F490435

General Info

Members Datasets Scaffolds Average Seq Length
1123 480 2246 140

Family's Representative Sequence

Representative Sequence 3300031090|Ga0265760_10241846|Ga0265760_102418462
Length 155
Sequence MTRTLSGGLSRKDEAMNYWLIKSEPDEWSWDEQVKKGAKGEAWTGVRNHAAKLNLTKMKKGDRAFFYHSGDAKAVVGIAEIIRESYPDPTAAAGEPWVAVDVKALRPLKTPVPLAAIKAEPALKDMTLIKQSRLSVQPVAAAEWNIVCEMGGVAP

Samples

Sample ID Description Type Environment
1 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
2 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
3 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
4 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
5 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
6 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
7 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
8 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
9 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
10 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
11 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
12 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
13 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
14 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
15 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
16 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
17 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
18 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
19 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
20 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
21 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
22 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
23 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
24 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
25 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
26 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
27 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
28 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
29 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
30 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
31 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
32 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
33 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
34 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
35 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
36 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
37 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
38 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
39 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
40 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
41 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
42 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
43 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
44 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
45 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
46 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
47 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
48 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
49 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
50 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
51 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
52 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
53 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
54 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
55 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
56 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
57 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
58 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
59 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
60 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
61 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
62 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
63 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
64 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
65 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
66 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
67 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
68 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
69 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
70 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
71 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
72 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
73 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
74 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
75 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
76 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
77 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
78 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
79 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
80 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
81 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
82 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
83 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
84 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
85 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
86 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
87 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
88 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
89 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
90 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
91 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
92 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
93 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
94 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
95 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
96 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
97 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
98 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
99 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
100 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
101 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
102 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
103 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
104 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
105 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
106 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
107 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
108 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
109 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
110 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
111 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
112 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
113 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
114 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
115 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
116 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
117 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
118 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
119 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
120 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
121 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
122 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
123 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
124 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
125 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
126 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
127 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
128 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
129 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
130 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
131 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
132 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
133 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
134 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
135 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
136 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
137 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
138 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
139 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
140 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
141 3300012485 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 Metagenome Rhizosphere
142 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
143 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
144 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
145 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
146 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
147 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
148 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
149 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
150 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
151 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
152 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
153 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
154 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
155 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
156 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
157 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
158 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
159 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
160 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
161 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
162 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
163 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
164 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
223 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
227 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
228 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
229 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
230 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
231 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
232 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
233 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
234 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
235 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
236 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
237 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
238 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
239 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
240 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
241 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
242 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
243 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
244 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
245 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
246 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
247 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
248 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
249 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
250 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
251 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
252 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
253 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
254 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
255 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
256 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
257 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
258 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
259 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
260 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
261 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
262 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
263 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
264 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
265 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
266 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
267 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
268 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
269 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
270 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
271 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
272 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
273 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
274 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
275 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
276 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
277 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
278 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
279 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
280 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
281 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
282 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
283 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
284 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
285 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
286 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
287 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
288 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
289 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
290 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
291 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
292 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
293 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
294 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
295 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
296 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
297 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
298 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
299 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
300 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
301 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
302 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
303 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
304 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
305 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
306 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
307 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
308 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
309 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
310 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
311 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
312 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
313 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
314 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
315 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
316 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
317 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
318 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
319 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
320 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
321 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
322 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
323 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
324 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
325 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
326 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
327 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
328 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
329 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
330 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
331 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
332 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
333 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
334 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
335 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
336 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
337 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
338 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
339 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
340 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
341 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
342 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
343 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
344 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
345 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
346 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
347 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
348 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
349 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
350 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
351 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
352 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
353 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
354 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
355 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
356 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
357 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
358 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
359 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
360 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
361 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
362 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
363 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
364 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
365 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
366 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
367 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
368 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
369 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
370 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
371 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
372 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
373 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
374 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
375 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
376 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
377 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
378 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
379 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
380 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
381 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
382 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
383 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
384 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
385 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
386 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
387 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
388 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
389 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
390 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
391 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
392 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
393 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
394 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
395 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
396 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
397 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
398 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
399 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
400 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
401 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
402 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
403 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
404 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
405 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
406 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
407 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
408 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
409 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
410 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
411 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
412 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
413 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
414 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
415 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
416 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
417 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
418 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
419 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
420 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
421 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
422 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
423 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
424 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
425 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
426 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
427 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
428 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
429 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
430 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
431 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
432 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
433 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
434 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
435 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
436 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
437 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
438 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
439 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
440 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
441 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
442 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
443 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
444 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
445 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
446 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
447 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
448 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
449 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
450 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
451 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
452 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
453 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
454 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
455 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
456 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
457 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
458 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
459 3300053144 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere Metagenome Endosphere
460 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
461 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
462 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
463 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
464 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
465 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
466 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
467 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
468 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
469 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
470 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
471 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
472 3300053728 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere Metagenome Endosphere
473 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
474 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
475 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
476 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
477 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
478 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
479 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
480 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.82
Metatranscriptomes 0.09
Isolates 0.09

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.6
Nodule 0.09
Rhizoplane 8.19
Rhizosphere 78.72
Stem 0
Stem Tuber 0
Unclassified 0.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265760_10241846 3300031090 Bacteria 622
2 CNAas_1013010 3300000532 Bacteria 573
3 JGI24752J21851_1037180 3300001976 Bacteria 648
4 JGI24746J21847_1007740 3300001977 Bacteria 1635
5 JGI24740J21852_10008188 3300001979 Bacteria 4190
6 JGI24739J22299_10012966 3300001989 Bacteria 3051
7 JGI24739J22299_10097796 3300001989 Bacteria 888
8 JGI24737J22298_10014869 3300001990 Bacteria 2523
9 JGI24737J22298_10061764 3300001990 Bacteria 1127
10 JGI24737J22298_10218200 3300001990 Bacteria 563
11 JGI24743J22301_10003449 3300001991 Bacteria 2503
12 JGI24735J21928_10013060 3300002067 Bacteria 2617
13 JGI24735J21928_10227937 3300002067 Bacteria 542
14 JGI24745J21846_1012529 3300002073 Bacteria 974
15 JGI24748J21848_1021502 3300002074 Bacteria 779
16 JGI24738J21930_10009183 3300002075 Bacteria 2233
17 JGI24744J21845_10008835 3300002077 Bacteria 2071
18 JGI24034J26672_10008736 3300002239 Bacteria 1484
19 JGI24742J22300_10004694 3300002244 Bacteria 2240
20 JGI24742J22300_10127762 3300002244 Bacteria 505
21 JGI24751J29686_10009152 3300002459 Bacteria 2034
22 JGI25406J46586_10010512 3300003203 Bacteria 4103
23 JGI25153J46596_10001794 3300003215 Bacteria 12730
24 JGI25153J46596_10003400 3300003215 Bacteria 8917
25 JGI25153J46596_10017127 3300003215 Bacteria 2868
26 JGI25160J50197_1000637 3300003354 Bacteria 19539
27 JGI25404J52841_10031981 3300003659 Bacteria 1123
28 JGI25404J52841_10076848 3300003659 Bacteria 698
29 Ga0055542_1006432 3300003762 Bacteria 2512
30 Ga0055531_10003548 3300003794 Bacteria 9902
31 Ga0065165_1006072 3300005262 Bacteria 6478
32 Ga0070658_10117842 3300005327 Bacteria 2205
33 Ga0070658_10416646 3300005327 Bacteria 1155
34 Ga0070658_10417437 3300005327 Bacteria 1154
35 Ga0070658_10604597 3300005327 Bacteria 950
36 Ga0070676_10102730 3300005328 Bacteria 1768
37 Ga0070683_100078412 3300005329 Bacteria 3090
38 Ga0070683_101715162 3300005329 Bacteria 604
39 Ga0070690_100174655 3300005330 Bacteria 1481
40 Ga0070670_100022928 3300005331 Bacteria 5371
41 Ga0068869_100174441 3300005334 Bacteria 1681
42 Ga0068869_100323900 3300005334 Bacteria 1250
43 Ga0068869_100352170 3300005334 Bacteria 1200
44 Ga0068869_100546414 3300005334 Bacteria 972
45 Ga0068869_100561921 3300005334 Bacteria 960
46 Ga0068869_100695333 3300005334 Bacteria 867
47 Ga0070666_10048402 3300005335 Bacteria 2856
48 Ga0070666_10092363 3300005335 Bacteria 2081
49 Ga0070666_10283664 3300005335 Bacteria 1178
50 Ga0070680_100036206 3300005336 Bacteria 3987
51 Ga0070680_100079277 3300005336 Bacteria 2707
52 Ga0070680_100081834 3300005336 Bacteria 2664
53 Ga0070682_100138504 3300005337 Bacteria 1656
54 Ga0068868_100122141 3300005338 Bacteria 2125
55 Ga0068868_100126614 3300005338 Bacteria 2087
56 Ga0068868_100236152 3300005338 Bacteria 1535
57 Ga0070660_100057379 3300005339 Bacteria 3016
58 Ga0070660_101217273 3300005339 Bacteria 638
59 Ga0070689_100121032 3300005340 Bacteria 2090
60 Ga0070687_100047817 3300005343 Bacteria 2196
61 Ga0070687_100360879 3300005343 Bacteria 941
62 Ga0070687_100459414 3300005343 Bacteria 849
63 Ga0070661_100064133 3300005344 Bacteria 2699
64 Ga0070661_100092123 3300005344 Bacteria 2245
65 Ga0070661_100105611 3300005344 Bacteria 2099
66 Ga0070692_10008328 3300005345 Bacteria 4621
67 Ga0070692_10841909 3300005345 Bacteria 630
68 Ga0070668_100185039 3300005347 Bacteria 1703
69 Ga0070668_100342398 3300005347 Bacteria 1263
70 Ga0070668_100917719 3300005347 Bacteria 783
71 Ga0070668_101281948 3300005347 Bacteria 665
72 Ga0070669_100044960 3300005353 Bacteria 3217
73 Ga0070669_100200855 3300005353 Bacteria 1568
74 Ga0070669_100277279 3300005353 Bacteria 1342
75 Ga0070675_100157585 3300005354 Bacteria 1950
76 Ga0070675_100319304 3300005354 Bacteria 1372
77 Ga0070675_101157347 3300005354 Bacteria 712
78 Ga0070671_100177528 3300005355 Bacteria 1802
79 Ga0070671_100358790 3300005355 Bacteria 1244
80 Ga0070671_101139461 3300005355 Bacteria 686
81 Ga0070674_100048372 3300005356 Bacteria 2918
82 Ga0070674_100229619 3300005356 Bacteria 1447
83 Ga0070673_100020132 3300005364 Bacteria 4806
84 Ga0070673_100238301 3300005364 Bacteria 1581
85 Ga0070673_100239350 3300005364 Bacteria 1577
86 Ga0070673_100305996 3300005364 Bacteria 1401
87 Ga0070688_100103583 3300005365 Bacteria 1880
88 Ga0070688_100505815 3300005365 Bacteria 912
89 Ga0070659_100059804 3300005366 Bacteria 3009
90 Ga0070659_100081376 3300005366 Bacteria 2586
91 Ga0070659_100129499 3300005366 Bacteria 2048
92 Ga0070659_100265147 3300005366 Bacteria 1426
93 Ga0070659_100464130 3300005366 Bacteria 1076
94 Ga0070659_102068338 3300005366 Bacteria 512
95 Ga0070667_100129610 3300005367 Bacteria 2200
96 Ga0070667_100642243 3300005367 Bacteria 980
97 Ga0070667_100691026 3300005367 Bacteria 944
98 Ga0070703_10460910 3300005406 Bacteria 565
99 Ga0070709_10284606 3300005434 Bacteria 1203
100 Ga0070714_100032110 3300005435 Bacteria 4383
101 Ga0070714_100037170 3300005435 Bacteria 4090
102 Ga0070714_100159680 3300005435 Bacteria 2038
103 Ga0070713_100004163 3300005436 Bacteria 9651
104 Ga0070713_100007601 3300005436 Bacteria 7624
105 Ga0070713_100781616 3300005436 Bacteria 914
106 Ga0070713_101560952 3300005436 Bacteria 641
107 Ga0070710_10022655 3300005437 Bacteria 3289
108 Ga0070710_10087876 3300005437 Bacteria 1828
109 Ga0070701_10020704 3300005438 Bacteria 3126
110 Ga0070701_10236501 3300005438 Bacteria 1096
111 Ga0070711_100068928 3300005439 Bacteria 2487
112 Ga0070705_101183392 3300005440 Bacteria 629
113 Ga0070700_100780293 3300005441 Bacteria 767
114 Ga0070694_100117481 3300005444 Bacteria 1904
115 Ga0070694_100312673 3300005444 Bacteria 1207
116 Ga0070708_100044164 3300005445 Bacteria 3918
117 Ga0070708_100332426 3300005445 Bacteria 1432
118 Ga0070663_100000390 3300005455 Bacteria 23042
119 Ga0070663_100051319 3300005455 Bacteria 2938
120 Ga0070663_100119574 3300005455 Bacteria 1988
121 Ga0070663_100172773 3300005455 Bacteria 1671
122 Ga0070663_100273932 3300005455 Bacteria 1343
123 Ga0070663_100727487 3300005455 Bacteria 845
124 Ga0070663_100909469 3300005455 Bacteria 761
125 Ga0070678_100153173 3300005456 Bacteria 1859
126 Ga0070678_100192751 3300005456 Bacteria 1677
127 Ga0070678_101158396 3300005456 Bacteria 716
128 Ga0070662_100019835 3300005457 Bacteria 4572
129 Ga0070662_100043591 3300005457 Bacteria 3211
130 Ga0070662_100112110 3300005457 Bacteria 2079
131 Ga0070662_100734439 3300005457 Bacteria 837
132 Ga0070662_100849031 3300005457 Bacteria 777
133 Ga0070681_10057038 3300005458 Bacteria 3886
134 Ga0070681_10126809 3300005458 Bacteria 2485
135 Ga0070681_10574922 3300005458 Bacteria 1041
136 Ga0070681_10591517 3300005458 Bacteria 1024
137 Ga0070681_11696140 3300005458 Bacteria 558
138 Ga0068867_100049285 3300005459 Bacteria 3100
139 Ga0070685_10019816 3300005466 Bacteria 3634
140 Ga0070685_10123159 3300005466 Bacteria 1612
141 Ga0070706_100281879 3300005467 Bacteria 1551
142 Ga0070706_100354838 3300005467 Bacteria 1367
143 Ga0070706_100423696 3300005467 Bacteria 1239
144 Ga0070707_100420648 3300005468 Bacteria 1297
145 Ga0070698_100584773 3300005471 Bacteria 1057
146 Ga0070698_101359983 3300005471 Bacteria 661
147 Ga0070679_100269221 3300005530 Bacteria 1658
148 Ga0070679_100318853 3300005530 Bacteria 1504
149 Ga0070679_100350704 3300005530 Bacteria 1423
150 Ga0070679_101222878 3300005530 Bacteria 696
151 Ga0070684_100020670 3300005535 Bacteria 5460
152 Ga0070684_100169847 3300005535 Bacteria 1981
153 Ga0070684_100299115 3300005535 Bacteria 1476
154 Ga0070684_101242924 3300005535 Bacteria 701
155 Ga0070697_101102060 3300005536 Bacteria 707
156 Ga0070697_101201380 3300005536 Bacteria 676
157 Ga0070697_101518744 3300005536 Bacteria 599
158 Ga0068853_100008484 3300005539 Bacteria 8258
159 Ga0068853_100035637 3300005539 Bacteria 4227
160 Ga0068853_100053014 3300005539 Bacteria 3493
161 Ga0068853_100129437 3300005539 Bacteria 2258
162 Ga0068853_100205522 3300005539 Bacteria 1793
163 Ga0068853_100352310 3300005539 Bacteria 1370
164 Ga0068853_100631056 3300005539 Bacteria 1019
165 Ga0068853_101113213 3300005539 Bacteria 762
166 Ga0068853_101628401 3300005539 Bacteria 626
167 Ga0070672_100111875 3300005543 Bacteria 2226
168 Ga0070672_100220324 3300005543 Bacteria 1591
169 Ga0070686_100934175 3300005544 Bacteria 708
170 Ga0070696_100547642 3300005546 Bacteria 927
171 Ga0070693_100243196 3300005547 Bacteria 1189
172 Ga0070693_100445517 3300005547 Bacteria 908
173 Ga0070665_100034600 3300005548 Bacteria 5080
174 Ga0070665_100070182 3300005548 Bacteria 3510
175 Ga0070665_100099991 3300005548 Bacteria 2904
176 Ga0070665_100453895 3300005548 Bacteria 1291
177 Ga0070665_100583583 3300005548 Bacteria 1131
178 Ga0070665_100648573 3300005548 Bacteria 1069
179 Ga0070665_101464312 3300005548 Bacteria 692
180 Ga0070665_102319135 3300005548 Bacteria 540
181 Ga0070704_101364748 3300005549 Bacteria 650
182 Ga0070704_101714060 3300005549 Bacteria 581
183 Ga0068855_100015566 3300005563 Bacteria 9156
184 Ga0068855_100026840 3300005563 Bacteria 6890
185 Ga0068855_100071356 3300005563 Bacteria 4039
186 Ga0068855_100075682 3300005563 Bacteria 3908
187 Ga0068855_100085754 3300005563 Bacteria 3643
188 Ga0068855_100086762 3300005563 Bacteria 3619
189 Ga0068855_100484466 3300005563 Bacteria 1346
190 Ga0068855_101525264 3300005563 Bacteria 686
191 Ga0070664_100049823 3300005564 Bacteria 3543
192 Ga0070664_100197720 3300005564 Bacteria 1793
193 Ga0070664_100463433 3300005564 Bacteria 1165
194 Ga0068857_100005885 3300005577 Bacteria 10469
195 Ga0068857_100061209 3300005577 Bacteria 3344
196 Ga0068857_100132994 3300005577 Bacteria 2244
197 Ga0068857_100258828 3300005577 Bacteria 1597
198 Ga0068857_101110926 3300005577 Bacteria 764
199 Ga0068854_100023935 3300005578 Bacteria 4175
200 Ga0068854_100149164 3300005578 Bacteria 1801
201 Ga0068854_100347019 3300005578 Bacteria 1214
202 Ga0068854_100383622 3300005578 Bacteria 1159
203 Ga0068854_100401955 3300005578 Bacteria 1134
204 Ga0068856_100000540 3300005614 Bacteria 41724
205 Ga0068856_100002838 3300005614 Bacteria 17741
206 Ga0068856_100053053 3300005614 Bacteria 3999
207 Ga0068856_100315921 3300005614 Bacteria 1579
208 Ga0068856_100610526 3300005614 Bacteria 1112
209 Ga0068856_100752269 3300005614 Bacteria 995
210 Ga0068856_101022428 3300005614 Bacteria 845
211 Ga0068856_101326615 3300005614 Bacteria 735
212 Ga0068856_101399763 3300005614 Bacteria 714
213 Ga0070702_100004385 3300005615 Bacteria 6436
214 Ga0070702_100190350 3300005615 Bacteria 1350
215 Ga0070702_100258417 3300005615 Bacteria 1184
216 Ga0068852_100045965 3300005616 Bacteria 3717
217 Ga0068852_100055665 3300005616 Bacteria 3415
218 Ga0068852_100057576 3300005616 Bacteria 3363
219 Ga0068852_100886970 3300005616 Bacteria 909
220 Ga0068852_102732341 3300005616 Bacteria 513
221 Ga0068859_100114760 3300005617 Bacteria 2757
222 Ga0068859_100132013 3300005617 Bacteria 2569
223 Ga0068859_100195380 3300005617 Bacteria 2107
224 Ga0068859_100903732 3300005617 Bacteria 968
225 Ga0068864_100153414 3300005618 Bacteria 2089
226 Ga0068864_100282489 3300005618 Bacteria 1550
227 Ga0068864_100336322 3300005618 Bacteria 1422
228 Ga0068864_100417579 3300005618 Bacteria 1278
229 Ga0068864_100489738 3300005618 Bacteria 1181
230 Ga0068864_101208463 3300005618 Bacteria 755
231 Ga0068866_10013973 3300005718 Bacteria 3534
232 Ga0068866_10593176 3300005718 Bacteria 747
233 Ga0068861_100051907 3300005719 Bacteria 3115
234 Ga0068861_100065730 3300005719 Bacteria 2794
235 Ga0068861_100074223 3300005719 Bacteria 2644
236 Ga0068861_100932105 3300005719 Bacteria 825
237 Ga0068861_101310122 3300005719 Bacteria 704
238 Ga0068851_10016425 3300005834 Bacteria 3542
239 Ga0068851_10018742 3300005834 Bacteria 3338
240 Ga0068851_10616450 3300005834 Bacteria 662
241 Ga0068870_10009759 3300005840 Bacteria 4378
242 Ga0068863_100014599 3300005841 Bacteria 7561
243 Ga0068858_100080996 3300005842 Bacteria 3017
244 Ga0068858_100095472 3300005842 Bacteria 2770
245 Ga0068858_100386437 3300005842 Bacteria 1343
246 Ga0068858_100504087 3300005842 Bacteria 1169
247 Ga0068860_100034650 3300005843 Bacteria 4843
248 Ga0068860_100201973 3300005843 Bacteria 1926
249 Ga0068860_100489257 3300005843 Bacteria 1227
250 Ga0068860_102451407 3300005843 Bacteria 541
251 Ga0068862_100163647 3300005844 Bacteria 1987
252 Ga0068862_100301407 3300005844 Bacteria 1474
253 Ga0068862_100330454 3300005844 Bacteria 1409
254 Ga0068862_100584070 3300005844 Bacteria 1071
255 Ga0081455_10033436 3300005937 Bacteria 4621
256 Ga0081455_10159792 3300005937 Bacteria 1729
257 Ga0081455_10160083 3300005937 Bacteria 1727
258 Ga0081540_1000226 3300005983 Bacteria 59126
259 Ga0081540_1008954 3300005983 Bacteria 6930
260 Ga0081540_1011883 3300005983 Bacteria 5780
261 Ga0081540_1016330 3300005983 Bacteria 4651
262 Ga0081540_1061348 3300005983 Bacteria 1793
263 Ga0081540_1206256 3300005983 Bacteria 710
264 Ga0081539_10000054 3300005985 Bacteria 259053
265 Ga0081539_10094905 3300005985 Bacteria 1533
266 Ga0081539_10449275 3300005985 Bacteria 534
267 Ga0070717_10021810 3300006028 Bacteria 5052
268 Ga0070717_10030807 3300006028 Bacteria 4311
269 Ga0070717_10032547 3300006028 Bacteria 4202
270 Ga0070717_10236196 3300006028 Bacteria 1611
271 Ga0070717_10388888 3300006028 Bacteria 1251
272 Ga0075365_10082696 3300006038 Bacteria 2177
273 Ga0075365_10088454 3300006038 Bacteria 2107
274 Ga0075365_10121175 3300006038 Bacteria 1804
275 Ga0075365_10138683 3300006038 Bacteria 1687
276 Ga0075365_10279448 3300006038 Bacteria 1175
277 Ga0075365_10465996 3300006038 Bacteria 892
278 Ga0075368_10031061 3300006042 Bacteria 2070
279 Ga0075368_10132741 3300006042 Bacteria 1035
280 Ga0075363_100001175 3300006048 Bacteria 9625
281 Ga0075363_100021411 3300006048 Bacteria 3256
282 Ga0075363_100228424 3300006048 Bacteria 1068
283 Ga0075363_100231169 3300006048 Bacteria 1061
284 Ga0075363_100314995 3300006048 Bacteria 910
285 Ga0075364_10021143 3300006051 Bacteria 4098
286 Ga0075364_10076192 3300006051 Bacteria 2213
287 Ga0075364_10128842 3300006051 Bacteria 1698
288 Ga0075364_10130025 3300006051 Bacteria 1689
289 Ga0075364_10567302 3300006051 Bacteria 776
290 Ga0075432_10280232 3300006058 Bacteria 686
291 Ga0070715_10229257 3300006163 Bacteria 959
292 Ga0070715_10873030 3300006163 Bacteria 552
293 Ga0070716_100281178 3300006173 Bacteria 1148
294 Ga0070712_100006234 3300006175 Bacteria 7384
295 Ga0070712_100216908 3300006175 Bacteria 1512
296 Ga0070712_100498281 3300006175 Bacteria 1021
297 Ga0075362_10059764 3300006177 Bacteria 1722
298 Ga0075362_10175889 3300006177 Bacteria 1036
299 Ga0075362_10391950 3300006177 Bacteria 700
300 Ga0075367_10018489 3300006178 Bacteria 3846
301 Ga0075367_10029364 3300006178 Bacteria 3144
302 Ga0075367_10034701 3300006178 Bacteria 2916
303 Ga0075367_10104683 3300006178 Bacteria 1732
304 Ga0075367_10235189 3300006178 Bacteria 1147
305 Ga0075367_10335108 3300006178 Bacteria 954
306 Ga0075367_10586030 3300006178 Bacteria 708
307 Ga0075369_10075317 3300006186 Bacteria 1490
308 Ga0075369_10141148 3300006186 Bacteria 1098
309 Ga0075369_10509141 3300006186 Bacteria 572
310 Ga0075366_10028742 3300006195 Bacteria 3264
311 Ga0075366_10200189 3300006195 Bacteria 1215
312 Ga0075366_10537363 3300006195 Bacteria 723
313 Ga0097621_100043261 3300006237 Bacteria 3631
314 Ga0097621_100165866 3300006237 Bacteria 1901
315 Ga0097621_100266595 3300006237 Bacteria 1504
316 Ga0097621_100760390 3300006237 Bacteria 895
317 Ga0097621_100772304 3300006237 Bacteria 889
318 Ga0097621_101126224 3300006237 Bacteria 737
319 Ga0075370_10051075 3300006353 Bacteria 2345
320 Ga0075370_10085391 3300006353 Bacteria 1817
321 Ga0075370_10095713 3300006353 Bacteria 1715
322 Ga0075370_10150554 3300006353 Bacteria 1363
323 Ga0075370_10482006 3300006353 Bacteria 748
324 Ga0075370_10546144 3300006353 Bacteria 701
325 Ga0068871_100005696 3300006358 Bacteria 8741
326 Ga0068871_100063845 3300006358 Bacteria 3013
327 Ga0068871_100108045 3300006358 Bacteria 2338
328 Ga0068871_100591251 3300006358 Bacteria 1009
329 Ga0075428_100518596 3300006844 Bacteria 1275
330 Ga0075428_100627076 3300006844 Bacteria 1147
331 Ga0075433_11109792 3300006852 Bacteria 688
332 Ga0075434_100074388 3300006871 Bacteria 3391
333 Ga0075434_100138054 3300006871 Bacteria 2457
334 Ga0075429_101691432 3300006880 Bacteria 550
335 Ga0068865_100008652 3300006881 Bacteria 6297
336 Ga0068865_100023723 3300006881 Bacteria 4020
337 Ga0075436_100023569 3300006914 Bacteria 4227
338 Ga0075436_100075545 3300006914 Bacteria 2333
339 Ga0097620_100114757 3300006931 Bacteria 2757
340 Ga0097620_100132013 3300006931 Bacteria 2569
341 Ga0097620_100195374 3300006931 Bacteria 2107
342 Ga0097620_100903735 3300006931 Bacteria 968
343 Ga0099822_1000007 3300006943 Bacteria 77453
344 Ga0075435_100168192 3300007076 Bacteria 1849
345 Ga0075435_100522936 3300007076 Bacteria 1026
346 Ga0075435_100570204 3300007076 Bacteria 981
347 Ga0099794_10125143 3300007265 Bacteria 1296
348 Ga0099795_10092951 3300007788 Bacteria 1172
349 Ga0099795_10142348 3300007788 Bacteria 976
350 Ga0099795_10482562 3300007788 Bacteria 575
351 Ga0105251_10318982 3300009011 Bacteria 706
352 Ga0105250_10059442 3300009092 Bacteria 1535
353 Ga0105250_10074367 3300009092 Bacteria 1374
354 Ga0105250_10268584 3300009092 Bacteria 732
355 Ga0105240_10004777 3300009093 Bacteria 20435
356 Ga0105240_10203984 3300009093 Bacteria 2315
357 Ga0105240_10323334 3300009093 Bacteria 1757
358 Ga0105240_10453995 3300009093 Bacteria 1433
359 Ga0105240_12169827 3300009093 Bacteria 576
360 Ga0111539_10461434 3300009094 Bacteria 1479
361 Ga0111539_10835904 3300009094 Bacteria 1071
362 Ga0111539_10865059 3300009094 Bacteria 1052
363 Ga0111539_11218869 3300009094 Bacteria 874
364 Ga0105245_10049805 3300009098 Bacteria 3752
365 Ga0105245_10077904 3300009098 Bacteria 3024
366 Ga0105245_11915252 3300009098 Bacteria 646
367 Ga0105247_10014823 3300009101 Bacteria 4672
368 Ga0105247_10236977 3300009101 Bacteria 1242
369 Ga0105243_10045003 3300009148 Bacteria 3466
370 Ga0105243_10459756 3300009148 Bacteria 1196
371 Ga0105243_10592332 3300009148 Bacteria 1066
372 Ga0105243_10593219 3300009148 Bacteria 1065
373 Ga0105243_10859537 3300009148 Bacteria 899
374 Ga0105243_11391429 3300009148 Bacteria 722
375 Ga0105243_11486870 3300009148 Bacteria 701
376 Ga0105241_10001668 3300009174 Bacteria 16913
377 Ga0105241_10066888 3300009174 Bacteria 2780
378 Ga0105241_12481382 3300009174 Bacteria 519
379 Ga0105242_10054126 3300009176 Bacteria 3279
380 Ga0105242_10183943 3300009176 Bacteria 1845
381 Ga0105242_10711546 3300009176 Bacteria 984
382 Ga0105242_10856801 3300009176 Bacteria 905
383 Ga0105242_11273578 3300009176 Bacteria 758
384 Ga0105242_11979654 3300009176 Bacteria 624
385 Ga0105248_10073743 3300009177 Bacteria 3835
386 Ga0105248_10213554 3300009177 Bacteria 2174
387 Ga0105248_10290977 3300009177 Bacteria 1839
388 Ga0105248_10442965 3300009177 Bacteria 1463
389 Ga0105248_10993358 3300009177 Bacteria 948
390 Ga0105248_11732606 3300009177 Bacteria 708
391 Ga0105237_10055980 3300009545 Bacteria 3949
392 Ga0105237_10082006 3300009545 Bacteria 3216
393 Ga0105237_10097292 3300009545 Bacteria 2933
394 Ga0105237_10147318 3300009545 Bacteria 2349
395 Ga0105237_10227915 3300009545 Bacteria 1864
396 Ga0105237_10322464 3300009545 Bacteria 1549
397 Ga0105237_11921762 3300009545 Bacteria 600
398 Ga0105238_10014953 3300009551 Bacteria 7857
399 Ga0105238_10099738 3300009551 Bacteria 2887
400 Ga0105238_10222970 3300009551 Bacteria 1862
401 Ga0105238_10631965 3300009551 Bacteria 1080
402 Ga0105238_11032636 3300009551 Bacteria 843
403 Ga0105249_10131509 3300009553 Bacteria 2390
404 Ga0105249_10433158 3300009553 Bacteria 1351
405 Ga0105249_10669967 3300009553 Bacteria 1096
406 Ga0105249_11695592 3300009553 Bacteria 704
407 Ga0099796_10026202 3300010159 Bacteria 1849
408 Ga0099796_10201584 3300010159 Bacteria 807
409 Ga0099796_10555306 3300010159 Bacteria 516
410 Ga0105239_10010140 3300010375 Bacteria 10557
411 Ga0105239_10037953 3300010375 Bacteria 5279
412 Ga0105239_10074495 3300010375 Bacteria 3732
413 Ga0105239_10088979 3300010375 Bacteria 3405
414 Ga0105239_10141480 3300010375 Bacteria 2681
415 Ga0105239_10481151 3300010375 Bacteria 1410
416 Ga0105239_10546169 3300010375 Bacteria 1319
417 Ga0105239_11145197 3300010375 Bacteria 896
418 Ga0105239_11487593 3300010375 Bacteria 782
419 Ga0105239_11510556 3300010375 Bacteria 776
420 Ga0105246_10070084 3300011119 Bacteria 2465
421 Ga0105246_10087607 3300011119 Bacteria 2235
422 Ga0105246_10142482 3300011119 Bacteria 1804
423 Ga0105246_10424036 3300011119 Bacteria 1111
424 Ga0105246_10774509 3300011119 Bacteria 849
425 Ga0105246_11004017 3300011119 Bacteria 756
426 Ga0105246_11864726 3300011119 Bacteria 576
427 Ga0157325_1021928 3300012485 Bacteria 577
428 Ga0157327_1071583 3300012512 Bacteria 539
429 Ga0157338_1034444 3300012515 Bacteria 662
430 Ga0157373_10341982 3300013100 Bacteria 1066
431 Ga0157371_10285937 3300013102 Bacteria 1192
432 Ga0157371_10529918 3300013102 Bacteria 872
433 Ga0157371_11347050 3300013102 Bacteria 553
434 Ga0157370_10185294 3300013104 Bacteria 1933
435 Ga0157370_10827247 3300013104 Bacteria 842
436 Ga0157370_11144423 3300013104 Bacteria 703
437 Ga0157369_10014138 3300013105 Bacteria 9020
438 Ga0157369_10195530 3300013105 Bacteria 2124
439 Ga0157369_11356885 3300013105 Bacteria 724
440 Ga0157374_10041871 3300013296 Bacteria 4223
441 Ga0157374_10204370 3300013296 Bacteria 1935
442 Ga0157374_11060515 3300013296 Bacteria 830
443 Ga0157378_10054515 3300013297 Bacteria 3560
444 Ga0157378_10240608 3300013297 Bacteria 1729
445 Ga0157378_10359629 3300013297 Bacteria 1424
446 Ga0157378_11279026 3300013297 Bacteria 774
447 Ga0157378_12783084 3300013297 Bacteria 542
448 Ga0163162_10075871 3300013306 Bacteria 3423
449 Ga0163162_10095577 3300013306 Bacteria 3059
450 Ga0163162_10158844 3300013306 Bacteria 2382
451 Ga0163162_10163672 3300013306 Bacteria 2347
452 Ga0163162_10241018 3300013306 Bacteria 1939
453 Ga0163162_11152495 3300013306 Bacteria 879
454 Ga0163162_12383156 3300013306 Bacteria 608
455 Ga0163162_12667584 3300013306 Bacteria 575
456 Ga0157375_10027450 3300013308 Bacteria 5321
457 Ga0157375_10030809 3300013308 Bacteria 5063
458 Ga0157375_13222412 3300013308 Bacteria 544
459 Ga0163163_10045738 3300014325 Bacteria 4298
460 Ga0163163_10112616 3300014325 Bacteria 2750
461 Ga0163163_10165068 3300014325 Bacteria 2260
462 Ga0163163_10176913 3300014325 Bacteria 2180
463 Ga0163163_10220101 3300014325 Bacteria 1947
464 Ga0163163_10700621 3300014325 Bacteria 1076
465 Ga0157380_10100965 3300014326 Bacteria 2403
466 Ga0157380_10140433 3300014326 Bacteria 2074
467 Ga0157380_11306603 3300014326 Bacteria 773
468 Ga0157380_11605590 3300014326 Bacteria 706
469 Ga0182008_10112091 3300014497 Bacteria 1352
470 Ga0182008_10594934 3300014497 Bacteria 620
471 Ga0157377_10026678 3300014745 Bacteria 3094
472 Ga0157379_10035692 3300014968 Bacteria 4433
473 Ga0157379_10097690 3300014968 Bacteria 2637
474 Ga0157379_10221427 3300014968 Bacteria 1715
475 Ga0157379_10388347 3300014968 Bacteria 1282
476 Ga0157379_11008106 3300014968 Bacteria 794
477 Ga0157376_10363541 3300014969 Bacteria 1388
478 Ga0157376_10486973 3300014969 Bacteria 1210
479 Ga0157376_10500479 3300014969 Bacteria 1194
480 Ga0157376_10536764 3300014969 Bacteria 1155
481 Ga0157376_10929138 3300014969 Bacteria 889
482 Ga0163161_10032435 3300017792 Bacteria 3729
483 Ga0213876_10013147 3300021384 Bacteria 4398
484 Ga0213876_10213805 3300021384 Bacteria 1025
485 Ga0209148_1000504 3300025254 Bacteria 39653
486 Ga0209233_1011700 3300025261 Bacteria 2577
487 Ga0209455_1000957 3300025272 Bacteria 14712
488 Ga0209758_1101841 3300025297 Bacteria 815
489 Ga0207696_1046717 3300025711 Bacteria 1249
490 Ga0207692_10036883 3300025898 Bacteria 2387
491 Ga0207642_10025377 3300025899 Bacteria 2397
492 Ga0207710_10011162 3300025900 Bacteria 3782
493 Ga0207710_10024285 3300025900 Bacteria 2609
494 Ga0207710_10237901 3300025900 Bacteria 908
495 Ga0207710_10548774 3300025900 Bacteria 602
496 Ga0207688_10003770 3300025901 Bacteria 8264
497 Ga0207688_10008498 3300025901 Bacteria 5588
498 Ga0207680_10465374 3300025903 Bacteria 898
499 Ga0207647_10038424 3300025904 Bacteria 3027
500 Ga0207685_10239883 3300025905 Bacteria 872
501 Ga0207699_10230522 3300025906 Bacteria 1268
502 Ga0207645_10026653 3300025907 Bacteria 3734
503 Ga0207643_10003440 3300025908 Bacteria 8518
504 Ga0207684_10122380 3300025910 Bacteria 2231
505 Ga0207654_10621225 3300025911 Bacteria 772
506 Ga0207671_10183846 3300025914 Bacteria 1628
507 Ga0207663_10051550 3300025916 Bacteria 2563
508 Ga0207660_11525698 3300025917 Bacteria 539
509 Ga0207662_10005321 3300025918 Bacteria 6844
510 Ga0207662_10428799 3300025918 Bacteria 901
511 Ga0207662_11046115 3300025918 Bacteria 580
512 Ga0207657_10011703 3300025919 Bacteria 8694
513 Ga0207649_10255306 3300025920 Bacteria 1264
514 Ga0207652_10336843 3300025921 Bacteria 1362
515 Ga0207652_10606328 3300025921 Bacteria 981
516 Ga0207681_10060281 3300025923 Bacteria 2604
517 Ga0207681_10278931 3300025923 Bacteria 1315
518 Ga0207681_10340820 3300025923 Bacteria 1197
519 Ga0207650_11299978 3300025925 Bacteria 619
520 Ga0207659_10816432 3300025926 Bacteria 801
521 Ga0207687_10012405 3300025927 Bacteria 5568
522 Ga0207687_10116027 3300025927 Bacteria 1995
523 Ga0207700_10119004 3300025928 Bacteria 2138
524 Ga0207700_10506006 3300025928 Bacteria 1069
525 Ga0207700_10834189 3300025928 Bacteria 825
526 Ga0207700_11476822 3300025928 Bacteria 603
527 Ga0207664_11125783 3300025929 Bacteria 701
528 Ga0207690_10362467 3300025932 Bacteria 1148
529 Ga0207706_10031230 3300025933 Bacteria 4746
530 Ga0207706_10052664 3300025933 Bacteria 3593
531 Ga0207706_10077157 3300025933 Bacteria 2930
532 Ga0207686_10008732 3300025934 Bacteria 5472
533 Ga0207709_10009837 3300025935 Bacteria 5268
534 Ga0207709_10012231 3300025935 Bacteria 4729
535 Ga0207670_10069596 3300025936 Bacteria 2428
536 Ga0207670_10070659 3300025936 Bacteria 2412
537 Ga0207669_10015382 3300025937 Bacteria 3857
538 Ga0207669_10019906 3300025937 Bacteria 3505
539 Ga0207669_10464773 3300025937 Bacteria 1005
540 Ga0207704_10024549 3300025938 Bacteria 3272
541 Ga0207704_10268556 3300025938 Bacteria 1290
542 Ga0207665_10076725 3300025939 Bacteria 2292
543 Ga0207691_10022632 3300025940 Bacteria 5926
544 Ga0207711_10220109 3300025941 Bacteria 1736
545 Ga0207689_10065770 3300025942 Bacteria 2982
546 Ga0207689_10291065 3300025942 Bacteria 1353
547 Ga0207689_10342874 3300025942 Bacteria 1241
548 Ga0207689_10612189 3300025942 Bacteria 917
549 Ga0207689_10802116 3300025942 Bacteria 795
550 Ga0207661_10109369 3300025944 Bacteria 2335
551 Ga0207679_10053114 3300025945 Bacteria 2976
552 Ga0207679_10327140 3300025945 Bacteria 1329
553 Ga0207667_10049467 3300025949 Bacteria 4439
554 Ga0207667_10836188 3300025949 Bacteria 915
555 Ga0207667_10919807 3300025949 Bacteria 866
556 Ga0207651_10033553 3300025960 Bacteria 3312
557 Ga0207712_10024710 3300025961 Bacteria 3983
558 Ga0207712_10262274 3300025961 Bacteria 1402
559 Ga0207668_10350346 3300025972 Bacteria 1234
560 Ga0207668_10421863 3300025972 Bacteria 1132
561 Ga0207668_10562216 3300025972 Bacteria 989
562 Ga0207640_10025292 3300025981 Bacteria 3591
563 Ga0207658_10144205 3300025986 Bacteria 1931
564 Ga0207677_10074177 3300026023 Bacteria 2413
565 Ga0207703_10056165 3300026035 Bacteria 3205
566 Ga0207703_10082708 3300026035 Bacteria 2680
567 Ga0207703_10426068 3300026035 Bacteria 1235
568 Ga0207639_11384209 3300026041 Bacteria 660
569 Ga0207678_10019641 3300026067 Bacteria 5941
570 Ga0207678_10704696 3300026067 Bacteria 889
571 Ga0207678_10902770 3300026067 Bacteria 781
572 Ga0207708_10272042 3300026075 Bacteria 1370
573 Ga0207702_10105795 3300026078 Bacteria 2492
574 Ga0207702_10429552 3300026078 Bacteria 1279
575 Ga0207702_10471648 3300026078 Bacteria 1220
576 Ga0207641_10070912 3300026088 Bacteria 2995
577 Ga0207641_10412613 3300026088 Bacteria 1299
578 Ga0207641_10417515 3300026088 Bacteria 1291
579 Ga0207648_10011369 3300026089 Bacteria 8390
580 Ga0207648_10202504 3300026089 Bacteria 1761
581 Ga0207676_10009832 3300026095 Bacteria 6803
582 Ga0207676_11271308 3300026095 Bacteria 730
583 Ga0207676_11306487 3300026095 Bacteria 720
584 Ga0207675_100032506 3300026118 Bacteria 4859
585 Ga0207675_100161746 3300026118 Bacteria 2136
586 Ga0207675_100618085 3300026118 Bacteria 1088
587 Ga0207683_10304033 3300026121 Bacteria 1459
588 Ga0207683_10413035 3300026121 Bacteria 1242
589 Ga0207698_10246068 3300026142 Bacteria 1633
590 Ga0209179_1080786 3300027512 Bacteria 717
591 Ga0207428_10159569 3300027907 Bacteria 1713
592 Ga0207428_10320229 3300027907 Bacteria 1145
593 Ga0207428_10366459 3300027907 Bacteria 1059
594 Ga0268266_10184994 3300028379 Bacteria 1899
595 Ga0268266_10886628 3300028379 Bacteria 862
596 Ga0268266_11156407 3300028379 Bacteria 748
597 Ga0268265_10273362 3300028380 Bacteria 1508
598 Ga0268265_12075584 3300028380 Bacteria 575
599 Ga0268264_10038701 3300028381 Bacteria 3937
600 Ga0268264_10420005 3300028381 Bacteria 1289
601 Ga0265338_10113920 3300028800 Bacteria 2171
602 Ga0265332_10002432 3300031238 Bacteria 9503
603 Ga0265329_10016134 3300031242 Bacteria 2595
604 Ga0265340_10002265 3300031247 Bacteria 10993
605 Ga0265340_10063285 3300031247 Bacteria 1766
606 Ga0265340_10193168 3300031247 Bacteria 917
607 Ga0265339_10002172 3300031249 Bacteria 14216
608 Ga0265339_10004027 3300031249 Bacteria 10153
609 Ga0265331_10008078 3300031250 Bacteria 6011
610 Ga0265316_10012332 3300031344 Bacteria 7672
611 Ga0265316_10369695 3300031344 Bacteria 1036
612 Ga0307513_10400609 3300031456 Bacteria 1107
613 Ga0307408_101338321 3300031548 Bacteria 672
614 Ga0307408_101548205 3300031548 Bacteria 628
615 Ga0265313_10098596 3300031595 Bacteria 1300
616 Ga0307508_10000108 3300031616 Bacteria 97443
617 Ga0307508_10050287 3300031616 Bacteria 3710
618 Ga0265314_10037557 3300031711 Bacteria 3508
619 Ga0265342_10000034 3300031712 Bacteria 145074
620 Ga0307405_11855553 3300031731 Bacteria 537
621 Ga0307410_11755675 3300031852 Bacteria 550
622 Ga0307406_10926760 3300031901 Bacteria 743
623 Ga0307406_11016587 3300031901 Bacteria 712
624 Ga0307409_100297351 3300031995 Bacteria 1500
625 Ga0307416_100770799 3300032002 Bacteria 1056
626 Ga0307411_11904897 3300032005 Bacteria 553
627 Ga0307411_11932323 3300032005 Bacteria 550
628 Ga0307415_100369681 3300032126 Bacteria 1214
629 Ga0307415_101060129 3300032126 Bacteria 757
630 Ga0307507_10105123 3300033179 Bacteria 2339
631 Ga0307510_10088633 3300033180 Bacteria 2952
632 Ga0373940_0212602 3300035088 Bacteria 640
633 Ga0373944_0009833 3300035089 Bacteria 2600
634 Ga0373951_0232796 3300035091 Bacteria 548
635 Ga0373923_0190182 3300035111 Bacteria 946
636 Ga0373923_0675642 3300035111 Bacteria 512
637 Ga0373932_0235750 3300035112 Bacteria 663
638 Ga0373936_0029650 3300035113 Bacteria 2155
639 Ga0373945_0053034 3300035116 Bacteria 1496
640 Ga0373953_0022511 3300035117 Bacteria 2377
641 Ga0373956_0294566 3300035119 Bacteria 773
642 Ga0373956_0379859 3300035119 Bacteria 674
643 Ga0373957_0044867 3300035120 Bacteria 1674
644 Ga0373960_0102178 3300035121 Bacteria 931
645 Ga0373960_0119496 3300035121 Bacteria 873
646 Ga0373960_0364968 3300035121 Bacteria 550
647 Ga0373943_0458284 3300035170 Bacteria 741
648 Ga0373946_0058819 3300035171 Bacteria 1629
649 Ga0373946_0365401 3300035171 Bacteria 724
650 Ga0373955_0014090 3300035172 Bacteria 3882
651 Ga0373955_0798815 3300035172 Bacteria 580
652 Ga0373924_0077853 3300035410 Bacteria 1407
653 Ga0373931_0161426 3300035691 Bacteria 1314
654 Ga0373931_0171258 3300035691 Bacteria 1280
655 Ga0373935_0147192 3300035692 Bacteria 1595
656 Ga0373935_0331122 3300035692 Bacteria 1082
657 Ga0373927_0011527 3300035695 Bacteria 5887
658 Ga0373927_0050794 3300035695 Bacteria 2682
659 Ga0373927_0085288 3300035695 Bacteria 2049
660 Ga0373927_0865409 3300035695 Bacteria 597
661 Ga0373933_0135167 3300035724 Bacteria 1553
662 Ga0373947_0068521 3300035725 Bacteria 2170
663 Ga0373947_0128227 3300035725 Bacteria 1617
664 Ga0373937_0020739 3300036401 Bacteria 5894
665 Ga0373937_0469497 3300036401 Bacteria 1195
666 Ga0373925_0095501 3300037068 Bacteria 2277
667 Ga0373925_0150579 3300037068 Bacteria 1827
668 Ga0373925_0181595 3300037068 Bacteria 1666
669 Ga0373925_0230236 3300037068 Bacteria 1481
670 Ga0395905_0009536 3300037471 Bacteria 9483
671 Ga0395905_0249236 3300037471 Bacteria 1659
672 Ga0395905_0467739 3300037471 Bacteria 1160
673 Ga0395905_0534562 3300037471 Bacteria 1073
674 Ga0436364_0381982 3300037853 Bacteria 3262
675 Ga0395901_0116830 3300038443 Bacteria 2803
676 Ga0395901_0215629 3300038443 Bacteria 2008
677 Ga0436365_0890825 3300039437 Bacteria 1279
678 Ga0436365_1401158 3300039437 Bacteria 3180
679 Ga0436360_0483262 3300039438 Bacteria 569
680 Ga0436361_0494221 3300039447 Bacteria 787
681 Ga0436361_0710365 3300039447 Bacteria 583
682 Ga0436361_1108726 3300039447 Bacteria 806
683 Ga0436362_0201781 3300039453 Bacteria 526
684 Ga0439439_0155320 3300041406 Bacteria 651
685 Ga0439465_0097813 3300041413 Bacteria 1010
686 Ga0451789_0728174 3300041443 Bacteria 603
687 Ga0451793_0765636 3300041452 Bacteria 763
688 Ga0451793_1274285 3300041452 Bacteria 603
689 Ga0451798_1006219 3300041458 Bacteria 707
690 Ga0451802_1290079 3300041460 Bacteria 865
691 Ga0451804_1024594 3300041463 Bacteria 526
692 Ga0439431_0056108 3300041997 Bacteria 1030
693 Ga0439446_0058567 3300042156 Bacteria 1162
694 Ga0439434_0067411 3300042435 Bacteria 1124
695 Ga0450893_0101395 3300042532 Bacteria 587
696 Ga0451577_0618926 3300042876 Bacteria 982
697 Ga0466969_0015195 3300044656 Bacteria 4036
698 Ga0466965_0118906 3300044683 Bacteria 1363
699 Ga0466966_0000429 3300044684 Bacteria 27002
700 Ga0466966_0413034 3300044684 Bacteria 811
701 Ga0466961_0000074 3300044693 Bacteria 61968
702 Ga0466963_0004518 3300044694 Bacteria 8099
703 Ga0466964_0033295 3300044706 Bacteria 2053
704 Ga0453684_0086269 3300044712 Bacteria 3896
705 Ga0466971_0365770 3300044719 Bacteria 699
706 Ga0466971_0513749 3300044719 Bacteria 592
707 Ga0466968_0020390 3300044735 Bacteria 2676
708 Ga0466968_0188156 3300044735 Bacteria 962
709 Ga0466970_0287459 3300044765 Bacteria 925
710 Ga0466957_0076403 3300044842 Bacteria 2079
711 Ga0466959_0001671 3300045049 Bacteria 13739
712 Ga0466959_0030925 3300045049 Bacteria 3964
713 Ga0466959_0175614 3300045049 Bacteria 1501
714 Ga0466958_0461833 3300045836 Bacteria 822
715 Ga0466958_0863384 3300045836 Bacteria 590
716 Ga0466967_0117309 3300045976 Bacteria 2453
717 Ga0495617_099345 3300046452 Bacteria 946
718 Ga0495617_216332 3300046452 Bacteria 596
719 Ga0495603_0027832 3300046455 Bacteria 3409
720 Ga0495603_0056973 3300046455 Bacteria 2312
721 Ga0495603_0376192 3300046455 Bacteria 814
722 Ga0495590_0165116 3300046457 Bacteria 806
723 Ga0495629_0685253 3300046459 Bacteria 681
724 Ga0495638_0003214 3300046460 Bacteria 12926
725 Ga0495638_0021855 3300046460 Bacteria 4205
726 Ga0495638_0451136 3300046460 Bacteria 657
727 Ga0495638_0517547 3300046460 Bacteria 598
728 Ga0495641_0092657 3300046461 Bacteria 1350
729 Ga0495641_0421785 3300046461 Bacteria 606
730 Ga0495650_0047516 3300046471 Bacteria 1795
731 Ga0495580_0350709 3300046472 Bacteria 1000
732 Ga0495582_0157068 3300046473 Bacteria 1293
733 Ga0495582_0520909 3300046473 Bacteria 687
734 Ga0495605_0046830 3300046474 Bacteria 2124
735 Ga0495605_0064779 3300046474 Bacteria 1740
736 Ga0495639_0158346 3300046475 Bacteria 1095
737 Ga0495664_0059845 3300046477 Bacteria 2267
738 Ga0495664_0204508 3300046477 Bacteria 1196
739 Ga0495584_0128590 3300046491 Bacteria 1285
740 Ga0495584_0363287 3300046491 Bacteria 735
741 Ga0495585_0255433 3300046492 Bacteria 873
742 Ga0495585_0286270 3300046492 Bacteria 813
743 Ga0495585_0459316 3300046492 Bacteria 608
744 Ga0495594_0363356 3300046499 Bacteria 824
745 Ga0495583_0053969 3300046506 Bacteria 1822
746 Ga0495606_0001875 3300046507 Bacteria 26343
747 Ga0495606_0037454 3300046507 Bacteria 3294
748 Ga0495606_0369403 3300046507 Bacteria 756
749 Ga0495608_0408087 3300046511 Bacteria 830
750 Ga0495610_0095837 3300046512 Bacteria 1337
751 Ga0495610_0222084 3300046512 Bacteria 762
752 Ga0495610_0309400 3300046512 Bacteria 607
753 Ga0495616_0013598 3300046513 Bacteria 4586
754 Ga0495618_0058410 3300046514 Bacteria 2443
755 Ga0495620_0059656 3300046515 Bacteria 1594
756 Ga0495620_0147215 3300046515 Bacteria 919
757 Ga0495620_0309410 3300046515 Bacteria 600
758 Ga0495630_0386070 3300046517 Bacteria 1073
759 Ga0495631_0064196 3300046518 Bacteria 1590
760 Ga0495632_0447903 3300046519 Bacteria 560
761 Ga0495637_0094247 3300046520 Bacteria 1177
762 Ga0495637_0282385 3300046520 Bacteria 592
763 Ga0495643_0428037 3300046522 Bacteria 579
764 Ga0495644_0274086 3300046523 Bacteria 657
765 Ga0495644_0404028 3300046523 Bacteria 541
766 Ga0495663_0011717 3300046525 Bacteria 2441
767 Ga0495663_0236975 3300046525 Bacteria 645
768 Ga0495666_0109821 3300046526 Bacteria 1296
769 Ga0495666_0485633 3300046526 Bacteria 552
770 Ga0495652_0867659 3300046529 Bacteria 597
771 Ga0495665_0168399 3300046531 Bacteria 1141
772 Ga0495640_0414353 3300046533 Bacteria 826
773 Ga0495609_0166348 3300046538 Bacteria 932
774 Ga0495609_0253204 3300046538 Bacteria 725
775 Ga0495645_0193616 3300046543 Bacteria 1384
776 Ga0495645_0463419 3300046543 Bacteria 797
777 Ga0495622_0033715 3300046557 Bacteria 2389
778 Ga0495622_0043567 3300046557 Bacteria 2086
779 Ga0495633_0154359 3300046558 Bacteria 1060
780 Ga0495656_0008929 3300046615 Bacteria 3594
781 Ga0495656_0016881 3300046615 Bacteria 2776
782 Ga0495656_0309305 3300046615 Bacteria 811
783 Ga0495668_0044244 3300046616 Bacteria 2474
784 Ga0495668_0161625 3300046616 Bacteria 1227
785 Ga0495634_0470023 3300046642 Bacteria 740
786 Ga0495625_0190555 3300046660 Bacteria 1359
787 Ga0495625_0850570 3300046660 Bacteria 527
788 Ga0495659_0030979 3300046664 Bacteria 1864
789 Ga0495659_0038196 3300046664 Bacteria 1704
790 Ga0495659_0496629 3300046664 Bacteria 534
791 Ga0495661_0175620 3300046665 Bacteria 1139
792 Ga0495661_0201938 3300046665 Bacteria 1040
793 Ga0495661_0338826 3300046665 Bacteria 743
794 Ga0495588_0003868 3300046674 Bacteria 6560
795 Ga0495588_0006045 3300046674 Bacteria 5430
796 Ga0495588_0092507 3300046674 Bacteria 1585
797 Ga0495588_0152751 3300046674 Bacteria 1220
798 Ga0495647_0093186 3300046681 Bacteria 1238
799 Ga0495647_0632286 3300046681 Bacteria 503
800 Ga0495669_0035031 3300046684 Bacteria 2215
801 Ga0495669_0200669 3300046684 Bacteria 953
802 Ga0495669_0230250 3300046684 Bacteria 889
803 Ga0495669_0564093 3300046684 Bacteria 554
804 Ga0495613_0135916 3300046689 Bacteria 1759
805 Ga0495613_0365796 3300046689 Bacteria 988
806 Ga0495624_0350282 3300046690 Bacteria 888
807 Ga0495670_0280386 3300046691 Bacteria 891
808 Ga0495671_0158164 3300046692 Bacteria 1102
809 Ga0495649_0294583 3300046694 Bacteria 827
810 Ga0495649_0365521 3300046694 Bacteria 727
811 Ga0495589_0050330 3300046794 Bacteria 2061
812 Ga0495589_0217492 3300046794 Bacteria 898
813 Ga0495660_0129469 3300046810 Bacteria 1268
814 Ga0495581_0247707 3300047315 Bacteria 1042
815 Ga0495581_0275133 3300047315 Bacteria 984
816 Ga0495604_0415488 3300047317 Bacteria 884
817 Ga0495674_0313303 3300047319 Bacteria 1280
818 Ga0495674_0322616 3300047319 Bacteria 1258
819 Ga0495674_0653689 3300047319 Bacteria 829
820 Ga0495672_0355980 3300047320 Bacteria 679
821 Ga0495676_0056970 3300047321 Bacteria 3086
822 Ga0495683_0008398 3300047323 Bacteria 5529
823 Ga0495687_044020 3300047443 Bacteria 1942
824 Ga0495677_0203938 3300047445 Bacteria 769
825 Ga0495679_017114 3300047446 Bacteria 2603
826 Ga0495679_058520 3300047446 Bacteria 1137
827 Ga0495685_134663 3300047447 Bacteria 807
828 Ga0495685_153797 3300047447 Bacteria 747
829 Ga0495681_0213864 3300047470 Bacteria 776
830 Ga0495684_0097865 3300047471 Bacteria 2219
831 Ga0495684_0628057 3300047471 Bacteria 721
832 Ga0495686_0144342 3300047472 Bacteria 1402
833 Ga0495615_0013542 3300048090 Bacteria 1706
834 Ga0495626_0205028 3300048091 Bacteria 807
835 Ga0496100_0099780 3300048903 Bacteria 1998
836 Ga0496100_0451583 3300048903 Bacteria 985
837 Ga0496100_0473343 3300048903 Bacteria 963
838 Ga0496100_0488837 3300048903 Bacteria 947
839 Ga0496100_0692575 3300048903 Bacteria 795
840 Ga0496100_0904013 3300048903 Bacteria 693
841 Ga0496101_0014749 3300048904 Bacteria 5257
842 Ga0496101_0161853 3300048904 Bacteria 1717
843 Ga0496101_0267544 3300048904 Bacteria 1334
844 Ga0496101_0997932 3300048904 Bacteria 658
845 Ga0496102_0024848 3300048905 Bacteria 5328
846 Ga0496102_0049243 3300048905 Bacteria 3833
847 Ga0496102_0237383 3300048905 Bacteria 1719
848 Ga0496102_0366308 3300048905 Bacteria 1356
849 Ga0496102_0500283 3300048905 Bacteria 1137
850 Ga0496102_0510801 3300048905 Bacteria 1124
851 Ga0496102_0541825 3300048905 Bacteria 1086
852 Ga0496102_0601236 3300048905 Bacteria 1023
853 Ga0496102_0983680 3300048905 Bacteria 764
854 Ga0496102_1262797 3300048905 Bacteria 658
855 Ga0496103_0004257 3300048906 Bacteria 8696
856 Ga0496103_0005987 3300048906 Bacteria 7274
857 Ga0496103_0080627 3300048906 Bacteria 2046
858 Ga0496103_0391419 3300048906 Bacteria 893
859 Ga0496104_0001028 3300048907 Bacteria 23891
860 Ga0496104_0017384 3300048907 Bacteria 6549
861 Ga0496104_0023717 3300048907 Bacteria 5642
862 Ga0496104_0079487 3300048907 Bacteria 3125
863 Ga0496104_0081709 3300048907 Bacteria 3082
864 Ga0496104_0172870 3300048907 Bacteria 2071
865 Ga0496104_0217068 3300048907 Bacteria 1824
866 Ga0496104_0575185 3300048907 Bacteria 1037
867 Ga0496105_0006459 3300048908 Bacteria 9016
868 Ga0496105_0024687 3300048908 Bacteria 4885
869 Ga0496105_0285893 3300048908 Bacteria 1328
870 Ga0496105_0398740 3300048908 Bacteria 1092
871 Ga0496106_0005992 3300048909 Bacteria 8988
872 Ga0496106_0101931 3300048909 Bacteria 2227
873 Ga0496106_0111264 3300048909 Bacteria 2132
874 Ga0496106_0159689 3300048909 Bacteria 1782
875 Ga0496106_0319781 3300048909 Bacteria 1245
876 Ga0496106_0569531 3300048909 Bacteria 908
877 Ga0496107_0002489 3300048910 Bacteria 11968
878 Ga0496107_0077523 3300048910 Bacteria 2421
879 Ga0496107_0145045 3300048910 Bacteria 1755
880 Ga0496108_0006501 3300048911 Bacteria 9482
881 Ga0496108_0025606 3300048911 Bacteria 4863
882 Ga0496108_0039052 3300048911 Bacteria 3956
883 Ga0496109_0004713 3300048912 Bacteria 11387
884 Ga0496109_0037400 3300048912 Bacteria 4385
885 Ga0496109_0174616 3300048912 Bacteria 2017
886 Ga0496109_0217541 3300048912 Bacteria 1796
887 Ga0496109_0223353 3300048912 Bacteria 1771
888 Ga0496109_0452105 3300048912 Bacteria 1213
889 Ga0496109_1307452 3300048912 Bacteria 661
890 Ga0496110_0086284 3300048913 Bacteria 2802
891 Ga0496110_0092230 3300048913 Bacteria 2710
892 Ga0496110_0112957 3300048913 Bacteria 2442
893 Ga0496110_0182315 3300048913 Bacteria 1906
894 Ga0496110_0195199 3300048913 Bacteria 1838
895 Ga0496110_0252962 3300048913 Bacteria 1603
896 Ga0496110_0305641 3300048913 Bacteria 1449
897 Ga0496110_1552113 3300048913 Bacteria 572
898 Ga0496110_1559058 3300048913 Bacteria 570
899 Ga0496111_0010414 3300048914 Bacteria 6239
900 Ga0496111_0076305 3300048914 Bacteria 2443
901 Ga0496111_0160463 3300048914 Bacteria 1669
902 Ga0496111_0196307 3300048914 Bacteria 1500
903 Ga0496111_0456696 3300048914 Bacteria 942
904 Ga0496112_0007660 3300048915 Bacteria 9604
905 Ga0496112_0025624 3300048915 Bacteria 5664
906 Ga0496112_0079008 3300048915 Bacteria 3253
907 Ga0496112_0165510 3300048915 Bacteria 2177
908 Ga0496112_0754755 3300048915 Bacteria 899
909 Ga0496113_0002831 3300048916 Bacteria 10199
910 Ga0496113_0163571 3300048916 Bacteria 1760
911 Ga0496113_0196189 3300048916 Bacteria 1603
912 Ga0496113_0215847 3300048916 Bacteria 1528
913 Ga0496113_0703186 3300048916 Bacteria 806
914 Ga0496114_0017230 3300048917 Bacteria 5829
915 Ga0496114_0039518 3300048917 Bacteria 3904
916 Ga0496114_0280800 3300048917 Bacteria 1468
917 Ga0496114_0326073 3300048917 Bacteria 1357
918 Ga0496115_0069827 3300048918 Bacteria 2846
919 Ga0496115_0297636 3300048918 Bacteria 1322
920 Ga0496115_0518202 3300048918 Bacteria 956
921 Ga0496117_0037619 3300048920 Bacteria 3603
922 Ga0496119_0311578 3300048922 Bacteria 773
923 Ga0496120_0529361 3300048923 Bacteria 503
924 Ga0496121_0012201 3300048924 Bacteria 9417
925 Ga0496121_0243237 3300048924 Bacteria 1252
926 Ga0496121_0251652 3300048924 Bacteria 1225
927 Ga0496121_0344149 3300048924 Bacteria 995
928 Ga0496124_0463900 3300048927 Bacteria 860
929 Ga0496125_0401370 3300048928 Bacteria 801
930 Ga0496126_0009492 3300048929 Bacteria 10322
931 Ga0496126_0010830 3300048929 Bacteria 9508
932 Ga0496126_0018252 3300048929 Bacteria 6959
933 Ga0496126_0042747 3300048929 Bacteria 4184
934 Ga0496126_0050585 3300048929 Bacteria 3785
935 Ga0496126_0508652 3300048929 Bacteria 961
936 Ga0496126_1102425 3300048929 Bacteria 589
937 Ga0495678_065276 3300049459 Bacteria 1352
938 Ga0495678_246976 3300049459 Bacteria 532
939 Ga0495682_0204977 3300049460 Bacteria 699
940 Ga0495682_0281788 3300049460 Bacteria 587
941 Ga0501032_0061242 3300049569 Bacteria 2523
942 Ga0501032_0345783 3300049569 Bacteria 958
943 Ga0501033_0006792 3300049570 Bacteria 8935
944 Ga0501033_0262145 3300049570 Bacteria 1223
945 Ga0501033_0397915 3300049570 Bacteria 961
946 Ga0501034_0001727 3300049571 Bacteria 28118
947 Ga0501034_0015758 3300049571 Bacteria 7762
948 Ga0501034_0060482 3300049571 Bacteria 3804
949 Ga0501034_0063810 3300049571 Bacteria 3697
950 Ga0501034_0084794 3300049571 Bacteria 3169
951 Ga0501034_0376363 3300049571 Bacteria 1345
952 Ga0501036_0000123 3300049572 Bacteria 48776
953 Ga0501036_0063807 3300049572 Bacteria 3118
954 Ga0501036_0314685 3300049572 Bacteria 1308
955 Ga0501037_0008498 3300049573 Bacteria 7528
956 Ga0501037_0055241 3300049573 Bacteria 2903
957 Ga0501037_0167061 3300049573 Bacteria 1566
958 Ga0501037_0312144 3300049573 Bacteria 1090
959 Ga0501038_0023342 3300049574 Bacteria 5531
960 Ga0501038_0029142 3300049574 Bacteria 4895
961 Ga0501038_0974321 3300049574 Bacteria 623
962 Ga0501039_0051218 3300049575 Bacteria 3195
963 Ga0501039_0106656 3300049575 Bacteria 2188
964 Ga0501039_0200293 3300049575 Bacteria 1570
965 Ga0501041_0067243 3300049577 Bacteria 2196
966 Ga0501043_0027703 3300049579 Bacteria 4448
967 Ga0501043_0055675 3300049579 Bacteria 3107
968 Ga0501043_0395726 3300049579 Bacteria 1044
969 Ga0501046_0028653 3300049580 Bacteria 4534
970 Ga0501046_0034121 3300049580 Bacteria 4109
971 Ga0501047_0000234 3300049581 Bacteria 65759
972 Ga0501047_0012893 3300049581 Bacteria 7919
973 Ga0501047_0333562 3300049581 Bacteria 1355
974 Ga0501047_0621541 3300049581 Bacteria 901
975 Ga0501047_0807878 3300049581 Bacteria 753
976 Ga0501048_0000051 3300049582 Bacteria 57320
977 Ga0501048_0521590 3300049582 Bacteria 852
978 Ga0501067_0180505 3300049583 Bacteria 1176
979 Ga0501067_0241317 3300049583 Bacteria 1006
980 Ga0501068_0046084 3300049584 Bacteria 2628
981 Ga0501069_0063948 3300049585 Bacteria 2056
982 Ga0501069_0379695 3300049585 Bacteria 835
983 Ga0501070_0000886 3300049586 Bacteria 27179
984 Ga0501070_0026864 3300049586 Bacteria 4828
985 Ga0501070_0443108 3300049586 Bacteria 1047
986 Ga0501070_0466105 3300049586 Bacteria 1017
987 Ga0501070_0488871 3300049586 Bacteria 989
988 Ga0501071_0113983 3300049587 Bacteria 2000
989 Ga0501071_0567855 3300049587 Bacteria 872
990 Ga0501072_0036736 3300049588 Bacteria 3841
991 Ga0501072_0363551 3300049588 Bacteria 1149
992 Ga0501073_0036638 3300049589 Bacteria 3485
993 Ga0501073_0049618 3300049589 Bacteria 2942
994 Ga0501074_0067659 3300049590 Bacteria 2568
995 Ga0501074_0116433 3300049590 Bacteria 1912
996 Ga0501074_0704836 3300049590 Bacteria 712
997 Ga0501075_0081871 3300049591 Bacteria 2444
998 Ga0501075_1116275 3300049591 Unclassified 599
999 Ga0501077_0004508 3300049593 Bacteria 8465
1000 Ga0501080_0000528 3300049742 Bacteria 30043
1001 Ga0501080_0084323 3300049742 Bacteria 2952
1002 Ga0501080_0115031 3300049742 Bacteria 2494
1003 Ga0501080_0210768 3300049742 Bacteria 1780
1004 Ga0501080_0217019 3300049742 Bacteria 1751
1005 Ga0501080_0246350 3300049742 Bacteria 1630
1006 Ga0501080_0994935 3300049742 Bacteria 727
1007 Ga0501081_0000718 3300049743 Bacteria 19248
1008 Ga0501083_0008673 3300049744 Bacteria 7171
1009 Ga0501083_0010022 3300049744 Bacteria 6686
1010 Ga0501083_0019506 3300049744 Bacteria 4723
1011 Ga0501083_0170077 3300049744 Bacteria 1424
1012 Ga0501083_0363593 3300049744 Bacteria 941
1013 Ga0501035_0055231 3300049822 Bacteria 3546
1014 Ga0501035_0126554 3300049822 Bacteria 2230
1015 Ga0501035_1305146 3300049822 Bacteria 559
1016 Ga0501044_0001683 3300049823 Bacteria 25978
1017 Ga0501044_0009800 3300049823 Bacteria 10417
1018 Ga0501044_0060296 3300049823 Bacteria 3885
1019 Ga0501044_0333742 3300049823 Bacteria 1438
1020 Ga0501044_0518428 3300049823 Bacteria 1092
1021 Ga0501045_1086983 3300049824 Bacteria 585
1022 nmdc:mga03683_12219_c1 3300050489 Bacteria 3131
1023 nmdc:mga03683_318549_c1 3300050489 Bacteria 732
1024 nmdc:mga03n38_2270_c1 3300050490 Bacteria 5886
1025 nmdc:mga00v17_123408_c1 3300050491 Bacteria 1651
1026 nmdc:mga00v17_46364_c1 3300050491 Bacteria 2629
1027 nmdc:mga00v17_506517_c1 3300050491 Bacteria 782
1028 nmdc:mga00v17_68957_c1 3300050491 Bacteria 2187
1029 nmdc:mga0yw44_1161093_c1 3300050492 Bacteria 521
1030 nmdc:mga0yw44_31068_c1 3300050492 Bacteria 3103
1031 nmdc:mga0yw44_319807_c1 3300050492 Bacteria 1042
1032 nmdc:mga0yw44_39474_c1 3300050492 Bacteria 2800
1033 nmdc:mga0yw44_492543_c1 3300050492 Bacteria 832
1034 nmdc:mga0yw44_658000_c1 3300050492 Bacteria 712
1035 nmdc:mga0yw44_706630_c1 3300050492 Bacteria 685
1036 nmdc:mga0k408_42884_c1 3300050493 Bacteria 2606
1037 nmdc:mga06z11_34317_c1 3300050494 Bacteria 2490
1038 nmdc:mga06z11_346682_c1 3300050494 Bacteria 889
1039 nmdc:mga06z11_95111_c1 3300050494 Bacteria 1625
1040 nmdc:mga04h51_27604_c1 3300050495 Bacteria 1765
1041 nmdc:mga04h51_37296_c1 3300050495 Bacteria 1569
1042 nmdc:mga04h51_435056_c1 3300050495 Bacteria 553
1043 nmdc:mga04h51_51457_c1 3300050495 Bacteria 1384
1044 nmdc:mga07m45_117189_c1 3300050496 Bacteria 1537
1045 nmdc:mga07m45_221092_c1 3300050496 Bacteria 1102
1046 nmdc:mga07m45_3560_c1 3300050496 Bacteria 7524
1047 nmdc:mga05p37_80989_c1 3300050507 Bacteria 3999
1048 nmdc:mga09592_1104804_c1 3300050508 Bacteria 659
1049 nmdc:mga06r32_268554_c1 3300050510 Bacteria 1693
1050 nmdc:mga06r32_449067_c1 3300050510 Bacteria 1269
1051 nmdc:mga08y16_156326_c1 3300050511 Bacteria 2369
1052 nmdc:mga08y16_175084_c1 3300050511 Bacteria 2228
1053 nmdc:mga08y16_212793_c1 3300050511 Bacteria 2002
1054 nmdc:mga08y16_346856_c1 3300050511 Bacteria 1526
1055 nmdc:mga0n895_143745_c1 3300050512 Bacteria 2415
1056 nmdc:mga0n895_1590205_c1 3300050512 Bacteria 618
1057 nmdc:mga0rr50_325907_c1 3300050513 Bacteria 1288
1058 nmdc:mga0rr50_467819_c1 3300050513 Bacteria 1070
1059 nmdc:mga0rr50_867891_c1 3300050513 Bacteria 769
1060 nmdc:mga08x19_39718_c1 3300050514 Bacteria 2992
1061 nmdc:mga0a205_875164_c1 3300050515 Bacteria 745
1062 nmdc:mga0sz30_156299_c1 3300050516 Bacteria 1010
1063 nmdc:mga0sz30_328303_c1 3300050516 Bacteria 683
1064 nmdc:mga0sz30_63777_c1 3300050516 Bacteria 1578
1065 Ga0495601_0041518 3300053077 Bacteria 2884
1066 Ga0495601_0282806 3300053077 Bacteria 1081
1067 Ga0495601_0298433 3300053077 Bacteria 1050
1068 Ga0495612_0061470 3300053078 Bacteria 1556
1069 Ga0495612_0172459 3300053078 Bacteria 948
1070 Ga0495612_0335609 3300053078 Bacteria 681
1071 Ga0495655_0125689 3300053083 Bacteria 785
1072 Ga0495655_0194433 3300053083 Bacteria 660
1073 Ga0495595_0402897 3300053084 Bacteria 693
1074 Ga0495619_0028472 3300053085 Bacteria 3604
1075 Ga0500643_000076 3300053087 Bacteria 106911
1076 Ga0500566_0008016 3300053094 Bacteria 6250
1077 Ga0500641_0011141 3300053096 Bacteria 3260
1078 Ga0500641_0027944 3300053096 Bacteria 2199
1079 Ga0500641_0056611 3300053096 Bacteria 1625
1080 Ga0500554_000886 3300053102 Bacteria 5866
1081 Ga0500555_036648 3300053103 Bacteria 1375
1082 Ga0500562_020702 3300053108 Bacteria 1708
1083 Ga0500592_019813 3300053116 Bacteria 1082
1084 Ga0500595_000506 3300053119 Bacteria 23559
1085 Ga0500595_008447 3300053119 Bacteria 4204
1086 Ga0500595_013765 3300053119 Bacteria 3093
1087 Ga0500626_073864 3300053128 Bacteria 1515
1088 Ga0500642_0166443 3300053130 Bacteria 1032
1089 Ga0500642_0427358 3300053130 Bacteria 573
1090 Ga0500568_0140472 3300053139 Bacteria 895
1091 Ga0500568_0190935 3300053139 Bacteria 752
1092 Ga0500573_0253746 3300053140 Bacteria 904
1093 Ga0500577_0174154 3300053142 Bacteria 921
1094 Ga0500585_182290 3300053144 Bacteria 712
1095 Ga0500588_0289194 3300053146 Bacteria 619
1096 Ga0500589_355947 3300053147 Bacteria 501
1097 Ga0500590_104116 3300053148 Bacteria 1358
1098 Ga0500603_007954 3300053150 Bacteria 2338
1099 Ga0500603_016415 3300053150 Bacteria 1757
1100 Ga0500616_0079254 3300053153 Bacteria 1654
1101 Ga0500622_0039578 3300053156 Bacteria 2457
1102 Ga0500627_0030456 3300053158 Bacteria 2260
1103 Ga0500634_0236713 3300053161 Bacteria 770
1104 Ga0500634_0312580 3300053161 Bacteria 617
1105 Ga0500638_020622 3300053162 Bacteria 3105
1106 Ga0500639_073225 3300053163 Bacteria 1740
1107 Ga0500639_283648 3300053163 Bacteria 636
1108 Ga0500637_0000542 3300053178 Bacteria 14772
1109 Ga0500611_119543 3300053727 Bacteria 701
1110 Ga0500657_107110 3300053728 Bacteria 1139
1111 Ga0500645_192776 3300053730 Bacteria 551
1112 Ga0500599_001474 3300053736 Bacteria 2711
1113 Ga0500587_011686 3300053739 Bacteria 1109
1114 Ga0501084_0026924 3300054114 Bacteria 4803
1115 Ga0501084_0033399 3300054114 Bacteria 4305
1116 Ga0501084_0112238 3300054114 Bacteria 2290
1117 Ga0500661_000578 3300055283 Bacteria 6841
1118 Ga0501082_0006870 3300060353 Bacteria 9842
1119 Ga0501082_0026810 3300060353 Bacteria 4966
1120 Ga0501082_0059259 3300060353 Bacteria 3300
1121 Ga0501082_0423369 3300060353 Bacteria 1163
1122 Ga0530510_0327564 3300061734 Bacteria 1149
1123 2874628729 2874628541 Bacteria 8630250
1124 Ga0265760_10241846
1125 CNAas_1013010
1126 JGI24752J21851_1037180
1127 JGI24746J21847_1007740
1128 JGI24740J21852_10008188
1129 JGI24739J22299_10012966
1130 JGI24739J22299_10097796
1131 JGI24737J22298_10014869
1132 JGI24737J22298_10061764
1133 JGI24737J22298_10218200
1134 JGI24743J22301_10003449
1135 JGI24735J21928_10013060
1136 JGI24735J21928_10227937
1137 JGI24745J21846_1012529
1138 JGI24748J21848_1021502
1139 JGI24738J21930_10009183
1140 JGI24744J21845_10008835
1141 JGI24034J26672_10008736
1142 JGI24742J22300_10004694
1143 JGI24742J22300_10127762
1144 JGI24751J29686_10009152
1145 JGI25406J46586_10010512
1146 JGI25153J46596_10001794
1147 JGI25153J46596_10003400
1148 JGI25153J46596_10017127
1149 JGI25160J50197_1000637
1150 JGI25404J52841_10031981
1151 JGI25404J52841_10076848
1152 Ga0055542_1006432
1153 Ga0055531_10003548
1154 Ga0065165_1006072
1155 Ga0070658_10117842
1156 Ga0070658_10416646
1157 Ga0070658_10417437
1158 Ga0070658_10604597
1159 Ga0070676_10102730
1160 Ga0070683_100078412
1161 Ga0070683_101715162
1162 Ga0070690_100174655
1163 Ga0070670_100022928
1164 Ga0068869_100174441
1165 Ga0068869_100323900
1166 Ga0068869_100352170
1167 Ga0068869_100546414
1168 Ga0068869_100561921
1169 Ga0068869_100695333
1170 Ga0070666_10048402
1171 Ga0070666_10092363
1172 Ga0070666_10283664
1173 Ga0070680_100036206
1174 Ga0070680_100079277
1175 Ga0070680_100081834
1176 Ga0070682_100138504
1177 Ga0068868_100122141
1178 Ga0068868_100126614
1179 Ga0068868_100236152
1180 Ga0070660_100057379
1181 Ga0070660_101217273
1182 Ga0070689_100121032
1183 Ga0070687_100047817
1184 Ga0070687_100360879
1185 Ga0070687_100459414
1186 Ga0070661_100064133
1187 Ga0070661_100092123
1188 Ga0070661_100105611
1189 Ga0070692_10008328
1190 Ga0070692_10841909
1191 Ga0070668_100185039
1192 Ga0070668_100342398
1193 Ga0070668_100917719
1194 Ga0070668_101281948
1195 Ga0070669_100044960
1196 Ga0070669_100200855
1197 Ga0070669_100277279
1198 Ga0070675_100157585
1199 Ga0070675_100319304
1200 Ga0070675_101157347
1201 Ga0070671_100177528
1202 Ga0070671_100358790
1203 Ga0070671_101139461
1204 Ga0070674_100048372
1205 Ga0070674_100229619
1206 Ga0070673_100020132
1207 Ga0070673_100238301
1208 Ga0070673_100239350
1209 Ga0070673_100305996
1210 Ga0070688_100103583
1211 Ga0070688_100505815
1212 Ga0070659_100059804
1213 Ga0070659_100081376
1214 Ga0070659_100129499
1215 Ga0070659_100265147
1216 Ga0070659_100464130
1217 Ga0070659_102068338
1218 Ga0070667_100129610
1219 Ga0070667_100642243
1220 Ga0070667_100691026
1221 Ga0070703_10460910
1222 Ga0070709_10284606
1223 Ga0070714_100032110
1224 Ga0070714_100037170
1225 Ga0070714_100159680
1226 Ga0070713_100004163
1227 Ga0070713_100007601
1228 Ga0070713_100781616
1229 Ga0070713_101560952
1230 Ga0070710_10022655
1231 Ga0070710_10087876
1232 Ga0070701_10020704
1233 Ga0070701_10236501
1234 Ga0070711_100068928
1235 Ga0070705_101183392
1236 Ga0070700_100780293
1237 Ga0070694_100117481
1238 Ga0070694_100312673
1239 Ga0070708_100044164
1240 Ga0070708_100332426
1241 Ga0070663_100000390
1242 Ga0070663_100051319
1243 Ga0070663_100119574
1244 Ga0070663_100172773
1245 Ga0070663_100273932
1246 Ga0070663_100727487
1247 Ga0070663_100909469
1248 Ga0070678_100153173
1249 Ga0070678_100192751
1250 Ga0070678_101158396
1251 Ga0070662_100019835
1252 Ga0070662_100043591
1253 Ga0070662_100112110
1254 Ga0070662_100734439
1255 Ga0070662_100849031
1256 Ga0070681_10057038
1257 Ga0070681_10126809
1258 Ga0070681_10574922
1259 Ga0070681_10591517
1260 Ga0070681_11696140
1261 Ga0068867_100049285
1262 Ga0070685_10019816
1263 Ga0070685_10123159
1264 Ga0070706_100281879
1265 Ga0070706_100354838
1266 Ga0070706_100423696
1267 Ga0070707_100420648
1268 Ga0070698_100584773
1269 Ga0070698_101359983
1270 Ga0070679_100269221
1271 Ga0070679_100318853
1272 Ga0070679_100350704
1273 Ga0070679_101222878
1274 Ga0070684_100020670
1275 Ga0070684_100169847
1276 Ga0070684_100299115
1277 Ga0070684_101242924
1278 Ga0070697_101102060
1279 Ga0070697_101201380
1280 Ga0070697_101518744
1281 Ga0068853_100008484
1282 Ga0068853_100035637
1283 Ga0068853_100053014
1284 Ga0068853_100129437
1285 Ga0068853_100205522
1286 Ga0068853_100352310
1287 Ga0068853_100631056
1288 Ga0068853_101113213
1289 Ga0068853_101628401
1290 Ga0070672_100111875
1291 Ga0070672_100220324
1292 Ga0070686_100934175
1293 Ga0070696_100547642
1294 Ga0070693_100243196
1295 Ga0070693_100445517
1296 Ga0070665_100034600
1297 Ga0070665_100070182
1298 Ga0070665_100099991
1299 Ga0070665_100453895
1300 Ga0070665_100583583
1301 Ga0070665_100648573
1302 Ga0070665_101464312
1303 Ga0070665_102319135
1304 Ga0070704_101364748
1305 Ga0070704_101714060
1306 Ga0068855_100015566
1307 Ga0068855_100026840
1308 Ga0068855_100071356
1309 Ga0068855_100075682
1310 Ga0068855_100085754
1311 Ga0068855_100086762
1312 Ga0068855_100484466
1313 Ga0068855_101525264
1314 Ga0070664_100049823
1315 Ga0070664_100197720
1316 Ga0070664_100463433
1317 Ga0068857_100005885
1318 Ga0068857_100061209
1319 Ga0068857_100132994
1320 Ga0068857_100258828
1321 Ga0068857_101110926
1322 Ga0068854_100023935
1323 Ga0068854_100149164
1324 Ga0068854_100347019
1325 Ga0068854_100383622
1326 Ga0068854_100401955
1327 Ga0068856_100000540
1328 Ga0068856_100002838
1329 Ga0068856_100053053
1330 Ga0068856_100315921
1331 Ga0068856_100610526
1332 Ga0068856_100752269
1333 Ga0068856_101022428
1334 Ga0068856_101326615
1335 Ga0068856_101399763
1336 Ga0070702_100004385
1337 Ga0070702_100190350
1338 Ga0070702_100258417
1339 Ga0068852_100045965
1340 Ga0068852_100055665
1341 Ga0068852_100057576
1342 Ga0068852_100886970
1343 Ga0068852_102732341
1344 Ga0068859_100114760
1345 Ga0068859_100132013
1346 Ga0068859_100195380
1347 Ga0068859_100903732
1348 Ga0068864_100153414
1349 Ga0068864_100282489
1350 Ga0068864_100336322
1351 Ga0068864_100417579
1352 Ga0068864_100489738
1353 Ga0068864_101208463
1354 Ga0068866_10013973
1355 Ga0068866_10593176
1356 Ga0068861_100051907
1357 Ga0068861_100065730
1358 Ga0068861_100074223
1359 Ga0068861_100932105
1360 Ga0068861_101310122
1361 Ga0068851_10016425
1362 Ga0068851_10018742
1363 Ga0068851_10616450
1364 Ga0068870_10009759
1365 Ga0068863_100014599
1366 Ga0068858_100080996
1367 Ga0068858_100095472
1368 Ga0068858_100386437
1369 Ga0068858_100504087
1370 Ga0068860_100034650
1371 Ga0068860_100201973
1372 Ga0068860_100489257
1373 Ga0068860_102451407
1374 Ga0068862_100163647
1375 Ga0068862_100301407
1376 Ga0068862_100330454
1377 Ga0068862_100584070
1378 Ga0081455_10033436
1379 Ga0081455_10159792
1380 Ga0081455_10160083
1381 Ga0081540_1000226
1382 Ga0081540_1008954
1383 Ga0081540_1011883
1384 Ga0081540_1016330
1385 Ga0081540_1061348
1386 Ga0081540_1206256
1387 Ga0081539_10000054
1388 Ga0081539_10094905
1389 Ga0081539_10449275
1390 Ga0070717_10021810
1391 Ga0070717_10030807
1392 Ga0070717_10032547
1393 Ga0070717_10236196
1394 Ga0070717_10388888
1395 Ga0075365_10082696
1396 Ga0075365_10088454
1397 Ga0075365_10121175
1398 Ga0075365_10138683
1399 Ga0075365_10279448
1400 Ga0075365_10465996
1401 Ga0075368_10031061
1402 Ga0075368_10132741
1403 Ga0075363_100001175
1404 Ga0075363_100021411
1405 Ga0075363_100228424
1406 Ga0075363_100231169
1407 Ga0075363_100314995
1408 Ga0075364_10021143
1409 Ga0075364_10076192
1410 Ga0075364_10128842
1411 Ga0075364_10130025
1412 Ga0075364_10567302
1413 Ga0075432_10280232
1414 Ga0070715_10229257
1415 Ga0070715_10873030
1416 Ga0070716_100281178
1417 Ga0070712_100006234
1418 Ga0070712_100216908
1419 Ga0070712_100498281
1420 Ga0075362_10059764
1421 Ga0075362_10175889
1422 Ga0075362_10391950
1423 Ga0075367_10018489
1424 Ga0075367_10029364
1425 Ga0075367_10034701
1426 Ga0075367_10104683
1427 Ga0075367_10235189
1428 Ga0075367_10335108
1429 Ga0075367_10586030
1430 Ga0075369_10075317
1431 Ga0075369_10141148
1432 Ga0075369_10509141
1433 Ga0075366_10028742
1434 Ga0075366_10200189
1435 Ga0075366_10537363
1436 Ga0097621_100043261
1437 Ga0097621_100165866
1438 Ga0097621_100266595
1439 Ga0097621_100760390
1440 Ga0097621_100772304
1441 Ga0097621_101126224
1442 Ga0075370_10051075
1443 Ga0075370_10085391
1444 Ga0075370_10095713
1445 Ga0075370_10150554
1446 Ga0075370_10482006
1447 Ga0075370_10546144
1448 Ga0068871_100005696
1449 Ga0068871_100063845
1450 Ga0068871_100108045
1451 Ga0068871_100591251
1452 Ga0075428_100518596
1453 Ga0075428_100627076
1454 Ga0075433_11109792
1455 Ga0075434_100074388
1456 Ga0075434_100138054
1457 Ga0075429_101691432
1458 Ga0068865_100008652
1459 Ga0068865_100023723
1460 Ga0075436_100023569
1461 Ga0075436_100075545
1462 Ga0097620_100114757
1463 Ga0097620_100132013
1464 Ga0097620_100195374
1465 Ga0097620_100903735
1466 Ga0099822_1000007
1467 Ga0075435_100168192
1468 Ga0075435_100522936
1469 Ga0075435_100570204
1470 Ga0099794_10125143
1471 Ga0099795_10092951
1472 Ga0099795_10142348
1473 Ga0099795_10482562
1474 Ga0105251_10318982
1475 Ga0105250_10059442
1476 Ga0105250_10074367
1477 Ga0105250_10268584
1478 Ga0105240_10004777
1479 Ga0105240_10203984
1480 Ga0105240_10323334
1481 Ga0105240_10453995
1482 Ga0105240_12169827
1483 Ga0111539_10461434
1484 Ga0111539_10835904
1485 Ga0111539_10865059
1486 Ga0111539_11218869
1487 Ga0105245_10049805
1488 Ga0105245_10077904
1489 Ga0105245_11915252
1490 Ga0105247_10014823
1491 Ga0105247_10236977
1492 Ga0105243_10045003
1493 Ga0105243_10459756
1494 Ga0105243_10592332
1495 Ga0105243_10593219
1496 Ga0105243_10859537
1497 Ga0105243_11391429
1498 Ga0105243_11486870
1499 Ga0105241_10001668
1500 Ga0105241_10066888
1501 Ga0105241_12481382
1502 Ga0105242_10054126
1503 Ga0105242_10183943
1504 Ga0105242_10711546
1505 Ga0105242_10856801
1506 Ga0105242_11273578
1507 Ga0105242_11979654
1508 Ga0105248_10073743
1509 Ga0105248_10213554
1510 Ga0105248_10290977
1511 Ga0105248_10442965
1512 Ga0105248_10993358
1513 Ga0105248_11732606
1514 Ga0105237_10055980
1515 Ga0105237_10082006
1516 Ga0105237_10097292
1517 Ga0105237_10147318
1518 Ga0105237_10227915
1519 Ga0105237_10322464
1520 Ga0105237_11921762
1521 Ga0105238_10014953
1522 Ga0105238_10099738
1523 Ga0105238_10222970
1524 Ga0105238_10631965
1525 Ga0105238_11032636
1526 Ga0105249_10131509
1527 Ga0105249_10433158
1528 Ga0105249_10669967
1529 Ga0105249_11695592
1530 Ga0099796_10026202
1531 Ga0099796_10201584
1532 Ga0099796_10555306
1533 Ga0105239_10010140
1534 Ga0105239_10037953
1535 Ga0105239_10074495
1536 Ga0105239_10088979
1537 Ga0105239_10141480
1538 Ga0105239_10481151
1539 Ga0105239_10546169
1540 Ga0105239_11145197
1541 Ga0105239_11487593
1542 Ga0105239_11510556
1543 Ga0105246_10070084
1544 Ga0105246_10087607
1545 Ga0105246_10142482
1546 Ga0105246_10424036
1547 Ga0105246_10774509
1548 Ga0105246_11004017
1549 Ga0105246_11864726
1550 Ga0157325_1021928
1551 Ga0157327_1071583
1552 Ga0157338_1034444
1553 Ga0157373_10341982
1554 Ga0157371_10285937
1555 Ga0157371_10529918
1556 Ga0157371_11347050
1557 Ga0157370_10185294
1558 Ga0157370_10827247
1559 Ga0157370_11144423
1560 Ga0157369_10014138
1561 Ga0157369_10195530
1562 Ga0157369_11356885
1563 Ga0157374_10041871
1564 Ga0157374_10204370
1565 Ga0157374_11060515
1566 Ga0157378_10054515
1567 Ga0157378_10240608
1568 Ga0157378_10359629
1569 Ga0157378_11279026
1570 Ga0157378_12783084
1571 Ga0163162_10075871
1572 Ga0163162_10095577
1573 Ga0163162_10158844
1574 Ga0163162_10163672
1575 Ga0163162_10241018
1576 Ga0163162_11152495
1577 Ga0163162_12383156
1578 Ga0163162_12667584
1579 Ga0157375_10027450
1580 Ga0157375_10030809
1581 Ga0157375_13222412
1582 Ga0163163_10045738
1583 Ga0163163_10112616
1584 Ga0163163_10165068
1585 Ga0163163_10176913
1586 Ga0163163_10220101
1587 Ga0163163_10700621
1588 Ga0157380_10100965
1589 Ga0157380_10140433
1590 Ga0157380_11306603
1591 Ga0157380_11605590
1592 Ga0182008_10112091
1593 Ga0182008_10594934
1594 Ga0157377_10026678
1595 Ga0157379_10035692
1596 Ga0157379_10097690
1597 Ga0157379_10221427
1598 Ga0157379_10388347
1599 Ga0157379_11008106
1600 Ga0157376_10363541
1601 Ga0157376_10486973
1602 Ga0157376_10500479
1603 Ga0157376_10536764
1604 Ga0157376_10929138
1605 Ga0163161_10032435
1606 Ga0213876_10013147
1607 Ga0213876_10213805
1608 Ga0209148_1000504
1609 Ga0209233_1011700
1610 Ga0209455_1000957
1611 Ga0209758_1101841
1612 Ga0207696_1046717
1613 Ga0207692_10036883
1614 Ga0207642_10025377
1615 Ga0207710_10011162
1616 Ga0207710_10024285
1617 Ga0207710_10237901
1618 Ga0207710_10548774
1619 Ga0207688_10003770
1620 Ga0207688_10008498
1621 Ga0207680_10465374
1622 Ga0207647_10038424
1623 Ga0207685_10239883
1624 Ga0207699_10230522
1625 Ga0207645_10026653
1626 Ga0207643_10003440
1627 Ga0207684_10122380
1628 Ga0207654_10621225
1629 Ga0207671_10183846
1630 Ga0207663_10051550
1631 Ga0207660_11525698
1632 Ga0207662_10005321
1633 Ga0207662_10428799
1634 Ga0207662_11046115
1635 Ga0207657_10011703
1636 Ga0207649_10255306
1637 Ga0207652_10336843
1638 Ga0207652_10606328
1639 Ga0207681_10060281
1640 Ga0207681_10278931
1641 Ga0207681_10340820
1642 Ga0207650_11299978
1643 Ga0207659_10816432
1644 Ga0207687_10012405
1645 Ga0207687_10116027
1646 Ga0207700_10119004
1647 Ga0207700_10506006
1648 Ga0207700_10834189
1649 Ga0207700_11476822
1650 Ga0207664_11125783
1651 Ga0207690_10362467
1652 Ga0207706_10031230
1653 Ga0207706_10052664
1654 Ga0207706_10077157
1655 Ga0207686_10008732
1656 Ga0207709_10009837
1657 Ga0207709_10012231
1658 Ga0207670_10069596
1659 Ga0207670_10070659
1660 Ga0207669_10015382
1661 Ga0207669_10019906
1662 Ga0207669_10464773
1663 Ga0207704_10024549
1664 Ga0207704_10268556
1665 Ga0207665_10076725
1666 Ga0207691_10022632
1667 Ga0207711_10220109
1668 Ga0207689_10065770
1669 Ga0207689_10291065
1670 Ga0207689_10342874
1671 Ga0207689_10612189
1672 Ga0207689_10802116
1673 Ga0207661_10109369
1674 Ga0207679_10053114
1675 Ga0207679_10327140
1676 Ga0207667_10049467
1677 Ga0207667_10836188
1678 Ga0207667_10919807
1679 Ga0207651_10033553
1680 Ga0207712_10024710
1681 Ga0207712_10262274
1682 Ga0207668_10350346
1683 Ga0207668_10421863
1684 Ga0207668_10562216
1685 Ga0207640_10025292
1686 Ga0207658_10144205
1687 Ga0207677_10074177
1688 Ga0207703_10056165
1689 Ga0207703_10082708
1690 Ga0207703_10426068
1691 Ga0207639_11384209
1692 Ga0207678_10019641
1693 Ga0207678_10704696
1694 Ga0207678_10902770
1695 Ga0207708_10272042
1696 Ga0207702_10105795
1697 Ga0207702_10429552
1698 Ga0207702_10471648
1699 Ga0207641_10070912
1700 Ga0207641_10412613
1701 Ga0207641_10417515
1702 Ga0207648_10011369
1703 Ga0207648_10202504
1704 Ga0207676_10009832
1705 Ga0207676_11271308
1706 Ga0207676_11306487
1707 Ga0207675_100032506
1708 Ga0207675_100161746
1709 Ga0207675_100618085
1710 Ga0207683_10304033
1711 Ga0207683_10413035
1712 Ga0207698_10246068
1713 Ga0209179_1080786
1714 Ga0207428_10159569
1715 Ga0207428_10320229
1716 Ga0207428_10366459
1717 Ga0268266_10184994
1718 Ga0268266_10886628
1719 Ga0268266_11156407
1720 Ga0268265_10273362
1721 Ga0268265_12075584
1722 Ga0268264_10038701
1723 Ga0268264_10420005
1724 Ga0265338_10113920
1725 Ga0265332_10002432
1726 Ga0265329_10016134
1727 Ga0265340_10002265
1728 Ga0265340_10063285
1729 Ga0265340_10193168
1730 Ga0265339_10002172
1731 Ga0265339_10004027
1732 Ga0265331_10008078
1733 Ga0265316_10012332
1734 Ga0265316_10369695
1735 Ga0307513_10400609
1736 Ga0307408_101338321
1737 Ga0307408_101548205
1738 Ga0265313_10098596
1739 Ga0307508_10000108
1740 Ga0307508_10050287
1741 Ga0265314_10037557
1742 Ga0265342_10000034
1743 Ga0307405_11855553
1744 Ga0307410_11755675
1745 Ga0307406_10926760
1746 Ga0307406_11016587
1747 Ga0307409_100297351
1748 Ga0307416_100770799
1749 Ga0307411_11904897
1750 Ga0307411_11932323
1751 Ga0307415_100369681
1752 Ga0307415_101060129
1753 Ga0307507_10105123
1754 Ga0307510_10088633
1755 Ga0373940_0212602
1756 Ga0373944_0009833
1757 Ga0373951_0232796
1758 Ga0373923_0190182
1759 Ga0373923_0675642
1760 Ga0373932_0235750
1761 Ga0373936_0029650
1762 Ga0373945_0053034
1763 Ga0373953_0022511
1764 Ga0373956_0294566
1765 Ga0373956_0379859
1766 Ga0373957_0044867
1767 Ga0373960_0102178
1768 Ga0373960_0119496
1769 Ga0373960_0364968
1770 Ga0373943_0458284
1771 Ga0373946_0058819
1772 Ga0373946_0365401
1773 Ga0373955_0014090
1774 Ga0373955_0798815
1775 Ga0373924_0077853
1776 Ga0373931_0161426
1777 Ga0373931_0171258
1778 Ga0373935_0147192
1779 Ga0373935_0331122
1780 Ga0373927_0011527
1781 Ga0373927_0050794
1782 Ga0373927_0085288
1783 Ga0373927_0865409
1784 Ga0373933_0135167
1785 Ga0373947_0068521
1786 Ga0373947_0128227
1787 Ga0373937_0020739
1788 Ga0373937_0469497
1789 Ga0373925_0095501
1790 Ga0373925_0150579
1791 Ga0373925_0181595
1792 Ga0373925_0230236
1793 Ga0395905_0009536
1794 Ga0395905_0249236
1795 Ga0395905_0467739
1796 Ga0395905_0534562
1797 Ga0436364_0381982
1798 Ga0395901_0116830
1799 Ga0395901_0215629
1800 Ga0436365_0890825
1801 Ga0436365_1401158
1802 Ga0436360_0483262
1803 Ga0436361_0494221
1804 Ga0436361_0710365
1805 Ga0436361_1108726
1806 Ga0436362_0201781
1807 Ga0439439_0155320
1808 Ga0439465_0097813
1809 Ga0451789_0728174
1810 Ga0451793_0765636
1811 Ga0451793_1274285
1812 Ga0451798_1006219
1813 Ga0451802_1290079
1814 Ga0451804_1024594
1815 Ga0439431_0056108
1816 Ga0439446_0058567
1817 Ga0439434_0067411
1818 Ga0450893_0101395
1819 Ga0451577_0618926
1820 Ga0466969_0015195
1821 Ga0466965_0118906
1822 Ga0466966_0000429
1823 Ga0466966_0413034
1824 Ga0466961_0000074
1825 Ga0466963_0004518
1826 Ga0466964_0033295
1827 Ga0453684_0086269
1828 Ga0466971_0365770
1829 Ga0466971_0513749
1830 Ga0466968_0020390
1831 Ga0466968_0188156
1832 Ga0466970_0287459
1833 Ga0466957_0076403
1834 Ga0466959_0001671
1835 Ga0466959_0030925
1836 Ga0466959_0175614
1837 Ga0466958_0461833
1838 Ga0466958_0863384
1839 Ga0466967_0117309
1840 Ga0495617_099345
1841 Ga0495617_216332
1842 Ga0495603_0027832
1843 Ga0495603_0056973
1844 Ga0495603_0376192
1845 Ga0495590_0165116
1846 Ga0495629_0685253
1847 Ga0495638_0003214
1848 Ga0495638_0021855
1849 Ga0495638_0451136
1850 Ga0495638_0517547
1851 Ga0495641_0092657
1852 Ga0495641_0421785
1853 Ga0495650_0047516
1854 Ga0495580_0350709
1855 Ga0495582_0157068
1856 Ga0495582_0520909
1857 Ga0495605_0046830
1858 Ga0495605_0064779
1859 Ga0495639_0158346
1860 Ga0495664_0059845
1861 Ga0495664_0204508
1862 Ga0495584_0128590
1863 Ga0495584_0363287
1864 Ga0495585_0255433
1865 Ga0495585_0286270
1866 Ga0495585_0459316
1867 Ga0495594_0363356
1868 Ga0495583_0053969
1869 Ga0495606_0001875
1870 Ga0495606_0037454
1871 Ga0495606_0369403
1872 Ga0495608_0408087
1873 Ga0495610_0095837
1874 Ga0495610_0222084
1875 Ga0495610_0309400
1876 Ga0495616_0013598
1877 Ga0495618_0058410
1878 Ga0495620_0059656
1879 Ga0495620_0147215
1880 Ga0495620_0309410
1881 Ga0495630_0386070
1882 Ga0495631_0064196
1883 Ga0495632_0447903
1884 Ga0495637_0094247
1885 Ga0495637_0282385
1886 Ga0495643_0428037
1887 Ga0495644_0274086
1888 Ga0495644_0404028
1889 Ga0495663_0011717
1890 Ga0495663_0236975
1891 Ga0495666_0109821
1892 Ga0495666_0485633
1893 Ga0495652_0867659
1894 Ga0495665_0168399
1895 Ga0495640_0414353
1896 Ga0495609_0166348
1897 Ga0495609_0253204
1898 Ga0495645_0193616
1899 Ga0495645_0463419
1900 Ga0495622_0033715
1901 Ga0495622_0043567
1902 Ga0495633_0154359
1903 Ga0495656_0008929
1904 Ga0495656_0016881
1905 Ga0495656_0309305
1906 Ga0495668_0044244
1907 Ga0495668_0161625
1908 Ga0495634_0470023
1909 Ga0495625_0190555
1910 Ga0495625_0850570
1911 Ga0495659_0030979
1912 Ga0495659_0038196
1913 Ga0495659_0496629
1914 Ga0495661_0175620
1915 Ga0495661_0201938
1916 Ga0495661_0338826
1917 Ga0495588_0003868
1918 Ga0495588_0006045
1919 Ga0495588_0092507
1920 Ga0495588_0152751
1921 Ga0495647_0093186
1922 Ga0495647_0632286
1923 Ga0495669_0035031
1924 Ga0495669_0200669
1925 Ga0495669_0230250
1926 Ga0495669_0564093
1927 Ga0495613_0135916
1928 Ga0495613_0365796
1929 Ga0495624_0350282
1930 Ga0495670_0280386
1931 Ga0495671_0158164
1932 Ga0495649_0294583
1933 Ga0495649_0365521
1934 Ga0495589_0050330
1935 Ga0495589_0217492
1936 Ga0495660_0129469
1937 Ga0495581_0247707
1938 Ga0495581_0275133
1939 Ga0495604_0415488
1940 Ga0495674_0313303
1941 Ga0495674_0322616
1942 Ga0495674_0653689
1943 Ga0495672_0355980
1944 Ga0495676_0056970
1945 Ga0495683_0008398
1946 Ga0495687_044020
1947 Ga0495677_0203938
1948 Ga0495679_017114
1949 Ga0495679_058520
1950 Ga0495685_134663
1951 Ga0495685_153797
1952 Ga0495681_0213864
1953 Ga0495684_0097865
1954 Ga0495684_0628057
1955 Ga0495686_0144342
1956 Ga0495615_0013542
1957 Ga0495626_0205028
1958 Ga0496100_0099780
1959 Ga0496100_0451583
1960 Ga0496100_0473343
1961 Ga0496100_0488837
1962 Ga0496100_0692575
1963 Ga0496100_0904013
1964 Ga0496101_0014749
1965 Ga0496101_0161853
1966 Ga0496101_0267544
1967 Ga0496101_0997932
1968 Ga0496102_0024848
1969 Ga0496102_0049243
1970 Ga0496102_0237383
1971 Ga0496102_0366308
1972 Ga0496102_0500283
1973 Ga0496102_0510801
1974 Ga0496102_0541825
1975 Ga0496102_0601236
1976 Ga0496102_0983680
1977 Ga0496102_1262797
1978 Ga0496103_0004257
1979 Ga0496103_0005987
1980 Ga0496103_0080627
1981 Ga0496103_0391419
1982 Ga0496104_0001028
1983 Ga0496104_0017384
1984 Ga0496104_0023717
1985 Ga0496104_0079487
1986 Ga0496104_0081709
1987 Ga0496104_0172870
1988 Ga0496104_0217068
1989 Ga0496104_0575185
1990 Ga0496105_0006459
1991 Ga0496105_0024687
1992 Ga0496105_0285893
1993 Ga0496105_0398740
1994 Ga0496106_0005992
1995 Ga0496106_0101931
1996 Ga0496106_0111264
1997 Ga0496106_0159689
1998 Ga0496106_0319781
1999 Ga0496106_0569531
2000 Ga0496107_0002489
2001 Ga0496107_0077523
2002 Ga0496107_0145045
2003 Ga0496108_0006501
2004 Ga0496108_0025606
2005 Ga0496108_0039052
2006 Ga0496109_0004713
2007 Ga0496109_0037400
2008 Ga0496109_0174616
2009 Ga0496109_0217541
2010 Ga0496109_0223353
2011 Ga0496109_0452105
2012 Ga0496109_1307452
2013 Ga0496110_0086284
2014 Ga0496110_0092230
2015 Ga0496110_0112957
2016 Ga0496110_0182315
2017 Ga0496110_0195199
2018 Ga0496110_0252962
2019 Ga0496110_0305641
2020 Ga0496110_1552113
2021 Ga0496110_1559058
2022 Ga0496111_0010414
2023 Ga0496111_0076305
2024 Ga0496111_0160463
2025 Ga0496111_0196307
2026 Ga0496111_0456696
2027 Ga0496112_0007660
2028 Ga0496112_0025624
2029 Ga0496112_0079008
2030 Ga0496112_0165510
2031 Ga0496112_0754755
2032 Ga0496113_0002831
2033 Ga0496113_0163571
2034 Ga0496113_0196189
2035 Ga0496113_0215847
2036 Ga0496113_0703186
2037 Ga0496114_0017230
2038 Ga0496114_0039518
2039 Ga0496114_0280800
2040 Ga0496114_0326073
2041 Ga0496115_0069827
2042 Ga0496115_0297636
2043 Ga0496115_0518202
2044 Ga0496117_0037619
2045 Ga0496119_0311578
2046 Ga0496120_0529361
2047 Ga0496121_0012201
2048 Ga0496121_0243237
2049 Ga0496121_0251652
2050 Ga0496121_0344149
2051 Ga0496124_0463900
2052 Ga0496125_0401370
2053 Ga0496126_0009492
2054 Ga0496126_0010830
2055 Ga0496126_0018252
2056 Ga0496126_0042747
2057 Ga0496126_0050585
2058 Ga0496126_0508652
2059 Ga0496126_1102425
2060 Ga0495678_065276
2061 Ga0495678_246976
2062 Ga0495682_0204977
2063 Ga0495682_0281788
2064 Ga0501032_0061242
2065 Ga0501032_0345783
2066 Ga0501033_0006792
2067 Ga0501033_0262145
2068 Ga0501033_0397915
2069 Ga0501034_0001727
2070 Ga0501034_0015758
2071 Ga0501034_0060482
2072 Ga0501034_0063810
2073 Ga0501034_0084794
2074 Ga0501034_0376363
2075 Ga0501036_0000123
2076 Ga0501036_0063807
2077 Ga0501036_0314685
2078 Ga0501037_0008498
2079 Ga0501037_0055241
2080 Ga0501037_0167061
2081 Ga0501037_0312144
2082 Ga0501038_0023342
2083 Ga0501038_0029142
2084 Ga0501038_0974321
2085 Ga0501039_0051218
2086 Ga0501039_0106656
2087 Ga0501039_0200293
2088 Ga0501041_0067243
2089 Ga0501043_0027703
2090 Ga0501043_0055675
2091 Ga0501043_0395726
2092 Ga0501046_0028653
2093 Ga0501046_0034121
2094 Ga0501047_0000234
2095 Ga0501047_0012893
2096 Ga0501047_0333562
2097 Ga0501047_0621541
2098 Ga0501047_0807878
2099 Ga0501048_0000051
2100 Ga0501048_0521590
2101 Ga0501067_0180505
2102 Ga0501067_0241317
2103 Ga0501068_0046084
2104 Ga0501069_0063948
2105 Ga0501069_0379695
2106 Ga0501070_0000886
2107 Ga0501070_0026864
2108 Ga0501070_0443108
2109 Ga0501070_0466105
2110 Ga0501070_0488871
2111 Ga0501071_0113983
2112 Ga0501071_0567855
2113 Ga0501072_0036736
2114 Ga0501072_0363551
2115 Ga0501073_0036638
2116 Ga0501073_0049618
2117 Ga0501074_0067659
2118 Ga0501074_0116433
2119 Ga0501074_0704836
2120 Ga0501075_0081871
2121 Ga0501075_1116275
2122 Ga0501077_0004508
2123 Ga0501080_0000528
2124 Ga0501080_0084323
2125 Ga0501080_0115031
2126 Ga0501080_0210768
2127 Ga0501080_0217019
2128 Ga0501080_0246350
2129 Ga0501080_0994935
2130 Ga0501081_0000718
2131 Ga0501083_0008673
2132 Ga0501083_0010022
2133 Ga0501083_0019506
2134 Ga0501083_0170077
2135 Ga0501083_0363593
2136 Ga0501035_0055231
2137 Ga0501035_0126554
2138 Ga0501035_1305146
2139 Ga0501044_0001683
2140 Ga0501044_0009800
2141 Ga0501044_0060296
2142 Ga0501044_0333742
2143 Ga0501044_0518428
2144 Ga0501045_1086983
2145 nmdc:mga03683_12219_c1
2146 nmdc:mga03683_318549_c1
2147 nmdc:mga03n38_2270_c1
2148 nmdc:mga00v17_123408_c1
2149 nmdc:mga00v17_46364_c1
2150 nmdc:mga00v17_506517_c1
2151 nmdc:mga00v17_68957_c1
2152 nmdc:mga0yw44_1161093_c1
2153 nmdc:mga0yw44_31068_c1
2154 nmdc:mga0yw44_319807_c1
2155 nmdc:mga0yw44_39474_c1
2156 nmdc:mga0yw44_492543_c1
2157 nmdc:mga0yw44_658000_c1
2158 nmdc:mga0yw44_706630_c1
2159 nmdc:mga0k408_42884_c1
2160 nmdc:mga06z11_34317_c1
2161 nmdc:mga06z11_346682_c1
2162 nmdc:mga06z11_95111_c1
2163 nmdc:mga04h51_27604_c1
2164 nmdc:mga04h51_37296_c1
2165 nmdc:mga04h51_435056_c1
2166 nmdc:mga04h51_51457_c1
2167 nmdc:mga07m45_117189_c1
2168 nmdc:mga07m45_221092_c1
2169 nmdc:mga07m45_3560_c1
2170 nmdc:mga05p37_80989_c1
2171 nmdc:mga09592_1104804_c1
2172 nmdc:mga06r32_268554_c1
2173 nmdc:mga06r32_449067_c1
2174 nmdc:mga08y16_156326_c1
2175 nmdc:mga08y16_175084_c1
2176 nmdc:mga08y16_212793_c1
2177 nmdc:mga08y16_346856_c1
2178 nmdc:mga0n895_143745_c1
2179 nmdc:mga0n895_1590205_c1
2180 nmdc:mga0rr50_325907_c1
2181 nmdc:mga0rr50_467819_c1
2182 nmdc:mga0rr50_867891_c1
2183 nmdc:mga08x19_39718_c1
2184 nmdc:mga0a205_875164_c1
2185 nmdc:mga0sz30_156299_c1
2186 nmdc:mga0sz30_328303_c1
2187 nmdc:mga0sz30_63777_c1
2188 Ga0495601_0041518
2189 Ga0495601_0282806
2190 Ga0495601_0298433
2191 Ga0495612_0061470
2192 Ga0495612_0172459
2193 Ga0495612_0335609
2194 Ga0495655_0125689
2195 Ga0495655_0194433
2196 Ga0495595_0402897
2197 Ga0495619_0028472
2198 Ga0500643_000076
2199 Ga0500566_0008016
2200 Ga0500641_0011141
2201 Ga0500641_0027944
2202 Ga0500641_0056611
2203 Ga0500554_000886
2204 Ga0500555_036648
2205 Ga0500562_020702
2206 Ga0500592_019813
2207 Ga0500595_000506
2208 Ga0500595_008447
2209 Ga0500595_013765
2210 Ga0500626_073864
2211 Ga0500642_0166443
2212 Ga0500642_0427358
2213 Ga0500568_0140472
2214 Ga0500568_0190935
2215 Ga0500573_0253746
2216 Ga0500577_0174154
2217 Ga0500585_182290
2218 Ga0500588_0289194
2219 Ga0500589_355947
2220 Ga0500590_104116
2221 Ga0500603_007954
2222 Ga0500603_016415
2223 Ga0500616_0079254
2224 Ga0500622_0039578
2225 Ga0500627_0030456
2226 Ga0500634_0236713
2227 Ga0500634_0312580
2228 Ga0500638_020622
2229 Ga0500639_073225
2230 Ga0500639_283648
2231 Ga0500637_0000542
2232 Ga0500611_119543
2233 Ga0500657_107110
2234 Ga0500645_192776
2235 Ga0500599_001474
2236 Ga0500587_011686
2237 Ga0501084_0026924
2238 Ga0501084_0033399
2239 Ga0501084_0112238
2240 Ga0500661_000578
2241 Ga0501082_0006870
2242 Ga0501082_0026810
2243 Ga0501082_0059259
2244 Ga0501082_0423369
2245 Ga0530510_0327564
2246 2874628729

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01878

EVE

EVE domain

17

150

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1zce-assembly1.cif.gz_A x-ray crystal structure of protein atu2648 from agrobacterium tumefaciens. northeast structural genomics consortium target atr33. 0.9776 1 137
1zce-assembly1.cif.gz_A x-ray crystal structure of protein atu2648 from agrobacterium tumefaciens. northeast structural genomics consortium target atr33. 0.957 1 137
2gbs-assembly1.cif.gz_A nmr structure of rpa0253 from rhodopseudomonas palustris. northeast structural genomics consortium target rpr3 0.9417 1 139
2gbs-assembly1.cif.gz_A nmr structure of rpa0253 from rhodopseudomonas palustris. northeast structural genomics consortium target rpr3 0.9352 1 139
2eve-assembly1.cif.gz_A x-ray crystal structure of protein pspto5229 from pseudomonas syringae. northeast structural genomics consortium target psr62 0.9273 2 135
ID Description Score Start End Superfamily
1zceA00 Alpha Beta;Roll;ph1033 like fold;ph1033 like domains 0.936 1 137 3.10.590.10
af_I1JAX2_1_77_3.10.590.10 Alpha Beta;Roll;ph1033 like fold;ph1033 like domains 0.928 5 73 3.10.590.10
af_A4ICC8_1_164_3.10.590.10 Alpha Beta;Roll;ph1033 like fold;ph1033 like domains 0.922 1 136 3.10.590.10
af_Q9ZVK5_4_152_3.10.590.10 Alpha Beta;Roll;ph1033 like fold;ph1033 like domains 0.9124 2 136 3.10.590.10
2eveA00 Alpha Beta;Roll;ph1033 like fold;ph1033 like domains 0.8995 2 135 3.10.590.10
ID Description Score Start End GO Terms
AF-A0A179SE64-F1-model_v4 Ubiquinol-cytochrome C reductase 0.9966 1 137
AF-A0A382ERT4-F1-model_v4 EVE domain-containing protein 0.9957 43 104 GO:0005634
AF-A0A212RM74-F1-model_v4 Predicted RNA-binding protein, contains PUA-like domain 0.9954 2 137
AF-A0A1M3CD34-F1-model_v4 Ubiquinol-cytochrome C reductase 0.9948 1 137
AF-A0A3D9HF31-F1-model_v4 Putative RNA-binding protein with PUA-like domain 0.9947 1 138

Map