247_10562908 3300009101 Bacteria 840
196 Ga0105247_10896740 3300009101 Bacteria 684
197 Ga0114129_10055348 3300009147 Bacteria 5560
198 Ga0105243_10004066 3300009148 Bacteria 11653
199 Ga0105243_10506141 3300009148 Bacteria 1145
200 Ga0105241_10014990 3300009174 Bacteria 5677
201 Ga0105241_10106876 3300009174 Bacteria 2234
202 Ga0105242_10000957 3300009176 Bacteria 22525
203 Ga0105242_10457859 3300009176 Bacteria 1204
204 Ga0105248_10000854 3300009177 Bacteria 34286
205 Ga0105248_10630755 3300009177 Bacteria 1209
206 Ga0105248_10634130 3300009177 Bacteria 1206
207 Ga0105237_10000974 3300009545 Bacteria 38484
208 Ga0105237_10001638 3300009545 Bacteria 29067
209 Ga0105237_10013741 3300009545 Bacteria 8479
210 Ga0105237_10252405 3300009545 Bacteria 1766
211 Ga0105237_10748799 3300009545 Bacteria 983
212 Ga0105237_10829593 3300009545 Bacteria 931
213 Ga0105237_11633432 3300009545 Bacteria 651
214 Ga0105237_11834838 3300009545 Bacteria 614
215 Ga0105237_12335032 3300009545 Bacteria 545
216 Ga0105238_10005006 3300009551 Bacteria 13097
217 Ga0105238_10077095 3300009551 Bacteria 3325
218 Ga0105238_10284449 3300009551 Bacteria 1635
219 Ga0105249_10000677 3300009553 Bacteria 30987
220 Ga0105249_11005983 3300009553 Bacteria 902
221 Ga0105239_10002346 3300010375 Bacteria 24125
222 Ga0105239_10004667 3300010375 Bacteria 16290
223 Ga0105239_10062542 3300010375 Bacteria 4085
224 Ga0105239_10196398 3300010375 Bacteria 2260
225 Ga0105239_11161568 3300010375 Bacteria 889
226 Ga0105239_11579987 3300010375 Bacteria 758
227 Ga0105246_10001644 3300011119 Bacteria 13331
228 Ga0105246_10286685 3300011119 Bacteria 1323
229 Ga0105246_11003071 3300011119 Bacteria 756
230 Ga0157320_1011286 3300012481 Bacteria 702
231 Ga0157373_10044718 3300013100 Bacteria 3161
232 Ga0157373_11273311 3300013100 Bacteria 556
233 Ga0157371_10024551 3300013102 Bacteria 4399
234 Ga0157371_10094952 3300013102 Bacteria 2113
235 Ga0157371_10795335 3300013102 Bacteria 712
236 Ga0157370_10233692 3300013104 Bacteria 1701
237 Ga0157369_10003955 3300013105 Bacteria 17571
238 Ga0157369_10371389 3300013105 Bacteria 1485
239 Ga0157369_10811085 3300013105 Bacteria 961
240 Ga0157374_10029930 3300013296 Bacteria 4939
241 Ga0157374_10268397 3300013296 Bacteria 1682
242 Ga0157374_10694658 3300013296 Bacteria 1030
243 Ga0157378_10006232 3300013297 Bacteria 10444
244 Ga0157378_10144337 3300013297 Bacteria 2213
245 Ga0163162_10005337 3300013306 Bacteria 12402
246 Ga0163162_10592948 3300013306 Bacteria 1235
247 Ga0157372_10010270 3300013307 Bacteria 9945
248 Ga0157372_11577648 3300013307 Bacteria 756
249 Ga0157375_10000519 3300013308 Bacteria 34613
250 Ga0157375_10020497 3300013308 Bacteria 6041
251 Ga0157375_10715486 3300013308 Bacteria 1154
252 Ga0163163_10026341 3300014325 Bacteria 5557
253 Ga0163163_10204954 3300014325 Bacteria 2020
254 Ga0163163_11158065 3300014325 Bacteria 836
255 Ga0157380_10839542 3300014326 Bacteria 939
256 Ga0157377_10000936 3300014745 Bacteria 12226
257 Ga0157377_10167232 3300014745 Bacteria 1372
258 Ga0157379_10006266 3300014968 Bacteria 10244
259 Ga0157379_10647372 3300014968 Bacteria 989
260 Ga0157379_10823159 3300014968 Bacteria 877
261 Ga0157376_10049794 3300014969 Bacteria 3472
262 Ga0157376_10701575 3300014969 Bacteria 1017
263 Ga0163161_10010203 3300017792 Bacteria 6503
264 Ga0206353_10411292 3300020082 Bacteria 686
265 Ga0209760_101970 3300025207 Bacteria 2002
266 Ga0207427_106742 3300025231 Bacteria 1419
267 Ga0209437_100033 3300025233 Bacteria 512520
268 Ga0209437_100075 3300025233 Bacteria 297202
269 Ga0209646_1017848 3300025246 Bacteria 1043
270 Ga0209026_1000002 3300025250 Bacteria 1136158
271 Ga0209148_1000038 3300025254 Bacteria 493744
272 Ga0209148_1015732 3300025254 Bacteria 1315
273 Ga0209233_1000064 3300025261 Bacteria 392156
274 Ga0209233_1000223 3300025261 Bacteria 103765
275 Ga0209233_1000342 3300025261 Bacteria 45690
276 Ga0209455_1000678 3300025272 Bacteria 20245
277 Ga0209130_1000018 3300025284 Bacteria 388301
278 Ga0209025_1158021 3300025294 Bacteria 616
279 Ga0207426_1000044 3300025302 Bacteria 428043
280 Ga0207656_10146839 3300025321 Bacteria 1114
281 Ga0207656_10176604 3300025321 Bacteria 1023
282 Ga0207656_10324107 3300025321 Bacteria 766
283 Ga0207713_1112417 3300025735 Bacteria 924
284 Ga0207692_10010556 3300025898 Bacteria 3898
285 Ga0207642_10031245 3300025899 Bacteria 2228
286 Ga0207642_10057741 3300025899 Bacteria 1787
287 Ga0207710_10006312 3300025900 Bacteria 5069
288 Ga0207710_10039726 3300025900 Bacteria 2083
289 Ga0207710_10195311 3300025900 Bacteria 998
290 Ga0207688_10288285 3300025901 Bacteria 1002
291 Ga0207688_10451551 3300025901 Bacteria 801
292 Ga0207680_10005465 3300025903 Bacteria 6071
293 Ga0207647_10004790 3300025904 Bacteria 10017
294 Ga0207699_10002555 3300025906 Bacteria 8584
295 Ga0207645_10001793 3300025907 Bacteria 17329
296 Ga0207645_10207260 3300025907 Bacteria 1291
297 Ga0207654_10030519 3300025911 Bacteria 2960
298 Ga0207695_10132304 3300025913 Bacteria 2451
299 Ga0207695_10302141 3300025913 Bacteria 1492
300 Ga0207695_10481911 3300025913 Bacteria 1123
301 Ga0207671_10013562 3300025914 Bacteria 6489
302 Ga0207671_10014363 3300025914 Bacteria 6264
303 Ga0207671_10334236 3300025914 Bacteria 1200
304 Ga0207671_11433902 3300025914 Bacteria 534
305 Ga0207693_10000998 3300025915 Bacteria 25439
306 Ga0207693_10039260 3300025915 Bacteria 3727
307 Ga0207693_10237126 3300025915 Bacteria 1432
308 Ga0207663_10000700 3300025916 Bacteria 14899
309 Ga0207660_10175643 3300025917 Bacteria 1661
310 Ga0207662_10003502 3300025918 Bacteria 8088
311 Ga0207662_10364326 3300025918 Bacteria 973
312 Ga0207657_10000516 3300025919 Bacteria 40906
313 Ga0207657_10056812 3300025919 Bacteria 3375
314 Ga0207649_10053908 3300025920 Bacteria 2501
315 Ga0207649_11063081 3300025920 Bacteria 638
316 Ga0207652_10101949 3300025921 Bacteria 2536
317 Ga0207681_10010302 3300025923 Bacteria 5718
318 Ga0207681_10759971 3300025923 Bacteria 808
319 Ga0207694_10021980 3300025924 Bacteria 4837
320 Ga0207694_10099971 3300025924 Bacteria 2298
321 Ga0207650_10009305 3300025925 Bacteria 6715
322 Ga0207650_10643881 3300025925 Bacteria 893
323 Ga0207659_10054489 3300025926 Bacteria 2856
324 Ga0207687_10029096 3300025927 Bacteria 3715
325 Ga0207687_10181792 3300025927 Bacteria 1630
326 Ga0207687_11460165 3300025927 Bacteria 588
327 Ga0207700_10128274 3300025928 Bacteria 2067
328 Ga0207664_10034941 3300025929 Bacteria 3875
329 Ga0207644_10080977 3300025931 Bacteria 2398
330 Ga0207644_10676690 3300025931 Bacteria 860
331 Ga0207690_10006538 3300025932 Bacteria 6911
332 Ga0207690_10572885 3300025932 Bacteria 919
333 Ga0207706_10002149 3300025933 Bacteria 19260
334 Ga0207706_10122622 3300025933 Bacteria 2286
335 Ga0207686_10004658 3300025934 Bacteria 7350
336 Ga0207686_10139007 3300025934 Bacteria 1676
337 Ga0207709_10007883 3300025935 Bacteria 5902
338 Ga0207709_10257072 3300025935 Bacteria 1279
339 Ga0207670_10002633 3300025936 Bacteria 9441
340 Ga0207670_10204030 3300025936 Bacteria 1504
341 Ga0207670_10561878 3300025936 Bacteria 933
342 Ga0207669_10033036 3300025937 Bacteria 2914
343 Ga0207704_10022172 3300025938 Bacteria 3397
344 Ga0207704_10233267 3300025938 Bacteria 1370
345 Ga0207704_10566787 3300025938 Bacteria 925
346 Ga0207704_10718630 3300025938 Bacteria 828
347 Ga0207665_10000327 3300025939 Bacteria 32933
348 Ga0207691_10022661 3300025940 Bacteria 5922
349 Ga0207711_10012217 3300025941 Bacteria 7141
350 Ga0207711_10217681 3300025941 Bacteria 1746
351 Ga0207689_10010763 3300025942 Bacteria 7871
352 Ga0207689_10028650 3300025942 Bacteria 4657
353 Ga0207689_10259346 3300025942 Bacteria 1438
354 Ga0207679_10012249 3300025945 Bacteria 5587
355 Ga0207679_11595088 3300025945 Bacteria 598
356 Ga0207667_10313344 3300025949 Bacteria 1603
357 Ga0207651_10005081 3300025960 Bacteria 6715
358 Ga0207712_10003778 3300025961 Bacteria 9559
359 Ga0207712_10499863 3300025961 Bacteria 1039
360 Ga0207712_10679428 3300025961 Bacteria 897
361 Ga0207668_10013555 3300025972 Bacteria 5024
362 Ga0207668_10037560 3300025972 Bacteria 3243
363 Ga0207668_10475056 3300025972 Bacteria 1071
364 Ga0207640_10004632 3300025981 Bacteria 7463
365 Ga0207640_10206654 3300025981 Bacteria 1492
366 Ga0207640_11077326 3300025981 Bacteria 710
367 Ga0207658_10019418 3300025986 Bacteria 4700
368 Ga0207658_10123987 3300025986 Bacteria 2065
369 Ga0207658_11265695 3300025986 Bacteria 674
370 Ga0207677_10329516 3300026023 Bacteria 1272
371 Ga0207703_10232561 3300026035 Bacteria 1653
372 Ga0207703_10276225 3300026035 Bacteria 1524
373 Ga0207639_10005217 3300026041 Bacteria 8765
374 Ga0207639_10351053 3300026041 Bacteria 1317
375 Ga0207678_10018943 3300026067 Bacteria 6049
376 Ga0207678_10054088 3300026067 Bacteria 3458
377 Ga0207678_10260940 3300026067 Bacteria 1485
378 Ga0207708_10001427 3300026075 Bacteria 17929
379 Ga0207702_10100362 3300026078 Bacteria 2553
380 Ga0207641_10005966 3300026088 Bacteria 10324
381 Ga0207648_10155357 3300026089 Bacteria 2020
382 Ga0207648_10324822 3300026089 Bacteria 1383
383 Ga0207676_10261959 3300026095 Bacteria 1561
384 Ga0207676_10594010 3300026095 Bacteria 1062
385 Ga0207674_10010004 3300026116 Bacteria 10796
386 Ga0207674_10151163 3300026116 Bacteria 2279
387 Ga0207674_10741057 3300026116 Bacteria 948
388 Ga0207675_100001630 3300026118 Bacteria 22489
389 Ga0207675_100705098 3300026118 Bacteria 1018
390 Ga0207675_100812105 3300026118 Bacteria 949
391 Ga0207675_101486986 3300026118 Bacteria 698
392 Ga0207683_10000351 3300026121 Bacteria 42117
393 Ga0207683_10051672 3300026121 Bacteria 3601
394 Ga0207683_10416356 3300026121 Bacteria 1237
395 Ga0207698_10009311 3300026142 Bacteria 6255
396 Ga0207698_10169072 3300026142 Bacteria 1923
397 Ga0207698_10756852 3300026142 Bacteria 971
398 Ga0209371_1000420 3300027312 Bacteria 43659
399 Ga0209998_10010305 3300027717 Bacteria 1935
400 Ga0209974_10125394 3300027876 Bacteria 913
401 Ga0207428_10074831 3300027907 Bacteria 2655
402 Ga0207428_10400855 3300027907 Bacteria 1004
403 Ga0268266_10012855 3300028379 Bacteria 7229
404 Ga0268266_10049403 3300028379 Bacteria 3608
405 Ga0268266_11296981 3300028379 Bacteria 703
406 Ga0268265_10081063 3300028380 Bacteria 2561
407 Ga0268265_10657217 3300028380 Bacteria 1008
408 Ga0268265_11273182 3300028380 Bacteria 735
409 Ga0268265_11641989 3300028380 Bacteria 648
410 Ga0268264_10023577 3300028381 Bacteria 5018
411 Ga0268264_10119195 3300028381 Bacteria 2323
412 Ga0307515_10000070 3300028794 Bacteria 239322
413 Ga0307515_10029068 3300028794 Bacteria 9363
414 Ga0268256_1008134 3300030500 Bacteria 3636
415 Ga0307513_10000404 3300031456 Bacteria 62692
416 Ga0307513_10268229 3300031456 Bacteria 1492
417 Ga0307513_10862518 3300031456 Bacteria 612
418 Ga0307509_10480994 3300031507 Bacteria 930
419 Ga0316576_10403100 3300031727 Bacteria 1013
420 Ga0316578_10031254 3300031728 Bacteria 3033
421 Ga0307516_10271711 3300031730 Bacteria 1381
422 Ga0307405_10094861 3300031731 Bacteria 1985
423 Ga0307405_10730644 3300031731 Bacteria 823
424 Ga0307413_10114710 3300031824 Bacteria 1811
425 Ga0307410_10363408 3300031852 Bacteria 1160
426 Ga0307410_11082769 3300031852 Bacteria 694
427 Ga0307407_10423169 3300031903 Bacteria 960
428 Ga0307412_10868996 3300031911 Bacteria 788
429 Ga0307409_100692992 3300031995 Bacteria 1017
430 Ga0307409_100804274 3300031995 Bacteria 948
431 Ga0307409_101550784 3300031995 Bacteria 690
432 Ga0307414_10338865 3300032004 Bacteria 1286
433 Ga0307414_10357464 3300032004 Bacteria 1255
434 Ga0307411_12065141 3300032005 Bacteria 533
435 Ga0307415_101603182 3300032126 Bacteria 625
436 Ga0316583_10134141 3300032133 Bacteria 863
437 Ga0316593_10134284 3300032168 Bacteria 894
438 Ga0316596_1225925 3300033541 Bacteria 524
439 Ga0373929_0037569 3300035085 Bacteria 1062
440 Ga0373929_0038548 3300035085 Bacteria 1052
441 Ga0373952_0122069 3300035092 Bacteria 708
442 Ga0373939_0044716 3300035114 Bacteria 1349
443 Ga0373960_0100017 3300035121 Bacteria 939
444 Ga0373961_0006145 3300035241 Bacteria 2886
445 Ga0373961_0028107 3300035241 Bacteria 1549
446 Ga0373962_0015643 3300035242 Bacteria 1947
447 Ga0373962_0108164 3300035242 Bacteria 874
448 Ga0373931_0496595 3300035691 Bacteria 786
449 Ga0373937_0047757 3300036401 Bacteria 3918
450 Ga0316582_0191482 3300036647 Bacteria 1393
451 Ga0395899_0000059 3300037312 Bacteria 213004
452 Ga0395899_0286650 3300037312 Bacteria 1118
453 Ga0395899_0295164 3300037312 Bacteria 1099
454 Ga0395900_0000017 3300037418 Bacteria 369602
455 Ga0395900_0158818 3300037418 Bacteria 2307
456 Ga0395900_0160673 3300037418 Bacteria 2292
457 Ga0395900_0351566 3300037418 Bacteria 1447
458 Ga0395900_0354772 3300037418 Bacteria 1439
459 Ga0395900_0569673 3300037418 Bacteria 1075
460 Ga0395900_0618074 3300037418 Bacteria 1022
461 Ga0395900_1010126 3300037418 Bacteria 751
462 Ga0395898_0000030 3300037466 Bacteria 369577
463 Ga0395898_0056315 3300037466 Bacteria 3832
464 Ga0395898_0087353 3300037466 Bacteria 3004
465 Ga0395898_0092373 3300037466 Bacteria 2911
466 Ga0395898_0118563 3300037466 Bacteria 2535
467 Ga0395898_1084799 3300037466 Bacteria 734
468 Ga0395905_0000056 3300037471 Bacteria 209230
469 Ga0395905_0223445 3300037471 Bacteria 1762
470 Ga0395905_0524883 3300037471 Bacteria 1084
471 Ga0395901_0000015 3300038443 Bacteria 373388
472 Ga0395901_0018122 3300038443 Bacteria 7186
473 Ga0395901_0418998 3300038443 Bacteria 1373
474 Ga0395901_0449754 3300038443 Bacteria 1317
475 Ga0395901_1859049 3300038443 Bacteria 550
476 Ga0400486_18150 3300038742 Bacteria 1132
477 Ga0400483_164597 3300039062 Bacteria 2620
478 Ga0400487_31446 3300039110 Bacteria 1170
479 Ga0439465_0044671 3300041413 Bacteria 1440
480 Ga0439465_0048470 3300041413 Bacteria 1386
481 Ga0439465_0384672 3300041413 Bacteria 533
482 Ga0451797_0578826 3300041453 Bacteria 1157
483 Ga0451800_0048927 3300041459 Bacteria 899
484 Ga0451807_0868095 3300041486 Bacteria 617
485 Ga0451843_1723520 3300041509 Bacteria 774
486 Ga0439445_0031169 3300042004 Bacteria 1385
487 Ga0439448_0204453 3300042005 Bacteria 693
488 Ga0439448_0234825 3300042005 Bacteria 646
489 Ga0439452_045714 3300042010 Bacteria 1018
490 Ga0439458_0062580 3300042157 Bacteria 931
491 Ga0439460_0253481 3300042461 Bacteria 609
492 Ga0439440_0054677 3300042993 Bacteria 1006
493 Ga0466965_0226700 3300044683 Bacteria 997
494 Ga0466966_0178657 3300044684 Bacteria 1288
495 Ga0466971_0135568 3300044719 Bacteria 1145
496 Ga0466968_0287072 3300044735 Bacteria 789
497 Ga0466970_0095817 3300044765 Bacteria 1613
498 Ga0466957_0206375 3300044842 Bacteria 1292
499 Ga0466960_0574826 3300044901 Bacteria 667
500 Ga0466959_0168252 3300045049 Bacteria 1538
501 Ga0466967_1130759 3300045976 Bacteria 780
502 Ga0466967_2077699 3300045976 Bacteria 564
503 Ga0495629_0224099 3300046459 Bacteria 1297
504 Ga0495638_0003767 3300046460 Bacteria 11787
505 Ga0495605_0073211 3300046474 Bacteria 1614
506 Ga0495584_0057320 3300046491 Bacteria 1960
507 Ga0495585_0190410 3300046492 Bacteria 1050
508 Ga0495585_0283142 3300046492 Bacteria 819
509 Ga0495583_0174937 3300046506 Bacteria 881
510 Ga0495606_0004680 3300046507 Bacteria 13523
511 Ga0495606_0054338 3300046507 Bacteria 2594
512 Ga0495610_0049022 3300046512 Bacteria 2070
513 Ga0495620_0062590 3300046515 Bacteria 1545
514 Ga0495628_0487256 3300046516 Bacteria 892
515 Ga0495632_0253414 3300046519 Bacteria 789
516 Ga0495632_0429543 3300046519 Bacteria 575
517 Ga0495633_0225840 3300046558 Bacteria 857
518 Ga0495633_0437924 3300046558 Bacteria 591
519 Ga0495656_0125425 3300046615 Bacteria 1217
520 Ga0495656_0335498 3300046615 Bacteria 781
521 Ga0495668_0288990 3300046616 Bacteria 898
522 Ga0495625_0268610 3300046660 Bacteria 1101
523 Ga0495657_0366327 3300046675 Bacteria 851
524 Ga0495658_0061043 3300046683 Bacteria 2164
525 Ga0495670_0313234 3300046691 Bacteria 842
526 Ga0495660_0160239 3300046810 Bacteria 1104
527 Ga0495672_0311182 3300047320 Bacteria 743
528 Ga0495683_0223543 3300047323 Bacteria 838
529 Ga0495686_0001465 3300047472 Bacteria 25695
530 Ga0495615_0099576 3300048090 Bacteria 820
531 Ga0495626_0170082 3300048091 Bacteria 909
532 Ga0496100_0023101 3300048903 Bacteria 3772
533 Ga0496100_0035960 3300048903 Bacteria 3120
534 Ga0496100_0613345 3300048903 Bacteria 846
535 Ga0496101_0059907 3300048904 Bacteria 2760
536 Ga0496101_0894567 3300048904 Bacteria 699
537 Ga0496102_0017938 3300048905 Bacteria 6209
538 Ga0496102_0171458 3300048905 Bacteria 2042
539 Ga0496102_0501310 3300048905 Bacteria 1136
540 Ga0496103_0013445 3300048906 Bacteria 4854
541 Ga0496103_0017163 3300048906 Bacteria 4328
542 Ga0496103_0159684 3300048906 Bacteria 1446
543 Ga0496103_0475240 3300048906 Bacteria 801
544 Ga0496104_0085498 3300048907 Bacteria 3010
545 Ga0496104_0297281 3300048907 Bacteria 1527
546 Ga0496105_0009703 3300048908 Bacteria 7538
547 Ga0496105_0402236 3300048908 Bacteria 1087
548 Ga0496106_0050389 3300048909 Bacteria 3138
549 Ga0496106_0416799 3300048909 Bacteria 1079
550 Ga0496107_0481936 3300048910 Bacteria 920
551 Ga0496107_0848028 3300048910 Bacteria 667
552 Ga0496108_0010541 3300048911 Bacteria 7510
553 Ga0496108_0529852 3300048911 Bacteria 1028
554 Ga0496109_0014012 3300048912 Bacteria 6970
555 Ga0496109_0020303 3300048912 Bacteria 5867
556 Ga0496109_0031859 3300048912 Bacteria 4736
557 Ga0496109_0263234 3300048912 Bacteria 1624
558 Ga0496109_0487612 3300048912 Bacteria 1163
559 Ga0496110_0004436 3300048913 Bacteria 10879
560 Ga0496110_0051018 3300048913 Bacteria 3635
561 Ga0496110_0129581 3300048913 Bacteria 2277
562 Ga0496110_0804688 3300048913 Bacteria 844
563 Ga0496111_0020482 3300048914 Bacteria 4604
564 Ga0496111_0058902 3300048914 Bacteria 2782
565 Ga0496111_0117078 3300048914 Bacteria 1965
566 Ga0496112_0005081 3300048915 Bacteria 11309
567 Ga0496112_0031458 3300048915 Bacteria 5147
568 Ga0496112_0039385 3300048915 Bacteria 4619
569 Ga0496112_0135841 3300048915 Bacteria 2430
570 Ga0496112_0250149 3300048915 Bacteria 1724
571 Ga0496112_0462719 3300048915 Bacteria 1206
572 Ga0496113_0139968 3300048916 Bacteria 1903
573 Ga0496113_0209740 3300048916 Bacteria 1550
574 Ga0496113_1125342 3300048916 Bacteria 615
575 Ga0496115_0067709 3300048918 Bacteria 2888
576 Ga0496115_0346200 3300048918 Bacteria 1213
577 Ga0496115_0905057 3300048918 Bacteria 680
578 Ga0496117_0225334 3300048920 Bacteria 1040
579 Ga0496117_0506246 3300048920 Bacteria 584
580 Ga0496117_0525236 3300048920 Bacteria 569
581 Ga0496119_0045279 3300048922 Bacteria 2760
582 Ga0496119_0050788 3300048922 Bacteria 2553
583 Ga0496119_0058680 3300048922 Bacteria 2317
584 Ga0496120_0001486 3300048923 Bacteria 27853
585 Ga0496120_0070103 3300048923 Bacteria 1929
586 Ga0496120_0178856 3300048923 Bacteria 1043
587 Ga0496121_0023237 3300048924 Bacteria 5980
588 Ga0496121_0413400 3300048924 Bacteria 880
589 Ga0496122_0064930 3300048925 Bacteria 2651
590 Ga0496122_0311863 3300048925 Bacteria 841
591 Ga0496123_0023865 3300048926 Bacteria 4669
592 Ga0496123_0338621 3300048926 Bacteria 704
593 Ga0496124_0076170 3300048927 Bacteria 2770
594 Ga0496124_0243599 3300048927 Bacteria 1335
595 Ga0496124_0592757 3300048927 Bacteria 723
596 Ga0496125_0000276 3300048928 Bacteria 103024
597 Ga0496125_0093025 3300048928 Bacteria 2252
598 Ga0496125_0466968 3300048928 Bacteria 718
599 Ga0496126_0179420 3300048929 Bacteria 1800
600 Ga0496126_1208102 3300048929 Bacteria 555
601 Ga0501305_017115 3300049161 Bacteria 1040
602 Ga0501307_069709 3300049162 Bacteria 559
603 Ga0501311_017035 3300049527 Bacteria 953
604 Ga0501313_017406 3300049529 Bacteria 868
605 Ga0501319_003996 3300049535 Bacteria 1010
606 Ga0501320_011474 3300049536 Bacteria 918
607 Ga0501031_0029518 3300049568 Bacteria 3577
608 Ga0501031_0034948 3300049568 Bacteria 3279
609 Ga0501031_0092852 3300049568 Bacteria 1970
610 Ga0501031_0207658 3300049568 Bacteria 1277
611 Ga0501031_0335658 3300049568 Bacteria 978
612 Ga0501031_0368844 3300049568 Bacteria 929
613 Ga0501031_0423601 3300049568 Bacteria 860
614 Ga0501031_0590923 3300049568 Bacteria 714
615 Ga0501032_0000116 3300049569 Bacteria 67350
616 Ga0501032_0020397 3300049569 Bacteria 4616
617 Ga0501032_0050930 3300049569 Bacteria 2792
618 Ga0501032_0062914 3300049569 Bacteria 2485
619 Ga0501032_0068747 3300049569 Bacteria 2364
620 Ga0501032_0088847 3300049569 Bacteria 2051
621 Ga0501032_0138096 3300049569 Bacteria 1606
622 Ga0501032_0160827 3300049569 Bacteria 1475
623 Ga0501032_0204835 3300049569 Bacteria 1287
624 Ga0501032_0265986 3300049569 Bacteria 1111
625 Ga0501032_0533947 3300049569 Bacteria 748
626 Ga0501032_0795208 3300049569 Bacteria 597
627 Ga0501032_0800361 3300049569 Bacteria 595
628 Ga0501033_0000346 3300049570 Bacteria 44155
629 Ga0501033_0005442 3300049570 Bacteria 10088
630 Ga0501033_0006207 3300049570 Bacteria 9367
631 Ga0501033_0014554 3300049570 Bacteria 5971
632 Ga0501033_0061822 3300049570 Bacteria 2759
633 Ga0501033_0119845 3300049570 Bacteria 1910
634 Ga0501033_0404242 3300049570 Bacteria 952
635 Ga0501033_0425306 3300049570 Bacteria 925
636 Ga0501033_0463224 3300049570 Bacteria 879
637 Ga0501033_0537174 3300049570 Bacteria 806
638 Ga0501034_0000314 3300049571 Bacteria 86025
639 Ga0501034_0001091 3300049571 Bacteria 38199
640 Ga0501034_0047815 3300049571 Bacteria 4318
641 Ga0501034_0049225 3300049571 Bacteria 4253
642 Ga0501034_0051624 3300049571 Bacteria 4146
643 Ga0501034_0084106 3300049571 Bacteria 3184
644 Ga0501034_0146938 3300049571 Bacteria 2334
645 Ga0501034_0174934 3300049571 Bacteria 2113
646 Ga0501034_0671814 3300049571 Bacteria 936
647 Ga0501034_0841185 3300049571 Bacteria 808
648 Ga0501034_1144567 3300049571 Bacteria 658
649 Ga0501036_0000117 3300049572 Bacteria 49511
650 Ga0501036_0020419 3300049572 Bacteria 5564
651 Ga0501036_0042203 3300049572 Bacteria 3862
652 Ga0501036_0042676 3300049572 Bacteria 3840
653 Ga0501036_0043949 3300049572 Bacteria 3783
654 Ga0501036_0156648 3300049572 Bacteria 1921
655 Ga0501036_0301549 3300049572 Bacteria 1340
656 Ga0501036_0539702 3300049572 Bacteria 969
657 Ga0501036_0677257 3300049572 Bacteria 853
658 Ga0501036_1597126 3300049572 Bacteria 527
659 Ga0501036_1660126 3300049572 Bacteria 515
660 Ga0501037_0000108 3300049573 Bacteria 77753
661 Ga0501037_0001070 3300049573 Bacteria 20310
662 Ga0501037_0036243 3300049573 Bacteria 3636
663 Ga0501037_0077620 3300049573 Bacteria 2410
664 Ga0501037_0151827 3300049573 Bacteria 1655
665 Ga0501037_0171344 3300049573 Bacteria 1543
666 Ga0501037_0273574 3300049573 Bacteria 1178
667 Ga0501037_0465129 3300049573 Bacteria 861
668 Ga0501037_0524068 3300049573 Bacteria 802
669 Ga0501037_0530557 3300049573 Bacteria 796
670 Ga0501038_0000126 3300049574 Bacteria 64756
671 Ga0501038_0096844 3300049574 Bacteria 2462
672 Ga0501038_0236934 3300049574 Bacteria 1450
673 Ga0501038_0304569 3300049574 Bacteria 1250
674 Ga0501038_0358155 3300049574 Bacteria 1135
675 Ga0501038_0390896 3300049574 Bacteria 1077
676 Ga0501038_1235444 3300049574 Bacteria 541
677 Ga0501039_0000003 3300049575 Bacteria 357424
678 Ga0501039_0013679 3300049575 Bacteria 6206
679 Ga0501039_0024319 3300049575 Bacteria 4651
680 Ga0501039_0081359 3300049575 Bacteria 2521
681 Ga0501039_0172074 3300049575 Bacteria 1702
682 Ga0501039_0289200 3300049575 Bacteria 1288
683 Ga0501039_0355124 3300049575 Bacteria 1152
684 Ga0501039_0503767 3300049575 Bacteria 951
685 Ga0501039_0634609 3300049575 Bacteria 837
686 Ga0501039_0818588 3300049575 Bacteria 726
687 Ga0501039_0900011 3300049575 Bacteria 689
688 Ga0501040_0207776 3300049576 Bacteria 1391
689 Ga0501040_0246648 3300049576 Bacteria 1273
690 Ga0501040_0319660 3300049576 Bacteria 1110
691 Ga0501040_0447364 3300049576 Bacteria 930
692 Ga0501041_0079483 3300049577 Bacteria 2018
693 Ga0501041_0429006 3300049577 Bacteria 838
694 Ga0501042_0028224 3300049578 Bacteria 3951
695 Ga0501042_0067691 3300049578 Bacteria 2553
696 Ga0501042_0090238 3300049578 Bacteria 2199
697 Ga0501042_0342726 3300049578 Bacteria 1080
698 Ga0501042_0348353 3300049578 Bacteria 1071
699 Ga0501042_0398706 3300049578 Bacteria 997
700 Ga0501042_0441457 3300049578 Bacteria 944
701 Ga0501042_0445465 3300049578 Bacteria 939
702 Ga0501042_0600174 3300049578 Bacteria 800
703 Ga0501043_0000041 3300049579 Bacteria 116876
704 Ga0501043_0000419 3300049579 Bacteria 38173
705 Ga0501043_0028008 3300049579 Bacteria 4422
706 Ga0501043_0032430 3300049579 Bacteria 4107
707 Ga0501043_0128903 3300049579 Bacteria 1983
708 Ga0501043_0203129 3300049579 Bacteria 1537
709 Ga0501043_0208501 3300049579 Bacteria 1515
710 Ga0501043_0235485 3300049579 Bacteria 1413
711 Ga0501043_0280498 3300049579 Bacteria 1277
712 Ga0501043_0466263 3300049579 Bacteria 947
713 Ga0501043_0521352 3300049579 Bacteria 886
714 Ga0501043_0871379 3300049579 Bacteria 647
715 Ga0501046_0058260 3300049580 Bacteria 3028
716 Ga0501046_0071734 3300049580 Bacteria 2690
717 Ga0501046_0084349 3300049580 Bacteria 2450
718 Ga0501046_0096109 3300049580 Bacteria 2276
719 Ga0501046_0201340 3300049580 Bacteria 1481
720 Ga0501047_0011716 3300049581 Bacteria 8290
721 Ga0501047_0015184 3300049581 Bacteria 7332
722 Ga0501047_0020608 3300049581 Bacteria 6331
723 Ga0501047_0085689 3300049581 Bacteria 3027
724 Ga0501047_0110628 3300049581 Bacteria 2630
725 Ga0501047_0121166 3300049581 Bacteria 2498
726 Ga0501047_0126194 3300049581 Bacteria 2439
727 Ga0501047_0166040 3300049581 Bacteria 2078
728 Ga0501047_0362261 3300049581 Bacteria 1285
729 Ga0501047_1200710 3300049581 Bacteria 572
730 Ga0501048_0046137 3300049582 Bacteria 3111
731 Ga0501048_0127717 3300049582 Bacteria 1798
732 Ga0501048_0142806 3300049582 Bacteria 1693
733 Ga0501048_0348102 3300049582 Bacteria 1057
734 Ga0501048_0476203 3300049582 Bacteria 895
735 Ga0501067_0334620 3300049583 Bacteria 843
736 Ga0501067_0365449 3300049583 Bacteria 804
737 Ga0501067_0509814 3300049583 Bacteria 673
738 Ga0501068_0014932 3300049584 Bacteria 4450
739 Ga0501068_0054565 3300049584 Bacteria 2421
740 Ga0501068_0354415 3300049584 Bacteria 943
741 Ga0501068_0371488 3300049584 Bacteria 920
742 Ga0501069_0000018 3300049585 Bacteria 133550
743 Ga0501069_0081794 3300049585 Bacteria 1820
744 Ga0501069_0115854 3300049585 Bacteria 1528
745 Ga0501069_0118879 3300049585 Bacteria 1509
746 Ga0501069_0482068 3300049585 Bacteria 739
747 Ga0501069_0528729 3300049585 Bacteria 705
748 Ga0501070_0000149 3300049586 Bacteria 64277
749 Ga0501070_0001007 3300049586 Bacteria 25257
750 Ga0501070_0006449 3300049586 Bacteria 9990
751 Ga0501070_0027866 3300049586 Bacteria 4738
752 Ga0501070_0032048 3300049586 Bacteria 4400
753 Ga0501070_0048340 3300049586 Bacteria 3534
754 Ga0501070_0057191 3300049586 Bacteria 3233
755 Ga0501070_0240323 3300049586 Bacteria 1482
756 Ga0501070_0301203 3300049586 Bacteria 1306
757 Ga0501070_0375810 3300049586 Bacteria 1151
758 Ga0501070_0429283 3300049586 Bacteria 1067
759 Ga0501070_0743150 3300049586 Bacteria 773
760 Ga0501070_0843923 3300049586 Bacteria 717
761 Ga0501070_1021542 3300049586 Bacteria 640
762 Ga0501071_0005101 3300049587 Bacteria 8404
763 Ga0501071_0009548 3300049587 Bacteria 6468
764 Ga0501071_0070895 3300049587 Bacteria 2540
765 Ga0501071_0077862 3300049587 Bacteria 2422
766 Ga0501071_0167743 3300049587 Bacteria 1643
767 Ga0501071_0170435 3300049587 Bacteria 1629
768 Ga0501071_0277632 3300049587 Bacteria 1268
769 Ga0501071_0285357 3300049587 Bacteria 1249
770 Ga0501071_0437020 3300049587 Bacteria 1001
771 Ga0501072_0015847 3300049588 Bacteria 5777
772 Ga0501072_0030510 3300049588 Bacteria 4217
773 Ga0501072_0033522 3300049588 Bacteria 4024
774 Ga0501072_0197359 3300049588 Bacteria 1605
775 Ga0501072_0298024 3300049588 Bacteria 1282
776 Ga0501072_0635583 3300049588 Bacteria 841
777 Ga0501072_1041429 3300049588 Bacteria 637
778 Ga0501072_1154149 3300049588 Bacteria 602
779 Ga0501073_0057178 3300049589 Bacteria 2727
780 Ga0501073_0186435 3300049589 Bacteria 1436
781 Ga0501073_0196681 3300049589 Bacteria 1394
782 Ga0501073_0208571 3300049589 Bacteria 1350
783 Ga0501073_0239201 3300049589 Bacteria 1254
784 Ga0501073_0297390 3300049589 Bacteria 1114
785 Ga0501073_0566948 3300049589 Bacteria 784
786 Ga0501073_0622362 3300049589 Bacteria 745
787 Ga0501073_0712119 3300049589 Bacteria 692
788 Ga0501074_0015715 3300049590 Bacteria 5503
789 Ga0501074_0036832 3300049590 Bacteria 3544
790 Ga0501074_0044789 3300049590 Bacteria 3202
791 Ga0501074_0060482 3300049590 Bacteria 2729
792 Ga0501074_0134462 3300049590 Bacteria 1769
793 Ga0501074_0138546 3300049590 Bacteria 1740
794 Ga0501074_0279253 3300049590 Bacteria 1187
795 Ga0501074_0358878 3300049590 Bacteria 1034
796 Ga0501074_0506706 3300049590 Bacteria 855
797 Ga0501075_0023025 3300049591 Bacteria 4556
798 Ga0501075_0023194 3300049591 Bacteria 4541
799 Ga0501075_0107810 3300049591 Bacteria 2117
800 Ga0501075_0210889 3300049591 Bacteria 1482
801 Ga0501076_0034396 3300049592 Bacteria 3961
802 Ga0501076_0054536 3300049592 Bacteria 3168
803 Ga0501076_0072340 3300049592 Bacteria 2759
804 Ga0501076_0114666 3300049592 Bacteria 2180
805 Ga0501077_0092221 3300049593 Bacteria 1919
806 Ga0501077_0198439 3300049593 Bacteria 1275
807 Ga0501077_0328500 3300049593 Bacteria 975
808 Ga0501079_0015310 3300049741 Bacteria 5850
809 Ga0501079_0093750 3300049741 Bacteria 2326
810 Ga0501079_0114292 3300049741 Bacteria 2098
811 Ga0501079_0186293 3300049741 Bacteria 1620
812 Ga0501079_0359212 3300049741 Bacteria 1141
813 Ga0501079_0377588 3300049741 Bacteria 1111
814 Ga0501079_0419252 3300049741 Bacteria 1051
815 Ga0501079_0861464 3300049741 Bacteria 713
816 Ga0501080_0001846 3300049742 Bacteria 18181
817 Ga0501080_0002294 3300049742 Bacteria 16667
818 Ga0501080_0014720 3300049742 Bacteria 7203
819 Ga0501080_0032171 3300049742 Bacteria 4890
820 Ga0501080_0131305 3300049742 Bacteria 2319
821 Ga0501080_0154201 3300049742 Bacteria 2122
822 Ga0501080_0181650 3300049742 Bacteria 1935
823 Ga0501081_0007477 3300049743 Bacteria 7083
824 Ga0501081_0082879 3300049743 Bacteria 2247
825 Ga0501081_0085196 3300049743 Bacteria 2217
826 Ga0501081_0097137 3300049743 Bacteria 2078
827 Ga0501081_0455081 3300049743 Bacteria 951
828 Ga0501081_0902189 3300049743 Bacteria 666
829 Ga0501083_0000524 3300049744 Bacteria 24464
830 Ga0501083_0006866 3300049744 Bacteria 8080
831 Ga0501083_0036097 3300049744 Bacteria 3373
832 Ga0501083_0062836 3300049744 Bacteria 2477
833 Ga0501083_0150125 3300049744 Bacteria 1526
834 Ga0501083_0165973 3300049744 Bacteria 1443
835 Ga0501083_0259894 3300049744 Bacteria 1130
836 Ga0501083_0308575 3300049744 Bacteria 1029
837 Ga0501035_0000032 3300049822 Bacteria 175435
838 Ga0501035_0000061 3300049822 Bacteria 131658
839 Ga0501035_0002052 3300049822 Bacteria 20071
840 Ga0501035_0002566 3300049822 Bacteria 17749
841 Ga0501035_0012273 3300049822 Bacteria 7919
842 Ga0501035_0238711 3300049822 Bacteria 1547
843 Ga0501035_0305392 3300049822 Bacteria 1340
844 Ga0501035_0321314 3300049822 Bacteria 1300
845 Ga0501035_0417741 3300049822 Bacteria 1114
846 Ga0501035_0562695 3300049822 Bacteria 933
847 Ga0501035_0600271 3300049822 Bacteria 897
848 Ga0501035_0997831 3300049822 Bacteria 658
849 Ga0501035_1104020 3300049822 Bacteria 619
850 Ga0501044_0000003 3300049823 Bacteria 345647
851 Ga0501044_0023419 3300049823 Bacteria 6568
852 Ga0501044_0044387 3300049823 Bacteria 4612
853 Ga0501044_0051125 3300049823 Bacteria 4262
854 Ga0501044_0152284 3300049823 Bacteria 2294
855 Ga0501044_0247188 3300049823 Bacteria 1726
856 Ga0501044_0298762 3300049823 Bacteria 1539
857 Ga0501044_0311223 3300049823 Bacteria 1501
858 Ga0501044_0409254 3300049823 Bacteria 1268
859 Ga0501044_0428309 3300049823 Bacteria 1232
860 Ga0501044_0463960 3300049823 Bacteria 1171
861 Ga0501044_0472122 3300049823 Bacteria 1158
862 Ga0501044_0480636 3300049823 Bacteria 1145
863 Ga0501044_1034380 3300049823 Bacteria 692
864 Ga0501044_1325056 3300049823 Bacteria 586
865 Ga0501044_1393540 3300049823 Bacteria 567
866 Ga0501045_0019019 3300049824 Bacteria 4892
867 Ga0501045_0055910 3300049824 Bacteria 2886
868 Ga0501045_0119776 3300049824 Bacteria 1954
869 Ga0501045_0195110 3300049824 Bacteria 1509
870 Ga0501045_0289422 3300049824 Bacteria 1219
871 Ga0501045_0306829 3300049824 Bacteria 1181
872 Ga0501045_0604184 3300049824 Bacteria 812
873 Ga0501045_0648256 3300049824 Bacteria 780
874 Ga0501045_0660127 3300049824 Bacteria 773
875 nmdc:mga03683_28037_c1 3300050489 Bacteria 2236
876 nmdc:mga00v17_5251_c2 3300050491 Bacteria 2077
877 nmdc:mga0yw44_1095889_c1 3300050492 Bacteria 538
878 nmdc:mga0yw44_138395_c1 3300050492 Bacteria 1581
879 nmdc:mga0yw44_257835_c1 3300050492 Bacteria 1162
880 nmdc:mga0yw44_315002_c1 3300050492 Bacteria 1050
881 nmdc:mga0yw44_64771_c1 3300050492 Bacteria 2250
882 nmdc:mga0yw44_82110_c1 3300050492 Bacteria 995
883 nmdc:mga06z11_129879_c1 3300050494 Bacteria 1414
884 nmdc:mga06z11_57898_c1 3300050494 Bacteria 2009
885 nmdc:mga06z11_59121_c1 3300050494 Bacteria 1991
886 nmdc:mga04h51_20696_c1 3300050495 Bacteria 1968
887 nmdc:mga04h51_276630_c1 3300050495 Bacteria 679
888 nmdc:mga07m45_46054_c1 3300050496 Bacteria 2450
889 nmdc:mga05p37_932744_c1 3300050507 Bacteria 932
890 nmdc:mga05p37_99844_c1 3300050507 Bacteria 3574
891 nmdc:mga09592_44022_c1 3300050508 Bacteria 3756
892 nmdc:mga0qj67_248590_c1 3300050509 Bacteria 1443
893 nmdc:mga06r32_226888_c1 3300050510 Bacteria 1856
894 nmdc:mga06r32_330282_c1 3300050510 Bacteria 1510
895 nmdc:mga08y16_139564_c1 3300050511 Bacteria 2520
896 nmdc:mga0n895_390638_c1 3300050512 Bacteria 1408
897 nmdc:mga0n895_763592_c1 3300050512 Bacteria 959
898 nmdc:mga08x19_6006_c1 3300050514 Bacteria 7178
899 nmdc:mga0a205_208281_c1 3300050515 Bacteria 1844
900 nmdc:mga0a205_46652_c1 3300050515 Bacteria 4179
901 nmdc:mga0sz30_4292_c1 3300050516 Bacteria 5142
902 nmdc:mga0sz30_87465_c1 3300050516 Bacteria 1353
903 Ga0495601_0036771 3300053077 Bacteria 3059
904 Ga0495655_0000773 3300053083 Bacteria 5025
905 Ga0495655_0020441 3300053083 Bacteria 1485
906 Ga0495655_0028907 3300053083 Bacteria 1328
907 Ga0495619_0060580 3300053085 Bacteria 2516
908 Ga0500578_0512062 3300053086 Bacteria 673
909 Ga0500643_037872 3300053087 Bacteria 1433
910 Ga0500650_0182629 3300053098 Bacteria 961
911 Ga0500658_0146703 3300053134 Bacteria 1061
912 Ga0500568_0000059 3300053139 Bacteria 108096
913 Ga0500573_0001398 3300053140 Bacteria 11530
914 Ga0500573_0465340 3300053140 Bacteria 580
915 Ga0500577_0159622 3300053142 Bacteria 960
916 Ga0500616_0054412 3300053153 Bacteria 2096
917 Ga0500624_004568 3300053157 Bacteria 1826
918 Ga0500627_0222596 3300053158 Bacteria 841
919 Ga0500634_0000004 3300053161 Bacteria 214946
920 Ga0500611_175569 3300053727 Bacteria 598
921 Ga0501084_0024909 3300054114 Bacteria 4992
922 Ga0501084_0096312 3300054114 Bacteria 2485
923 Ga0501084_0097519 3300054114 Bacteria 2468
924 Ga0501084_0536815 3300054114 Bacteria 988
925 Ga0501084_1074125 3300054114 Bacteria 676
926 Ga0587080_018613 3300059503 Bacteria 1117
927 Ga0587082_013800 3300059504 Bacteria 1223
928 Ga0587082_021678 3300059504 Bacteria 1051
929 Ga0587083_0074043 3300059505 Bacteria 797
930 Ga0587086_061741 3300059507 Bacteria 626
931 Ga0587089_026455 3300059509 Bacteria 833
932 Ga0587094_015377 3300059513 Bacteria 1056
933 Ga0587095_003995 3300059514 Bacteria 1065
934 Ga0587095_013659 3300059514 Bacteria 719
935 Ga0587098_064275 3300059604 Bacteria 583
936 Ga0587129_017446 3300059608 Bacteria 613
937 Ga0587101_014842 3300059623 Bacteria 1046
938 Ga0587113_006331 3300059625 Bacteria 1003
939 Ga0587117_028738 3300059627 Bacteria 825
940 Ga0587130_024773 3300059631 Bacteria 667
941 Ga0587067_123612 3300059640 Bacteria 624
942 Ga0587072_026891 3300059643 Bacteria 1054
943 Ga0587076_106917 3300059645 Bacteria 632
944 Ga0587078_010918 3300059646 Bacteria 1048
945 Ga0587078_013417 3300059646 Bacteria 970
946 Ga0587102_037271 3300059649 Bacteria 616
947 Ga0587104_015989 3300059650 Bacteria 594
948 Ga0587107_015572 3300059652 Bacteria 994
949 Ga0587114_085899 3300059655 Bacteria 592
950 Ga0587119_014111 3300059658 Bacteria 954
951 Ga0587124_031150 3300059660 Bacteria 590
952 Ga0587071_115100 3300060344 Bacteria 637
953 Ga0587111_0032452 3300060346 Bacteria 1074
954 Ga0587111_0212036 3300060346 Bacteria 555
955 Ga0501082_0033500 3300060353 Bacteria 4433
956 Ga0501082_0042278 3300060353 Bacteria 3929
957 Ga0501082_0068033 3300060353 Bacteria 3067
958 Ga0501082_0083784 3300060353 Bacteria 2751
959 Ga0501082_0164397 3300060353 Bacteria 1929
960 Ga0501082_0185586 3300060353 Bacteria 1809
961 Ga0501082_0203528 3300060353 Bacteria 1722
962 Ga0501082_0221183 3300060353 Bacteria 1647
963 Ga0501082_0618417 3300060353 Bacteria 948
964 Ga0501082_0886486 3300060353 Bacteria 780
965 Ga0530510_0007204 3300061734 Bacteria 7738
966 Ga0530510_0055187 3300061734 Bacteria 2870
967 Ga0530510_0295611 3300061734 Bacteria 1211
968 Ga0530510_0673320 3300061734 Bacteria 788

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005614 Ga0068856_100313025 Ga0068856_1003130252 150
2 3300014326 Ga0157380_10839542 Ga0157380_108395423 153
3 3300002704 JGI25155J39150_1000019 JGI25155J39150_100001953 154
4 3300002705 JGI25156J39149_1000020 JGI25156J39149_1000020117 154
5 3300002738 JGI25154J39366_1000102 JGI25154J39366_100010253 154
6 3300002741 JGI25157J39369_1000070 JGI25157J39369_100007053 154
7 3300003771 Ga0055526_1006554 Ga0055526_10065544 154
8 3300003775 Ga0055524_1031931 Ga0055524_10319312 154
9 3300003790 Ga0055528_1000373 Ga0055528_10003732 154
10 3300005530 Ga0070679_100965837 Ga0070679_1009658371 154
11 3300005563 Ga0068855_100197519 Ga0068855_1001975192 154
12 3300005578 Ga0068854_100033016 Ga0068854_1000330166 154
13 3300005614 Ga0068856_100197529 Ga0068856_1001975292 154
14 3300005616 Ga0068852_100073723 Ga0068852_1000737233 154
15 3300005834 Ga0068851_10018385 Ga0068851_100183854 154
16 3300006353 Ga0075370_10011760 Ga0075370_100117606 154
17 3300009093 Ga0105240_10000032 Ga0105240_10000032106 154
18 3300009101 Ga0105247_10562908 Ga0105247_105629081 154
19 3300009174 Ga0105241_10106876 Ga0105241_101068762 154
20 3300009545 Ga0105237_10001638 Ga0105237_1000163834 154
21 3300009551 Ga0105238_10284449 Ga0105238_102844492 154
22 3300010375 Ga0105239_10004667 Ga0105239_100046673 154
23 3300010375 Ga0105239_11161568 Ga0105239_111615682 154
24 3300013102 Ga0157371_10795335 Ga0157371_107953352 154
25 3300013307 Ga0157372_11577648 Ga0157372_115776481 154
26 3300037312 Ga0395899_0286650 Ga0395899_0286650_69_557 154
27 3300037418 Ga0395900_0618074 Ga0395900_0618074_69_557 154
28 3300037466 Ga0395898_0056315 Ga0395898_0056315_2668_3156 154
29 3300037466 Ga0395898_0118563 Ga0395898_0118563_933_1421 154
30 3300038443 Ga0395901_0449754 Ga0395901_0449754_345_833 154
31 3300041413 Ga0439465_0384672 Ga0439465_0384672_37_507 154
32 3300049162 Ga0501307_069709 Ga0501307_069709_64_534 154
33 3300049529 Ga0501313_017406 Ga0501313_017406_183_653 154
34 3300049536 Ga0501320_011474 Ga0501320_011474_433_903 154
35 3300049568 Ga0501031_0368844 Ga0501031_0368844_356_826 154
36 3300049570 Ga0501033_0463224 Ga0501033_0463224_179_649 154
37 3300049572 Ga0501036_0539702 Ga0501036_0539702_28_498 154
38 3300049573 Ga0501037_0077620 Ga0501037_0077620_1215_1685 154
39 3300049574 Ga0501038_0390896 Ga0501038_0390896_277_747 154
40 3300049575 Ga0501039_0818588 Ga0501039_0818588_187_657 154
41 3300049578 Ga0501042_0441457 Ga0501042_0441457_52_531 154
42 3300049579 Ga0501043_0028008 Ga0501043_0028008_2951_3421 154
43 3300049581 Ga0501047_0015184 Ga0501047_0015184_2154_2624 154
44 3300049583 Ga0501067_0365449 Ga0501067_0365449_193_663 154
45 3300049586 Ga0501070_0240323 Ga0501070_0240323_500_970 154
46 3300049588 Ga0501072_0298024 Ga0501072_0298024_38_508 154
47 3300049589 Ga0501073_0057178 Ga0501073_0057178_1408_1878 154
48 3300049589 Ga0501073_0239201 Ga0501073_0239201_568_1038 154
49 3300049589 Ga0501073_0712119 Ga0501073_0712119_188_658 154
50 3300049590 Ga0501074_0279253 Ga0501074_0279253_149_619 154
51 3300049741 Ga0501079_0419252 Ga0501079_0419252_321_791 154
52 3300049742 Ga0501080_0032171 Ga0501080_0032171_3508_3978 154
53 3300049822 Ga0501035_0321314 Ga0501035_0321314_506_976 154
54 3300049823 Ga0501044_0428309 Ga0501044_0428309_501_971 154
55 3300049823 Ga0501044_0463960 Ga0501044_0463960_98_568 154
56 3300059504 Ga0587082_021678 Ga0587082_021678_19_489 154
57 3300060353 Ga0501082_0083784 Ga0501082_0083784_420_890 154
58 3300002737 JGI25162J39368_1000891 JGI25162J39368_100089120 155
59 3300002737 JGI25162J39368_1001396 JGI25162J39368_10013962 155
60 3300002738 JGI25154J39366_1021810 JGI25154J39366_10218101 155
61 3300002987 JGI25159J45721_1000291 JGI25159J45721_10002916 155
62 3300003214 JGI25165J46597_1000406 JGI25165J46597_100040631 155
63 3300003214 JGI25165J46597_1000936 JGI25165J46597_100093621 155
64 3300003214 JGI25165J46597_1001407 JGI25165J46597_100140713 155
65 3300003354 JGI25160J50197_1000015 JGI25160J50197_1000015119 155
66 3300003374 JGI25161J50226_1000005 JGI25161J50226_1000005121 155
67 3300004625 Ga0055543_1000012 Ga0055543_1000012120 155
68 3300005262 Ga0065165_1000125 Ga0065165_100012520 155
69 3300005339 Ga0070660_101039030 Ga0070660_1010390302 155
70 3300005937 Ga0081455_10123925 Ga0081455_101239253 155
71 3300006178 Ga0075367_10281594 Ga0075367_102815942 155
72 3300006353 Ga0075370_10093917 Ga0075370_100939172 155
73 3300009093 Ga0105240_10019313 Ga0105240_100193138 155
74 3300009545 Ga0105237_10013741 Ga0105237_100137412 155
75 3300009545 Ga0105237_10748799 Ga0105237_107487992 155
76 3300009551 Ga0105238_10077095 Ga0105238_100770952 155
77 3300013100 Ga0157373_11273311 Ga0157373_112733111 155
78 3300013102 Ga0157371_10024551 Ga0157371_100245512 155
79 3300013105 Ga0157369_10811085 Ga0157369_108110852 155
80 3300025207 Ga0209760_101970 Ga0209760_1019703 155
81 3300025231 Ga0207427_106742 Ga0207427_1067423 155
82 3300025233 Ga0209437_100033 Ga0209437_100033385 155
83 3300025233 Ga0209437_100075 Ga0209437_100075116 155
84 3300025246 Ga0209646_1017848 Ga0209646_10178481 155
85 3300025254 Ga0209148_1015732 Ga0209148_10157322 155
86 3300025261 Ga0209233_1000064 Ga0209233_100006437 155
87 3300025261 Ga0209233_1000223 Ga0209233_100022360 155
88 3300025261 Ga0209233_1000342 Ga0209233_100034231 155
89 3300025284 Ga0209130_1000018 Ga0209130_1000018152 155
90 3300025302 Ga0207426_1000044 Ga0207426_1000044237 155
91 3300025321 Ga0207656_10176604 Ga0207656_101766042 155
92 3300025913 Ga0207695_10132304 Ga0207695_101323044 155
93 3300025914 Ga0207671_10013562 Ga0207671_100135622 155
94 3300025924 Ga0207694_10099971 Ga0207694_100999713 155
95 3300025925 Ga0207650_10009305 Ga0207650_100093056 155
96 3300026118 Ga0207675_100705098 Ga0207675_1007050982 155
97 3300027312 Ga0209371_1000420 Ga0209371_10004205 155
98 3300028794 Ga0307515_10029068 Ga0307515_100290687 155
99 3300030500 Ga0268256_1008134 Ga0268256_10081343 155
100 3300031456 Ga0307513_10268229 Ga0307513_102682294 155
101 3300031730 Ga0307516_10271711 Ga0307516_102717111 155
102 3300035085 Ga0373929_0038548 Ga0373929_0038548_552_1022 155
103 3300037418 Ga0395900_1010126 Ga0395900_1010126_30_500 155
104 3300037471 Ga0395905_0223445 Ga0395905_0223445_851_1321 155
105 3300037471 Ga0395905_0524883 Ga0395905_0524883_526_996 155
106 3300038443 Ga0395901_1859049 Ga0395901_1859049_69_539 155
107 3300044684 Ga0466966_0178657 Ga0466966_0178657_51_521 155
108 3300044719 Ga0466971_0135568 Ga0466971_0135568_634_1104 155
109 3300044735 Ga0466968_0287072 Ga0466968_0287072_214_684 155
110 3300044765 Ga0466970_0095817 Ga0466970_0095817_202_672 155
111 3300044842 Ga0466957_0206375 Ga0466957_0206375_176_646 155
112 3300045049 Ga0466959_0168252 Ga0466959_0168252_183_653 155
113 3300045976 Ga0466967_1130759 Ga0466967_1130759_125_595 155
114 3300045976 Ga0466967_2077699 Ga0466967_2077699_70_540 155
115 3300046507 Ga0495606_0004680 Ga0495606_0004680_5890_6360 155
116 3300046507 Ga0495606_0054338 Ga0495606_0054338_2107_2577 155
117 3300048903 Ga0496100_0613345 Ga0496100_0613345_268_738 155
118 3300048906 Ga0496103_0475240 Ga0496103_0475240_163_633 155
119 3300048918 Ga0496115_0905057 Ga0496115_0905057_111_581 155
120 3300048920 Ga0496117_0225334 Ga0496117_0225334_532_1002 155
121 3300048920 Ga0496117_0506246 Ga0496117_0506246_42_512 155
122 3300048922 Ga0496119_0045279 Ga0496119_0045279_62_532 155
123 3300048922 Ga0496119_0050788 Ga0496119_0050788_1181_1651 155
124 3300048923 Ga0496120_0001486 Ga0496120_0001486_2175_2645 155
125 3300048923 Ga0496120_0070103 Ga0496120_0070103_71_541 155
126 3300048924 Ga0496121_0023237 Ga0496121_0023237_5223_5693 155
127 3300048925 Ga0496122_0064930 Ga0496122_0064930_2116_2586 155
128 3300048927 Ga0496124_0076170 Ga0496124_0076170_2191_2661 155
129 3300048928 Ga0496125_0093025 Ga0496125_0093025_96_566 155
130 3300048929 Ga0496126_0179420 Ga0496126_0179420_954_1424 155
131 3300050492 nmdc:mga0yw44_1095889_c1 nmdc:mga0yw44_1095889_c1_58_528 155
132 3300050494 nmdc:mga06z11_59121_c1 nmdc:mga06z11_59121_c1_353_823 155
133 3300050516 nmdc:mga0sz30_87465_c1 nmdc:mga0sz30_87465_c1_372_842 155
134 3300059514 Ga0587095_003995 Ga0587095_003995_18_488 155
135 3300059608 Ga0587129_017446 Ga0587129_017446_94_564 155
136 3300059623 Ga0587101_014842 Ga0587101_014842_12_482 155
137 3300059631 Ga0587130_024773 Ga0587130_024773_96_566 155
138 3300059640 Ga0587067_123612 Ga0587067_123612_142_612 155
139 3300059650 Ga0587104_015989 Ga0587104_015989_19_489 155
140 iso_pu_bacteria 2503198000 2503202938 155
141 iso_pu_bacteria 2508501123 2509115343 155
142 iso_pu_bacteria 2508501127 2509145241 155
143 iso_pu_bacteria 2509276018 2509372336 155
144 iso_pu_bacteria 2509276022 2509397418 155
145 iso_pu_bacteria 2510065059 2510317860 155
146 iso_pu_bacteria 2512875016 2512930245 155
147 iso_pu_bacteria 2512875024 2512957998 155
148 iso_pu_bacteria 2513237164 2514032862 155
149 iso_pu_bacteria 2513237305 2514418756 155
150 iso_pu_bacteria 2588253730 2588515893 155
151 iso_pu_bacteria 2597489875 2597814447 155
152 iso_pu_bacteria 2643221580 2643910260 155
153 iso_pu_bacteria 2643221591 2643963889 155
154 iso_pu_bacteria 2643221595 2643986842 155
155 iso_pu_bacteria 2643221627 2644157685 155
156 iso_pu_bacteria 2643221674 2644410816 155
157 iso_pu_bacteria 2687453392 2688599790 155
158 iso_pu_bacteria 2721755686 2723576567 155
159 iso_pu_bacteria 2756170246 2756676004 155
160 iso_pu_bacteria 2757320392 2757571656 155
161 iso_pu_bacteria 2791355123 2792745908 155
162 iso_pu_bacteria 2837678835 2837679434 155
163 iso_pu_bacteria 2837678835 2837682912 155
164 iso_pu_bacteria 2841734538 2841740747 155
165 iso_pu_bacteria 2844002411 2844007098 155
166 iso_pu_bacteria 2844009547 2844015078 155
167 iso_pu_bacteria 2856320880 2856324738 155
168 iso_pu_bacteria 2856328259 2856333069 155
169 iso_pu_bacteria 2856334872 2856337627 155
170 iso_pu_bacteria 2856342000 2856349278 155
171 iso_pu_bacteria 2857367948 2857368986 155
172 iso_pu_bacteria 2869162929 2869166880 155
173 iso_pu_bacteria 2869169390 2869176471 155
174 iso_pu_bacteria 2869234852 2869236195 155
175 iso_pu_bacteria 2869249662 2869255369 155
176 iso_pu_bacteria 2869256925 2869257053 155
177 iso_pu_bacteria 2869264136 2869265653 155
178 iso_pu_bacteria 2869271264 2869273435 155
179 iso_pu_bacteria 2869278585 2869281271 155
180 iso_pu_bacteria 2871451962 2871455053 155
181 iso_pu_bacteria 2871459585 2871464262 155
182 iso_pu_bacteria 2871466892 2871469991 155
183 iso_pu_bacteria 2871474448 2871478710 155
184 iso_pu_bacteria 2871481445 2871481926 155
185 iso_pu_bacteria 2874109183 2874116271 155
186 iso_pu_bacteria 2874116593 2874123396 155
187 iso_pu_bacteria 2874131515 2874138177 155
188 iso_pu_bacteria 2874139085 2874141063 155
189 iso_pu_bacteria 2874162495 2874166194 155
190 iso_pu_bacteria 2874168670 2874170246 155
191 iso_pu_bacteria 2876363079 2876366190 155
192 iso_pu_bacteria 2876399893 2876403470 155
193 iso_pu_bacteria 2876406927 2876413185 155
194 iso_pu_bacteria 2876420981 2876426576 155
195 iso_pu_bacteria 2878730984 2878735904 155
196 iso_pu_bacteria 2878738818 2878742845 155
197 iso_pu_bacteria 2878774303 2878778179 155
198 iso_pu_bacteria 2878781027 2878783388 155
199 iso_pu_bacteria 2878788777 2878789796 155
200 iso_pu_bacteria 2882632389 2882633371 155
201 iso_pu_bacteria 2885312484 2885316741 155
202 iso_pu_bacteria 2888337043 2888340974 155
203 iso_pu_bacteria 2888343758 2888348176 155
204 iso_pu_bacteria 2903448605 2903452394 155
205 iso_pu_bacteria 2903513507 2903518702 155
206 iso_pu_bacteria 2903521522 2903524058 155
207 iso_pu_bacteria 2903528002 2903533759 155
208 iso_pu_bacteria 2906363423 2906370069 155
209 iso_pu_bacteria 2906370794 2906375930 155
210 iso_pu_bacteria 2906378014 2906384205 155
211 iso_pu_bacteria 2906393657 2906398934 155
212 iso_pu_bacteria 2906401398 2906405845 155
213 iso_pu_bacteria 2906408224 2906409495 155
214 iso_pu_bacteria 2906427513 2906433845 155
215 iso_pu_bacteria 2919679072 2919682460 155
216 iso_pu_bacteria 2922151315 2922155018 155
217 iso_pu_bacteria 2922172374 2922175900 155
218 iso_pu_bacteria 2922178524 2922180976 155
219 iso_pu_bacteria 2924710171 2924714253 155
220 iso_pu_bacteria 2924733363 2924735031 155
221 iso_pu_bacteria 2924741084 2924744038 155
222 iso_pu_bacteria 2924748358 2924752047 155
223 iso_pu_bacteria 2924754689 2924756888 155
224 iso_pu_bacteria 2924762789 2924763445 155
225 iso_pu_bacteria 2924776078 2924780645 155
226 iso_pu_bacteria 2932401849 2932403678 155
227 iso_pu_bacteria 2937822353 2937823588 155
228 iso_pu_bacteria 2937836603 2937836918 155
229 iso_pu_bacteria 2937848649 2937854383 155
230 iso_pu_bacteria 2937861824 2937862436 155
231 iso_pu_bacteria 2937877337 2937879855 155
232 iso_pu_bacteria 2937972304 2937974549 155
233 iso_pu_bacteria 2937980651 2937987654 155
234 iso_pu_bacteria 2958034702 2958037233 155
235 iso_pu_bacteria 2958041894 2958046945 155
236 iso_pu_bacteria 2958064165 2958067457 155
237 iso_pu_bacteria 2958071322 2958076809 155
238 iso_pu_bacteria 2958084443 2958087033 155
239 iso_pu_bacteria 2958108152 2958111169 155
240 iso_pu_bacteria 2958122699 2958122703 155
241 iso_pu_bacteria 2958137437 2958138229 155
242 iso_pu_bacteria 2958158011 2958160694 155
243 iso_pu_bacteria 2961183825 2961188628 155
244 iso_pu_bacteria 2963644680 2963648986 155
245 iso_pu_bacteria 2965025482 2965028036 155
246 iso_pu_bacteria 2965032056 2965039199 155
247 iso_pu_bacteria 2965040258 2965045329 155
248 iso_pu_bacteria 2965047637 2965052072 155
249 iso_pu_bacteria 2965089291 2965090028 155
250 iso_pu_bacteria 2965102966 2965106858 155
251 iso_pu_bacteria 2968016561 2968019949 155
252 iso_pu_bacteria 2968083720 2968084174 155
253 iso_pu_bacteria 2970469710 2970473270 155
254 iso_pu_bacteria 2970489779 2970495394 155
255 iso_pu_bacteria 2970510686 2970510722 155
256 iso_pu_bacteria 2970524798 2970531499 155
257 iso_pu_bacteria 2970532167 2970535181 155
258 iso_pu_bacteria 2970540015 2970544371 155
259 iso_pu_bacteria 2970547951 2970549132 155
260 iso_pu_bacteria 2970593180 2970595875 155
261 iso_pu_bacteria 2970619444 2970622827 155
262 iso_pu_bacteria 2970627176 2970628008 155
263 iso_pu_bacteria 2977851361 2977852461 155
264 iso_pu_bacteria 2977872689 2977873121 155
265 iso_pu_bacteria 2977898635 2977904202 155
266 iso_pu_bacteria 2977907340 2977910719 155
267 iso_pu_bacteria 2977915119 2977922331 155
268 iso_pu_bacteria 2977922695 2977926796 155
269 iso_pu_bacteria 2977935797 2977939241 155
270 iso_pu_bacteria 2977950692 2977953415 155
271 iso_pu_bacteria 2977957713 2977958613 155
272 iso_pu_bacteria 2977986579 2977992559 155
273 iso_pu_bacteria 2979764755 2979767217 155
274 iso_pu_bacteria 2979772303 2979779699 155
275 iso_pu_bacteria 2979793036 2979797513 155
276 iso_pu_bacteria 2987645492 2987645997 155
277 iso_pu_bacteria 2987666974 2987667728 155
278 iso_pu_bacteria 2987673487 2987679336 155
279 iso_pu_bacteria 2996348954 2996351539 155
280 iso_pu_bacteria 2996386984 2996389433 155
281 iso_pu_bacteria 3000135777 3000138916 155
282 iso_pu_bacteria 3004167301 3004170502 155
283 iso_pu_bacteria 3004195979 3004197823 155
284 iso_pu_bacteria 3004211236 3004214992 155
285 iso_pu_bacteria 3004218560 3004222417 155
286 iso_pu_bacteria 3004239961 3004242950 155
287 iso_pu_bacteria 3004248173 3004249655 155
288 iso_pu_bacteria 3004268573 3004272377 155
289 iso_pu_bacteria 3004275668 3004278239 155
290 iso_pu_bacteria 3004289098 3004289220 155
291 iso_pu_bacteria 3004334049 3004339837 155
292 iso_pu_bacteria 637000159 637080025 155
293 iso_pu_bacteria 649633066 649874296 155
294 iso_pu_bacteria 8004300914 8004307338 155
295 iso_pu_bacteria 8004312739 8004315297 155
296 iso_pu_bacteria 8004361976 8004362133 155
297 iso_pu_bacteria 8004395343 8004402278 155
298 iso_pu_bacteria 8004633249 8004640058 155
299 iso_pu_bacteria 8004695233 8004697816 155
300 iso_pu_bacteria 8004727605 8004727945 155
301 iso_pu_bacteria 8055617313 8055622295 155
302 3300003203 JGI25406J46586_10006588 JGI25406J46586_100065886 156
303 3300005328 Ga0070676_10092242 Ga0070676_100922422 156
304 3300005334 Ga0068869_100223463 Ga0068869_1002234632 156
305 3300005343 Ga0070687_100649982 Ga0070687_1006499821 156
306 3300005439 Ga0070711_100118311 Ga0070711_1001183112 156
307 3300005466 Ga0070685_10050558 Ga0070685_100505582 156
308 3300005466 Ga0070685_10404867 Ga0070685_104048671 156
309 3300005577 Ga0068857_100094136 Ga0068857_1000941363 156
310 3300005985 Ga0081539_10001367 Ga0081539_1000136720 156
311 3300009101 Ga0105247_10021678 Ga0105247_100216783 156
312 3300013308 Ga0157375_10020497 Ga0157375_100204978 156
313 3300014325 Ga0163163_10204954 Ga0163163_102049542 156
314 3300025907 Ga0207645_10207260 Ga0207645_102072601 156
315 3300025918 Ga0207662_10364326 Ga0207662_103643261 156
316 3300025927 Ga0207687_10181792 Ga0207687_101817922 156
317 3300025936 Ga0207670_10561878 Ga0207670_105618781 156
318 3300025942 Ga0207689_10028650 Ga0207689_100286503 156
319 3300026095 Ga0207676_10594010 Ga0207676_105940102 156
320 3300026116 Ga0207674_10151163 Ga0207674_101511632 156
321 3300026142 Ga0207698_10756852 Ga0207698_107568522 156
322 3300028794 Ga0307515_10000070 Ga0307515_1000007067 156
323 3300031456 Ga0307513_10000404 Ga0307513_100004045 156
324 3300031852 Ga0307410_10363408 Ga0307410_103634082 156
325 3300037418 Ga0395900_0160673 Ga0395900_0160673_560_1036 156
326 3300037466 Ga0395898_1084799 Ga0395898_1084799_12_488 156
327 3300044683 Ga0466965_0226700 Ga0466965_0226700_504_980 156
328 3300046474 Ga0495605_0073211 Ga0495605_0073211_57_533 156
329 3300048908 Ga0496105_0402236 Ga0496105_0402236_382_852 156
330 3300048912 Ga0496109_0263234 Ga0496109_0263234_1080_1550 156
331 3300048915 Ga0496112_0250149 Ga0496112_0250149_911_1381 156
332 3300048925 Ga0496122_0311863 Ga0496122_0311863_20_493 156
333 3300048926 Ga0496123_0023865 Ga0496123_0023865_2653_3126 156
334 3300048928 Ga0496125_0466968 Ga0496125_0466968_52_525 156
335 3300049569 Ga0501032_0050930 Ga0501032_0050930_1295_1768 156
336 3300049569 Ga0501032_0138096 Ga0501032_0138096_679_1158 156
337 3300049569 Ga0501032_0533947 Ga0501032_0533947_78_551 156
338 3300049569 Ga0501032_0795208 Ga0501032_0795208_86_565 156
339 3300049572 Ga0501036_0042676 Ga0501036_0042676_1116_1589 156
340 3300049572 Ga0501036_0301549 Ga0501036_0301549_73_552 156
341 3300049573 Ga0501037_0171344 Ga0501037_0171344_589_1068 156
342 3300049573 Ga0501037_0465129 Ga0501037_0465129_129_602 156
343 3300049574 Ga0501038_0304569 Ga0501038_0304569_257_730 156
344 3300049574 Ga0501038_1235444 Ga0501038_1235444_54_527 156
345 3300049575 Ga0501039_0634609 Ga0501039_0634609_299_778 156
346 3300049579 Ga0501043_0203129 Ga0501043_0203129_426_899 156
347 3300049579 Ga0501043_0208501 Ga0501043_0208501_1000_1473 156
348 3300049581 Ga0501047_1200710 Ga0501047_1200710_82_555 156
349 3300049583 Ga0501067_0509814 Ga0501067_0509814_155_628 156
350 3300049589 Ga0501073_0186435 Ga0501073_0186435_570_1049 156
351 3300049589 Ga0501073_0196681 Ga0501073_0196681_669_1142 156
352 3300049589 Ga0501073_0622362 Ga0501073_0622362_219_692 156
353 3300049744 Ga0501083_0006866 Ga0501083_0006866_474_947 156
354 3300049822 Ga0501035_0997831 Ga0501035_0997831_98_571 156
355 3300049823 Ga0501044_0152284 Ga0501044_0152284_60_539 156
356 3300049823 Ga0501044_0472122 Ga0501044_0472122_647_1120 156
357 3300049823 Ga0501044_1034380 Ga0501044_1034380_74_547 156
358 3300053140 Ga0500573_0001398 Ga0500573_0001398_10543_11016 156
359 3300053140 Ga0500573_0465340 Ga0500573_0465340_95_568 156
360 3300053142 Ga0500577_0159622 Ga0500577_0159622_410_883 156
361 3300059507 Ga0587086_061741 Ga0587086_061741_20_496 156
362 3300059646 Ga0587078_013417 Ga0587078_013417_141_611 156
363 3300060353 Ga0501082_0068033 Ga0501082_0068033_267_740 156
364 3300005339 Ga0070660_100142969 Ga0070660_1001429692 157
365 3300005347 Ga0070668_100382511 Ga0070668_1003825112 157
366 3300005548 Ga0070665_100016148 Ga0070665_1000161484 157
367 3300005983 Ga0081540_1044223 Ga0081540_10442232 157
368 3300006038 Ga0075365_10132744 Ga0075365_101327442 157
369 3300006177 Ga0075362_10018661 Ga0075362_100186613 157
370 3300006186 Ga0075369_10005107 Ga0075369_100051077 157
371 3300006353 Ga0075370_10439119 Ga0075370_104391192 157
372 3300009101 Ga0105247_10896740 Ga0105247_108967401 157
373 3300009545 Ga0105237_11633432 Ga0105237_116334321 157
374 3300025914 Ga0207671_11433902 Ga0207671_114339021 157
375 3300026116 Ga0207674_10741057 Ga0207674_107410572 157
376 3300026118 Ga0207675_101486986 Ga0207675_1014869861 157
377 3300037312 Ga0395899_0000059 Ga0395899_0000059_129626_130105 157
378 3300037418 Ga0395900_0000017 Ga0395900_0000017_129626_130105 157
379 3300037418 Ga0395900_0158818 Ga0395900_0158818_891_1367 157
380 3300037418 Ga0395900_0354772 Ga0395900_0354772_538_1014 157
381 3300037418 Ga0395900_0569673 Ga0395900_0569673_527_1003 157
382 3300037466 Ga0395898_0000030 Ga0395898_0000030_129601_130080 157
383 3300037466 Ga0395898_0092373 Ga0395898_0092373_1187_1663 157
384 3300037471 Ga0395905_0000056 Ga0395905_0000056_79126_79605 157
385 3300038443 Ga0395901_0000015 Ga0395901_0000015_239498_239977 157
386 3300038443 Ga0395901_0418998 Ga0395901_0418998_400_876 157
387 3300041413 Ga0439465_0044671 Ga0439465_0044671_80_556 157
388 3300041486 Ga0451807_0868095 Ga0451807_0868095_106_585 157
389 3300042004 Ga0439445_0031169 Ga0439445_0031169_155_631 157
390 3300048915 Ga0496112_0462719 Ga0496112_0462719_276_752 157
391 3300048929 Ga0496126_1208102 Ga0496126_1208102_45_524 157
392 3300049568 Ga0501031_0335658 Ga0501031_0335658_436_915 157
393 3300049569 Ga0501032_0000116 Ga0501032_0000116_53467_53943 157
394 3300049569 Ga0501032_0062914 Ga0501032_0062914_886_1365 157
395 3300049569 Ga0501032_0088847 Ga0501032_0088847_452_931 157
396 3300049570 Ga0501033_0000346 Ga0501033_0000346_5842_6318 157
397 3300049570 Ga0501033_0014554 Ga0501033_0014554_559_1038 157
398 3300049571 Ga0501034_0000314 Ga0501034_0000314_68824_69300 157
399 3300049571 Ga0501034_0047815 Ga0501034_0047815_559_1038 157
400 3300049571 Ga0501034_0049225 Ga0501034_0049225_3637_4113 157
401 3300049571 Ga0501034_0051624 Ga0501034_0051624_337_813 157
402 3300049572 Ga0501036_0000117 Ga0501036_0000117_43417_43893 157
403 3300049572 Ga0501036_0043949 Ga0501036_0043949_416_895 157
404 3300049572 Ga0501036_1597126 Ga0501036_1597126_37_513 157
405 3300049573 Ga0501037_0000108 Ga0501037_0000108_68381_68857 157
406 3300049573 Ga0501037_0273574 Ga0501037_0273574_130_606 157
407 3300049574 Ga0501038_0000126 Ga0501038_0000126_53339_53815 157
408 3300049575 Ga0501039_0000003 Ga0501039_0000003_219461_219937 157
409 3300049575 Ga0501039_0172074 Ga0501039_0172074_134_613 157
410 3300049575 Ga0501039_0503767 Ga0501039_0503767_459_932 157
411 3300049576 Ga0501040_0319660 Ga0501040_0319660_75_554 157
412 3300049576 Ga0501040_0447364 Ga0501040_0447364_227_700 157
413 3300049578 Ga0501042_0067691 Ga0501042_0067691_1289_1768 157
414 3300049578 Ga0501042_0445465 Ga0501042_0445465_123_599 157
415 3300049578 Ga0501042_0600174 Ga0501042_0600174_295_768 157
416 3300049579 Ga0501043_0000419 Ga0501043_0000419_24539_25015 157
417 3300049579 Ga0501043_0032430 Ga0501043_0032430_1121_1600 157
418 3300049579 Ga0501043_0128903 Ga0501043_0128903_881_1357 157
419 3300049579 Ga0501043_0871379 Ga0501043_0871379_155_631 157
420 3300049580 Ga0501046_0071734 Ga0501046_0071734_35_511 157
421 3300049581 Ga0501047_0011716 Ga0501047_0011716_5994_6473 157
422 3300049581 Ga0501047_0085689 Ga0501047_0085689_876_1352 157
423 3300049581 Ga0501047_0121166 Ga0501047_0121166_671_1147 157
424 3300049581 Ga0501047_0166040 Ga0501047_0166040_1547_2023 157
425 3300049582 Ga0501048_0348102 Ga0501048_0348102_448_921 157
426 3300049584 Ga0501068_0354415 Ga0501068_0354415_56_535 157
427 3300049586 Ga0501070_0048340 Ga0501070_0048340_2863_3342 157
428 3300049587 Ga0501071_0170435 Ga0501071_0170435_885_1364 157
429 3300049587 Ga0501071_0277632 Ga0501071_0277632_315_788 157
430 3300049588 Ga0501072_0197359 Ga0501072_0197359_625_1098 157
431 3300049590 Ga0501074_0138546 Ga0501074_0138546_1033_1512 157
432 3300049741 Ga0501079_0377588 Ga0501079_0377588_80_559 157
433 3300049742 Ga0501080_0181650 Ga0501080_0181650_168_647 157
434 3300049743 Ga0501081_0455081 Ga0501081_0455081_459_932 157
435 3300049744 Ga0501083_0165973 Ga0501083_0165973_383_862 157
436 3300049822 Ga0501035_0000032 Ga0501035_0000032_137250_137726 157
437 3300049822 Ga0501035_0012273 Ga0501035_0012273_559_1038 157
438 3300049822 Ga0501035_0238711 Ga0501035_0238711_704_1180 157
439 3300049822 Ga0501035_0600271 Ga0501035_0600271_271_744 157
440 3300049823 Ga0501044_0298762 Ga0501044_0298762_559_1038 157
441 3300049823 Ga0501044_0480636 Ga0501044_0480636_413_889 157
442 3300049824 Ga0501045_0604184 Ga0501045_0604184_18_494 157
443 3300049824 Ga0501045_0648256 Ga0501045_0648256_168_647 157
444 3300050489 nmdc:mga03683_28037_c1 nmdc:mga03683_28037_c1_481_957 157
445 3300050492 nmdc:mga0yw44_82110_c1 nmdc:mga0yw44_82110_c1_336_812 157
446 3300050494 nmdc:mga06z11_57898_c1 nmdc:mga06z11_57898_c1_561_1037 157
447 3300050495 nmdc:mga04h51_20696_c1 nmdc:mga04h51_20696_c1_235_711 157
448 3300050495 nmdc:mga04h51_276630_c1 nmdc:mga04h51_276630_c1_115_591 157
449 3300050516 nmdc:mga0sz30_4292_c1 nmdc:mga0sz30_4292_c1_3864_4340 157
450 3300053139 Ga0500568_0000059 Ga0500568_0000059_99934_100410 157
451 3300060353 Ga0501082_0618417 Ga0501082_0618417_204_677 157
452 3300005455 Ga0070663_100109857 Ga0070663_1001098572 158
453 3300005937 Ga0081455_10034109 Ga0081455_100341095 158
454 3300006038 Ga0075365_10083984 Ga0075365_100839842 158
455 3300013102 Ga0157371_10094952 Ga0157371_100949522 158
456 3300025294 Ga0209025_1158021 Ga0209025_11580211 158
457 3300025949 Ga0207667_10313344 Ga0207667_103133441 158
458 3300026035 Ga0207703_10276225 Ga0207703_102762252 158
459 3300026067 Ga0207678_10018943 Ga0207678_100189432 158
460 3300031731 Ga0307405_10094861 Ga0307405_100948613 158
461 3300031824 Ga0307413_10114710 Ga0307413_101147102 158
462 3300031903 Ga0307407_10423169 Ga0307407_104231691 158
463 3300031995 Ga0307409_100692992 Ga0307409_1006929922 158
464 3300031995 Ga0307409_100804274 Ga0307409_1008042742 158
465 3300031995 Ga0307409_101550784 Ga0307409_1015507842 158
466 3300032004 Ga0307414_10338865 Ga0307414_103388653 158
467 3300032004 Ga0307414_10357464 Ga0307414_103574642 158
468 3300032005 Ga0307411_12065141 Ga0307411_120651411 158
469 3300032168 Ga0316593_10134284 Ga0316593_101342842 158
470 3300038742 Ga0400486_18150 Ga0400486_18150_306_788 158
471 3300039110 Ga0400487_31446 Ga0400487_31446_511_993 158
472 3300044901 Ga0466960_0574826 Ga0466960_0574826_160_642 158
473 3300046460 Ga0495638_0003767 Ga0495638_0003767_6825_7304 158
474 3300048913 Ga0496110_0051018 Ga0496110_0051018_1866_2348 158
475 3300048914 Ga0496111_0117078 Ga0496111_0117078_584_1066 158
476 3300048924 Ga0496121_0413400 Ga0496121_0413400_124_606 158
477 3300048926 Ga0496123_0338621 Ga0496123_0338621_197_679 158
478 3300048927 Ga0496124_0243599 Ga0496124_0243599_516_998 158
479 3300048928 Ga0496125_0000276 Ga0496125_0000276_66748_67230 158
480 3300049161 Ga0501305_017115 Ga0501305_017115_473_955 158
481 3300049527 Ga0501311_017035 Ga0501311_017035_399_881 158
482 3300049535 Ga0501319_003996 Ga0501319_003996_13_495 158
483 3300049568 Ga0501031_0034948 Ga0501031_0034948_777_1256 158
484 3300049568 Ga0501031_0207658 Ga0501031_0207658_769_1245 158
485 3300049569 Ga0501032_0020397 Ga0501032_0020397_4046_4525 158
486 3300049569 Ga0501032_0068747 Ga0501032_0068747_1807_2283 158
487 3300049569 Ga0501032_0800361 Ga0501032_0800361_61_537 158
488 3300049570 Ga0501033_0005442 Ga0501033_0005442_8205_8681 158
489 3300049570 Ga0501033_0006207 Ga0501033_0006207_5003_5482 158
490 3300049571 Ga0501034_0001091 Ga0501034_0001091_358_840 158
491 3300049571 Ga0501034_0146938 Ga0501034_0146938_358_840 158
492 3300049571 Ga0501034_0671814 Ga0501034_0671814_53_529 158
493 3300049571 Ga0501034_0841185 Ga0501034_0841185_90_566 158
494 3300049572 Ga0501036_0156648 Ga0501036_0156648_994_1470 158
495 3300049572 Ga0501036_1660126 Ga0501036_1660126_13_489 158
496 3300049573 Ga0501037_0001070 Ga0501037_0001070_14803_15282 158
497 3300049573 Ga0501037_0036243 Ga0501037_0036243_34_510 158
498 3300049574 Ga0501038_0236934 Ga0501038_0236934_513_989 158
499 3300049579 Ga0501043_0000041 Ga0501043_0000041_5041_5520 158
500 3300049579 Ga0501043_0466263 Ga0501043_0466263_23_499 158
501 3300049581 Ga0501047_0020608 Ga0501047_0020608_4693_5169 158
502 3300049581 Ga0501047_0126194 Ga0501047_0126194_609_1085 158
503 3300049583 Ga0501067_0334620 Ga0501067_0334620_205_684 158
504 3300049585 Ga0501069_0000018 Ga0501069_0000018_123532_124011 158
505 3300049585 Ga0501069_0081794 Ga0501069_0081794_695_1171 158
506 3300049585 Ga0501069_0115854 Ga0501069_0115854_896_1372 158
507 3300049585 Ga0501069_0528729 Ga0501069_0528729_152_628 158
508 3300049586 Ga0501070_0000149 Ga0501070_0000149_32517_32996 158
509 3300049586 Ga0501070_0001007 Ga0501070_0001007_16391_16867 158
510 3300049586 Ga0501070_0006449 Ga0501070_0006449_5340_5816 158
511 3300049586 Ga0501070_0027866 Ga0501070_0027866_3979_4455 158
512 3300049586 Ga0501070_0032048 Ga0501070_0032048_2257_2733 158
513 3300049586 Ga0501070_0301203 Ga0501070_0301203_772_1248 158
514 3300049586 Ga0501070_0743150 Ga0501070_0743150_44_520 158
515 3300049586 Ga0501070_1021542 Ga0501070_1021542_32_508 158
516 3300049587 Ga0501071_0009548 Ga0501071_0009548_2344_2823 158
517 3300049587 Ga0501071_0070895 Ga0501071_0070895_135_611 158
518 3300049589 Ga0501073_0208571 Ga0501073_0208571_637_1116 158
519 3300049590 Ga0501074_0015715 Ga0501074_0015715_18_494 158
520 3300049590 Ga0501074_0060482 Ga0501074_0060482_1148_1624 158
521 3300049590 Ga0501074_0358878 Ga0501074_0358878_21_497 158
522 3300049742 Ga0501080_0001846 Ga0501080_0001846_7458_7937 158
523 3300049742 Ga0501080_0002294 Ga0501080_0002294_12392_12868 158
524 3300049742 Ga0501080_0014720 Ga0501080_0014720_3665_4141 158
525 3300049744 Ga0501083_0000524 Ga0501083_0000524_12917_13396 158
526 3300049822 Ga0501035_0000061 Ga0501035_0000061_86722_87201 158
527 3300049822 Ga0501035_0002052 Ga0501035_0002052_8472_8948 158
528 3300049822 Ga0501035_0002566 Ga0501035_0002566_14489_14965 158
529 3300049823 Ga0501044_0000003 Ga0501044_0000003_340572_341051 158
530 3300049823 Ga0501044_0023419 Ga0501044_0023419_6024_6500 158
531 3300049823 Ga0501044_0247188 Ga0501044_0247188_268_744 158
532 3300049823 Ga0501044_0311223 Ga0501044_0311223_16_492 158
533 3300050492 nmdc:mga0yw44_64771_c1 nmdc:mga0yw44_64771_c1_340_819 158
534 3300053087 Ga0500643_037872 Ga0500643_037872_579_1058 158
535 3300053153 Ga0500616_0054412 Ga0500616_0054412_981_1460 158
536 3300053157 Ga0500624_004568 Ga0500624_004568_95_577 158
537 3300053161 Ga0500634_0000004 Ga0500634_0000004_212648_213130 158
538 3300054114 Ga0501084_1074125 Ga0501084_1074125_79_555 158
539 3300059643 Ga0587072_026891 Ga0587072_026891_59_541 158
540 3300060353 Ga0501082_0886486 Ga0501082_0886486_268_747 158
541 3300001990 JGI24737J22298_10005558 JGI24737J22298_100055585 159
542 3300002067 JGI24735J21928_10022099 JGI24735J21928_100220992 159
543 3300002075 JGI24738J21930_10016180 JGI24738J21930_100161802 159
544 3300002076 JGI24749J21850_1005277 JGI24749J21850_10052772 159
545 3300002077 JGI24744J21845_10011991 JGI24744J21845_100119912 159
546 3300002239 JGI24034J26672_10009889 JGI24034J26672_100098892 159
547 3300002741 JGI25157J39369_1000222 JGI25157J39369_100022255 159
548 3300003762 Ga0055542_1001452 Ga0055542_10014526 159
549 3300003763 Ga0055529_1001896 Ga0055529_10018966 159
550 3300005327 Ga0070658_10249243 Ga0070658_102492432 159
551 3300005327 Ga0070658_10634615 Ga0070658_106346151 159
552 3300005328 Ga0070676_10002448 Ga0070676_100024488 159
553 3300005329 Ga0070683_100016688 Ga0070683_1000166885 159
554 3300005330 Ga0070690_100000438 Ga0070690_10000043824 159
555 3300005331 Ga0070670_100001713 Ga0070670_10000171311 159
556 3300005334 Ga0068869_100126011 Ga0068869_1001260112 159
557 3300005335 Ga0070666_10179946 Ga0070666_101799463 159
558 3300005335 Ga0070666_10393504 Ga0070666_103935042 159
559 3300005336 Ga0070680_100002037 Ga0070680_1000020373 159
560 3300005337 Ga0070682_100000387 Ga0070682_10000038726 159
561 3300005338 Ga0068868_100007844 Ga0068868_1000078446 159
562 3300005340 Ga0070689_100003836 Ga0070689_10000383611 159
563 3300005341 Ga0070691_10006920 Ga0070691_100069203 159
564 3300005343 Ga0070687_100002483 Ga0070687_1000024832 159
565 3300005344 Ga0070661_100000689 Ga0070661_1000006899 159
566 3300005345 Ga0070692_10001470 Ga0070692_100014702 159
567 3300005347 Ga0070668_100049327 Ga0070668_1000493272 159
568 3300005353 Ga0070669_100009784 Ga0070669_1000097845 159
569 3300005353 Ga0070669_101232317 Ga0070669_1012323171 159
570 3300005354 Ga0070675_100002266 Ga0070675_1000022666 159
571 3300005355 Ga0070671_100010188 Ga0070671_1000101883 159
572 3300005356 Ga0070674_100001353 Ga0070674_1000013536 159
573 3300005356 Ga0070674_100151689 Ga0070674_1001516892 159
574 3300005364 Ga0070673_100003636 Ga0070673_10000363612 159
575 3300005365 Ga0070688_100001165 Ga0070688_10000116512 159
576 3300005366 Ga0070659_100018173 Ga0070659_1000181735 159
577 3300005367 Ga0070667_100000657 Ga0070667_10000065729 159
578 3300005434 Ga0070709_10003372 Ga0070709_100033722 159
579 3300005435 Ga0070714_100002744 Ga0070714_1000027443 159
580 3300005436 Ga0070713_100123044 Ga0070713_1001230442 159
581 3300005437 Ga0070710_10006897 Ga0070710_100068974 159
582 3300005438 Ga0070701_10001555 Ga0070701_100015556 159
583 3300005439 Ga0070711_100001294 Ga0070711_1000012947 159
584 3300005440 Ga0070705_100002287 Ga0070705_10000228710 159
585 3300005441 Ga0070700_100001827 Ga0070700_1000018273 159
586 3300005444 Ga0070694_100003648 Ga0070694_1000036489 159
587 3300005455 Ga0070663_100003294 Ga0070663_1000032948 159
588 3300005455 Ga0070663_100133864 Ga0070663_1001338643 159
589 3300005456 Ga0070678_100030424 Ga0070678_1000304243 159
590 3300005456 Ga0070678_100347995 Ga0070678_1003479952 159
591 3300005457 Ga0070662_100001709 Ga0070662_1000017096 159
592 3300005458 Ga0070681_10092614 Ga0070681_100926143 159
593 3300005459 Ga0068867_100043855 Ga0068867_1000438553 159
594 3300005518 Ga0070699_100298224 Ga0070699_1002982242 159
595 3300005530 Ga0070679_100036086 Ga0070679_1000360866 159
596 3300005535 Ga0070684_100001739 Ga0070684_1000017399 159
597 3300005536 Ga0070697_100006693 Ga0070697_1000066938 159
598 3300005539 Ga0068853_100006306 Ga0068853_1000063063 159
599 3300005543 Ga0070672_100002994 Ga0070672_1000029946 159
600 3300005545 Ga0070695_100013728 Ga0070695_1000137283 159
601 3300005546 Ga0070696_100046152 Ga0070696_1000461523 159
602 3300005547 Ga0070693_100000155 Ga0070693_10000015527 159
603 3300005547 Ga0070693_100565888 Ga0070693_1005658881 159
604 3300005548 Ga0070665_100025519 Ga0070665_1000255194 159
605 3300005548 Ga0070665_100342207 Ga0070665_1003422072 159
606 3300005549 Ga0070704_100000688 Ga0070704_10000068819 159
607 3300005563 Ga0068855_100015557 Ga0068855_1000155573 159
608 3300005563 Ga0068855_100308043 Ga0068855_1003080432 159
609 3300005564 Ga0070664_100000700 Ga0070664_10000070023 159
610 3300005564 Ga0070664_100339790 Ga0070664_1003397904 159
611 3300005577 Ga0068857_100010258 Ga0068857_1000102583 159
612 3300005578 Ga0068854_100002106 Ga0068854_10000210611 159
613 3300005578 Ga0068854_100600566 Ga0068854_1006005662 159
614 3300005614 Ga0068856_100006075 Ga0068856_1000060756 159
615 3300005614 Ga0068856_100278424 Ga0068856_1002784242 159
616 3300005615 Ga0070702_100001131 Ga0070702_10000113111 159
617 3300005616 Ga0068852_100059841 Ga0068852_1000598412 159
618 3300005616 Ga0068852_100299278 Ga0068852_1002992782 159
619 3300005617 Ga0068859_100014016 Ga0068859_1000140166 159
620 3300005618 Ga0068864_100005168 Ga0068864_1000051683 159
621 3300005718 Ga0068866_10004281 Ga0068866_100042814 159
622 3300005719 Ga0068861_100027027 Ga0068861_1000270273 159
623 3300005841 Ga0068863_100003165 Ga0068863_10000316518 159
624 3300005842 Ga0068858_100018872 Ga0068858_1000188726 159
625 3300005842 Ga0068858_100750720 Ga0068858_1007507201 159
626 3300005844 Ga0068862_100006195 Ga0068862_1000061958 159
627 3300005844 Ga0068862_100393109 Ga0068862_1003931091 159
628 3300006038 Ga0075365_10039274 Ga0075365_100392742 159
629 3300006038 Ga0075365_10100973 Ga0075365_101009732 159
630 3300006042 Ga0075368_10142677 Ga0075368_101426772 159
631 3300006051 Ga0075364_10454062 Ga0075364_104540622 159
632 3300006163 Ga0070715_10000219 Ga0070715_1000021911 159
633 3300006163 Ga0070715_10034114 Ga0070715_100341142 159
634 3300006173 Ga0070716_100001864 Ga0070716_10000186410 159
635 3300006175 Ga0070712_100000382 Ga0070712_10000038226 159
636 3300006175 Ga0070712_100085109 Ga0070712_1000851092 159
637 3300006177 Ga0075362_10398728 Ga0075362_103987281 159
638 3300006178 Ga0075367_10240549 Ga0075367_102405492 159
639 3300006237 Ga0097621_100105246 Ga0097621_1001052462 159
640 3300006353 Ga0075370_10066061 Ga0075370_100660611 159
641 3300006358 Ga0068871_101157423 Ga0068871_1011574231 159
642 3300006844 Ga0075428_100005355 Ga0075428_1000053552 159
643 3300006846 Ga0075430_100196244 Ga0075430_1001962442 159
644 3300006847 Ga0075431_100033350 Ga0075431_1000333506 159
645 3300006847 Ga0075431_100362288 Ga0075431_1003622882 159
646 3300006852 Ga0075433_10079314 Ga0075433_100793143 159
647 3300006871 Ga0075434_100467491 Ga0075434_1004674912 159
648 3300006881 Ga0068865_100002456 Ga0068865_1000024565 159
649 3300006914 Ga0075436_100011825 Ga0075436_1000118252 159
650 3300006931 Ga0097620_100014016 Ga0097620_1000140166 159
651 3300007076 Ga0075435_101058994 Ga0075435_1010589941 159
652 3300009101 Ga0105247_10222109 Ga0105247_102221092 159
653 3300009177 Ga0105248_10634130 Ga0105248_106341301 159
654 3300009545 Ga0105237_10252405 Ga0105237_102524052 159
655 3300009545 Ga0105237_11834838 Ga0105237_118348381 159
656 3300009553 Ga0105249_11005983 Ga0105249_110059831 159
657 3300010375 Ga0105239_10196398 Ga0105239_101963983 159
658 3300010375 Ga0105239_11579987 Ga0105239_115799872 159
659 3300011119 Ga0105246_11003071 Ga0105246_110030711 159
660 3300013105 Ga0157369_10371389 Ga0157369_103713892 159
661 3300013296 Ga0157374_10268397 Ga0157374_102683972 159
662 3300013306 Ga0163162_10592948 Ga0163162_105929481 159
663 3300013308 Ga0157375_10715486 Ga0157375_107154861 159
664 3300014325 Ga0163163_11158065 Ga0163163_111580651 159
665 3300014968 Ga0157379_10647372 Ga0157379_106473721 159
666 3300017792 Ga0163161_10010203 Ga0163161_100102032 159
667 3300020082 Ga0206353_10411292 Ga0206353_104112921 159
668 3300025250 Ga0209026_1000002 Ga0209026_1000002790 159
669 3300025254 Ga0209148_1000038 Ga0209148_1000038435 159
670 3300025272 Ga0209455_1000678 Ga0209455_100067811 159
671 3300025321 Ga0207656_10146839 Ga0207656_101468392 159
672 3300025321 Ga0207656_10324107 Ga0207656_103241071 159
673 3300025735 Ga0207713_1112417 Ga0207713_11124172 159
674 3300025898 Ga0207692_10010556 Ga0207692_100105563 159
675 3300025899 Ga0207642_10031245 Ga0207642_100312454 159
676 3300025900 Ga0207710_10006312 Ga0207710_100063123 159
677 3300025900 Ga0207710_10195311 Ga0207710_101953111 159
678 3300025901 Ga0207688_10288285 Ga0207688_102882852 159
679 3300025903 Ga0207680_10005465 Ga0207680_100054653 159
680 3300025904 Ga0207647_10004790 Ga0207647_100047909 159
681 3300025906 Ga0207699_10002555 Ga0207699_100025552 159
682 3300025907 Ga0207645_10001793 Ga0207645_1000179312 159
683 3300025911 Ga0207654_10030519 Ga0207654_100305193 159
684 3300025913 Ga0207695_10302141 Ga0207695_103021413 159
685 3300025913 Ga0207695_10481911 Ga0207695_104819112 159
686 3300025914 Ga0207671_10014363 Ga0207671_100143637 159
687 3300025914 Ga0207671_10334236 Ga0207671_103342362 159
688 3300025915 Ga0207693_10000998 Ga0207693_1000099822 159
689 3300025915 Ga0207693_10039260 Ga0207693_100392602 159
690 3300025916 Ga0207663_10000700 Ga0207663_1000070010 159
691 3300025917 Ga0207660_10175643 Ga0207660_101756433 159
692 3300025918 Ga0207662_10003502 Ga0207662_100035022 159
693 3300025919 Ga0207657_10000516 Ga0207657_1000051638 159
694 3300025919 Ga0207657_10056812 Ga0207657_100568123 159
695 3300025920 Ga0207649_10053908 Ga0207649_100539082 159
696 3300025921 Ga0207652_10101949 Ga0207652_101019491 159
697 3300025923 Ga0207681_10010302 Ga0207681_100103023 159
698 3300025924 Ga0207694_10021980 Ga0207694_100219803 159
699 3300025925 Ga0207650_10643881 Ga0207650_106438812 159
700 3300025926 Ga0207659_10054489 Ga0207659_100544892 159
701 3300025927 Ga0207687_10029096 Ga0207687_100290965 159
702 3300025927 Ga0207687_11460165 Ga0207687_114601652 159
703 3300025928 Ga0207700_10128274 Ga0207700_101282742 159
704 3300025929 Ga0207664_10034941 Ga0207664_100349413 159
705 3300025931 Ga0207644_10080977 Ga0207644_100809773 159
706 3300025931 Ga0207644_10676690 Ga0207644_106766902 159
707 3300025932 Ga0207690_10006538 Ga0207690_100065385 159
708 3300025933 Ga0207706_10002149 Ga0207706_1000214914 159
709 3300025934 Ga0207686_10004658 Ga0207686_100046588 159
710 3300025934 Ga0207686_10139007 Ga0207686_101390073 159
711 3300025935 Ga0207709_10007883 Ga0207709_100078835 159
712 3300025936 Ga0207670_10002633 Ga0207670_100026333 159
713 3300025937 Ga0207669_10033036 Ga0207669_100330363 159
714 3300025938 Ga0207704_10022172 Ga0207704_100221722 159
715 3300025938 Ga0207704_10566787 Ga0207704_105667872 159
716 3300025939 Ga0207665_10000327 Ga0207665_1000032729 159
717 3300025940 Ga0207691_10022661 Ga0207691_100226617 159
718 3300025941 Ga0207711_10012217 Ga0207711_100122175 159
719 3300025942 Ga0207689_10010763 Ga0207689_100107635 159
720 3300025945 Ga0207679_10012249 Ga0207679_100122497 159
721 3300025945 Ga0207679_11595088 Ga0207679_115950881 159
722 3300025960 Ga0207651_10005081 Ga0207651_100050811 159
723 3300025961 Ga0207712_10003778 Ga0207712_100037782 159
724 3300025961 Ga0207712_10499863 Ga0207712_104998632 159
725 3300025972 Ga0207668_10013555 Ga0207668_100135553 159
726 3300025972 Ga0207668_10475056 Ga0207668_104750561 159
727 3300025981 Ga0207640_10004632 Ga0207640_100046325 159
728 3300025981 Ga0207640_11077326 Ga0207640_110773261 159
729 3300025986 Ga0207658_10019418 Ga0207658_100194185 159
730 3300025986 Ga0207658_10123987 Ga0207658_101239873 159
731 3300026023 Ga0207677_10329516 Ga0207677_103295162 159
732 3300026035 Ga0207703_10232561 Ga0207703_102325612 159
733 3300026041 Ga0207639_10005217 Ga0207639_100052173 159
734 3300026067 Ga0207678_10054088 Ga0207678_100540882 159
735 3300026067 Ga0207678_10260940 Ga0207678_102609403 159
736 3300026075 Ga0207708_10001427 Ga0207708_1000142710 159
737 3300026078 Ga0207702_10100362 Ga0207702_101003624 159
738 3300026088 Ga0207641_10005966 Ga0207641_100059663 159
739 3300026089 Ga0207648_10155357 Ga0207648_101553572 159
740 3300026089 Ga0207648_10324822 Ga0207648_103248222 159
741 3300026095 Ga0207676_10261959 Ga0207676_102619591 159
742 3300026116 Ga0207674_10010004 Ga0207674_100100043 159
743 3300026118 Ga0207675_100001630 Ga0207675_10000163023 159
744 3300026118 Ga0207675_100812105 Ga0207675_1008121051 159
745 3300026121 Ga0207683_10000351 Ga0207683_1000035110 159
746 3300026121 Ga0207683_10051672 Ga0207683_100516723 159
747 3300026142 Ga0207698_10009311 Ga0207698_100093113 159
748 3300026142 Ga0207698_10169072 Ga0207698_101690722 159
749 3300027907 Ga0207428_10074831 Ga0207428_100748312 159
750 3300027907 Ga0207428_10400855 Ga0207428_104008552 159
751 3300028379 Ga0268266_10012855 Ga0268266_100128555 159
752 3300028379 Ga0268266_10049403 Ga0268266_100494032 159
753 3300028379 Ga0268266_11296981 Ga0268266_112969811 159
754 3300028380 Ga0268265_10081063 Ga0268265_100810634 159
755 3300028380 Ga0268265_11273182 Ga0268265_112731821 159
756 3300028380 Ga0268265_11641989 Ga0268265_116419891 159
757 3300028381 Ga0268264_10023577 Ga0268264_100235774 159
758 3300031456 Ga0307513_10862518 Ga0307513_108625181 159
759 3300031507 Ga0307509_10480994 Ga0307509_104809941 159
760 3300031727 Ga0316576_10403100 Ga0316576_104031001 159
761 3300031728 Ga0316578_10031254 Ga0316578_100312543 159
762 3300031731 Ga0307405_10730644 Ga0307405_107306441 159
763 3300031852 Ga0307410_11082769 Ga0307410_110827691 159
764 3300031911 Ga0307412_10868996 Ga0307412_108689962 159
765 3300032126 Ga0307415_101603182 Ga0307415_1016031821 159
766 3300032133 Ga0316583_10134141 Ga0316583_101341412 159
767 3300035242 Ga0373962_0015643 Ga0373962_0015643_1239_1718 159
768 3300037466 Ga0395898_0087353 Ga0395898_0087353_1865_2344 159
769 3300038443 Ga0395901_0018122 Ga0395901_0018122_6316_6795 159
770 3300039062 Ga0400483_164597 Ga0400483_164597_436_933 159
771 3300041413 Ga0439465_0048470 Ga0439465_0048470_555_1037 159
772 3300041459 Ga0451800_0048927 Ga0451800_0048927_137_619 159
773 3300041509 Ga0451843_1723520 Ga0451843_1723520_143_625 159
774 3300042005 Ga0439448_0204453 Ga0439448_0204453_168_647 159
775 3300042005 Ga0439448_0234825 Ga0439448_0234825_44_523 159
776 3300042010 Ga0439452_045714 Ga0439452_045714_70_570 159
777 3300042157 Ga0439458_0062580 Ga0439458_0062580_138_620 159
778 3300042461 Ga0439460_0253481 Ga0439460_0253481_26_505 159
779 3300042993 Ga0439440_0054677 Ga0439440_0054677_233_712 159
780 3300046459 Ga0495629_0224099 Ga0495629_0224099_53_535 159
781 3300046512 Ga0495610_0049022 Ga0495610_0049022_837_1319 159
782 3300046515 Ga0495620_0062590 Ga0495620_0062590_941_1423 159
783 3300046519 Ga0495632_0253414 Ga0495632_0253414_227_709 159
784 3300046558 Ga0495633_0437924 Ga0495633_0437924_62_544 159
785 3300046615 Ga0495656_0125425 Ga0495656_0125425_367_870 159
786 3300046616 Ga0495668_0288990 Ga0495668_0288990_163_645 159
787 3300046660 Ga0495625_0268610 Ga0495625_0268610_13_495 159
788 3300046683 Ga0495658_0061043 Ga0495658_0061043_1168_1650 159
789 3300046691 Ga0495670_0313234 Ga0495670_0313234_287_769 159
790 3300046810 Ga0495660_0160239 Ga0495660_0160239_255_737 159
791 3300047320 Ga0495672_0311182 Ga0495672_0311182_195_677 159
792 3300047323 Ga0495683_0223543 Ga0495683_0223543_340_819 159
793 3300047472 Ga0495686_0001465 Ga0495686_0001465_237_719 159
794 3300048090 Ga0495615_0099576 Ga0495615_0099576_145_627 159
795 3300048091 Ga0495626_0170082 Ga0495626_0170082_318_797 159
796 3300048905 Ga0496102_0501310 Ga0496102_0501310_367_849 159
797 3300048906 Ga0496103_0159684 Ga0496103_0159684_518_1000 159
798 3300048909 Ga0496106_0416799 Ga0496106_0416799_92_574 159
799 3300048912 Ga0496109_0487612 Ga0496109_0487612_584_1063 159
800 3300048913 Ga0496110_0804688 Ga0496110_0804688_256_738 159
801 3300048915 Ga0496112_0039385 Ga0496112_0039385_134_616 159
802 3300048916 Ga0496113_0209740 Ga0496113_0209740_445_924 159
803 3300048920 Ga0496117_0525236 Ga0496117_0525236_67_549 159
804 3300048922 Ga0496119_0058680 Ga0496119_0058680_201_683 159
805 3300048923 Ga0496120_0178856 Ga0496120_0178856_294_776 159
806 3300048927 Ga0496124_0592757 Ga0496124_0592757_37_519 159
807 3300049568 Ga0501031_0092852 Ga0501031_0092852_1003_1482 159
808 3300049568 Ga0501031_0590923 Ga0501031_0590923_194_676 159
809 3300049569 Ga0501032_0204835 Ga0501032_0204835_526_1008 159
810 3300049570 Ga0501033_0061822 Ga0501033_0061822_2022_2504 159
811 3300049570 Ga0501033_0404242 Ga0501033_0404242_343_822 159
812 3300049570 Ga0501033_0537174 Ga0501033_0537174_57_536 159
813 3300049571 Ga0501034_0174934 Ga0501034_0174934_1064_1546 159
814 3300049571 Ga0501034_1144567 Ga0501034_1144567_165_647 159
815 3300049572 Ga0501036_0677257 Ga0501036_0677257_125_604 159
816 3300049573 Ga0501037_0524068 Ga0501037_0524068_17_496 159
817 3300049573 Ga0501037_0530557 Ga0501037_0530557_40_522 159
818 3300049574 Ga0501038_0096844 Ga0501038_0096844_697_1179 159
819 3300049575 Ga0501039_0013679 Ga0501039_0013679_980_1459 159
820 3300049575 Ga0501039_0900011 Ga0501039_0900011_47_577 159
821 3300049576 Ga0501040_0207776 Ga0501040_0207776_759_1238 159
822 3300049577 Ga0501041_0429006 Ga0501041_0429006_213_692 159
823 3300049578 Ga0501042_0342726 Ga0501042_0342726_584_1063 159
824 3300049578 Ga0501042_0348353 Ga0501042_0348353_288_767 159
825 3300049579 Ga0501043_0235485 Ga0501043_0235485_576_1055 159
826 3300049579 Ga0501043_0280498 Ga0501043_0280498_248_727 159
827 3300049580 Ga0501046_0201340 Ga0501046_0201340_443_922 159
828 3300049581 Ga0501047_0362261 Ga0501047_0362261_178_660 159
829 3300049582 Ga0501048_0127717 Ga0501048_0127717_670_1149 159
830 3300049582 Ga0501048_0476203 Ga0501048_0476203_125_604 159
831 3300049584 Ga0501068_0371488 Ga0501068_0371488_336_815 159
832 3300049585 Ga0501069_0118879 Ga0501069_0118879_661_1140 159
833 3300049586 Ga0501070_0057191 Ga0501070_0057191_1077_1559 159
834 3300049586 Ga0501070_0375810 Ga0501070_0375810_514_996 159
835 3300049586 Ga0501070_0429283 Ga0501070_0429283_458_937 159
836 3300049587 Ga0501071_0005101 Ga0501071_0005101_3016_3495 159
837 3300049588 Ga0501072_0033522 Ga0501072_0033522_3350_3829 159
838 3300049588 Ga0501072_0635583 Ga0501072_0635583_168_647 159
839 3300049589 Ga0501073_0297390 Ga0501073_0297390_350_829 159
840 3300049590 Ga0501074_0134462 Ga0501074_0134462_927_1406 159
841 3300049590 Ga0501074_0506706 Ga0501074_0506706_92_571 159
842 3300049591 Ga0501075_0210889 Ga0501075_0210889_469_948 159
843 3300049592 Ga0501076_0054536 Ga0501076_0054536_2225_2704 159
844 3300049592 Ga0501076_0072340 Ga0501076_0072340_1156_1635 159
845 3300049741 Ga0501079_0114292 Ga0501079_0114292_186_665 159
846 3300049741 Ga0501079_0186293 Ga0501079_0186293_288_767 159
847 3300049743 Ga0501081_0082879 Ga0501081_0082879_709_1188 159
848 3300049743 Ga0501081_0085196 Ga0501081_0085196_981_1460 159
849 3300049743 Ga0501081_0902189 Ga0501081_0902189_138_617 159
850 3300049744 Ga0501083_0150125 Ga0501083_0150125_1028_1507 159
851 3300049744 Ga0501083_0259894 Ga0501083_0259894_45_527 159
852 3300049744 Ga0501083_0308575 Ga0501083_0308575_491_970 159
853 3300049822 Ga0501035_0305392 Ga0501035_0305392_558_1037 159
854 3300049822 Ga0501035_0562695 Ga0501035_0562695_14_493 159
855 3300049823 Ga0501044_0044387 Ga0501044_0044387_934_1416 159
856 3300049823 Ga0501044_0409254 Ga0501044_0409254_713_1195 159
857 3300049823 Ga0501044_1393540 Ga0501044_1393540_32_511 159
858 3300049824 Ga0501045_0195110 Ga0501045_0195110_77_556 159
859 3300049824 Ga0501045_0289422 Ga0501045_0289422_343_822 159
860 3300049824 Ga0501045_0660127 Ga0501045_0660127_191_670 159
861 3300050491 nmdc:mga00v17_5251_c2 nmdc:mga00v17_5251_c2_100_582 159
862 3300050492 nmdc:mga0yw44_138395_c1 nmdc:mga0yw44_138395_c1_86_568 159
863 3300050492 nmdc:mga0yw44_257835_c1 nmdc:mga0yw44_257835_c1_654_1136 159
864 3300050492 nmdc:mga0yw44_315002_c1 nmdc:mga0yw44_315002_c1_515_997 159
865 3300050494 nmdc:mga06z11_129879_c1 nmdc:mga06z11_129879_c1_745_1227 159
866 3300050496 nmdc:mga07m45_46054_c1 nmdc:mga07m45_46054_c1_1858_2340 159
867 3300050509 nmdc:mga0qj67_248590_c1 nmdc:mga0qj67_248590_c1_73_552 159
868 3300050510 nmdc:mga06r32_330282_c1 nmdc:mga06r32_330282_c1_438_917 159
869 3300050515 nmdc:mga0a205_46652_c1 nmdc:mga0a205_46652_c1_3262_3741 159
870 3300053083 Ga0495655_0000773 Ga0495655_0000773_2865_3344 159
871 3300053083 Ga0495655_0028907 Ga0495655_0028907_579_1061 159
872 3300053086 Ga0500578_0512062 Ga0500578_0512062_140_622 159
873 3300053098 Ga0500650_0182629 Ga0500650_0182629_80_562 159
874 3300053134 Ga0500658_0146703 Ga0500658_0146703_180_662 159
875 3300053158 Ga0500627_0222596 Ga0500627_0222596_309_791 159
876 3300053727 Ga0500611_175569 Ga0500611_175569_21_503 159
877 3300054114 Ga0501084_0097519 Ga0501084_0097519_308_787 159
878 3300059503 Ga0587080_018613 Ga0587080_018613_554_1036 159
879 3300059504 Ga0587082_013800 Ga0587082_013800_16_498 159
880 3300059505 Ga0587083_0074043 Ga0587083_0074043_19_501 159
881 3300059509 Ga0587089_026455 Ga0587089_026455_156_638 159
882 3300059513 Ga0587094_015377 Ga0587094_015377_561_1043 159
883 3300059514 Ga0587095_013659 Ga0587095_013659_174_656 159
884 3300059604 Ga0587098_064275 Ga0587098_064275_83_565 159
885 3300059625 Ga0587113_006331 Ga0587113_006331_13_495 159
886 3300059627 Ga0587117_028738 Ga0587117_028738_263_745 159
887 3300059645 Ga0587076_106917 Ga0587076_106917_80_562 159
888 3300059646 Ga0587078_010918 Ga0587078_010918_24_506 159
889 3300059649 Ga0587102_037271 Ga0587102_037271_27_509 159
890 3300059652 Ga0587107_015572 Ga0587107_015572_485_967 159
891 3300059655 Ga0587114_085899 Ga0587114_085899_19_501 159
892 3300059658 Ga0587119_014111 Ga0587119_014111_432_914 159
893 3300059660 Ga0587124_031150 Ga0587124_031150_80_562 159
894 3300060344 Ga0587071_115100 Ga0587071_115100_109_591 159
895 3300060346 Ga0587111_0032452 Ga0587111_0032452_18_500 159
896 3300060346 Ga0587111_0212036 Ga0587111_0212036_47_529 159
897 3300060353 Ga0501082_0033500 Ga0501082_0033500_2626_3105 159
898 3300060353 Ga0501082_0164397 Ga0501082_0164397_521_1000 159
899 3300033541 Ga0316596_1225925 Ga0316596_12259251 160
900 3300036647 Ga0316582_0191482 Ga0316582_0191482_878_1363 160
901 3300041453 Ga0451797_0578826 Ga0451797_0578826_425_916 160
902 3300049571 Ga0501034_0084106 Ga0501034_0084106_731_1216 160
903 3300049574 Ga0501038_0358155 Ga0501038_0358155_531_1019 160
904 3300049575 Ga0501039_0355124 Ga0501039_0355124_53_541 160
905 3300049579 Ga0501043_0521352 Ga0501043_0521352_27_515 160
906 3300049582 Ga0501048_0142806 Ga0501048_0142806_68_550 160
907 3300049585 Ga0501069_0482068 Ga0501069_0482068_67_549 160
908 3300049586 Ga0501070_0843923 Ga0501070_0843923_133_621 160
909 3300049591 Ga0501075_0023194 Ga0501075_0023194_1998_2480 160
910 3300049822 Ga0501035_1104020 Ga0501035_1104020_35_523 160
911 3300049823 Ga0501044_0051125 Ga0501044_0051125_3678_4166 160
912 3300009093 Ga0105240_10028048 Ga0105240_100280486 161
913 3300009094 Ga0111539_10126417 Ga0111539_101264171 161
914 3300009098 Ga0105245_10000729 Ga0105245_1000072927 161
915 3300009101 Ga0105247_10000684 Ga0105247_100006848 161
916 3300009147 Ga0114129_10055348 Ga0114129_100553484 161
917 3300009148 Ga0105243_10004066 Ga0105243_100040669 161
918 3300009174 Ga0105241_10014990 Ga0105241_100149903 161
919 3300009176 Ga0105242_10000957 Ga0105242_1000095718 161
920 3300009177 Ga0105248_10000854 Ga0105248_1000085427 161
921 3300009545 Ga0105237_10000974 Ga0105237_1000097436 161
922 3300009551 Ga0105238_10005006 Ga0105238_100050069 161
923 3300009553 Ga0105249_10000677 Ga0105249_1000067710 161
924 3300010375 Ga0105239_10002346 Ga0105239_1000234610 161
925 3300011119 Ga0105246_10001644 Ga0105246_100016443 161
926 3300013100 Ga0157373_10044718 Ga0157373_100447181 161
927 3300013104 Ga0157370_10233692 Ga0157370_102336922 161
928 3300013105 Ga0157369_10003955 Ga0157369_100039553 161
929 3300013296 Ga0157374_10029930 Ga0157374_100299305 161
930 3300013297 Ga0157378_10006232 Ga0157378_100062322 161
931 3300013306 Ga0163162_10005337 Ga0163162_100053375 161
932 3300013307 Ga0157372_10010270 Ga0157372_1001027010 161
933 3300013308 Ga0157375_10000519 Ga0157375_100005193 161
934 3300014325 Ga0163163_10026341 Ga0163163_100263412 161
935 3300014745 Ga0157377_10000936 Ga0157377_100009369 161
936 3300014968 Ga0157379_10006266 Ga0157379_100062665 161
937 3300014969 Ga0157376_10049794 Ga0157376_100497941 161
938 3300014969 Ga0157376_10701575 Ga0157376_107015752 161
939 3300035114 Ga0373939_0044716 Ga0373939_0044716_536_1036 161
940 3300035241 Ga0373961_0006145 Ga0373961_0006145_1137_1637 161
941 3300035691 Ga0373931_0496595 Ga0373931_0496595_86_586 161
942 3300036401 Ga0373937_0047757 Ga0373937_0047757_1652_2137 161
943 3300037312 Ga0395899_0295164 Ga0395899_0295164_342_842 161
944 3300037418 Ga0395900_0351566 Ga0395900_0351566_67_567 161
945 3300046516 Ga0495628_0487256 Ga0495628_0487256_249_734 161
946 3300046675 Ga0495657_0366327 Ga0495657_0366327_165_650 161
947 3300048903 Ga0496100_0023101 Ga0496100_0023101_1499_1999 161
948 3300048904 Ga0496101_0059907 Ga0496101_0059907_487_987 161
949 3300048904 Ga0496101_0894567 Ga0496101_0894567_105_605 161
950 3300048905 Ga0496102_0017938 Ga0496102_0017938_1046_1546 161
951 3300048906 Ga0496103_0013445 Ga0496103_0013445_2024_2524 161
952 3300048907 Ga0496104_0085498 Ga0496104_0085498_487_987 161
953 3300048908 Ga0496105_0009703 Ga0496105_0009703_2375_2875 161
954 3300048909 Ga0496106_0050389 Ga0496106_0050389_615_1115 161
955 3300048910 Ga0496107_0848028 Ga0496107_0848028_33_533 161
956 3300048911 Ga0496108_0010541 Ga0496108_0010541_2347_2847 161
957 3300048912 Ga0496109_0014012 Ga0496109_0014012_777_1277 161
958 3300048912 Ga0496109_0020303 Ga0496109_0020303_615_1115 161
959 3300048913 Ga0496110_0004436 Ga0496110_0004436_7285_7785 161
960 3300048914 Ga0496111_0020482 Ga0496111_0020482_2331_2831 161
961 3300048915 Ga0496112_0005081 Ga0496112_0005081_5119_5619 161
962 3300048915 Ga0496112_0031458 Ga0496112_0031458_2796_3296 161
963 3300048916 Ga0496113_0139968 Ga0496113_0139968_1371_1871 161
964 3300048918 Ga0496115_0067709 Ga0496115_0067709_615_1115 161
965 3300049568 Ga0501031_0423601 Ga0501031_0423601_333_818 161
966 3300049570 Ga0501033_0425306 Ga0501033_0425306_16_501 161
967 3300049575 Ga0501039_0289200 Ga0501039_0289200_574_1059 161
968 3300049578 Ga0501042_0398706 Ga0501042_0398706_304_789 161
969 3300049587 Ga0501071_0167743 Ga0501071_0167743_423_908 161
970 3300049588 Ga0501072_1041429 Ga0501072_1041429_20_505 161
971 3300049588 Ga0501072_1154149 Ga0501072_1154149_33_533 161
972 3300049590 Ga0501074_0044789 Ga0501074_0044789_2198_2683 161
973 3300049593 Ga0501077_0328500 Ga0501077_0328500_473_958 161
974 3300049824 Ga0501045_0306829 Ga0501045_0306829_68_553 161
975 3300050507 nmdc:mga05p37_932744_c1 nmdc:mga05p37_932744_c1_292_792 161
976 3300050508 nmdc:mga09592_44022_c1 nmdc:mga09592_44022_c1_59_559 161
977 3300050511 nmdc:mga08y16_139564_c1 nmdc:mga08y16_139564_c1_1074_1574 161
978 3300050512 nmdc:mga0n895_390638_c1 nmdc:mga0n895_390638_c1_776_1276 161
979 3300050514 nmdc:mga08x19_6006_c1 nmdc:mga08x19_6006_c1_1611_2111 161
980 3300053077 Ga0495601_0036771 Ga0495601_0036771_1618_2103 161
981 3300053085 Ga0495619_0060580 Ga0495619_0060580_229_714 161
982 3300060353 Ga0501082_0042278 Ga0501082_0042278_221_706 161
983 3300061734 Ga0530510_0673320 Ga0530510_0673320_261_746 161
984 3300000044 ARSoilOldRDRAFT_c005725 ARSoilOldRDRAFT_0057252 162
985 3300005347 Ga0070668_100420178 Ga0070668_1004201782 162
986 3300005353 Ga0070669_100164725 Ga0070669_1001647252 162
987 3300005355 Ga0070671_100530455 Ga0070671_1005304552 162
988 3300005356 Ga0070674_100057288 Ga0070674_1000572885 162
989 3300005365 Ga0070688_100414168 Ga0070688_1004141682 162
990 3300005441 Ga0070700_100102923 Ga0070700_1001029232 162
991 3300005444 Ga0070694_100747058 Ga0070694_1007470581 162
992 3300005459 Ga0068867_100318457 Ga0068867_1003184572 162
993 3300005536 Ga0070697_100147000 Ga0070697_1001470003 162
994 3300005539 Ga0068853_100181870 Ga0068853_1001818702 162
995 3300005539 Ga0068853_100819416 Ga0068853_1008194161 162
996 3300005546 Ga0070696_100086366 Ga0070696_1000863662 162
997 3300005548 Ga0070665_100698278 Ga0070665_1006982782 162
998 3300005578 Ga0068854_100063366 Ga0068854_1000633664 162
999 3300005617 Ga0068859_100293109 Ga0068859_1002931092 162
1000 3300005843 Ga0068860_100393567 Ga0068860_1003935672 162
1001 3300005843 Ga0068860_100611569 Ga0068860_1006115692 162
1002 3300005844 Ga0068862_100139304 Ga0068862_1001393044 162
1003 3300006038 Ga0075365_11055805 Ga0075365_110558051 162
1004 3300006175 Ga0070712_100084684 Ga0070712_1000846843 162
1005 3300006847 Ga0075431_100314580 Ga0075431_1003145802 162
1006 3300006881 Ga0068865_100364346 Ga0068865_1003643462 162
1007 3300006931 Ga0097620_100293110 Ga0097620_1002931102 162
1008 3300009101 Ga0105247_10031011 Ga0105247_100310112 162
1009 3300009148 Ga0105243_10506141 Ga0105243_105061412 162
1010 3300009176 Ga0105242_10457859 Ga0105242_104578592 162
1011 3300009177 Ga0105248_10630755 Ga0105248_106307552 162
1012 3300009545 Ga0105237_10829593 Ga0105237_108295932 162
1013 3300009545 Ga0105237_12335032 Ga0105237_123350321 162
1014 3300010375 Ga0105239_10062542 Ga0105239_100625423 162
1015 3300011119 Ga0105246_10286685 Ga0105246_102866852 162
1016 3300012481 Ga0157320_1011286 Ga0157320_10112862 162
1017 3300013296 Ga0157374_10694658 Ga0157374_106946582 162
1018 3300013297 Ga0157378_10144337 Ga0157378_101443372 162
1019 3300014745 Ga0157377_10167232 Ga0157377_101672322 162
1020 3300014968 Ga0157379_10823159 Ga0157379_108231592 162
1021 3300025899 Ga0207642_10057741 Ga0207642_100577412 162
1022 3300025900 Ga0207710_10039726 Ga0207710_100397264 162
1023 3300025901 Ga0207688_10451551 Ga0207688_104515511 162
1024 3300025915 Ga0207693_10237126 Ga0207693_102371262 162
1025 3300025920 Ga0207649_11063081 Ga0207649_110630811 162
1026 3300025923 Ga0207681_10759971 Ga0207681_107599712 162
1027 3300025932 Ga0207690_10572885 Ga0207690_105728851 162
1028 3300025933 Ga0207706_10122622 Ga0207706_101226222 162
1029 3300025935 Ga0207709_10257072 Ga0207709_102570722 162
1030 3300025936 Ga0207670_10204030 Ga0207670_102040301 162
1031 3300025938 Ga0207704_10233267 Ga0207704_102332672 162
1032 3300025938 Ga0207704_10718630 Ga0207704_107186302 162
1033 3300025941 Ga0207711_10217681 Ga0207711_102176813 162
1034 3300025942 Ga0207689_10259346 Ga0207689_102593462 162
1035 3300025961 Ga0207712_10679428 Ga0207712_106794282 162
1036 3300025972 Ga0207668_10037560 Ga0207668_100375602 162
1037 3300025981 Ga0207640_10206654 Ga0207640_102066542 162
1038 3300025986 Ga0207658_11265695 Ga0207658_112656951 162
1039 3300026041 Ga0207639_10351053 Ga0207639_103510532 162
1040 3300026121 Ga0207683_10416356 Ga0207683_104163561 162
1041 3300027717 Ga0209998_10010305 Ga0209998_100103052 162
1042 3300027876 Ga0209974_10125394 Ga0209974_101253941 162
1043 3300028380 Ga0268265_10657217 Ga0268265_106572172 162
1044 3300028381 Ga0268264_10119195 Ga0268264_101191951 162
1045 3300035085 Ga0373929_0037569 Ga0373929_0037569_391_900 162
1046 3300035092 Ga0373952_0122069 Ga0373952_0122069_97_585 162
1047 3300035121 Ga0373960_0100017 Ga0373960_0100017_377_886 162
1048 3300035241 Ga0373961_0028107 Ga0373961_0028107_828_1316 162
1049 3300035242 Ga0373962_0108164 Ga0373962_0108164_260_748 162
1050 3300046491 Ga0495584_0057320 Ga0495584_0057320_458_946 162
1051 3300046492 Ga0495585_0190410 Ga0495585_0190410_525_1013 162
1052 3300046492 Ga0495585_0283142 Ga0495585_0283142_171_659 162
1053 3300046506 Ga0495583_0174937 Ga0495583_0174937_145_633 162
1054 3300046519 Ga0495632_0429543 Ga0495632_0429543_13_522 162
1055 3300046558 Ga0495633_0225840 Ga0495633_0225840_241_729 162
1056 3300046615 Ga0495656_0335498 Ga0495656_0335498_162_650 162
1057 3300048903 Ga0496100_0035960 Ga0496100_0035960_1277_1786 162
1058 3300048905 Ga0496102_0171458 Ga0496102_0171458_1073_1561 162
1059 3300048906 Ga0496103_0017163 Ga0496103_0017163_1044_1532 162
1060 3300048907 Ga0496104_0297281 Ga0496104_0297281_493_981 162
1061 3300048910 Ga0496107_0481936 Ga0496107_0481936_239_727 162
1062 3300048911 Ga0496108_0529852 Ga0496108_0529852_126_614 162
1063 3300048912 Ga0496109_0031859 Ga0496109_0031859_4103_4591 162
1064 3300048913 Ga0496110_0129581 Ga0496110_0129581_890_1378 162
1065 3300048914 Ga0496111_0058902 Ga0496111_0058902_1622_2110 162
1066 3300048915 Ga0496112_0135841 Ga0496112_0135841_285_773 162
1067 3300048916 Ga0496113_1125342 Ga0496113_1125342_64_573 162
1068 3300048918 Ga0496115_0346200 Ga0496115_0346200_598_1086 162
1069 3300049568 Ga0501031_0029518 Ga0501031_0029518_594_1082 162
1070 3300049569 Ga0501032_0160827 Ga0501032_0160827_770_1258 162
1071 3300049569 Ga0501032_0265986 Ga0501032_0265986_498_986 162
1072 3300049570 Ga0501033_0119845 Ga0501033_0119845_401_889 162
1073 3300049572 Ga0501036_0020419 Ga0501036_0020419_1605_2093 162
1074 3300049572 Ga0501036_0042203 Ga0501036_0042203_2256_2744 162
1075 3300049573 Ga0501037_0151827 Ga0501037_0151827_644_1132 162
1076 3300049575 Ga0501039_0024319 Ga0501039_0024319_1396_1884 162
1077 3300049575 Ga0501039_0081359 Ga0501039_0081359_686_1174 162
1078 3300049576 Ga0501040_0246648 Ga0501040_0246648_600_1088 162
1079 3300049577 Ga0501041_0079483 Ga0501041_0079483_1135_1623 162
1080 3300049578 Ga0501042_0028224 Ga0501042_0028224_1243_1731 162
1081 3300049578 Ga0501042_0090238 Ga0501042_0090238_705_1193 162
1082 3300049580 Ga0501046_0058260 Ga0501046_0058260_2273_2761 162
1083 3300049580 Ga0501046_0084349 Ga0501046_0084349_840_1328 162
1084 3300049580 Ga0501046_0096109 Ga0501046_0096109_1252_1740 162
1085 3300049581 Ga0501047_0110628 Ga0501047_0110628_894_1382 162
1086 3300049582 Ga0501048_0046137 Ga0501048_0046137_1251_1739 162
1087 3300049584 Ga0501068_0014932 Ga0501068_0014932_3363_3851 162
1088 3300049584 Ga0501068_0054565 Ga0501068_0054565_1111_1599 162
1089 3300049587 Ga0501071_0077862 Ga0501071_0077862_784_1272 162
1090 3300049587 Ga0501071_0285357 Ga0501071_0285357_424_912 162
1091 3300049587 Ga0501071_0437020 Ga0501071_0437020_85_594 162
1092 3300049588 Ga0501072_0015847 Ga0501072_0015847_4347_4835 162
1093 3300049588 Ga0501072_0030510 Ga0501072_0030510_1147_1635 162
1094 3300049589 Ga0501073_0566948 Ga0501073_0566948_201_710 162
1095 3300049590 Ga0501074_0036832 Ga0501074_0036832_1808_2296 162
1096 3300049591 Ga0501075_0023025 Ga0501075_0023025_3364_3852 162
1097 3300049591 Ga0501075_0107810 Ga0501075_0107810_1356_1844 162
1098 3300049592 Ga0501076_0034396 Ga0501076_0034396_3210_3698 162
1099 3300049592 Ga0501076_0114666 Ga0501076_0114666_280_768 162
1100 3300049593 Ga0501077_0092221 Ga0501077_0092221_1281_1769 162
1101 3300049593 Ga0501077_0198439 Ga0501077_0198439_759_1247 162
1102 3300049741 Ga0501079_0015310 Ga0501079_0015310_3879_4367 162
1103 3300049741 Ga0501079_0093750 Ga0501079_0093750_976_1464 162
1104 3300049741 Ga0501079_0359212 Ga0501079_0359212_598_1089 162
1105 3300049741 Ga0501079_0861464 Ga0501079_0861464_47_535 162
1106 3300049742 Ga0501080_0131305 Ga0501080_0131305_129_617 162
1107 3300049742 Ga0501080_0154201 Ga0501080_0154201_295_783 162
1108 3300049743 Ga0501081_0007477 Ga0501081_0007477_4140_4628 162
1109 3300049743 Ga0501081_0097137 Ga0501081_0097137_292_780 162
1110 3300049744 Ga0501083_0036097 Ga0501083_0036097_1341_1829 162
1111 3300049744 Ga0501083_0062836 Ga0501083_0062836_101_589 162
1112 3300049822 Ga0501035_0417741 Ga0501035_0417741_598_1089 162
1113 3300049823 Ga0501044_1325056 Ga0501044_1325056_24_512 162
1114 3300049824 Ga0501045_0019019 Ga0501045_0019019_62_571 162
1115 3300049824 Ga0501045_0055910 Ga0501045_0055910_1317_1805 162
1116 3300049824 Ga0501045_0119776 Ga0501045_0119776_1284_1772 162
1117 3300050507 nmdc:mga05p37_99844_c1 nmdc:mga05p37_99844_c1_770_1258 162
1118 3300050510 nmdc:mga06r32_226888_c1 nmdc:mga06r32_226888_c1_579_1067 162
1119 3300050512 nmdc:mga0n895_763592_c1 nmdc:mga0n895_763592_c1_365_874 162
1120 3300050515 nmdc:mga0a205_208281_c1 nmdc:mga0a205_208281_c1_570_1079 162
1121 3300053083 Ga0495655_0020441 Ga0495655_0020441_496_987 162
1122 3300054114 Ga0501084_0024909 Ga0501084_0024909_1630_2118 162
1123 3300054114 Ga0501084_0096312 Ga0501084_0096312_651_1139 162
1124 3300054114 Ga0501084_0536815 Ga0501084_0536815_14_502 162
1125 3300060353 Ga0501082_0185586 Ga0501082_0185586_211_699 162
1126 3300060353 Ga0501082_0203528 Ga0501082_0203528_549_1037 162
1127 3300060353 Ga0501082_0221183 Ga0501082_0221183_777_1265 162
1128 3300061734 Ga0530510_0007204 Ga0530510_0007204_963_1451 162
1129 3300061734 Ga0530510_0055187 Ga0530510_0055187_1192_1680 162
1130 3300061734 Ga0530510_0295611 Ga0530510_0295611_701_1192 162

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00380

Ribosomal_S9

Ribosomal protein S9/S16

36

155

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
7m4u-assembly1.cif.gz_i a. baumannii ribosome-eravacycline complex: 30s 0.9785 38 140
7nhn-assembly1.cif.gz_j vgal, an antibiotic resistance abcf, in complex with 70s ribosome from listeria monocytogenes 0.9763 38 141
8d8k-assembly1.cif.gz_I yeast mitochondrial small subunit assembly intermediate (state 2) 0.9748 29 140
8d8l-assembly1.cif.gz_I yeast mitochondrial small subunit assembly intermediate (state 3) 0.9737 29 140
5mrf-assembly1.cif.gz_II structure of the yeast mitochondrial ribosome - class c 0.9698 29 140
ID Description Score Start End Superfamily
af_Q7XAM9_269_415_3.30.230.10 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.9964 29 140 3.30.230.10
af_O14006_146_271_3.30.230.10 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.9898 38 140 3.30.230.10
af_O94150_208_336_3.30.230.10 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.9872 36 140 3.30.230.10
af_Q54CK4_214_339_3.30.230.10 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.9867 38 140 3.30.230.10
af_Q8IHZ4_170_300_3.30.230.10 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.9715 37 140 3.30.230.10
ID Description Score Start End GO Terms
AF-D8QWR9-F1-model_v4 30S ribosomal protein S9, chloroplastic 0.9994 28 140 GO:0003723
GO:0003735
GO:0006412
GO:0022627
AF-A0A6D2KP69-F1-model_v4 30S ribosomal protein S9, chloroplastic 0.9979 28 140 GO:0003723
GO:0003735
GO:0006412
GO:0022627
AF-A0A7J6WZV8-F1-model_v4 30S ribosomal protein S9 protein 0.9978 28 140 GO:0003723
GO:0003735
GO:0006412
GO:0022627
AF-A0A6D2JVG9-F1-model_v4 30S ribosomal protein S9 0.9967 28 140 GO:0003723
GO:0003735
GO:0006412
GO:0022627
AF-A0A0G4AM87-F1-model_v4 Ribosomal protein S5 domain 2-like superfamily protein 0.9966 28 140 GO:0003723
GO:0003735
GO:0006412
GO:0022627

Feature Viewer

pLDDT pTM Quality
77.95 0.68 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map