F490244
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1111 | 279 | 2222 | 129 |
Family's Representative Sequence
| Representative Sequence | 3300049663|Ga0501223_005363|Ga0501223_005363_2158_2607 |
| Length | 149 |
| Sequence | MNSTSSFQWEAVKDANEGTEMFKQLDYTMIIVSDMQRSVEFYRDKLGLPLKFQSPDWTEFATGTTTLALHGGGVRNEQPPAGDPSKTAGACSIGFNVDDVDKTYEELKARGIRFVMPPTQREGEGIKLAVGLDPDGLPVSFAQLISHGA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 2 | 2162886006 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 | Metagenome | Rhizosphere |
| 3 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 4 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 5 | 3300000532 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled | Metagenome | Rhizosphere |
| 6 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 7 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 10 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 17 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 21 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 48 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 54 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 64 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 66 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 67 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 68 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 70 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 71 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 72 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 73 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 74 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 75 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 76 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 77 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 78 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 79 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 80 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 81 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 82 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 84 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 85 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 86 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 87 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 88 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 89 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 90 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 91 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 92 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 94 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 95 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 109 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 120 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 124 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 181 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 185 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 186 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 187 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 188 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 189 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 190 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 191 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 192 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 193 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 194 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 195 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 196 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 197 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 198 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 199 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 200 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 201 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 202 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 203 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 204 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 205 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 206 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 207 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 208 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 209 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 210 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 211 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 212 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 213 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 214 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 231 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 232 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 233 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 234 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 235 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 236 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 237 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 238 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 239 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 240 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 241 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 242 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 243 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 244 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 245 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 246 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 247 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 248 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 249 | 3300049655 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought | Metagenome | Rhizosphere |
| 250 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 251 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 252 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 253 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 254 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 255 | 3300049670 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought | Metagenome | Rhizosphere |
| 256 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 257 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 258 | 3300049689 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought | Metagenome | Rhizosphere |
| 259 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 260 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 261 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 262 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 263 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 264 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 265 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 266 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 267 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 268 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 269 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 270 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 271 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 272 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 273 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 274 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 275 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 276 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 277 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 278 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 279 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 1.62 |
| Rhizosphere | 98.29 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 34.83 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0501223_005363 | 3300049663 | Bacteria | 2696 |
| 2 | SwRhRL3b_contig_2135242 | 2162886006 | Unclassified | 867 |
| 3 | SwRhRL2b_contig_1868649 | 2162886007 | Bacteria | 3230 |
| 4 | MBSR1b_contig_347854 | 2162886012 | Unclassified | 963 |
| 5 | MBSR1b_contig_387553 | 2162886012 | Unclassified | 806 |
| 6 | CNAas_1000558 | 3300000532 | Bacteria | 3604 |
| 7 | JGI25406J46586_10020673 | 3300003203 | Bacteria | 2656 |
| 8 | Ga0065714_10064425 | 3300005288 | Bacteria | 189652 |
| 9 | Ga0065714_10373163 | 3300005288 | Unclassified | 614 |
| 10 | Ga0065704_10017720 | 3300005289 | Bacteria | 2076 |
| 11 | Ga0065704_10075557 | 3300005289 | Bacteria | 5533 |
| 12 | Ga0065704_10103842 | 3300005289 | Bacteria | 2142 |
| 13 | Ga0065704_10109827 | 3300005289 | Bacteria | 1994 |
| 14 | Ga0065712_10067727 | 3300005290 | Bacteria | 189643 |
| 15 | Ga0065712_10110168 | 3300005290 | Bacteria | 1841 |
| 16 | Ga0065712_10236655 | 3300005290 | Unclassified | 996 |
| 17 | Ga0065712_10489075 | 3300005290 | Unclassified | 630 |
| 18 | Ga0065712_10503981 | 3300005290 | Unclassified | 647 |
| 19 | Ga0065715_10003739 | 3300005293 | Unclassified | 4745 |
| 20 | Ga0065715_10005934 | 3300005293 | Bacteria | 3014 |
| 21 | Ga0065715_10090321 | 3300005293 | Bacteria | 7209 |
| 22 | Ga0065715_10094837 | 3300005293 | Bacteria | 4229 |
| 23 | Ga0065715_10111252 | 3300005293 | Bacteria | 2582 |
| 24 | Ga0065715_10125669 | 3300005293 | Bacteria | 2125 |
| 25 | Ga0065715_10131091 | 3300005293 | Bacteria | 2014 |
| 26 | Ga0065715_10215704 | 3300005293 | Bacteria | 1263 |
| 27 | Ga0065715_10236551 | 3300005293 | Bacteria | 1214 |
| 28 | Ga0065715_10307433 | 3300005293 | Unclassified | 1028 |
| 29 | Ga0065715_10611849 | 3300005293 | Unclassified | 701 |
| 30 | Ga0065715_10645028 | 3300005293 | Unclassified | 678 |
| 31 | Ga0065715_10959991 | 3300005293 | Unclassified | 556 |
| 32 | Ga0065707_10005134 | 3300005295 | Bacteria | 8707 |
| 33 | Ga0065707_10088064 | 3300005295 | Bacteria | 4793 |
| 34 | Ga0065707_10172428 | 3300005295 | Bacteria | 1475 |
| 35 | Ga0065707_10568813 | 3300005295 | Unclassified | 707 |
| 36 | Ga0070676_10106466 | 3300005328 | Unclassified | 1740 |
| 37 | Ga0070676_10113692 | 3300005328 | Bacteria | 1689 |
| 38 | Ga0070676_10181261 | 3300005328 | Bacteria | 1369 |
| 39 | Ga0070676_10289806 | 3300005328 | Bacteria | 1106 |
| 40 | Ga0070676_10326972 | 3300005328 | Bacteria | 1047 |
| 41 | Ga0070690_100023588 | 3300005330 | Bacteria | 3774 |
| 42 | Ga0070690_100034913 | 3300005330 | Bacteria | 3153 |
| 43 | Ga0070690_100056026 | 3300005330 | Bacteria | 2526 |
| 44 | Ga0070690_100091693 | 3300005330 | Bacteria | 2002 |
| 45 | Ga0070690_100300048 | 3300005330 | Bacteria | 1152 |
| 46 | Ga0070690_100542074 | 3300005330 | Bacteria | 876 |
| 47 | Ga0070670_100000223 | 3300005331 | Bacteria | 52272 |
| 48 | Ga0070670_100311022 | 3300005331 | Bacteria | 1379 |
| 49 | Ga0070670_101063919 | 3300005331 | Unclassified | 737 |
| 50 | Ga0070670_101652653 | 3300005331 | Unclassified | 589 |
| 51 | Ga0070670_101842181 | 3300005331 | Unclassified | 557 |
| 52 | Ga0070677_10110060 | 3300005333 | Unclassified | 1228 |
| 53 | Ga0068869_100011825 | 3300005334 | Bacteria | 5741 |
| 54 | Ga0068869_100044168 | 3300005334 | Bacteria | 3204 |
| 55 | Ga0068869_100083377 | 3300005334 | Bacteria | 2391 |
| 56 | Ga0068869_100203347 | 3300005334 | Bacteria | 1563 |
| 57 | Ga0068869_100240691 | 3300005334 | Bacteria | 1442 |
| 58 | Ga0068869_100355711 | 3300005334 | Unclassified | 1195 |
| 59 | Ga0068869_100964653 | 3300005334 | Unclassified | 741 |
| 60 | Ga0068869_101187471 | 3300005334 | Bacteria | 670 |
| 61 | Ga0068869_101238109 | 3300005334 | Unclassified | 657 |
| 62 | Ga0068869_101486457 | 3300005334 | Unclassified | 601 |
| 63 | Ga0070666_10059790 | 3300005335 | Bacteria | 2578 |
| 64 | Ga0070666_10289988 | 3300005335 | Bacteria | 1164 |
| 65 | Ga0070680_100002231 | 3300005336 | Bacteria | 14296 |
| 66 | Ga0070680_100005222 | 3300005336 | Bacteria | 9826 |
| 67 | Ga0070680_100028397 | 3300005336 | Bacteria | 4487 |
| 68 | Ga0070680_100551188 | 3300005336 | Bacteria | 988 |
| 69 | Ga0070680_100738091 | 3300005336 | Bacteria | 848 |
| 70 | Ga0070680_100793590 | 3300005336 | Unclassified | 816 |
| 71 | Ga0070680_100827099 | 3300005336 | Unclassified | 798 |
| 72 | Ga0070682_100000210 | 3300005337 | Bacteria | 42814 |
| 73 | Ga0070682_100163584 | 3300005337 | Bacteria | 1539 |
| 74 | Ga0068868_100010333 | 3300005338 | Bacteria | 6750 |
| 75 | Ga0068868_100046778 | 3300005338 | Bacteria | 3387 |
| 76 | Ga0070660_100095561 | 3300005339 | Bacteria | 2349 |
| 77 | Ga0070660_101595593 | 3300005339 | Unclassified | 555 |
| 78 | Ga0070689_100014454 | 3300005340 | Bacteria | 5735 |
| 79 | Ga0070689_100053759 | 3300005340 | Bacteria | 3117 |
| 80 | Ga0070689_100069366 | 3300005340 | Bacteria | 2750 |
| 81 | Ga0070689_100473908 | 3300005340 | Bacteria | 1068 |
| 82 | Ga0070689_100738401 | 3300005340 | Unclassified | 862 |
| 83 | Ga0070689_100755422 | 3300005340 | Bacteria | 853 |
| 84 | Ga0070689_101852631 | 3300005340 | Unclassified | 550 |
| 85 | Ga0070691_10263163 | 3300005341 | Bacteria | 929 |
| 86 | Ga0070687_100001313 | 3300005343 | Bacteria | 8685 |
| 87 | Ga0070687_100003618 | 3300005343 | Bacteria | 6033 |
| 88 | Ga0070687_100441293 | 3300005343 | Bacteria | 863 |
| 89 | Ga0070661_100075235 | 3300005344 | Bacteria | 2488 |
| 90 | Ga0070661_100296224 | 3300005344 | Bacteria | 1258 |
| 91 | Ga0070692_10096453 | 3300005345 | Bacteria | 1615 |
| 92 | Ga0070692_10160781 | 3300005345 | Bacteria | 1287 |
| 93 | Ga0070692_10956238 | 3300005345 | Unclassified | 596 |
| 94 | Ga0070692_11369616 | 3300005345 | Bacteria | 510 |
| 95 | Ga0070668_100008204 | 3300005347 | Bacteria | 7755 |
| 96 | Ga0070668_100524350 | 3300005347 | Bacteria | 1028 |
| 97 | Ga0070669_100002272 | 3300005353 | Bacteria | 13944 |
| 98 | Ga0070669_100027227 | 3300005353 | Bacteria | 4114 |
| 99 | Ga0070669_100045610 | 3300005353 | Bacteria | 3195 |
| 100 | Ga0070669_100249590 | 3300005353 | Bacteria | 1413 |
| 101 | Ga0070669_100381192 | 3300005353 | Bacteria | 1150 |
| 102 | Ga0070669_100426970 | 3300005353 | Unclassified | 1089 |
| 103 | Ga0070669_100567542 | 3300005353 | Bacteria | 948 |
| 104 | Ga0070669_100808249 | 3300005353 | Bacteria | 797 |
| 105 | Ga0070669_100816450 | 3300005353 | Bacteria | 793 |
| 106 | Ga0070669_101680943 | 3300005353 | Bacteria | 553 |
| 107 | Ga0070675_100000539 | 3300005354 | Bacteria | 25935 |
| 108 | Ga0070675_100009562 | 3300005354 | Bacteria | 7543 |
| 109 | Ga0070675_100024557 | 3300005354 | Unclassified | 4827 |
| 110 | Ga0070675_100029768 | 3300005354 | Unclassified | 4406 |
| 111 | Ga0070675_100088570 | 3300005354 | Bacteria | 2590 |
| 112 | Ga0070675_100118080 | 3300005354 | Bacteria | 2252 |
| 113 | Ga0070675_100218045 | 3300005354 | Bacteria | 1661 |
| 114 | Ga0070675_100720399 | 3300005354 | Unclassified | 909 |
| 115 | Ga0070675_101582618 | 3300005354 | Unclassified | 605 |
| 116 | Ga0070671_100002475 | 3300005355 | Bacteria | 14278 |
| 117 | Ga0070671_100003917 | 3300005355 | Bacteria | 11707 |
| 118 | Ga0070671_100195840 | 3300005355 | Unclassified | 1713 |
| 119 | Ga0070671_100215048 | 3300005355 | Bacteria | 1631 |
| 120 | Ga0070671_101132331 | 3300005355 | Unclassified | 688 |
| 121 | Ga0070674_100058068 | 3300005356 | Bacteria | 2688 |
| 122 | Ga0070674_100403558 | 3300005356 | Bacteria | 1117 |
| 123 | Ga0070674_100488316 | 3300005356 | Bacteria | 1023 |
| 124 | Ga0070674_100853583 | 3300005356 | Unclassified | 790 |
| 125 | Ga0070673_100002003 | 3300005364 | Bacteria | 12294 |
| 126 | Ga0070673_100002995 | 3300005364 | Bacteria | 10423 |
| 127 | Ga0070673_100078240 | 3300005364 | Bacteria | 2675 |
| 128 | Ga0070673_100117114 | 3300005364 | Bacteria | 2217 |
| 129 | Ga0070673_100139839 | 3300005364 | Bacteria | 2041 |
| 130 | Ga0070673_100270655 | 3300005364 | Bacteria | 1487 |
| 131 | Ga0070673_100685464 | 3300005364 | Unclassified | 940 |
| 132 | Ga0070673_100717272 | 3300005364 | Unclassified | 919 |
| 133 | Ga0070673_100919919 | 3300005364 | Unclassified | 812 |
| 134 | Ga0070673_101069266 | 3300005364 | Unclassified | 753 |
| 135 | Ga0070673_101458550 | 3300005364 | Unclassified | 645 |
| 136 | Ga0070688_100011338 | 3300005365 | Unclassified | 4951 |
| 137 | Ga0070688_100205134 | 3300005365 | Bacteria | 1381 |
| 138 | Ga0070688_100246518 | 3300005365 | Unclassified | 1270 |
| 139 | Ga0070688_100598649 | 3300005365 | Unclassified | 843 |
| 140 | Ga0070688_101367289 | 3300005365 | Bacteria | 573 |
| 141 | Ga0070659_100002515 | 3300005366 | Bacteria | 13013 |
| 142 | Ga0070667_100012891 | 3300005367 | Bacteria | 6908 |
| 143 | Ga0070667_100237414 | 3300005367 | Bacteria | 1627 |
| 144 | Ga0070667_100319210 | 3300005367 | Bacteria | 1401 |
| 145 | Ga0070667_100352797 | 3300005367 | Bacteria | 1332 |
| 146 | Ga0070667_100868815 | 3300005367 | Unclassified | 839 |
| 147 | Ga0070667_101226436 | 3300005367 | Bacteria | 702 |
| 148 | Ga0070703_10374978 | 3300005406 | Unclassified | 613 |
| 149 | Ga0070709_10162302 | 3300005434 | Bacteria | 1555 |
| 150 | Ga0070701_10018019 | 3300005438 | Bacteria | 3313 |
| 151 | Ga0070701_10031444 | 3300005438 | Bacteria | 2634 |
| 152 | Ga0070701_10065731 | 3300005438 | Bacteria | 1926 |
| 153 | Ga0070701_10073431 | 3300005438 | Bacteria | 1834 |
| 154 | Ga0070701_10254208 | 3300005438 | Bacteria | 1062 |
| 155 | Ga0070701_10297955 | 3300005438 | Bacteria | 990 |
| 156 | Ga0070705_100007174 | 3300005440 | Bacteria | 5484 |
| 157 | Ga0070705_100047853 | 3300005440 | Bacteria | 2474 |
| 158 | Ga0070705_100058542 | 3300005440 | Bacteria | 2278 |
| 159 | Ga0070705_100087190 | 3300005440 | Bacteria | 1934 |
| 160 | Ga0070705_100146315 | 3300005440 | Bacteria | 1562 |
| 161 | Ga0070705_100455134 | 3300005440 | Bacteria | 961 |
| 162 | Ga0070705_100477381 | 3300005440 | Bacteria | 941 |
| 163 | Ga0070705_100744550 | 3300005440 | Unclassified | 774 |
| 164 | Ga0070705_100841697 | 3300005440 | Unclassified | 733 |
| 165 | Ga0070705_101600347 | 3300005440 | Unclassified | 548 |
| 166 | Ga0070700_100000248 | 3300005441 | Bacteria | 29509 |
| 167 | Ga0070700_100011138 | 3300005441 | Bacteria | 4977 |
| 168 | Ga0070700_100444257 | 3300005441 | Bacteria | 985 |
| 169 | Ga0070700_101345342 | 3300005441 | Unclassified | 602 |
| 170 | Ga0070694_100010531 | 3300005444 | Bacteria | 5708 |
| 171 | Ga0070694_100022116 | 3300005444 | Bacteria | 4072 |
| 172 | Ga0070694_100034441 | 3300005444 | Bacteria | 3340 |
| 173 | Ga0070694_100115170 | 3300005444 | Unclassified | 1921 |
| 174 | Ga0070694_100118963 | 3300005444 | Bacteria | 1893 |
| 175 | Ga0070694_100126411 | 3300005444 | Bacteria | 1841 |
| 176 | Ga0070694_100182093 | 3300005444 | Unclassified | 1555 |
| 177 | Ga0070694_100215744 | 3300005444 | Bacteria | 1437 |
| 178 | Ga0070694_100488470 | 3300005444 | Bacteria | 978 |
| 179 | Ga0070694_100640083 | 3300005444 | Bacteria | 860 |
| 180 | Ga0070694_100678258 | 3300005444 | Bacteria | 836 |
| 181 | Ga0070694_100714109 | 3300005444 | Unclassified | 816 |
| 182 | Ga0070694_101064500 | 3300005444 | Unclassified | 673 |
| 183 | Ga0070694_101139944 | 3300005444 | Unclassified | 652 |
| 184 | Ga0070694_101315517 | 3300005444 | Bacteria | 608 |
| 185 | Ga0070694_101524571 | 3300005444 | Unclassified | 566 |
| 186 | Ga0070694_101729733 | 3300005444 | Unclassified | 532 |
| 187 | Ga0070708_100209342 | 3300005445 | Bacteria | 1827 |
| 188 | Ga0070708_100541240 | 3300005445 | Unclassified | 1098 |
| 189 | Ga0070708_100712438 | 3300005445 | Unclassified | 944 |
| 190 | Ga0070708_100980881 | 3300005445 | Unclassified | 792 |
| 191 | Ga0070708_101229812 | 3300005445 | Unclassified | 700 |
| 192 | Ga0070663_100988050 | 3300005455 | Bacteria | 731 |
| 193 | Ga0070678_100811306 | 3300005456 | Unclassified | 850 |
| 194 | Ga0070662_100151102 | 3300005457 | Bacteria | 1808 |
| 195 | Ga0070662_100501860 | 3300005457 | Unclassified | 1012 |
| 196 | Ga0070681_10000053 | 3300005458 | Bacteria | 81387 |
| 197 | Ga0070681_10009693 | 3300005458 | Bacteria | 9476 |
| 198 | Ga0070681_10039851 | 3300005458 | Bacteria | 4709 |
| 199 | Ga0070681_10124649 | 3300005458 | Bacteria | 2509 |
| 200 | Ga0068867_100027205 | 3300005459 | Bacteria | 4109 |
| 201 | Ga0068867_100031339 | 3300005459 | Bacteria | 3838 |
| 202 | Ga0068867_100312917 | 3300005459 | Bacteria | 1298 |
| 203 | Ga0068867_100359040 | 3300005459 | Unclassified | 1218 |
| 204 | Ga0068867_100397579 | 3300005459 | Bacteria | 1161 |
| 205 | Ga0068867_100632533 | 3300005459 | Bacteria | 937 |
| 206 | Ga0068867_100767527 | 3300005459 | Unclassified | 857 |
| 207 | Ga0068867_100983187 | 3300005459 | Unclassified | 764 |
| 208 | Ga0068867_101216605 | 3300005459 | Unclassified | 692 |
| 209 | Ga0068867_101763956 | 3300005459 | Unclassified | 581 |
| 210 | Ga0070685_10024138 | 3300005466 | Bacteria | 3337 |
| 211 | Ga0070685_10120237 | 3300005466 | Bacteria | 1630 |
| 212 | Ga0070685_10121323 | 3300005466 | Unclassified | 1624 |
| 213 | Ga0070685_11034755 | 3300005466 | Bacteria | 618 |
| 214 | Ga0070706_100000053 | 3300005467 | Bacteria | 139565 |
| 215 | Ga0070706_100006176 | 3300005467 | Bacteria | 11334 |
| 216 | Ga0070706_100007447 | 3300005467 | Bacteria | 10263 |
| 217 | Ga0070706_100036769 | 3300005467 | Bacteria | 4523 |
| 218 | Ga0070706_100085262 | 3300005467 | Bacteria | 2927 |
| 219 | Ga0070706_100287685 | 3300005467 | Bacteria | 1534 |
| 220 | Ga0070706_100522612 | 3300005467 | Unclassified | 1104 |
| 221 | Ga0070706_100676171 | 3300005467 | Unclassified | 958 |
| 222 | Ga0070706_101567035 | 3300005467 | Unclassified | 601 |
| 223 | Ga0070707_100049035 | 3300005468 | Bacteria | 4047 |
| 224 | Ga0070707_100159200 | 3300005468 | Bacteria | 2200 |
| 225 | Ga0070707_100458761 | 3300005468 | Unclassified | 1235 |
| 226 | Ga0070707_100906341 | 3300005468 | Bacteria | 846 |
| 227 | Ga0070707_100926388 | 3300005468 | Unclassified | 836 |
| 228 | Ga0070698_100015537 | 3300005471 | Bacteria | 8041 |
| 229 | Ga0070698_100023480 | 3300005471 | Bacteria | 6446 |
| 230 | Ga0070698_100047663 | 3300005471 | Unclassified | 4380 |
| 231 | Ga0070698_100062415 | 3300005471 | Unclassified | 3760 |
| 232 | Ga0070698_100088484 | 3300005471 | Bacteria | 3082 |
| 233 | Ga0070698_100106269 | 3300005471 | Bacteria | 2776 |
| 234 | Ga0070698_100132219 | 3300005471 | Unclassified | 2450 |
| 235 | Ga0070698_100413846 | 3300005471 | Bacteria | 1282 |
| 236 | Ga0070698_101702297 | 3300005471 | Unclassified | 583 |
| 237 | Ga0070698_101740390 | 3300005471 | Unclassified | 576 |
| 238 | Ga0070698_101829048 | 3300005471 | Unclassified | 560 |
| 239 | Ga0070699_100001084 | 3300005518 | Bacteria | 25336 |
| 240 | Ga0070699_100018502 | 3300005518 | Bacteria | 5983 |
| 241 | Ga0070699_100021527 | 3300005518 | Bacteria | 5560 |
| 242 | Ga0070699_100047344 | 3300005518 | Unclassified | 3720 |
| 243 | Ga0070699_100061761 | 3300005518 | Bacteria | 3246 |
| 244 | Ga0070699_100271468 | 3300005518 | Bacteria | 1518 |
| 245 | Ga0070699_100644027 | 3300005518 | Unclassified | 967 |
| 246 | Ga0070699_101304533 | 3300005518 | Unclassified | 666 |
| 247 | Ga0070679_100000030 | 3300005530 | Bacteria | 108148 |
| 248 | Ga0070679_100095526 | 3300005530 | Bacteria | 2960 |
| 249 | Ga0070679_100131293 | 3300005530 | Bacteria | 2486 |
| 250 | Ga0070679_100470026 | 3300005530 | Bacteria | 1202 |
| 251 | Ga0070684_100054258 | 3300005535 | Bacteria | 3492 |
| 252 | Ga0070684_101753274 | 3300005535 | Bacteria | 586 |
| 253 | Ga0070697_100000815 | 3300005536 | Bacteria | 23370 |
| 254 | Ga0070697_100002202 | 3300005536 | Bacteria | 14960 |
| 255 | Ga0070697_100011445 | 3300005536 | Bacteria | 6935 |
| 256 | Ga0070697_100066544 | 3300005536 | Unclassified | 2946 |
| 257 | Ga0070697_100449920 | 3300005536 | Unclassified | 1122 |
| 258 | Ga0070697_101698323 | 3300005536 | Unclassified | 565 |
| 259 | Ga0070697_101976435 | 3300005536 | Unclassified | 522 |
| 260 | Ga0070672_100028482 | 3300005543 | Bacteria | 4179 |
| 261 | Ga0070672_100100863 | 3300005543 | Bacteria | 2341 |
| 262 | Ga0070672_100700085 | 3300005543 | Unclassified | 887 |
| 263 | Ga0070672_101587759 | 3300005543 | Unclassified | 587 |
| 264 | Ga0070686_100003241 | 3300005544 | Bacteria | 8908 |
| 265 | Ga0070686_100003645 | 3300005544 | Bacteria | 8450 |
| 266 | Ga0070686_100072525 | 3300005544 | Bacteria | 2258 |
| 267 | Ga0070686_100104425 | 3300005544 | Unclassified | 1919 |
| 268 | Ga0070686_100194045 | 3300005544 | Bacteria | 1451 |
| 269 | Ga0070686_100279213 | 3300005544 | Bacteria | 1231 |
| 270 | Ga0070686_100563817 | 3300005544 | Bacteria | 893 |
| 271 | Ga0070695_100056181 | 3300005545 | Unclassified | 2539 |
| 272 | Ga0070695_100060367 | 3300005545 | Unclassified | 2457 |
| 273 | Ga0070695_100097003 | 3300005545 | Bacteria | 1979 |
| 274 | Ga0070695_100103617 | 3300005545 | Unclassified | 1920 |
| 275 | Ga0070695_100202170 | 3300005545 | Bacteria | 1420 |
| 276 | Ga0070695_100211263 | 3300005545 | Bacteria | 1393 |
| 277 | Ga0070695_100211506 | 3300005545 | Bacteria | 1392 |
| 278 | Ga0070695_100392297 | 3300005545 | Bacteria | 1050 |
| 279 | Ga0070695_100424180 | 3300005545 | Bacteria | 1013 |
| 280 | Ga0070695_100987162 | 3300005545 | Bacteria | 684 |
| 281 | Ga0070695_101137060 | 3300005545 | Unclassified | 640 |
| 282 | Ga0070695_101224282 | 3300005545 | Bacteria | 618 |
| 283 | Ga0070696_100008993 | 3300005546 | Bacteria | 6685 |
| 284 | Ga0070696_100012093 | 3300005546 | Bacteria | 5784 |
| 285 | Ga0070696_100015019 | 3300005546 | Bacteria | 5199 |
| 286 | Ga0070696_100016605 | 3300005546 | Bacteria | 4962 |
| 287 | Ga0070696_100049388 | 3300005546 | Bacteria | 2922 |
| 288 | Ga0070696_100061058 | 3300005546 | Bacteria | 2636 |
| 289 | Ga0070696_100078322 | 3300005546 | Bacteria | 2337 |
| 290 | Ga0070696_100142136 | 3300005546 | Unclassified | 1755 |
| 291 | Ga0070696_100187618 | 3300005546 | Unclassified | 1537 |
| 292 | Ga0070696_100296973 | 3300005546 | Bacteria | 1236 |
| 293 | Ga0070696_100362221 | 3300005546 | Bacteria | 1126 |
| 294 | Ga0070696_100369548 | 3300005546 | Bacteria | 1115 |
| 295 | Ga0070696_100384532 | 3300005546 | Unclassified | 1094 |
| 296 | Ga0070696_100452811 | 3300005546 | Bacteria | 1013 |
| 297 | Ga0070696_101467076 | 3300005546 | Unclassified | 583 |
| 298 | Ga0070693_100005361 | 3300005547 | Bacteria | 6150 |
| 299 | Ga0070693_100134485 | 3300005547 | Bacteria | 1549 |
| 300 | Ga0070693_100667526 | 3300005547 | Unclassified | 758 |
| 301 | Ga0070693_100831899 | 3300005547 | Bacteria | 687 |
| 302 | Ga0070665_100621938 | 3300005548 | Bacteria | 1093 |
| 303 | Ga0070665_100652801 | 3300005548 | Bacteria | 1065 |
| 304 | Ga0070704_100017172 | 3300005549 | Bacteria | 4594 |
| 305 | Ga0070704_100047827 | 3300005549 | Bacteria | 2992 |
| 306 | Ga0070704_100067298 | 3300005549 | Bacteria | 2586 |
| 307 | Ga0070704_100075324 | 3300005549 | Bacteria | 2465 |
| 308 | Ga0070704_100133972 | 3300005549 | Bacteria | 1925 |
| 309 | Ga0070704_100147907 | 3300005549 | Unclassified | 1843 |
| 310 | Ga0070704_100160798 | 3300005549 | Unclassified | 1776 |
| 311 | Ga0070704_100322848 | 3300005549 | Bacteria | 1294 |
| 312 | Ga0070704_100437221 | 3300005549 | Bacteria | 1124 |
| 313 | Ga0070704_100889414 | 3300005549 | Unclassified | 800 |
| 314 | Ga0070704_100990059 | 3300005549 | Unclassified | 760 |
| 315 | Ga0068855_100310167 | 3300005563 | Bacteria | 1746 |
| 316 | Ga0068855_100391708 | 3300005563 | Unclassified | 1524 |
| 317 | Ga0068855_100996467 | 3300005563 | Bacteria | 880 |
| 318 | Ga0068855_101612168 | 3300005563 | Unclassified | 664 |
| 319 | Ga0070664_100000993 | 3300005564 | Bacteria | 22209 |
| 320 | Ga0070664_100003271 | 3300005564 | Bacteria | 13098 |
| 321 | Ga0070664_100123989 | 3300005564 | Bacteria | 2264 |
| 322 | Ga0070664_100126990 | 3300005564 | Bacteria | 2238 |
| 323 | Ga0070664_100146323 | 3300005564 | Bacteria | 2084 |
| 324 | Ga0070664_100276488 | 3300005564 | Unclassified | 1514 |
| 325 | Ga0070664_101528368 | 3300005564 | Unclassified | 632 |
| 326 | Ga0068857_100000975 | 3300005577 | Bacteria | 21916 |
| 327 | Ga0068857_100109569 | 3300005577 | Bacteria | 2481 |
| 328 | Ga0068857_100279702 | 3300005577 | Bacteria | 1535 |
| 329 | Ga0068857_100452727 | 3300005577 | Unclassified | 1200 |
| 330 | Ga0068857_101624632 | 3300005577 | Unclassified | 631 |
| 331 | Ga0068857_102135000 | 3300005577 | Unclassified | 550 |
| 332 | Ga0068854_100077477 | 3300005578 | Unclassified | 2447 |
| 333 | Ga0068854_100142980 | 3300005578 | Bacteria | 1838 |
| 334 | Ga0068854_100378723 | 3300005578 | Bacteria | 1165 |
| 335 | Ga0068854_100515312 | 3300005578 | Bacteria | 1009 |
| 336 | Ga0068856_100020464 | 3300005614 | Bacteria | 6427 |
| 337 | Ga0070702_100039155 | 3300005615 | Bacteria | 2644 |
| 338 | Ga0070702_100162399 | 3300005615 | Bacteria | 1445 |
| 339 | Ga0070702_100532340 | 3300005615 | Unclassified | 869 |
| 340 | Ga0068852_101696275 | 3300005616 | Unclassified | 654 |
| 341 | Ga0068859_100003712 | 3300005617 | Bacteria | 15561 |
| 342 | Ga0068859_100003989 | 3300005617 | Bacteria | 15044 |
| 343 | Ga0068859_100007068 | 3300005617 | Bacteria | 11402 |
| 344 | Ga0068859_100024761 | 3300005617 | Bacteria | 6023 |
| 345 | Ga0068859_100042357 | 3300005617 | Bacteria | 4573 |
| 346 | Ga0068859_100090453 | 3300005617 | Unclassified | 3112 |
| 347 | Ga0068859_100119377 | 3300005617 | Bacteria | 2703 |
| 348 | Ga0068859_100219375 | 3300005617 | Unclassified | 1989 |
| 349 | Ga0068859_100523200 | 3300005617 | Bacteria | 1281 |
| 350 | Ga0068859_100573501 | 3300005617 | Bacteria | 1222 |
| 351 | Ga0068859_101309365 | 3300005617 | Unclassified | 798 |
| 352 | Ga0068859_101567494 | 3300005617 | Bacteria | 727 |
| 353 | Ga0068859_101642927 | 3300005617 | Unclassified | 710 |
| 354 | Ga0068859_101977815 | 3300005617 | Unclassified | 644 |
| 355 | Ga0068859_103061892 | 3300005617 | Unclassified | 510 |
| 356 | Ga0068859_103088479 | 3300005617 | Unclassified | 508 |
| 357 | Ga0068864_100007365 | 3300005618 | Bacteria | 9056 |
| 358 | Ga0068864_100010943 | 3300005618 | Bacteria | 7499 |
| 359 | Ga0068864_100174023 | 3300005618 | Bacteria | 1964 |
| 360 | Ga0068864_100191376 | 3300005618 | Bacteria | 1875 |
| 361 | Ga0068864_100435052 | 3300005618 | Bacteria | 1252 |
| 362 | Ga0068864_100658325 | 3300005618 | Bacteria | 1020 |
| 363 | Ga0068864_101000255 | 3300005618 | Bacteria | 829 |
| 364 | Ga0068864_101249732 | 3300005618 | Bacteria | 742 |
| 365 | Ga0068864_101476907 | 3300005618 | Unclassified | 682 |
| 366 | Ga0068864_101573086 | 3300005618 | Bacteria | 661 |
| 367 | Ga0068864_101949007 | 3300005618 | Unclassified | 593 |
| 368 | Ga0068866_10023361 | 3300005718 | Bacteria | 2875 |
| 369 | Ga0068866_10023772 | 3300005718 | Bacteria | 2855 |
| 370 | Ga0068866_10666507 | 3300005718 | Unclassified | 710 |
| 371 | Ga0068866_11086399 | 3300005718 | Unclassified | 572 |
| 372 | Ga0068861_100002914 | 3300005719 | Bacteria | 11283 |
| 373 | Ga0068861_100096956 | 3300005719 | Bacteria | 2338 |
| 374 | Ga0068861_100123195 | 3300005719 | Bacteria | 2094 |
| 375 | Ga0068861_100270860 | 3300005719 | Bacteria | 1458 |
| 376 | Ga0068861_100391804 | 3300005719 | Bacteria | 1230 |
| 377 | Ga0068861_100453071 | 3300005719 | Bacteria | 1150 |
| 378 | Ga0068861_100650624 | 3300005719 | Unclassified | 974 |
| 379 | Ga0068861_100651352 | 3300005719 | Unclassified | 973 |
| 380 | Ga0068861_100655269 | 3300005719 | Unclassified | 970 |
| 381 | Ga0068861_101217006 | 3300005719 | Unclassified | 729 |
| 382 | Ga0068861_101443807 | 3300005719 | Unclassified | 673 |
| 383 | Ga0068861_101906486 | 3300005719 | Bacteria | 591 |
| 384 | Ga0068861_101987071 | 3300005719 | Bacteria | 580 |
| 385 | Ga0068870_10170287 | 3300005840 | Unclassified | 1299 |
| 386 | Ga0068870_10315820 | 3300005840 | Unclassified | 991 |
| 387 | Ga0068863_100000577 | 3300005841 | Bacteria | 37376 |
| 388 | Ga0068863_100029077 | 3300005841 | Bacteria | 5277 |
| 389 | Ga0068863_100109843 | 3300005841 | Bacteria | 2626 |
| 390 | Ga0068863_100143103 | 3300005841 | Bacteria | 2286 |
| 391 | Ga0068863_100262294 | 3300005841 | Bacteria | 1671 |
| 392 | Ga0068863_100269386 | 3300005841 | Unclassified | 1648 |
| 393 | Ga0068863_100300763 | 3300005841 | Bacteria | 1556 |
| 394 | Ga0068863_100354247 | 3300005841 | Bacteria | 1430 |
| 395 | Ga0068863_100471379 | 3300005841 | Bacteria | 1234 |
| 396 | Ga0068863_100549393 | 3300005841 | Archaea | 1140 |
| 397 | Ga0068863_101100872 | 3300005841 | Unclassified | 799 |
| 398 | Ga0068858_100015618 | 3300005842 | Bacteria | 7141 |
| 399 | Ga0068858_100026768 | 3300005842 | Bacteria | 5357 |
| 400 | Ga0068858_100298636 | 3300005842 | Unclassified | 1536 |
| 401 | Ga0068858_100514322 | 3300005842 | Bacteria | 1157 |
| 402 | Ga0068858_100533381 | 3300005842 | Unclassified | 1136 |
| 403 | Ga0068858_100832317 | 3300005842 | Unclassified | 901 |
| 404 | Ga0068858_101292501 | 3300005842 | Unclassified | 718 |
| 405 | Ga0068860_100001406 | 3300005843 | Bacteria | 26084 |
| 406 | Ga0068860_100025516 | 3300005843 | Bacteria | 5701 |
| 407 | Ga0068860_100102595 | 3300005843 | Bacteria | 2730 |
| 408 | Ga0068860_100142573 | 3300005843 | Bacteria | 2304 |
| 409 | Ga0068860_100188068 | 3300005843 | Unclassified | 1998 |
| 410 | Ga0068860_100273947 | 3300005843 | Unclassified | 1648 |
| 411 | Ga0068860_100335601 | 3300005843 | Bacteria | 1485 |
| 412 | Ga0068860_100529876 | 3300005843 | Bacteria | 1178 |
| 413 | Ga0068860_100578764 | 3300005843 | Unclassified | 1127 |
| 414 | Ga0068862_100009473 | 3300005844 | Bacteria | 8057 |
| 415 | Ga0068862_100022410 | 3300005844 | Bacteria | 5283 |
| 416 | Ga0068862_100052837 | 3300005844 | Bacteria | 3477 |
| 417 | Ga0068862_100062876 | 3300005844 | Bacteria | 3193 |
| 418 | Ga0068862_100197680 | 3300005844 | Bacteria | 1812 |
| 419 | Ga0068862_100385397 | 3300005844 | Bacteria | 1308 |
| 420 | Ga0068862_100947620 | 3300005844 | Unclassified | 849 |
| 421 | Ga0081539_10000481 | 3300005985 | Bacteria | 84382 |
| 422 | Ga0075432_10037234 | 3300006058 | Bacteria | 1693 |
| 423 | Ga0075432_10271962 | 3300006058 | Bacteria | 694 |
| 424 | Ga0070716_100030114 | 3300006173 | Unclassified | 2941 |
| 425 | Ga0070716_100064804 | 3300006173 | Bacteria | 2126 |
| 426 | Ga0097621_100017050 | 3300006237 | Bacteria | 5508 |
| 427 | Ga0097621_100090628 | 3300006237 | Bacteria | 2559 |
| 428 | Ga0097621_100363789 | 3300006237 | Bacteria | 1289 |
| 429 | Ga0068871_100015902 | 3300006358 | Bacteria | 5650 |
| 430 | Ga0068871_100145924 | 3300006358 | Unclassified | 2015 |
| 431 | Ga0068871_100245069 | 3300006358 | Bacteria | 1559 |
| 432 | Ga0068871_101189603 | 3300006358 | Unclassified | 715 |
| 433 | Ga0075428_100248221 | 3300006844 | Bacteria | 1919 |
| 434 | Ga0075428_100564362 | 3300006844 | Bacteria | 1216 |
| 435 | Ga0075428_100641772 | 3300006844 | Bacteria | 1133 |
| 436 | Ga0075430_100324768 | 3300006846 | Bacteria | 1272 |
| 437 | Ga0075431_100753093 | 3300006847 | Bacteria | 949 |
| 438 | Ga0075431_101698127 | 3300006847 | Unclassified | 588 |
| 439 | Ga0075433_10032085 | 3300006852 | Bacteria | 4496 |
| 440 | Ga0075433_10032560 | 3300006852 | Unclassified | 4465 |
| 441 | Ga0075433_10196138 | 3300006852 | Bacteria | 1796 |
| 442 | Ga0075433_10197263 | 3300006852 | Bacteria | 1790 |
| 443 | Ga0075433_10231501 | 3300006852 | Bacteria | 1641 |
| 444 | Ga0075433_10410322 | 3300006852 | Bacteria | 1195 |
| 445 | Ga0075433_10451352 | 3300006852 | Unclassified | 1133 |
| 446 | Ga0075433_10470009 | 3300006852 | Bacteria | 1108 |
| 447 | Ga0075433_10695064 | 3300006852 | Unclassified | 891 |
| 448 | Ga0075433_10942830 | 3300006852 | Bacteria | 752 |
| 449 | Ga0075433_11055049 | 3300006852 | Unclassified | 707 |
| 450 | Ga0075433_11137108 | 3300006852 | Bacteria | 679 |
| 451 | Ga0075434_100015289 | 3300006871 | Bacteria | 7355 |
| 452 | Ga0075434_100059966 | 3300006871 | Bacteria | 3784 |
| 453 | Ga0075434_100062144 | 3300006871 | Bacteria | 3717 |
| 454 | Ga0075434_100068328 | 3300006871 | Bacteria | 3540 |
| 455 | Ga0075434_100103280 | 3300006871 | Unclassified | 2858 |
| 456 | Ga0075434_100368380 | 3300006871 | Bacteria | 1458 |
| 457 | Ga0075434_100511283 | 3300006871 | Bacteria | 1222 |
| 458 | Ga0075434_101717762 | 3300006871 | Unclassified | 635 |
| 459 | Ga0075429_100128407 | 3300006880 | Bacteria | 2217 |
| 460 | Ga0075429_100589542 | 3300006880 | Unclassified | 974 |
| 461 | Ga0068865_100012041 | 3300006881 | Bacteria | 5436 |
| 462 | Ga0068865_100130531 | 3300006881 | Bacteria | 1882 |
| 463 | Ga0068865_101000859 | 3300006881 | Unclassified | 732 |
| 464 | Ga0068865_101760806 | 3300006881 | Unclassified | 559 |
| 465 | Ga0068865_101854264 | 3300006881 | Unclassified | 545 |
| 466 | Ga0075436_100005634 | 3300006914 | Bacteria | 8596 |
| 467 | Ga0075436_100311312 | 3300006914 | Bacteria | 1130 |
| 468 | Ga0075436_100819003 | 3300006914 | Unclassified | 694 |
| 469 | Ga0097620_100003712 | 3300006931 | Bacteria | 15561 |
| 470 | Ga0097620_100003989 | 3300006931 | Bacteria | 15044 |
| 471 | Ga0097620_100007068 | 3300006931 | Bacteria | 11402 |
| 472 | Ga0097620_100024762 | 3300006931 | Bacteria | 6023 |
| 473 | Ga0097620_100042356 | 3300006931 | Bacteria | 4573 |
| 474 | Ga0097620_100090448 | 3300006931 | Unclassified | 3112 |
| 475 | Ga0097620_100119378 | 3300006931 | Bacteria | 2703 |
| 476 | Ga0097620_100219380 | 3300006931 | Unclassified | 1989 |
| 477 | Ga0097620_100523245 | 3300006931 | Bacteria | 1281 |
| 478 | Ga0097620_100573522 | 3300006931 | Bacteria | 1222 |
| 479 | Ga0097620_101309411 | 3300006931 | Unclassified | 798 |
| 480 | Ga0097620_101567701 | 3300006931 | Bacteria | 727 |
| 481 | Ga0097620_101643049 | 3300006931 | Unclassified | 710 |
| 482 | Ga0097620_101977669 | 3300006931 | Unclassified | 644 |
| 483 | Ga0097620_103061592 | 3300006931 | Unclassified | 510 |
| 484 | Ga0097620_103088224 | 3300006931 | Unclassified | 508 |
| 485 | Ga0075435_100039945 | 3300007076 | Bacteria | 3745 |
| 486 | Ga0075435_100043657 | 3300007076 | Bacteria | 3589 |
| 487 | Ga0075435_100076034 | 3300007076 | Bacteria | 2751 |
| 488 | Ga0075435_100196201 | 3300007076 | Bacteria | 1710 |
| 489 | Ga0075435_100571024 | 3300007076 | Bacteria | 980 |
| 490 | Ga0075435_100664471 | 3300007076 | Unclassified | 905 |
| 491 | Ga0099794_10017128 | 3300007265 | Archaea | 3225 |
| 492 | Ga0099794_10070245 | 3300007265 | Bacteria | 1714 |
| 493 | Ga0099794_10140091 | 3300007265 | Bacteria | 1225 |
| 494 | Ga0099794_10470798 | 3300007265 | Unclassified | 660 |
| 495 | Ga0099794_10708150 | 3300007265 | Unclassified | 536 |
| 496 | Ga0105251_10241345 | 3300009011 | Bacteria | 814 |
| 497 | Ga0105244_10517864 | 3300009036 | Unclassified | 549 |
| 498 | Ga0105240_10098906 | 3300009093 | Bacteria | 3552 |
| 499 | Ga0105240_10400527 | 3300009093 | Unclassified | 1546 |
| 500 | Ga0105240_12366288 | 3300009093 | Unclassified | 550 |
| 501 | Ga0111539_10002073 | 3300009094 | Bacteria | 26784 |
| 502 | Ga0111539_10006551 | 3300009094 | Bacteria | 15008 |
| 503 | Ga0111539_10176825 | 3300009094 | Bacteria | 2493 |
| 504 | Ga0111539_10469022 | 3300009094 | Unclassified | 1466 |
| 505 | Ga0111539_10665708 | 3300009094 | Bacteria | 1212 |
| 506 | Ga0111539_10938175 | 3300009094 | Bacteria | 1006 |
| 507 | Ga0111539_11037745 | 3300009094 | Bacteria | 953 |
| 508 | Ga0105245_10174675 | 3300009098 | Bacteria | 2048 |
| 509 | Ga0105245_10212026 | 3300009098 | Bacteria | 1865 |
| 510 | Ga0105245_10879524 | 3300009098 | Unclassified | 937 |
| 511 | Ga0105245_11349781 | 3300009098 | Unclassified | 762 |
| 512 | Ga0105245_12231265 | 3300009098 | Bacteria | 601 |
| 513 | Ga0105247_10019871 | 3300009101 | Unclassified | 4035 |
| 514 | Ga0105247_10030088 | 3300009101 | Bacteria | 3292 |
| 515 | Ga0105247_10086800 | 3300009101 | Bacteria | 1980 |
| 516 | Ga0105247_10562369 | 3300009101 | Unclassified | 840 |
| 517 | Ga0114129_10001970 | 3300009147 | Bacteria | 28080 |
| 518 | Ga0114129_10026989 | 3300009147 | Bacteria | 8130 |
| 519 | Ga0114129_10029655 | 3300009147 | Bacteria | 7748 |
| 520 | Ga0114129_10050453 | 3300009147 | Bacteria | 5844 |
| 521 | Ga0114129_10090258 | 3300009147 | Unclassified | 4248 |
| 522 | Ga0114129_10119040 | 3300009147 | Unclassified | 3637 |
| 523 | Ga0114129_10123475 | 3300009147 | Bacteria | 3561 |
| 524 | Ga0114129_10144970 | 3300009147 | Bacteria | 3253 |
| 525 | Ga0114129_10223822 | 3300009147 | Bacteria | 2537 |
| 526 | Ga0114129_10309368 | 3300009147 | Unclassified | 2103 |
| 527 | Ga0114129_10328153 | 3300009147 | Unclassified | 2033 |
| 528 | Ga0114129_10511525 | 3300009147 | Bacteria | 1567 |
| 529 | Ga0114129_10512847 | 3300009147 | Bacteria | 1564 |
| 530 | Ga0114129_10754561 | 3300009147 | Unclassified | 1245 |
| 531 | Ga0114129_10778489 | 3300009147 | Bacteria | 1222 |
| 532 | Ga0114129_11683364 | 3300009147 | Bacteria | 774 |
| 533 | Ga0114129_11794373 | 3300009147 | Unclassified | 746 |
| 534 | Ga0114129_11887663 | 3300009147 | Unclassified | 725 |
| 535 | Ga0114129_12448001 | 3300009147 | Unclassified | 625 |
| 536 | Ga0105243_10025836 | 3300009148 | Bacteria | 4491 |
| 537 | Ga0105243_10221169 | 3300009148 | Unclassified | 1674 |
| 538 | Ga0105243_10385983 | 3300009148 | Bacteria | 1297 |
| 539 | Ga0105243_10665195 | 3300009148 | Unclassified | 1011 |
| 540 | Ga0105243_10847218 | 3300009148 | Unclassified | 905 |
| 541 | Ga0105243_10895511 | 3300009148 | Unclassified | 882 |
| 542 | Ga0105243_10993954 | 3300009148 | Bacteria | 841 |
| 543 | Ga0105243_12071062 | 3300009148 | Unclassified | 604 |
| 544 | Ga0105243_12570946 | 3300009148 | Unclassified | 549 |
| 545 | Ga0105243_13093567 | 3300009148 | Unclassified | 504 |
| 546 | Ga0105241_10026459 | 3300009174 | Bacteria | 4317 |
| 547 | Ga0105241_10128760 | 3300009174 | Bacteria | 2047 |
| 548 | Ga0105241_10147680 | 3300009174 | Bacteria | 1920 |
| 549 | Ga0105241_10201235 | 3300009174 | Unclassified | 1663 |
| 550 | Ga0105241_11028917 | 3300009174 | Unclassified | 772 |
| 551 | Ga0105241_11491726 | 3300009174 | Bacteria | 650 |
| 552 | Ga0105241_11831690 | 3300009174 | Bacteria | 593 |
| 553 | Ga0105242_10019807 | 3300009176 | Bacteria | 5271 |
| 554 | Ga0105242_10058067 | 3300009176 | Unclassified | 3171 |
| 555 | Ga0105242_10152961 | 3300009176 | Bacteria | 2013 |
| 556 | Ga0105242_10466642 | 3300009176 | Bacteria | 1193 |
| 557 | Ga0105242_10500637 | 3300009176 | Bacteria | 1155 |
| 558 | Ga0105242_10661929 | 3300009176 | Bacteria | 1017 |
| 559 | Ga0105242_10858089 | 3300009176 | Bacteria | 904 |
| 560 | Ga0105242_11584273 | 3300009176 | Unclassified | 688 |
| 561 | Ga0105242_12427523 | 3300009176 | Bacteria | 572 |
| 562 | Ga0105248_10000477 | 3300009177 | Bacteria | 45623 |
| 563 | Ga0105248_10001987 | 3300009177 | Bacteria | 22745 |
| 564 | Ga0105248_10034210 | 3300009177 | Bacteria | 5681 |
| 565 | Ga0105248_10044241 | 3300009177 | Bacteria | 4994 |
| 566 | Ga0105248_10140455 | 3300009177 | Bacteria | 2725 |
| 567 | Ga0105248_10175381 | 3300009177 | Bacteria | 2416 |
| 568 | Ga0105248_10240928 | 3300009177 | Bacteria | 2036 |
| 569 | Ga0105248_10401039 | 3300009177 | Bacteria | 1544 |
| 570 | Ga0105248_10544267 | 3300009177 | Unclassified | 1310 |
| 571 | Ga0105248_12309056 | 3300009177 | Unclassified | 612 |
| 572 | Ga0105237_10028633 | 3300009545 | Bacteria | 5672 |
| 573 | Ga0105237_10062631 | 3300009545 | Bacteria | 3719 |
| 574 | Ga0105249_10000201 | 3300009553 | Bacteria | 68199 |
| 575 | Ga0105249_10062224 | 3300009553 | Unclassified | 3427 |
| 576 | Ga0105249_10085455 | 3300009553 | Bacteria | 2940 |
| 577 | Ga0105249_10129643 | 3300009553 | Bacteria | 2406 |
| 578 | Ga0105249_10304673 | 3300009553 | Bacteria | 1599 |
| 579 | Ga0105249_11013933 | 3300009553 | Unclassified | 899 |
| 580 | Ga0105249_11602561 | 3300009553 | Unclassified | 723 |
| 581 | Ga0105249_11796245 | 3300009553 | Unclassified | 686 |
| 582 | Ga0105249_13203815 | 3300009553 | Unclassified | 526 |
| 583 | Ga0099796_10084472 | 3300010159 | Bacteria | 1170 |
| 584 | Ga0105239_10068318 | 3300010375 | Bacteria | 3905 |
| 585 | Ga0105239_10098786 | 3300010375 | Unclassified | 3227 |
| 586 | Ga0105239_10991907 | 3300010375 | Bacteria | 966 |
| 587 | Ga0105239_11157402 | 3300010375 | Unclassified | 891 |
| 588 | Ga0105246_10248298 | 3300011119 | Bacteria | 1411 |
| 589 | Ga0105246_10266415 | 3300011119 | Unclassified | 1367 |
| 590 | Ga0105246_10309885 | 3300011119 | Bacteria | 1278 |
| 591 | Ga0105246_10327920 | 3300011119 | Bacteria | 1247 |
| 592 | Ga0105246_10610329 | 3300011119 | Bacteria | 944 |
| 593 | Ga0105246_10953481 | 3300011119 | Bacteria | 773 |
| 594 | Ga0105246_10964375 | 3300011119 | Bacteria | 769 |
| 595 | Ga0105246_11618218 | 3300011119 | Unclassified | 613 |
| 596 | Ga0157373_10047943 | 3300013100 | Bacteria | 3046 |
| 597 | Ga0157373_10277704 | 3300013100 | Unclassified | 1187 |
| 598 | Ga0157374_10049408 | 3300013296 | Bacteria | 3906 |
| 599 | Ga0157374_10061420 | 3300013296 | Bacteria | 3519 |
| 600 | Ga0157374_10151739 | 3300013296 | Archaea | 2253 |
| 601 | Ga0157374_12632849 | 3300013296 | Unclassified | 531 |
| 602 | Ga0157378_10019509 | 3300013297 | Bacteria | 5961 |
| 603 | Ga0157378_10022463 | 3300013297 | Bacteria | 5553 |
| 604 | Ga0157378_10033382 | 3300013297 | Bacteria | 4549 |
| 605 | Ga0157378_10070495 | 3300013297 | Bacteria | 3139 |
| 606 | Ga0157378_10079059 | 3300013297 | Bacteria | 2968 |
| 607 | Ga0157378_10119386 | 3300013297 | Bacteria | 2428 |
| 608 | Ga0157378_10128948 | 3300013297 | Bacteria | 2339 |
| 609 | Ga0157378_10254053 | 3300013297 | Unclassified | 1684 |
| 610 | Ga0157378_10262453 | 3300013297 | Bacteria | 1658 |
| 611 | Ga0157378_10263611 | 3300013297 | Bacteria | 1654 |
| 612 | Ga0157378_10340235 | 3300013297 | Bacteria | 1463 |
| 613 | Ga0157378_10406026 | 3300013297 | Unclassified | 1343 |
| 614 | Ga0157378_12117882 | 3300013297 | Unclassified | 613 |
| 615 | Ga0157378_12645343 | 3300013297 | Unclassified | 554 |
| 616 | Ga0163162_10000128 | 3300013306 | Bacteria | 68199 |
| 617 | Ga0163162_10003297 | 3300013306 | Bacteria | 15445 |
| 618 | Ga0163162_10006443 | 3300013306 | Bacteria | 11370 |
| 619 | Ga0163162_10015820 | 3300013306 | Bacteria | 7371 |
| 620 | Ga0163162_10034610 | 3300013306 | Bacteria | 5027 |
| 621 | Ga0163162_10072560 | 3300013306 | Bacteria | 3497 |
| 622 | Ga0163162_10102852 | 3300013306 | Bacteria | 2950 |
| 623 | Ga0163162_10675855 | 3300013306 | Unclassified | 1155 |
| 624 | Ga0163162_10768925 | 3300013306 | Unclassified | 1082 |
| 625 | Ga0163162_11111392 | 3300013306 | Bacteria | 896 |
| 626 | Ga0163162_11173387 | 3300013306 | Bacteria | 871 |
| 627 | Ga0163162_11360662 | 3300013306 | Bacteria | 807 |
| 628 | Ga0163162_11466312 | 3300013306 | Unclassified | 777 |
| 629 | Ga0157372_10120127 | 3300013307 | Bacteria | 3017 |
| 630 | Ga0157372_10848062 | 3300013307 | Unclassified | 1061 |
| 631 | Ga0157372_11256796 | 3300013307 | Unclassified | 855 |
| 632 | Ga0157372_12808005 | 3300013307 | Unclassified | 558 |
| 633 | Ga0157375_10000307 | 3300013308 | Bacteria | 44303 |
| 634 | Ga0157375_10001282 | 3300013308 | Bacteria | 21701 |
| 635 | Ga0157375_10016863 | 3300013308 | Bacteria | 6576 |
| 636 | Ga0157375_10031253 | 3300013308 | Bacteria | 5030 |
| 637 | Ga0157375_10039220 | 3300013308 | Bacteria | 4557 |
| 638 | Ga0157375_10067249 | 3300013308 | Bacteria | 3580 |
| 639 | Ga0157375_10169065 | 3300013308 | Bacteria | 2333 |
| 640 | Ga0157375_10333571 | 3300013308 | Unclassified | 1682 |
| 641 | Ga0157375_10368311 | 3300013308 | Bacteria | 1603 |
| 642 | Ga0157375_10370963 | 3300013308 | Bacteria | 1597 |
| 643 | Ga0157375_10466333 | 3300013308 | Bacteria | 1428 |
| 644 | Ga0157375_10479287 | 3300013308 | Bacteria | 1409 |
| 645 | Ga0157375_10567149 | 3300013308 | Bacteria | 1296 |
| 646 | Ga0157375_10627866 | 3300013308 | Unclassified | 1232 |
| 647 | Ga0157375_10790649 | 3300013308 | Bacteria | 1098 |
| 648 | Ga0157375_11671413 | 3300013308 | Unclassified | 754 |
| 649 | Ga0157375_11701434 | 3300013308 | Unclassified | 747 |
| 650 | Ga0157375_13229279 | 3300013308 | Bacteria | 544 |
| 651 | Ga0163163_10004672 | 3300014325 | Bacteria | 11713 |
| 652 | Ga0163163_10026850 | 3300014325 | Bacteria | 5508 |
| 653 | Ga0163163_10046151 | 3300014325 | Bacteria | 4279 |
| 654 | Ga0163163_10056787 | 3300014325 | Bacteria | 3869 |
| 655 | Ga0163163_10076357 | 3300014325 | Bacteria | 3345 |
| 656 | Ga0163163_10121557 | 3300014325 | Unclassified | 2645 |
| 657 | Ga0163163_10296601 | 3300014325 | Bacteria | 1669 |
| 658 | Ga0163163_10440351 | 3300014325 | Bacteria | 1363 |
| 659 | Ga0163163_10490414 | 3300014325 | Bacteria | 1290 |
| 660 | Ga0163163_10772789 | 3300014325 | Bacteria | 1024 |
| 661 | Ga0157380_10009334 | 3300014326 | Bacteria | 7026 |
| 662 | Ga0157380_10010880 | 3300014326 | Bacteria | 6560 |
| 663 | Ga0157380_10019160 | 3300014326 | Bacteria | 5097 |
| 664 | Ga0157380_10023228 | 3300014326 | Bacteria | 4676 |
| 665 | Ga0157380_10044093 | 3300014326 | Bacteria | 3494 |
| 666 | Ga0157380_10065618 | 3300014326 | Unclassified | 2918 |
| 667 | Ga0157380_10081799 | 3300014326 | Unclassified | 2642 |
| 668 | Ga0157380_10273918 | 3300014326 | Bacteria | 1540 |
| 669 | Ga0157380_10311925 | 3300014326 | Bacteria | 1454 |
| 670 | Ga0157380_10625549 | 3300014326 | Unclassified | 1069 |
| 671 | Ga0182008_10923308 | 3300014497 | Bacteria | 515 |
| 672 | Ga0157377_10110174 | 3300014745 | Bacteria | 1654 |
| 673 | Ga0157377_10110701 | 3300014745 | Bacteria | 1650 |
| 674 | Ga0157377_10232398 | 3300014745 | Bacteria | 1186 |
| 675 | Ga0157377_10233164 | 3300014745 | Unclassified | 1185 |
| 676 | Ga0157377_10874126 | 3300014745 | Unclassified | 670 |
| 677 | Ga0157379_10049799 | 3300014968 | Unclassified | 3740 |
| 678 | Ga0157379_10218545 | 3300014968 | Bacteria | 1726 |
| 679 | Ga0157376_10135708 | 3300014969 | Bacteria | 2201 |
| 680 | Ga0157376_10168566 | 3300014969 | Unclassified | 1992 |
| 681 | Ga0157376_10274566 | 3300014969 | Unclassified | 1585 |
| 682 | Ga0157376_11596226 | 3300014969 | Bacteria | 687 |
| 683 | Ga0157376_12239743 | 3300014969 | Unclassified | 585 |
| 684 | Ga0182007_10047721 | 3300015262 | Bacteria | 1416 |
| 685 | Ga0163161_10022540 | 3300017792 | Bacteria | 4436 |
| 686 | Ga0163161_10031371 | 3300017792 | Bacteria | 3786 |
| 687 | Ga0163161_10106879 | 3300017792 | Unclassified | 2088 |
| 688 | Ga0163161_10119457 | 3300017792 | Bacteria | 1979 |
| 689 | Ga0207697_10052010 | 3300025315 | Unclassified | 1694 |
| 690 | Ga0207682_10023989 | 3300025893 | Unclassified | 2413 |
| 691 | Ga0207642_10093758 | 3300025899 | Unclassified | 1490 |
| 692 | Ga0207642_10479342 | 3300025899 | Bacteria | 758 |
| 693 | Ga0207710_10011750 | 3300025900 | Bacteria | 3682 |
| 694 | Ga0207710_10043674 | 3300025900 | Bacteria | 1994 |
| 695 | Ga0207710_10092241 | 3300025900 | Bacteria | 1419 |
| 696 | Ga0207710_10102147 | 3300025900 | Bacteria | 1353 |
| 697 | Ga0207688_10098098 | 3300025901 | Bacteria | 1689 |
| 698 | Ga0207680_10145233 | 3300025903 | Bacteria | 1576 |
| 699 | Ga0207645_10072452 | 3300025907 | Bacteria | 2205 |
| 700 | Ga0207645_10308651 | 3300025907 | Bacteria | 1054 |
| 701 | Ga0207645_10941634 | 3300025907 | Unclassified | 586 |
| 702 | Ga0207643_10955168 | 3300025908 | Unclassified | 555 |
| 703 | Ga0207684_10000053 | 3300025910 | Bacteria | 225260 |
| 704 | Ga0207684_10040204 | 3300025910 | Bacteria | 3965 |
| 705 | Ga0207684_10197469 | 3300025910 | Bacteria | 1735 |
| 706 | Ga0207684_10309509 | 3300025910 | Bacteria | 1362 |
| 707 | Ga0207684_10856041 | 3300025910 | Unclassified | 766 |
| 708 | Ga0207684_11040759 | 3300025910 | Unclassified | 683 |
| 709 | Ga0207654_10095292 | 3300025911 | Bacteria | 1823 |
| 710 | Ga0207654_10109735 | 3300025911 | Unclassified | 1714 |
| 711 | Ga0207654_10531275 | 3300025911 | Unclassified | 834 |
| 712 | Ga0207654_10670543 | 3300025911 | Bacteria | 744 |
| 713 | Ga0207654_11228333 | 3300025911 | Unclassified | 546 |
| 714 | Ga0207707_10000063 | 3300025912 | Bacteria | 108163 |
| 715 | Ga0207707_10076778 | 3300025912 | Bacteria | 2915 |
| 716 | Ga0207707_10135446 | 3300025912 | Bacteria | 2153 |
| 717 | Ga0207707_10184989 | 3300025912 | Bacteria | 1818 |
| 718 | Ga0207695_10105623 | 3300025913 | Bacteria | 2803 |
| 719 | Ga0207671_10121742 | 3300025914 | Unclassified | 1995 |
| 720 | Ga0207663_10343542 | 3300025916 | Bacteria | 1128 |
| 721 | Ga0207660_10004704 | 3300025917 | Bacteria | 8885 |
| 722 | Ga0207660_10021218 | 3300025917 | Bacteria | 4366 |
| 723 | Ga0207660_10108717 | 3300025917 | Unclassified | 2083 |
| 724 | Ga0207660_10817025 | 3300025917 | Unclassified | 761 |
| 725 | Ga0207660_11035633 | 3300025917 | Bacteria | 669 |
| 726 | Ga0207662_10007338 | 3300025918 | Bacteria | 5998 |
| 727 | Ga0207662_10020795 | 3300025918 | Bacteria | 3746 |
| 728 | Ga0207662_10042706 | 3300025918 | Unclassified | 2673 |
| 729 | Ga0207662_11309689 | 3300025918 | Unclassified | 515 |
| 730 | Ga0207657_10073315 | 3300025919 | Bacteria | 2894 |
| 731 | Ga0207649_10173720 | 3300025920 | Bacteria | 1503 |
| 732 | Ga0207649_10359247 | 3300025920 | Unclassified | 1080 |
| 733 | Ga0207649_10550105 | 3300025920 | Bacteria | 883 |
| 734 | Ga0207652_10000091 | 3300025921 | Bacteria | 98787 |
| 735 | Ga0207652_10163737 | 3300025921 | Bacteria | 1994 |
| 736 | Ga0207652_10474654 | 3300025921 | Bacteria | 1127 |
| 737 | Ga0207652_10518533 | 3300025921 | Unclassified | 1072 |
| 738 | Ga0207646_10459041 | 3300025922 | Bacteria | 1149 |
| 739 | Ga0207646_10578571 | 3300025922 | Bacteria | 1009 |
| 740 | Ga0207646_10742000 | 3300025922 | Unclassified | 876 |
| 741 | Ga0207681_10000966 | 3300025923 | Bacteria | 18757 |
| 742 | Ga0207681_10085292 | 3300025923 | Unclassified | 2241 |
| 743 | Ga0207681_10135256 | 3300025923 | Bacteria | 1828 |
| 744 | Ga0207681_10200670 | 3300025923 | Bacteria | 1531 |
| 745 | Ga0207681_10346535 | 3300025923 | Bacteria | 1188 |
| 746 | Ga0207650_10005207 | 3300025925 | Bacteria | 8869 |
| 747 | Ga0207650_10178365 | 3300025925 | Bacteria | 1692 |
| 748 | Ga0207650_11156389 | 3300025925 | Bacteria | 659 |
| 749 | Ga0207659_10000434 | 3300025926 | Bacteria | 25118 |
| 750 | Ga0207659_10006583 | 3300025926 | Bacteria | 7132 |
| 751 | Ga0207659_10009662 | 3300025926 | Bacteria | 6034 |
| 752 | Ga0207659_10108807 | 3300025926 | Bacteria | 2103 |
| 753 | Ga0207659_10118867 | 3300025926 | Unclassified | 2022 |
| 754 | Ga0207659_10171331 | 3300025926 | Bacteria | 1713 |
| 755 | Ga0207659_10532752 | 3300025926 | Unclassified | 997 |
| 756 | Ga0207659_10557278 | 3300025926 | Unclassified | 975 |
| 757 | Ga0207687_10757800 | 3300025927 | Unclassified | 826 |
| 758 | Ga0207644_10011563 | 3300025931 | Bacteria | 5844 |
| 759 | Ga0207644_10054551 | 3300025931 | Bacteria | 2879 |
| 760 | Ga0207690_10016209 | 3300025932 | Bacteria | 4530 |
| 761 | Ga0207706_10042442 | 3300025933 | Unclassified | 4031 |
| 762 | Ga0207706_10046419 | 3300025933 | Unclassified | 3846 |
| 763 | Ga0207706_10192070 | 3300025933 | Bacteria | 1792 |
| 764 | Ga0207706_10197879 | 3300025933 | Unclassified | 1762 |
| 765 | Ga0207686_10130238 | 3300025934 | Bacteria | 1724 |
| 766 | Ga0207686_10187353 | 3300025934 | Unclassified | 1472 |
| 767 | Ga0207686_10649740 | 3300025934 | Unclassified | 834 |
| 768 | Ga0207686_11109250 | 3300025934 | Unclassified | 645 |
| 769 | Ga0207709_10001732 | 3300025935 | Bacteria | 14688 |
| 770 | Ga0207709_10114466 | 3300025935 | Bacteria | 1810 |
| 771 | Ga0207709_10167383 | 3300025935 | Bacteria | 1539 |
| 772 | Ga0207709_10377464 | 3300025935 | Unclassified | 1078 |
| 773 | Ga0207670_10043515 | 3300025936 | Bacteria | 2966 |
| 774 | Ga0207670_10052646 | 3300025936 | Bacteria | 2738 |
| 775 | Ga0207670_10243975 | 3300025936 | Unclassified | 1385 |
| 776 | Ga0207670_10742330 | 3300025936 | Unclassified | 815 |
| 777 | Ga0207670_11386692 | 3300025936 | Unclassified | 597 |
| 778 | Ga0207670_11394776 | 3300025936 | Bacteria | 595 |
| 779 | Ga0207669_10967732 | 3300025937 | Unclassified | 714 |
| 780 | Ga0207704_10064467 | 3300025938 | Bacteria | 2289 |
| 781 | Ga0207704_10452168 | 3300025938 | Unclassified | 1025 |
| 782 | Ga0207665_10038349 | 3300025939 | Bacteria | 3190 |
| 783 | Ga0207665_10156163 | 3300025939 | Unclassified | 1638 |
| 784 | Ga0207691_10008051 | 3300025940 | Bacteria | 10131 |
| 785 | Ga0207691_10110280 | 3300025940 | Bacteria | 2448 |
| 786 | Ga0207691_10604603 | 3300025940 | Bacteria | 928 |
| 787 | Ga0207691_10886894 | 3300025940 | Unclassified | 747 |
| 788 | Ga0207691_11235945 | 3300025940 | Unclassified | 618 |
| 789 | Ga0207711_10019925 | 3300025941 | Bacteria | 5590 |
| 790 | Ga0207711_10069615 | 3300025941 | Bacteria | 3051 |
| 791 | Ga0207711_10139558 | 3300025941 | Bacteria | 2179 |
| 792 | Ga0207711_10141696 | 3300025941 | Bacteria | 2163 |
| 793 | Ga0207711_10997529 | 3300025941 | Bacteria | 777 |
| 794 | Ga0207711_11468110 | 3300025941 | Unclassified | 625 |
| 795 | Ga0207689_10004147 | 3300025942 | Bacteria | 13173 |
| 796 | Ga0207689_10059118 | 3300025942 | Bacteria | 3153 |
| 797 | Ga0207689_10076002 | 3300025942 | Bacteria | 2761 |
| 798 | Ga0207689_10076696 | 3300025942 | Bacteria | 2748 |
| 799 | Ga0207689_10133582 | 3300025942 | Bacteria | 2043 |
| 800 | Ga0207689_10389038 | 3300025942 | Unclassified | 1162 |
| 801 | Ga0207689_10448631 | 3300025942 | Bacteria | 1078 |
| 802 | Ga0207689_10462272 | 3300025942 | Bacteria | 1061 |
| 803 | Ga0207689_10816609 | 3300025942 | Bacteria | 787 |
| 804 | Ga0207689_11100228 | 3300025942 | Bacteria | 670 |
| 805 | Ga0207689_11223102 | 3300025942 | Unclassified | 632 |
| 806 | Ga0207689_11480087 | 3300025942 | Unclassified | 567 |
| 807 | Ga0207679_10003210 | 3300025945 | Bacteria | 10081 |
| 808 | Ga0207679_10012423 | 3300025945 | Bacteria | 5553 |
| 809 | Ga0207679_10113981 | 3300025945 | Bacteria | 2139 |
| 810 | Ga0207679_10239018 | 3300025945 | Bacteria | 1538 |
| 811 | Ga0207679_10437624 | 3300025945 | Bacteria | 1157 |
| 812 | Ga0207679_10482320 | 3300025945 | Unclassified | 1104 |
| 813 | Ga0207667_11079466 | 3300025949 | Unclassified | 787 |
| 814 | Ga0207667_11608008 | 3300025949 | Unclassified | 618 |
| 815 | Ga0207651_10012392 | 3300025960 | Bacteria | 4825 |
| 816 | Ga0207651_10027242 | 3300025960 | Bacteria | 3586 |
| 817 | Ga0207651_10090316 | 3300025960 | Bacteria | 2239 |
| 818 | Ga0207651_10092077 | 3300025960 | Bacteria | 2222 |
| 819 | Ga0207651_10122328 | 3300025960 | Bacteria | 1976 |
| 820 | Ga0207651_10214935 | 3300025960 | Unclassified | 1551 |
| 821 | Ga0207651_11179880 | 3300025960 | Unclassified | 687 |
| 822 | Ga0207712_10000259 | 3300025961 | Bacteria | 51318 |
| 823 | Ga0207712_10044518 | 3300025961 | Bacteria | 3068 |
| 824 | Ga0207712_10143644 | 3300025961 | Bacteria | 1835 |
| 825 | Ga0207712_10438836 | 3300025961 | Bacteria | 1105 |
| 826 | Ga0207712_10570392 | 3300025961 | Unclassified | 975 |
| 827 | Ga0207668_10002115 | 3300025972 | Bacteria | 11592 |
| 828 | Ga0207640_10063069 | 3300025981 | Bacteria | 2461 |
| 829 | Ga0207640_10185759 | 3300025981 | Unclassified | 1563 |
| 830 | Ga0207640_10480048 | 3300025981 | Bacteria | 1031 |
| 831 | Ga0207640_10486217 | 3300025981 | Bacteria | 1025 |
| 832 | Ga0207658_10033070 | 3300025986 | Bacteria | 3686 |
| 833 | Ga0207658_10042921 | 3300025986 | Bacteria | 3284 |
| 834 | Ga0207658_10155866 | 3300025986 | Bacteria | 1866 |
| 835 | Ga0207658_11100662 | 3300025986 | Unclassified | 726 |
| 836 | Ga0207677_10150319 | 3300026023 | Bacteria | 1796 |
| 837 | Ga0207677_10787276 | 3300026023 | Unclassified | 850 |
| 838 | Ga0207703_10026644 | 3300026035 | Bacteria | 4552 |
| 839 | Ga0207703_10064730 | 3300026035 | Unclassified | 3002 |
| 840 | Ga0207703_10139092 | 3300026035 | Bacteria | 2105 |
| 841 | Ga0207703_11054430 | 3300026035 | Unclassified | 780 |
| 842 | Ga0207639_10069785 | 3300026041 | Bacteria | 2743 |
| 843 | Ga0207708_10000471 | 3300026075 | Bacteria | 31120 |
| 844 | Ga0207708_10001411 | 3300026075 | Bacteria | 18027 |
| 845 | Ga0207708_10132149 | 3300026075 | Bacteria | 1952 |
| 846 | Ga0207708_10201603 | 3300026075 | Unclassified | 1587 |
| 847 | Ga0207708_10619079 | 3300026075 | Unclassified | 919 |
| 848 | Ga0207708_11266311 | 3300026075 | Unclassified | 646 |
| 849 | Ga0207702_10041969 | 3300026078 | Bacteria | 3836 |
| 850 | Ga0207641_10000455 | 3300026088 | Bacteria | 46777 |
| 851 | Ga0207641_10076480 | 3300026088 | Bacteria | 2894 |
| 852 | Ga0207641_10152069 | 3300026088 | Unclassified | 2097 |
| 853 | Ga0207641_10237590 | 3300026088 | Unclassified | 1696 |
| 854 | Ga0207641_10252603 | 3300026088 | Bacteria | 1647 |
| 855 | Ga0207641_10451214 | 3300026088 | Bacteria | 1243 |
| 856 | Ga0207641_10619249 | 3300026088 | Unclassified | 1061 |
| 857 | Ga0207641_10825714 | 3300026088 | Unclassified | 918 |
| 858 | Ga0207641_11019281 | 3300026088 | Bacteria | 825 |
| 859 | Ga0207641_11129768 | 3300026088 | Unclassified | 782 |
| 860 | Ga0207648_10048568 | 3300026089 | Bacteria | 3715 |
| 861 | Ga0207648_10056466 | 3300026089 | Bacteria | 3426 |
| 862 | Ga0207648_10141747 | 3300026089 | Bacteria | 2118 |
| 863 | Ga0207648_10177024 | 3300026089 | Unclassified | 1887 |
| 864 | Ga0207648_10262121 | 3300026089 | Bacteria | 1542 |
| 865 | Ga0207648_10680775 | 3300026089 | Unclassified | 952 |
| 866 | Ga0207648_10802390 | 3300026089 | Bacteria | 876 |
| 867 | Ga0207676_10011121 | 3300026095 | Bacteria | 6424 |
| 868 | Ga0207676_10019886 | 3300026095 | Bacteria | 4904 |
| 869 | Ga0207676_10030591 | 3300026095 | Bacteria | 4042 |
| 870 | Ga0207676_10064974 | 3300026095 | Bacteria | 2904 |
| 871 | Ga0207676_10438402 | 3300026095 | Unclassified | 1229 |
| 872 | Ga0207676_10441928 | 3300026095 | Unclassified | 1224 |
| 873 | Ga0207676_10659201 | 3300026095 | Bacteria | 1011 |
| 874 | Ga0207676_10660310 | 3300026095 | Unclassified | 1010 |
| 875 | Ga0207676_10807246 | 3300026095 | Bacteria | 916 |
| 876 | Ga0207676_10925463 | 3300026095 | Unclassified | 856 |
| 877 | Ga0207676_11277421 | 3300026095 | Unclassified | 728 |
| 878 | Ga0207676_11551829 | 3300026095 | Unclassified | 660 |
| 879 | Ga0207674_10000058 | 3300026116 | Bacteria | 113012 |
| 880 | Ga0207674_10217964 | 3300026116 | Bacteria | 1857 |
| 881 | Ga0207674_10221298 | 3300026116 | Bacteria | 1841 |
| 882 | Ga0207674_10255066 | 3300026116 | Bacteria | 1701 |
| 883 | Ga0207674_10392750 | 3300026116 | Bacteria | 1341 |
| 884 | Ga0207674_10656599 | 3300026116 | Unclassified | 1013 |
| 885 | Ga0207674_10914826 | 3300026116 | Unclassified | 845 |
| 886 | Ga0207674_11620915 | 3300026116 | Unclassified | 616 |
| 887 | Ga0207675_100002898 | 3300026118 | Bacteria | 16870 |
| 888 | Ga0207675_100019567 | 3300026118 | Bacteria | 6317 |
| 889 | Ga0207675_100026731 | 3300026118 | Bacteria | 5371 |
| 890 | Ga0207675_100113238 | 3300026118 | Bacteria | 2561 |
| 891 | Ga0207675_100125281 | 3300026118 | Bacteria | 2433 |
| 892 | Ga0207675_100134612 | 3300026118 | Bacteria | 2344 |
| 893 | Ga0207675_100150254 | 3300026118 | Unclassified | 2216 |
| 894 | Ga0207675_100156763 | 3300026118 | Bacteria | 2170 |
| 895 | Ga0207675_100591707 | 3300026118 | Unclassified | 1112 |
| 896 | Ga0207675_101649111 | 3300026118 | Unclassified | 661 |
| 897 | Ga0207675_101873541 | 3300026118 | Unclassified | 618 |
| 898 | Ga0207683_10056980 | 3300026121 | Bacteria | 3429 |
| 899 | Ga0207683_10719957 | 3300026121 | Unclassified | 925 |
| 900 | Ga0207698_10557490 | 3300026142 | Bacteria | 1124 |
| 901 | Ga0207428_10007052 | 3300027907 | Bacteria | 10291 |
| 902 | Ga0207428_10036227 | 3300027907 | Bacteria | 4026 |
| 903 | Ga0207428_10068145 | 3300027907 | Unclassified | 2800 |
| 904 | Ga0207428_10111346 | 3300027907 | Bacteria | 2106 |
| 905 | Ga0207428_10575612 | 3300027907 | Unclassified | 813 |
| 906 | Ga0268266_10514937 | 3300028379 | Bacteria | 1143 |
| 907 | Ga0268266_11080657 | 3300028379 | Bacteria | 776 |
| 908 | Ga0268265_10028484 | 3300028380 | Bacteria | 3999 |
| 909 | Ga0268265_10134675 | 3300028380 | Bacteria | 2059 |
| 910 | Ga0268265_10142765 | 3300028380 | Bacteria | 2007 |
| 911 | Ga0268265_10225450 | 3300028380 | Bacteria | 1643 |
| 912 | Ga0268265_10402473 | 3300028380 | Bacteria | 1266 |
| 913 | Ga0268265_10586864 | 3300028380 | Unclassified | 1063 |
| 914 | Ga0268265_10891658 | 3300028380 | Unclassified | 873 |
| 915 | Ga0268265_10901930 | 3300028380 | Unclassified | 868 |
| 916 | Ga0268265_11045617 | 3300028380 | Unclassified | 808 |
| 917 | Ga0268265_11903632 | 3300028380 | Unclassified | 602 |
| 918 | Ga0268265_12038785 | 3300028380 | Unclassified | 581 |
| 919 | Ga0268265_12287803 | 3300028380 | Unclassified | 547 |
| 920 | Ga0268264_10009644 | 3300028381 | Bacteria | 7998 |
| 921 | Ga0268264_10027485 | 3300028381 | Bacteria | 4650 |
| 922 | Ga0268264_10029294 | 3300028381 | Bacteria | 4507 |
| 923 | Ga0268264_10036951 | 3300028381 | Bacteria | 4025 |
| 924 | Ga0268264_10113532 | 3300028381 | Bacteria | 2377 |
| 925 | Ga0268264_10425474 | 3300028381 | Bacteria | 1281 |
| 926 | Ga0268264_10464725 | 3300028381 | Unclassified | 1228 |
| 927 | Ga0268264_10713852 | 3300028381 | Unclassified | 996 |
| 928 | Ga0268264_11058192 | 3300028381 | Unclassified | 819 |
| 929 | Ga0268264_11426039 | 3300028381 | Unclassified | 703 |
| 930 | Ga0268264_11698378 | 3300028381 | Unclassified | 642 |
| 931 | Ga0307513_10053961 | 3300031456 | Unclassified | 4314 |
| 932 | Ga0307408_100002360 | 3300031548 | Bacteria | 13325 |
| 933 | Ga0307408_100439096 | 3300031548 | Unclassified | 1129 |
| 934 | Ga0307408_101294956 | 3300031548 | Bacteria | 683 |
| 935 | Ga0307405_10009530 | 3300031731 | Bacteria | 4983 |
| 936 | Ga0307413_10388874 | 3300031824 | Bacteria | 1089 |
| 937 | Ga0307410_10006757 | 3300031852 | Bacteria | 6221 |
| 938 | Ga0307406_10001697 | 3300031901 | Bacteria | 12099 |
| 939 | Ga0307406_11404745 | 3300031901 | Unclassified | 612 |
| 940 | Ga0307412_10008182 | 3300031911 | Bacteria | 5962 |
| 941 | Ga0307416_100005462 | 3300032002 | Bacteria | 7808 |
| 942 | Ga0307414_10003043 | 3300032004 | Bacteria | 8895 |
| 943 | Ga0307411_10003209 | 3300032005 | Bacteria | 7530 |
| 944 | Ga0307415_100004223 | 3300032126 | Bacteria | 7422 |
| 945 | Ga0307415_100269584 | 3300032126 | Bacteria | 1394 |
| 946 | Ga0373941_0270932 | 3300035115 | Unclassified | 669 |
| 947 | Ga0373954_0097166 | 3300035118 | Unclassified | 1419 |
| 948 | Ga0373955_0063940 | 3300035172 | Bacteria | 2038 |
| 949 | Ga0373962_0224676 | 3300035242 | Unclassified | 644 |
| 950 | Ga0373937_0055277 | 3300036401 | Bacteria | 3644 |
| 951 | Ga0373937_0336553 | 3300036401 | Bacteria | 1429 |
| 952 | Ga0395900_0253790 | 3300037418 | Bacteria | 1759 |
| 953 | Ga0395900_0343334 | 3300037418 | Bacteria | 1468 |
| 954 | Ga0395900_0467589 | 3300037418 | Unclassified | 1215 |
| 955 | Ga0395900_0675956 | 3300037418 | Unclassified | 967 |
| 956 | Ga0395900_1227634 | 3300037418 | Unclassified | 665 |
| 957 | Ga0395900_1319390 | 3300037418 | Unclassified | 635 |
| 958 | Ga0395900_1361658 | 3300037418 | Unclassified | 623 |
| 959 | Ga0395900_1497721 | 3300037418 | Archaea | 587 |
| 960 | Ga0395898_0222997 | 3300037466 | Bacteria | 1798 |
| 961 | Ga0395898_0390591 | 3300037466 | Bacteria | 1327 |
| 962 | Ga0395898_1274283 | 3300037466 | Bacteria | 665 |
| 963 | Ga0395898_1929259 | 3300037466 | Unclassified | 510 |
| 964 | Ga0395905_0108657 | 3300037471 | Bacteria | 2604 |
| 965 | Ga0395905_0650880 | 3300037471 | Unclassified | 956 |
| 966 | Ga0395901_0311136 | 3300038443 | Bacteria | 1631 |
| 967 | Ga0395901_0893072 | 3300038443 | Unclassified | 871 |
| 968 | Ga0242420_040628 | 3300038996 | Unclassified | 888 |
| 969 | Ga0436361_0038753 | 3300039447 | Bacteria | 818 |
| 970 | Ga0436361_0097781 | 3300039447 | Bacteria | 1402 |
| 971 | Ga0436361_0273342 | 3300039447 | Bacteria | 594 |
| 972 | Ga0439439_0100287 | 3300041406 | Unclassified | 797 |
| 973 | Ga0439462_0152797 | 3300042015 | Unclassified | 649 |
| 974 | Ga0450889_030116 | 3300042144 | Unclassified | 633 |
| 975 | Ga0439458_0003430 | 3300042157 | Bacteria | 3708 |
| 976 | Ga0439434_0312982 | 3300042435 | Unclassified | 544 |
| 977 | Ga0450893_0036950 | 3300042532 | Unclassified | 885 |
| 978 | Ga0453683_0002963 | 3300044673 | Bacteria | 12750 |
| 979 | Ga0453683_0292847 | 3300044673 | Unclassified | 1041 |
| 980 | Ga0453683_0463603 | 3300044673 | Unclassified | 820 |
| 981 | Ga0451576_0322812 | 3300045051 | Bacteria | 1616 |
| 982 | Ga0451576_0334251 | 3300045051 | Bacteria | 1586 |
| 983 | Ga0451576_0488737 | 3300045051 | Unclassified | 1293 |
| 984 | Ga0495629_1136857 | 3300046459 | Bacteria | 504 |
| 985 | Ga0495664_0050191 | 3300046477 | Unclassified | 2477 |
| 986 | Ga0495584_0297550 | 3300046491 | Unclassified | 820 |
| 987 | Ga0495610_0135710 | 3300046512 | Bacteria | 1064 |
| 988 | Ga0495618_0065886 | 3300046514 | Unclassified | 2302 |
| 989 | Ga0495663_0000141 | 3300046525 | Bacteria | 29337 |
| 990 | Ga0495640_0249536 | 3300046533 | Unclassified | 1112 |
| 991 | Ga0495598_0001391 | 3300046537 | Bacteria | 4771 |
| 992 | Ga0495621_0003242 | 3300046539 | Bacteria | 4469 |
| 993 | Ga0495621_0273970 | 3300046539 | Unclassified | 694 |
| 994 | Ga0495658_0965436 | 3300046683 | Unclassified | 544 |
| 995 | Ga0495613_0014721 | 3300046689 | Bacteria | 5805 |
| 996 | Ga0495636_0015855 | 3300047318 | Bacteria | 3005 |
| 997 | Ga0495636_0107152 | 3300047318 | Unclassified | 1227 |
| 998 | Ga0495674_0085371 | 3300047319 | Bacteria | 2704 |
| 999 | Ga0495672_0037470 | 3300047320 | Bacteria | 2966 |
| 1000 | Ga0495680_0547427 | 3300047322 | Unclassified | 780 |
| 1001 | Ga0495684_0980728 | 3300047471 | Bacteria | 538 |
| 1002 | Ga0496102_0027452 | 3300048905 | Bacteria | 5084 |
| 1003 | Ga0496104_0090421 | 3300048907 | Bacteria | 2925 |
| 1004 | Ga0496104_0388553 | 3300048907 | Bacteria | 1308 |
| 1005 | Ga0496105_1241206 | 3300048908 | Unclassified | 547 |
| 1006 | Ga0496106_0070548 | 3300048909 | Bacteria | 2669 |
| 1007 | Ga0496106_0492228 | 3300048909 | Bacteria | 985 |
| 1008 | Ga0496106_1185776 | 3300048909 | Unclassified | 596 |
| 1009 | Ga0496107_0088036 | 3300048910 | Bacteria | 2267 |
| 1010 | Ga0496107_0140898 | 3300048910 | Bacteria | 1782 |
| 1011 | Ga0496108_0091443 | 3300048911 | Bacteria | 2587 |
| 1012 | Ga0496108_0332699 | 3300048911 | Bacteria | 1325 |
| 1013 | Ga0496109_0667197 | 3300048912 | Bacteria | 977 |
| 1014 | Ga0496110_0176971 | 3300048913 | Bacteria | 1937 |
| 1015 | Ga0496110_0731137 | 3300048913 | Unclassified | 892 |
| 1016 | Ga0496110_0805301 | 3300048913 | Unclassified | 844 |
| 1017 | Ga0496112_0235439 | 3300048915 | Bacteria | 1785 |
| 1018 | Ga0496112_0285463 | 3300048915 | Bacteria | 1597 |
| 1019 | Ga0496114_0351036 | 3300048917 | Bacteria | 1305 |
| 1020 | Ga0501290_059572 | 3300049513 | Unclassified | 612 |
| 1021 | Ga0501292_028310 | 3300049515 | Unclassified | 932 |
| 1022 | Ga0501298_002414 | 3300049521 | Bacteria | 2823 |
| 1023 | Ga0501031_0284998 | 3300049568 | Bacteria | 1071 |
| 1024 | Ga0501076_0318873 | 3300049592 | Bacteria | 1275 |
| 1025 | Ga0501077_0885371 | 3300049593 | Unclassified | 574 |
| 1026 | Ga0501198_066271 | 3300049649 | Unclassified | 672 |
| 1027 | Ga0501202_000926 | 3300049652 | Bacteria | 4515 |
| 1028 | Ga0501202_008649 | 3300049652 | Bacteria | 1858 |
| 1029 | Ga0501207_019171 | 3300049654 | Unclassified | 1082 |
| 1030 | Ga0501208_001891 | 3300049655 | Bacteria | 2094 |
| 1031 | Ga0501216_000138 | 3300049660 | Bacteria | 7447 |
| 1032 | Ga0501217_000335 | 3300049661 | Bacteria | 7481 |
| 1033 | Ga0501223_014882 | 3300049663 | Bacteria | 1542 |
| 1034 | Ga0501227_003645 | 3300049665 | Bacteria | 3336 |
| 1035 | Ga0501233_011024 | 3300049668 | Bacteria | 1791 |
| 1036 | Ga0501235_000537 | 3300049669 | Bacteria | 7572 |
| 1037 | Ga0501236_019102 | 3300049670 | Bacteria | 996 |
| 1038 | Ga0501253_026904 | 3300049683 | Bacteria | 1064 |
| 1039 | Ga0501257_079552 | 3300049686 | Unclassified | 844 |
| 1040 | Ga0501260_008863 | 3300049689 | Bacteria | 995 |
| 1041 | Ga0501225_0145736 | 3300049705 | Unclassified | 719 |
| 1042 | Ga0501229_049613 | 3300049706 | Bacteria | 617 |
| 1043 | Ga0501234_000512 | 3300049707 | Bacteria | 5950 |
| 1044 | Ga0501234_022848 | 3300049707 | Unclassified | 999 |
| 1045 | Ga0501081_1173270 | 3300049743 | Unclassified | 582 |
| 1046 | Ga0501268_067653 | 3300049765 | Bacteria | 717 |
| 1047 | Ga0501272_013670 | 3300049769 | Bacteria | 932 |
| 1048 | Ga0501273_000692 | 3300049770 | Bacteria | 2850 |
| 1049 | Ga0501045_0494458 | 3300049824 | Bacteria | 908 |
| 1050 | Ga0501212_001963 | 3300049851 | Bacteria | 2417 |
| 1051 | Ga0501226_001384 | 3300049853 | Bacteria | 3136 |
| 1052 | nmdc:mga05p37_102984_c1 | 3300050507 | Unclassified | 3514 |
| 1053 | nmdc:mga05p37_1210226_c1 | 3300050507 | Unclassified | 779 |
| 1054 | nmdc:mga05p37_127174_c1 | 3300050507 | Bacteria | 3129 |
| 1055 | nmdc:mga05p37_13047_c1 | 3300050507 | Bacteria | 9943 |
| 1056 | nmdc:mga05p37_1350539_c1 | 3300050507 | Unclassified | 722 |
| 1057 | nmdc:mga05p37_1378107_c1 | 3300050507 | Unclassified | 712 |
| 1058 | nmdc:mga05p37_1443240_c1 | 3300050507 | Unclassified | 690 |
| 1059 | nmdc:mga05p37_1516577_c1 | 3300050507 | Unclassified | 666 |
| 1060 | nmdc:mga05p37_158976_c1 | 3300050507 | Bacteria | 2760 |
| 1061 | nmdc:mga05p37_1620250_c1 | 3300050507 | Bacteria | 636 |
| 1062 | nmdc:mga05p37_1660928_c1 | 3300050507 | Unclassified | 625 |
| 1063 | nmdc:mga05p37_288194_c1 | 3300050507 | Bacteria | 1955 |
| 1064 | nmdc:mga05p37_358246_c1 | 3300050507 | Unclassified | 1716 |
| 1065 | nmdc:mga05p37_396613_c1 | 3300050507 | Bacteria | 1612 |
| 1066 | nmdc:mga05p37_448950_c1 | 3300050507 | Bacteria | 1493 |
| 1067 | nmdc:mga05p37_759313_c1 | 3300050507 | Unclassified | 1067 |
| 1068 | nmdc:mga05p37_775073_c1 | 3300050507 | Bacteria | 1053 |
| 1069 | nmdc:mga09592_132270_c1 | 3300050508 | Bacteria | 2147 |
| 1070 | nmdc:mga09592_671824_c1 | 3300050508 | Unclassified | 883 |
| 1071 | nmdc:mga0qj67_359768_c1 | 3300050509 | Unclassified | 1176 |
| 1072 | nmdc:mga06r32_468566_c1 | 3300050510 | Bacteria | 1238 |
| 1073 | nmdc:mga08y16_106268_c1 | 3300050511 | Bacteria | 2922 |
| 1074 | nmdc:mga08y16_14107_c1 | 3300050511 | Bacteria | 8412 |
| 1075 | nmdc:mga08y16_164209_c1 | 3300050511 | Bacteria | 2307 |
| 1076 | nmdc:mga08y16_296197_c1 | 3300050511 | Bacteria | 1668 |
| 1077 | nmdc:mga08y16_39775_c1 | 3300050511 | Unclassified | 4932 |
| 1078 | nmdc:mga08y16_41891_c1 | 3300050511 | Bacteria | 4796 |
| 1079 | nmdc:mga08y16_85730_c1 | 3300050511 | Bacteria | 3283 |
| 1080 | nmdc:mga08y16_8851_c1 | 3300050511 | Bacteria | 10566 |
| 1081 | nmdc:mga0n895_360604_c1 | 3300050512 | Bacteria | 1472 |
| 1082 | nmdc:mga0n895_50076_c1 | 3300050512 | Bacteria | 4095 |
| 1083 | nmdc:mga0n895_66058_c1 | 3300050512 | Bacteria | 3582 |
| 1084 | nmdc:mga0n895_665477_c1 | 3300050512 | Bacteria | 1039 |
| 1085 | nmdc:mga0n895_72469_c1 | 3300050512 | Bacteria | 3417 |
| 1086 | nmdc:mga0rr50_148329_c1 | 3300050513 | Bacteria | 1893 |
| 1087 | nmdc:mga0rr50_151395_c1 | 3300050513 | Bacteria | 1875 |
| 1088 | nmdc:mga0rr50_173012_c1 | 3300050513 | Bacteria | 1761 |
| 1089 | nmdc:mga0rr50_61526_c1 | 3300050513 | Bacteria | 2829 |
| 1090 | nmdc:mga0rr50_729958_c1 | 3300050513 | Unclassified | 845 |
| 1091 | nmdc:mga08x19_3501_c1 | 3300050514 | Bacteria | 9341 |
| 1092 | nmdc:mga0a205_1063216_c1 | 3300050515 | Bacteria | 656 |
| 1093 | nmdc:mga0a205_1099872_c1 | 3300050515 | Unclassified | 642 |
| 1094 | nmdc:mga0a205_112407_c1 | 3300050515 | Bacteria | 2623 |
| 1095 | nmdc:mga0a205_115612_c1 | 3300050515 | Bacteria | 2581 |
| 1096 | nmdc:mga0a205_17483_c1 | 3300050515 | Bacteria | 3270 |
| 1097 | nmdc:mga0a205_211349_c1 | 3300050515 | Unclassified | 1828 |
| 1098 | nmdc:mga0a205_25748_c1 | 3300050515 | Bacteria | 5606 |
| 1099 | nmdc:mga0a205_367832_c1 | 3300050515 | Bacteria | 1304 |
| 1100 | nmdc:mga0a205_412280_c1 | 3300050515 | Bacteria | 1214 |
| 1101 | nmdc:mga0a205_459292_c1 | 3300050515 | Unclassified | 1133 |
| 1102 | nmdc:mga0a205_527134_c1 | 3300050515 | Unclassified | 1037 |
| 1103 | nmdc:mga0a205_541756_c1 | 3300050515 | Bacteria | 1019 |
| 1104 | nmdc:mga0a205_600291_c1 | 3300050515 | Bacteria | 954 |
| 1105 | nmdc:mga0a205_63102_c1 | 3300050515 | Unclassified | 3580 |
| 1106 | nmdc:mga0a205_64457_c1 | 3300050515 | Bacteria | 3539 |
| 1107 | nmdc:mga0a205_853929_c1 | 3300050515 | Unclassified | 757 |
| 1108 | nmdc:mga0a205_88838_c1 | 3300050515 | Bacteria | 2987 |
| 1109 | Ga0501084_0073915 | 3300054114 | Bacteria | 2854 |
| 1110 | Ga0501084_0327543 | 3300054114 | Unclassified | 1294 |
| 1111 | Ga0530510_0662718 | 3300061734 | Unclassified | 795 |
| 1112 | Ga0501223_005363 | |||
| 1113 | SwRhRL3b_contig_2135242 | |||
| 1114 | SwRhRL2b_contig_1868649 | |||
| 1115 | MBSR1b_contig_347854 | |||
| 1116 | MBSR1b_contig_387553 | |||
| 1117 | CNAas_1000558 | |||
| 1118 | JGI25406J46586_10020673 | |||
| 1119 | Ga0065714_10064425 | |||
| 1120 | Ga0065714_10373163 | |||
| 1121 | Ga0065704_10017720 | |||
| 1122 | Ga0065704_10075557 | |||
| 1123 | Ga0065704_10103842 | |||
| 1124 | Ga0065704_10109827 | |||
| 1125 | Ga0065712_10067727 | |||
| 1126 | Ga0065712_10110168 | |||
| 1127 | Ga0065712_10236655 | |||
| 1128 | Ga0065712_10489075 | |||
| 1129 | Ga0065712_10503981 | |||
| 1130 | Ga0065715_10003739 | |||
| 1131 | Ga0065715_10005934 | |||
| 1132 | Ga0065715_10090321 | |||
| 1133 | Ga0065715_10094837 | |||
| 1134 | Ga0065715_10111252 | |||
| 1135 | Ga0065715_10125669 | |||
| 1136 | Ga0065715_10131091 | |||
| 1137 | Ga0065715_10215704 | |||
| 1138 | Ga0065715_10236551 | |||
| 1139 | Ga0065715_10307433 | |||
| 1140 | Ga0065715_10611849 | |||
| 1141 | Ga0065715_10645028 | |||
| 1142 | Ga0065715_10959991 | |||
| 1143 | Ga0065707_10005134 | |||
| 1144 | Ga0065707_10088064 | |||
| 1145 | Ga0065707_10172428 | |||
| 1146 | Ga0065707_10568813 | |||
| 1147 | Ga0070676_10106466 | |||
| 1148 | Ga0070676_10113692 | |||
| 1149 | Ga0070676_10181261 | |||
| 1150 | Ga0070676_10289806 | |||
| 1151 | Ga0070676_10326972 | |||
| 1152 | Ga0070690_100023588 | |||
| 1153 | Ga0070690_100034913 | |||
| 1154 | Ga0070690_100056026 | |||
| 1155 | Ga0070690_100091693 | |||
| 1156 | Ga0070690_100300048 | |||
| 1157 | Ga0070690_100542074 | |||
| 1158 | Ga0070670_100000223 | |||
| 1159 | Ga0070670_100311022 | |||
| 1160 | Ga0070670_101063919 | |||
| 1161 | Ga0070670_101652653 | |||
| 1162 | Ga0070670_101842181 | |||
| 1163 | Ga0070677_10110060 | |||
| 1164 | Ga0068869_100011825 | |||
| 1165 | Ga0068869_100044168 | |||
| 1166 | Ga0068869_100083377 | |||
| 1167 | Ga0068869_100203347 | |||
| 1168 | Ga0068869_100240691 | |||
| 1169 | Ga0068869_100355711 | |||
| 1170 | Ga0068869_100964653 | |||
| 1171 | Ga0068869_101187471 | |||
| 1172 | Ga0068869_101238109 | |||
| 1173 | Ga0068869_101486457 | |||
| 1174 | Ga0070666_10059790 | |||
| 1175 | Ga0070666_10289988 | |||
| 1176 | Ga0070680_100002231 | |||
| 1177 | Ga0070680_100005222 | |||
| 1178 | Ga0070680_100028397 | |||
| 1179 | Ga0070680_100551188 | |||
| 1180 | Ga0070680_100738091 | |||
| 1181 | Ga0070680_100793590 | |||
| 1182 | Ga0070680_100827099 | |||
| 1183 | Ga0070682_100000210 | |||
| 1184 | Ga0070682_100163584 | |||
| 1185 | Ga0068868_100010333 | |||
| 1186 | Ga0068868_100046778 | |||
| 1187 | Ga0070660_100095561 | |||
| 1188 | Ga0070660_101595593 | |||
| 1189 | Ga0070689_100014454 | |||
| 1190 | Ga0070689_100053759 | |||
| 1191 | Ga0070689_100069366 | |||
| 1192 | Ga0070689_100473908 | |||
| 1193 | Ga0070689_100738401 | |||
| 1194 | Ga0070689_100755422 | |||
| 1195 | Ga0070689_101852631 | |||
| 1196 | Ga0070691_10263163 | |||
| 1197 | Ga0070687_100001313 | |||
| 1198 | Ga0070687_100003618 | |||
| 1199 | Ga0070687_100441293 | |||
| 1200 | Ga0070661_100075235 | |||
| 1201 | Ga0070661_100296224 | |||
| 1202 | Ga0070692_10096453 | |||
| 1203 | Ga0070692_10160781 | |||
| 1204 | Ga0070692_10956238 | |||
| 1205 | Ga0070692_11369616 | |||
| 1206 | Ga0070668_100008204 | |||
| 1207 | Ga0070668_100524350 | |||
| 1208 | Ga0070669_100002272 | |||
| 1209 | Ga0070669_100027227 | |||
| 1210 | Ga0070669_100045610 | |||
| 1211 | Ga0070669_100249590 | |||
| 1212 | Ga0070669_100381192 | |||
| 1213 | Ga0070669_100426970 | |||
| 1214 | Ga0070669_100567542 | |||
| 1215 | Ga0070669_100808249 | |||
| 1216 | Ga0070669_100816450 | |||
| 1217 | Ga0070669_101680943 | |||
| 1218 | Ga0070675_100000539 | |||
| 1219 | Ga0070675_100009562 | |||
| 1220 | Ga0070675_100024557 | |||
| 1221 | Ga0070675_100029768 | |||
| 1222 | Ga0070675_100088570 | |||
| 1223 | Ga0070675_100118080 | |||
| 1224 | Ga0070675_100218045 | |||
| 1225 | Ga0070675_100720399 | |||
| 1226 | Ga0070675_101582618 | |||
| 1227 | Ga0070671_100002475 | |||
| 1228 | Ga0070671_100003917 | |||
| 1229 | Ga0070671_100195840 | |||
| 1230 | Ga0070671_100215048 | |||
| 1231 | Ga0070671_101132331 | |||
| 1232 | Ga0070674_100058068 | |||
| 1233 | Ga0070674_100403558 | |||
| 1234 | Ga0070674_100488316 | |||
| 1235 | Ga0070674_100853583 | |||
| 1236 | Ga0070673_100002003 | |||
| 1237 | Ga0070673_100002995 | |||
| 1238 | Ga0070673_100078240 | |||
| 1239 | Ga0070673_100117114 | |||
| 1240 | Ga0070673_100139839 | |||
| 1241 | Ga0070673_100270655 | |||
| 1242 | Ga0070673_100685464 | |||
| 1243 | Ga0070673_100717272 | |||
| 1244 | Ga0070673_100919919 | |||
| 1245 | Ga0070673_101069266 | |||
| 1246 | Ga0070673_101458550 | |||
| 1247 | Ga0070688_100011338 | |||
| 1248 | Ga0070688_100205134 | |||
| 1249 | Ga0070688_100246518 | |||
| 1250 | Ga0070688_100598649 | |||
| 1251 | Ga0070688_101367289 | |||
| 1252 | Ga0070659_100002515 | |||
| 1253 | Ga0070667_100012891 | |||
| 1254 | Ga0070667_100237414 | |||
| 1255 | Ga0070667_100319210 | |||
| 1256 | Ga0070667_100352797 | |||
| 1257 | Ga0070667_100868815 | |||
| 1258 | Ga0070667_101226436 | |||
| 1259 | Ga0070703_10374978 | |||
| 1260 | Ga0070709_10162302 | |||
| 1261 | Ga0070701_10018019 | |||
| 1262 | Ga0070701_10031444 | |||
| 1263 | Ga0070701_10065731 | |||
| 1264 | Ga0070701_10073431 | |||
| 1265 | Ga0070701_10254208 | |||
| 1266 | Ga0070701_10297955 | |||
| 1267 | Ga0070705_100007174 | |||
| 1268 | Ga0070705_100047853 | |||
| 1269 | Ga0070705_100058542 | |||
| 1270 | Ga0070705_100087190 | |||
| 1271 | Ga0070705_100146315 | |||
| 1272 | Ga0070705_100455134 | |||
| 1273 | Ga0070705_100477381 | |||
| 1274 | Ga0070705_100744550 | |||
| 1275 | Ga0070705_100841697 | |||
| 1276 | Ga0070705_101600347 | |||
| 1277 | Ga0070700_100000248 | |||
| 1278 | Ga0070700_100011138 | |||
| 1279 | Ga0070700_100444257 | |||
| 1280 | Ga0070700_101345342 | |||
| 1281 | Ga0070694_100010531 | |||
| 1282 | Ga0070694_100022116 | |||
| 1283 | Ga0070694_100034441 | |||
| 1284 | Ga0070694_100115170 | |||
| 1285 | Ga0070694_100118963 | |||
| 1286 | Ga0070694_100126411 | |||
| 1287 | Ga0070694_100182093 | |||
| 1288 | Ga0070694_100215744 | |||
| 1289 | Ga0070694_100488470 | |||
| 1290 | Ga0070694_100640083 | |||
| 1291 | Ga0070694_100678258 | |||
| 1292 | Ga0070694_100714109 | |||
| 1293 | Ga0070694_101064500 | |||
| 1294 | Ga0070694_101139944 | |||
| 1295 | Ga0070694_101315517 | |||
| 1296 | Ga0070694_101524571 | |||
| 1297 | Ga0070694_101729733 | |||
| 1298 | Ga0070708_100209342 | |||
| 1299 | Ga0070708_100541240 | |||
| 1300 | Ga0070708_100712438 | |||
| 1301 | Ga0070708_100980881 | |||
| 1302 | Ga0070708_101229812 | |||
| 1303 | Ga0070663_100988050 | |||
| 1304 | Ga0070678_100811306 | |||
| 1305 | Ga0070662_100151102 | |||
| 1306 | Ga0070662_100501860 | |||
| 1307 | Ga0070681_10000053 | |||
| 1308 | Ga0070681_10009693 | |||
| 1309 | Ga0070681_10039851 | |||
| 1310 | Ga0070681_10124649 | |||
| 1311 | Ga0068867_100027205 | |||
| 1312 | Ga0068867_100031339 | |||
| 1313 | Ga0068867_100312917 | |||
| 1314 | Ga0068867_100359040 | |||
| 1315 | Ga0068867_100397579 | |||
| 1316 | Ga0068867_100632533 | |||
| 1317 | Ga0068867_100767527 | |||
| 1318 | Ga0068867_100983187 | |||
| 1319 | Ga0068867_101216605 | |||
| 1320 | Ga0068867_101763956 | |||
| 1321 | Ga0070685_10024138 | |||
| 1322 | Ga0070685_10120237 | |||
| 1323 | Ga0070685_10121323 | |||
| 1324 | Ga0070685_11034755 | |||
| 1325 | Ga0070706_100000053 | |||
| 1326 | Ga0070706_100006176 | |||
| 1327 | Ga0070706_100007447 | |||
| 1328 | Ga0070706_100036769 | |||
| 1329 | Ga0070706_100085262 | |||
| 1330 | Ga0070706_100287685 | |||
| 1331 | Ga0070706_100522612 | |||
| 1332 | Ga0070706_100676171 | |||
| 1333 | Ga0070706_101567035 | |||
| 1334 | Ga0070707_100049035 | |||
| 1335 | Ga0070707_100159200 | |||
| 1336 | Ga0070707_100458761 | |||
| 1337 | Ga0070707_100906341 | |||
| 1338 | Ga0070707_100926388 | |||
| 1339 | Ga0070698_100015537 | |||
| 1340 | Ga0070698_100023480 | |||
| 1341 | Ga0070698_100047663 | |||
| 1342 | Ga0070698_100062415 | |||
| 1343 | Ga0070698_100088484 | |||
| 1344 | Ga0070698_100106269 | |||
| 1345 | Ga0070698_100132219 | |||
| 1346 | Ga0070698_100413846 | |||
| 1347 | Ga0070698_101702297 | |||
| 1348 | Ga0070698_101740390 | |||
| 1349 | Ga0070698_101829048 | |||
| 1350 | Ga0070699_100001084 | |||
| 1351 | Ga0070699_100018502 | |||
| 1352 | Ga0070699_100021527 | |||
| 1353 | Ga0070699_100047344 | |||
| 1354 | Ga0070699_100061761 | |||
| 1355 | Ga0070699_100271468 | |||
| 1356 | Ga0070699_100644027 | |||
| 1357 | Ga0070699_101304533 | |||
| 1358 | Ga0070679_100000030 | |||
| 1359 | Ga0070679_100095526 | |||
| 1360 | Ga0070679_100131293 | |||
| 1361 | Ga0070679_100470026 | |||
| 1362 | Ga0070684_100054258 | |||
| 1363 | Ga0070684_101753274 | |||
| 1364 | Ga0070697_100000815 | |||
| 1365 | Ga0070697_100002202 | |||
| 1366 | Ga0070697_100011445 | |||
| 1367 | Ga0070697_100066544 | |||
| 1368 | Ga0070697_100449920 | |||
| 1369 | Ga0070697_101698323 | |||
| 1370 | Ga0070697_101976435 | |||
| 1371 | Ga0070672_100028482 | |||
| 1372 | Ga0070672_100100863 | |||
| 1373 | Ga0070672_100700085 | |||
| 1374 | Ga0070672_101587759 | |||
| 1375 | Ga0070686_100003241 | |||
| 1376 | Ga0070686_100003645 | |||
| 1377 | Ga0070686_100072525 | |||
| 1378 | Ga0070686_100104425 | |||
| 1379 | Ga0070686_100194045 | |||
| 1380 | Ga0070686_100279213 | |||
| 1381 | Ga0070686_100563817 | |||
| 1382 | Ga0070695_100056181 | |||
| 1383 | Ga0070695_100060367 | |||
| 1384 | Ga0070695_100097003 | |||
| 1385 | Ga0070695_100103617 | |||
| 1386 | Ga0070695_100202170 | |||
| 1387 | Ga0070695_100211263 | |||
| 1388 | Ga0070695_100211506 | |||
| 1389 | Ga0070695_100392297 | |||
| 1390 | Ga0070695_100424180 | |||
| 1391 | Ga0070695_100987162 | |||
| 1392 | Ga0070695_101137060 | |||
| 1393 | Ga0070695_101224282 | |||
| 1394 | Ga0070696_100008993 | |||
| 1395 | Ga0070696_100012093 | |||
| 1396 | Ga0070696_100015019 | |||
| 1397 | Ga0070696_100016605 | |||
| 1398 | Ga0070696_100049388 | |||
| 1399 | Ga0070696_100061058 | |||
| 1400 | Ga0070696_100078322 | |||
| 1401 | Ga0070696_100142136 | |||
| 1402 | Ga0070696_100187618 | |||
| 1403 | Ga0070696_100296973 | |||
| 1404 | Ga0070696_100362221 | |||
| 1405 | Ga0070696_100369548 | |||
| 1406 | Ga0070696_100384532 | |||
| 1407 | Ga0070696_100452811 | |||
| 1408 | Ga0070696_101467076 | |||
| 1409 | Ga0070693_100005361 | |||
| 1410 | Ga0070693_100134485 | |||
| 1411 | Ga0070693_100667526 | |||
| 1412 | Ga0070693_100831899 | |||
| 1413 | Ga0070665_100621938 | |||
| 1414 | Ga0070665_100652801 | |||
| 1415 | Ga0070704_100017172 | |||
| 1416 | Ga0070704_100047827 | |||
| 1417 | Ga0070704_100067298 | |||
| 1418 | Ga0070704_100075324 | |||
| 1419 | Ga0070704_100133972 | |||
| 1420 | Ga0070704_100147907 | |||
| 1421 | Ga0070704_100160798 | |||
| 1422 | Ga0070704_100322848 | |||
| 1423 | Ga0070704_100437221 | |||
| 1424 | Ga0070704_100889414 | |||
| 1425 | Ga0070704_100990059 | |||
| 1426 | Ga0068855_100310167 | |||
| 1427 | Ga0068855_100391708 | |||
| 1428 | Ga0068855_100996467 | |||
| 1429 | Ga0068855_101612168 | |||
| 1430 | Ga0070664_100000993 | |||
| 1431 | Ga0070664_100003271 | |||
| 1432 | Ga0070664_100123989 | |||
| 1433 | Ga0070664_100126990 | |||
| 1434 | Ga0070664_100146323 | |||
| 1435 | Ga0070664_100276488 | |||
| 1436 | Ga0070664_101528368 | |||
| 1437 | Ga0068857_100000975 | |||
| 1438 | Ga0068857_100109569 | |||
| 1439 | Ga0068857_100279702 | |||
| 1440 | Ga0068857_100452727 | |||
| 1441 | Ga0068857_101624632 | |||
| 1442 | Ga0068857_102135000 | |||
| 1443 | Ga0068854_100077477 | |||
| 1444 | Ga0068854_100142980 | |||
| 1445 | Ga0068854_100378723 | |||
| 1446 | Ga0068854_100515312 | |||
| 1447 | Ga0068856_100020464 | |||
| 1448 | Ga0070702_100039155 | |||
| 1449 | Ga0070702_100162399 | |||
| 1450 | Ga0070702_100532340 | |||
| 1451 | Ga0068852_101696275 | |||
| 1452 | Ga0068859_100003712 | |||
| 1453 | Ga0068859_100003989 | |||
| 1454 | Ga0068859_100007068 | |||
| 1455 | Ga0068859_100024761 | |||
| 1456 | Ga0068859_100042357 | |||
| 1457 | Ga0068859_100090453 | |||
| 1458 | Ga0068859_100119377 | |||
| 1459 | Ga0068859_100219375 | |||
| 1460 | Ga0068859_100523200 | |||
| 1461 | Ga0068859_100573501 | |||
| 1462 | Ga0068859_101309365 | |||
| 1463 | Ga0068859_101567494 | |||
| 1464 | Ga0068859_101642927 | |||
| 1465 | Ga0068859_101977815 | |||
| 1466 | Ga0068859_103061892 | |||
| 1467 | Ga0068859_103088479 | |||
| 1468 | Ga0068864_100007365 | |||
| 1469 | Ga0068864_100010943 | |||
| 1470 | Ga0068864_100174023 | |||
| 1471 | Ga0068864_100191376 | |||
| 1472 | Ga0068864_100435052 | |||
| 1473 | Ga0068864_100658325 | |||
| 1474 | Ga0068864_101000255 | |||
| 1475 | Ga0068864_101249732 | |||
| 1476 | Ga0068864_101476907 | |||
| 1477 | Ga0068864_101573086 | |||
| 1478 | Ga0068864_101949007 | |||
| 1479 | Ga0068866_10023361 | |||
| 1480 | Ga0068866_10023772 | |||
| 1481 | Ga0068866_10666507 | |||
| 1482 | Ga0068866_11086399 | |||
| 1483 | Ga0068861_100002914 | |||
| 1484 | Ga0068861_100096956 | |||
| 1485 | Ga0068861_100123195 | |||
| 1486 | Ga0068861_100270860 | |||
| 1487 | Ga0068861_100391804 | |||
| 1488 | Ga0068861_100453071 | |||
| 1489 | Ga0068861_100650624 | |||
| 1490 | Ga0068861_100651352 | |||
| 1491 | Ga0068861_100655269 | |||
| 1492 | Ga0068861_101217006 | |||
| 1493 | Ga0068861_101443807 | |||
| 1494 | Ga0068861_101906486 | |||
| 1495 | Ga0068861_101987071 | |||
| 1496 | Ga0068870_10170287 | |||
| 1497 | Ga0068870_10315820 | |||
| 1498 | Ga0068863_100000577 | |||
| 1499 | Ga0068863_100029077 | |||
| 1500 | Ga0068863_100109843 | |||
| 1501 | Ga0068863_100143103 | |||
| 1502 | Ga0068863_100262294 | |||
| 1503 | Ga0068863_100269386 | |||
| 1504 | Ga0068863_100300763 | |||
| 1505 | Ga0068863_100354247 | |||
| 1506 | Ga0068863_100471379 | |||
| 1507 | Ga0068863_100549393 | |||
| 1508 | Ga0068863_101100872 | |||
| 1509 | Ga0068858_100015618 | |||
| 1510 | Ga0068858_100026768 | |||
| 1511 | Ga0068858_100298636 | |||
| 1512 | Ga0068858_100514322 | |||
| 1513 | Ga0068858_100533381 | |||
| 1514 | Ga0068858_100832317 | |||
| 1515 | Ga0068858_101292501 | |||
| 1516 | Ga0068860_100001406 | |||
| 1517 | Ga0068860_100025516 | |||
| 1518 | Ga0068860_100102595 | |||
| 1519 | Ga0068860_100142573 | |||
| 1520 | Ga0068860_100188068 | |||
| 1521 | Ga0068860_100273947 | |||
| 1522 | Ga0068860_100335601 | |||
| 1523 | Ga0068860_100529876 | |||
| 1524 | Ga0068860_100578764 | |||
| 1525 | Ga0068862_100009473 | |||
| 1526 | Ga0068862_100022410 | |||
| 1527 | Ga0068862_100052837 | |||
| 1528 | Ga0068862_100062876 | |||
| 1529 | Ga0068862_100197680 | |||
| 1530 | Ga0068862_100385397 | |||
| 1531 | Ga0068862_100947620 | |||
| 1532 | Ga0081539_10000481 | |||
| 1533 | Ga0075432_10037234 | |||
| 1534 | Ga0075432_10271962 | |||
| 1535 | Ga0070716_100030114 | |||
| 1536 | Ga0070716_100064804 | |||
| 1537 | Ga0097621_100017050 | |||
| 1538 | Ga0097621_100090628 | |||
| 1539 | Ga0097621_100363789 | |||
| 1540 | Ga0068871_100015902 | |||
| 1541 | Ga0068871_100145924 | |||
| 1542 | Ga0068871_100245069 | |||
| 1543 | Ga0068871_101189603 | |||
| 1544 | Ga0075428_100248221 | |||
| 1545 | Ga0075428_100564362 | |||
| 1546 | Ga0075428_100641772 | |||
| 1547 | Ga0075430_100324768 | |||
| 1548 | Ga0075431_100753093 | |||
| 1549 | Ga0075431_101698127 | |||
| 1550 | Ga0075433_10032085 | |||
| 1551 | Ga0075433_10032560 | |||
| 1552 | Ga0075433_10196138 | |||
| 1553 | Ga0075433_10197263 | |||
| 1554 | Ga0075433_10231501 | |||
| 1555 | Ga0075433_10410322 | |||
| 1556 | Ga0075433_10451352 | |||
| 1557 | Ga0075433_10470009 | |||
| 1558 | Ga0075433_10695064 | |||
| 1559 | Ga0075433_10942830 | |||
| 1560 | Ga0075433_11055049 | |||
| 1561 | Ga0075433_11137108 | |||
| 1562 | Ga0075434_100015289 | |||
| 1563 | Ga0075434_100059966 | |||
| 1564 | Ga0075434_100062144 | |||
| 1565 | Ga0075434_100068328 | |||
| 1566 | Ga0075434_100103280 | |||
| 1567 | Ga0075434_100368380 | |||
| 1568 | Ga0075434_100511283 | |||
| 1569 | Ga0075434_101717762 | |||
| 1570 | Ga0075429_100128407 | |||
| 1571 | Ga0075429_100589542 | |||
| 1572 | Ga0068865_100012041 | |||
| 1573 | Ga0068865_100130531 | |||
| 1574 | Ga0068865_101000859 | |||
| 1575 | Ga0068865_101760806 | |||
| 1576 | Ga0068865_101854264 | |||
| 1577 | Ga0075436_100005634 | |||
| 1578 | Ga0075436_100311312 | |||
| 1579 | Ga0075436_100819003 | |||
| 1580 | Ga0097620_100003712 | |||
| 1581 | Ga0097620_100003989 | |||
| 1582 | Ga0097620_100007068 | |||
| 1583 | Ga0097620_100024762 | |||
| 1584 | Ga0097620_100042356 | |||
| 1585 | Ga0097620_100090448 | |||
| 1586 | Ga0097620_100119378 | |||
| 1587 | Ga0097620_100219380 | |||
| 1588 | Ga0097620_100523245 | |||
| 1589 | Ga0097620_100573522 | |||
| 1590 | Ga0097620_101309411 | |||
| 1591 | Ga0097620_101567701 | |||
| 1592 | Ga0097620_101643049 | |||
| 1593 | Ga0097620_101977669 | |||
| 1594 | Ga0097620_103061592 | |||
| 1595 | Ga0097620_103088224 | |||
| 1596 | Ga0075435_100039945 | |||
| 1597 | Ga0075435_100043657 | |||
| 1598 | Ga0075435_100076034 | |||
| 1599 | Ga0075435_100196201 | |||
| 1600 | Ga0075435_100571024 | |||
| 1601 | Ga0075435_100664471 | |||
| 1602 | Ga0099794_10017128 | |||
| 1603 | Ga0099794_10070245 | |||
| 1604 | Ga0099794_10140091 | |||
| 1605 | Ga0099794_10470798 | |||
| 1606 | Ga0099794_10708150 | |||
| 1607 | Ga0105251_10241345 | |||
| 1608 | Ga0105244_10517864 | |||
| 1609 | Ga0105240_10098906 | |||
| 1610 | Ga0105240_10400527 | |||
| 1611 | Ga0105240_12366288 | |||
| 1612 | Ga0111539_10002073 | |||
| 1613 | Ga0111539_10006551 | |||
| 1614 | Ga0111539_10176825 | |||
| 1615 | Ga0111539_10469022 | |||
| 1616 | Ga0111539_10665708 | |||
| 1617 | Ga0111539_10938175 | |||
| 1618 | Ga0111539_11037745 | |||
| 1619 | Ga0105245_10174675 | |||
| 1620 | Ga0105245_10212026 | |||
| 1621 | Ga0105245_10879524 | |||
| 1622 | Ga0105245_11349781 | |||
| 1623 | Ga0105245_12231265 | |||
| 1624 | Ga0105247_10019871 | |||
| 1625 | Ga0105247_10030088 | |||
| 1626 | Ga0105247_10086800 | |||
| 1627 | Ga0105247_10562369 | |||
| 1628 | Ga0114129_10001970 | |||
| 1629 | Ga0114129_10026989 | |||
| 1630 | Ga0114129_10029655 | |||
| 1631 | Ga0114129_10050453 | |||
| 1632 | Ga0114129_10090258 | |||
| 1633 | Ga0114129_10119040 | |||
| 1634 | Ga0114129_10123475 | |||
| 1635 | Ga0114129_10144970 | |||
| 1636 | Ga0114129_10223822 | |||
| 1637 | Ga0114129_10309368 | |||
| 1638 | Ga0114129_10328153 | |||
| 1639 | Ga0114129_10511525 | |||
| 1640 | Ga0114129_10512847 | |||
| 1641 | Ga0114129_10754561 | |||
| 1642 | Ga0114129_10778489 | |||
| 1643 | Ga0114129_11683364 | |||
| 1644 | Ga0114129_11794373 | |||
| 1645 | Ga0114129_11887663 | |||
| 1646 | Ga0114129_12448001 | |||
| 1647 | Ga0105243_10025836 | |||
| 1648 | Ga0105243_10221169 | |||
| 1649 | Ga0105243_10385983 | |||
| 1650 | Ga0105243_10665195 | |||
| 1651 | Ga0105243_10847218 | |||
| 1652 | Ga0105243_10895511 | |||
| 1653 | Ga0105243_10993954 | |||
| 1654 | Ga0105243_12071062 | |||
| 1655 | Ga0105243_12570946 | |||
| 1656 | Ga0105243_13093567 | |||
| 1657 | Ga0105241_10026459 | |||
| 1658 | Ga0105241_10128760 | |||
| 1659 | Ga0105241_10147680 | |||
| 1660 | Ga0105241_10201235 | |||
| 1661 | Ga0105241_11028917 | |||
| 1662 | Ga0105241_11491726 | |||
| 1663 | Ga0105241_11831690 | |||
| 1664 | Ga0105242_10019807 | |||
| 1665 | Ga0105242_10058067 | |||
| 1666 | Ga0105242_10152961 | |||
| 1667 | Ga0105242_10466642 | |||
| 1668 | Ga0105242_10500637 | |||
| 1669 | Ga0105242_10661929 | |||
| 1670 | Ga0105242_10858089 | |||
| 1671 | Ga0105242_11584273 | |||
| 1672 | Ga0105242_12427523 | |||
| 1673 | Ga0105248_10000477 | |||
| 1674 | Ga0105248_10001987 | |||
| 1675 | Ga0105248_10034210 | |||
| 1676 | Ga0105248_10044241 | |||
| 1677 | Ga0105248_10140455 | |||
| 1678 | Ga0105248_10175381 | |||
| 1679 | Ga0105248_10240928 | |||
| 1680 | Ga0105248_10401039 | |||
| 1681 | Ga0105248_10544267 | |||
| 1682 | Ga0105248_12309056 | |||
| 1683 | Ga0105237_10028633 | |||
| 1684 | Ga0105237_10062631 | |||
| 1685 | Ga0105249_10000201 | |||
| 1686 | Ga0105249_10062224 | |||
| 1687 | Ga0105249_10085455 | |||
| 1688 | Ga0105249_10129643 | |||
| 1689 | Ga0105249_10304673 | |||
| 1690 | Ga0105249_11013933 | |||
| 1691 | Ga0105249_11602561 | |||
| 1692 | Ga0105249_11796245 | |||
| 1693 | Ga0105249_13203815 | |||
| 1694 | Ga0099796_10084472 | |||
| 1695 | Ga0105239_10068318 | |||
| 1696 | Ga0105239_10098786 | |||
| 1697 | Ga0105239_10991907 | |||
| 1698 | Ga0105239_11157402 | |||
| 1699 | Ga0105246_10248298 | |||
| 1700 | Ga0105246_10266415 | |||
| 1701 | Ga0105246_10309885 | |||
| 1702 | Ga0105246_10327920 | |||
| 1703 | Ga0105246_10610329 | |||
| 1704 | Ga0105246_10953481 | |||
| 1705 | Ga0105246_10964375 | |||
| 1706 | Ga0105246_11618218 | |||
| 1707 | Ga0157373_10047943 | |||
| 1708 | Ga0157373_10277704 | |||
| 1709 | Ga0157374_10049408 | |||
| 1710 | Ga0157374_10061420 | |||
| 1711 | Ga0157374_10151739 | |||
| 1712 | Ga0157374_12632849 | |||
| 1713 | Ga0157378_10019509 | |||
| 1714 | Ga0157378_10022463 | |||
| 1715 | Ga0157378_10033382 | |||
| 1716 | Ga0157378_10070495 | |||
| 1717 | Ga0157378_10079059 | |||
| 1718 | Ga0157378_10119386 | |||
| 1719 | Ga0157378_10128948 | |||
| 1720 | Ga0157378_10254053 | |||
| 1721 | Ga0157378_10262453 | |||
| 1722 | Ga0157378_10263611 | |||
| 1723 | Ga0157378_10340235 | |||
| 1724 | Ga0157378_10406026 | |||
| 1725 | Ga0157378_12117882 | |||
| 1726 | Ga0157378_12645343 | |||
| 1727 | Ga0163162_10000128 | |||
| 1728 | Ga0163162_10003297 | |||
| 1729 | Ga0163162_10006443 | |||
| 1730 | Ga0163162_10015820 | |||
| 1731 | Ga0163162_10034610 | |||
| 1732 | Ga0163162_10072560 | |||
| 1733 | Ga0163162_10102852 | |||
| 1734 | Ga0163162_10675855 | |||
| 1735 | Ga0163162_10768925 | |||
| 1736 | Ga0163162_11111392 | |||
| 1737 | Ga0163162_11173387 | |||
| 1738 | Ga0163162_11360662 | |||
| 1739 | Ga0163162_11466312 | |||
| 1740 | Ga0157372_10120127 | |||
| 1741 | Ga0157372_10848062 | |||
| 1742 | Ga0157372_11256796 | |||
| 1743 | Ga0157372_12808005 | |||
| 1744 | Ga0157375_10000307 | |||
| 1745 | Ga0157375_10001282 | |||
| 1746 | Ga0157375_10016863 | |||
| 1747 | Ga0157375_10031253 | |||
| 1748 | Ga0157375_10039220 | |||
| 1749 | Ga0157375_10067249 | |||
| 1750 | Ga0157375_10169065 | |||
| 1751 | Ga0157375_10333571 | |||
| 1752 | Ga0157375_10368311 | |||
| 1753 | Ga0157375_10370963 | |||
| 1754 | Ga0157375_10466333 | |||
| 1755 | Ga0157375_10479287 | |||
| 1756 | Ga0157375_10567149 | |||
| 1757 | Ga0157375_10627866 | |||
| 1758 | Ga0157375_10790649 | |||
| 1759 | Ga0157375_11671413 | |||
| 1760 | Ga0157375_11701434 | |||
| 1761 | Ga0157375_13229279 | |||
| 1762 | Ga0163163_10004672 | |||
| 1763 | Ga0163163_10026850 | |||
| 1764 | Ga0163163_10046151 | |||
| 1765 | Ga0163163_10056787 | |||
| 1766 | Ga0163163_10076357 | |||
| 1767 | Ga0163163_10121557 | |||
| 1768 | Ga0163163_10296601 | |||
| 1769 | Ga0163163_10440351 | |||
| 1770 | Ga0163163_10490414 | |||
| 1771 | Ga0163163_10772789 | |||
| 1772 | Ga0157380_10009334 | |||
| 1773 | Ga0157380_10010880 | |||
| 1774 | Ga0157380_10019160 | |||
| 1775 | Ga0157380_10023228 | |||
| 1776 | Ga0157380_10044093 | |||
| 1777 | Ga0157380_10065618 | |||
| 1778 | Ga0157380_10081799 | |||
| 1779 | Ga0157380_10273918 | |||
| 1780 | Ga0157380_10311925 | |||
| 1781 | Ga0157380_10625549 | |||
| 1782 | Ga0182008_10923308 | |||
| 1783 | Ga0157377_10110174 | |||
| 1784 | Ga0157377_10110701 | |||
| 1785 | Ga0157377_10232398 | |||
| 1786 | Ga0157377_10233164 | |||
| 1787 | Ga0157377_10874126 | |||
| 1788 | Ga0157379_10049799 | |||
| 1789 | Ga0157379_10218545 | |||
| 1790 | Ga0157376_10135708 | |||
| 1791 | Ga0157376_10168566 | |||
| 1792 | Ga0157376_10274566 | |||
| 1793 | Ga0157376_11596226 | |||
| 1794 | Ga0157376_12239743 | |||
| 1795 | Ga0182007_10047721 | |||
| 1796 | Ga0163161_10022540 | |||
| 1797 | Ga0163161_10031371 | |||
| 1798 | Ga0163161_10106879 | |||
| 1799 | Ga0163161_10119457 | |||
| 1800 | Ga0207697_10052010 | |||
| 1801 | Ga0207682_10023989 | |||
| 1802 | Ga0207642_10093758 | |||
| 1803 | Ga0207642_10479342 | |||
| 1804 | Ga0207710_10011750 | |||
| 1805 | Ga0207710_10043674 | |||
| 1806 | Ga0207710_10092241 | |||
| 1807 | Ga0207710_10102147 | |||
| 1808 | Ga0207688_10098098 | |||
| 1809 | Ga0207680_10145233 | |||
| 1810 | Ga0207645_10072452 | |||
| 1811 | Ga0207645_10308651 | |||
| 1812 | Ga0207645_10941634 | |||
| 1813 | Ga0207643_10955168 | |||
| 1814 | Ga0207684_10000053 | |||
| 1815 | Ga0207684_10040204 | |||
| 1816 | Ga0207684_10197469 | |||
| 1817 | Ga0207684_10309509 | |||
| 1818 | Ga0207684_10856041 | |||
| 1819 | Ga0207684_11040759 | |||
| 1820 | Ga0207654_10095292 | |||
| 1821 | Ga0207654_10109735 | |||
| 1822 | Ga0207654_10531275 | |||
| 1823 | Ga0207654_10670543 | |||
| 1824 | Ga0207654_11228333 | |||
| 1825 | Ga0207707_10000063 | |||
| 1826 | Ga0207707_10076778 | |||
| 1827 | Ga0207707_10135446 | |||
| 1828 | Ga0207707_10184989 | |||
| 1829 | Ga0207695_10105623 | |||
| 1830 | Ga0207671_10121742 | |||
| 1831 | Ga0207663_10343542 | |||
| 1832 | Ga0207660_10004704 | |||
| 1833 | Ga0207660_10021218 | |||
| 1834 | Ga0207660_10108717 | |||
| 1835 | Ga0207660_10817025 | |||
| 1836 | Ga0207660_11035633 | |||
| 1837 | Ga0207662_10007338 | |||
| 1838 | Ga0207662_10020795 | |||
| 1839 | Ga0207662_10042706 | |||
| 1840 | Ga0207662_11309689 | |||
| 1841 | Ga0207657_10073315 | |||
| 1842 | Ga0207649_10173720 | |||
| 1843 | Ga0207649_10359247 | |||
| 1844 | Ga0207649_10550105 | |||
| 1845 | Ga0207652_10000091 | |||
| 1846 | Ga0207652_10163737 | |||
| 1847 | Ga0207652_10474654 | |||
| 1848 | Ga0207652_10518533 | |||
| 1849 | Ga0207646_10459041 | |||
| 1850 | Ga0207646_10578571 | |||
| 1851 | Ga0207646_10742000 | |||
| 1852 | Ga0207681_10000966 | |||
| 1853 | Ga0207681_10085292 | |||
| 1854 | Ga0207681_10135256 | |||
| 1855 | Ga0207681_10200670 | |||
| 1856 | Ga0207681_10346535 | |||
| 1857 | Ga0207650_10005207 | |||
| 1858 | Ga0207650_10178365 | |||
| 1859 | Ga0207650_11156389 | |||
| 1860 | Ga0207659_10000434 | |||
| 1861 | Ga0207659_10006583 | |||
| 1862 | Ga0207659_10009662 | |||
| 1863 | Ga0207659_10108807 | |||
| 1864 | Ga0207659_10118867 | |||
| 1865 | Ga0207659_10171331 | |||
| 1866 | Ga0207659_10532752 | |||
| 1867 | Ga0207659_10557278 | |||
| 1868 | Ga0207687_10757800 | |||
| 1869 | Ga0207644_10011563 | |||
| 1870 | Ga0207644_10054551 | |||
| 1871 | Ga0207690_10016209 | |||
| 1872 | Ga0207706_10042442 | |||
| 1873 | Ga0207706_10046419 | |||
| 1874 | Ga0207706_10192070 | |||
| 1875 | Ga0207706_10197879 | |||
| 1876 | Ga0207686_10130238 | |||
| 1877 | Ga0207686_10187353 | |||
| 1878 | Ga0207686_10649740 | |||
| 1879 | Ga0207686_11109250 | |||
| 1880 | Ga0207709_10001732 | |||
| 1881 | Ga0207709_10114466 | |||
| 1882 | Ga0207709_10167383 | |||
| 1883 | Ga0207709_10377464 | |||
| 1884 | Ga0207670_10043515 | |||
| 1885 | Ga0207670_10052646 | |||
| 1886 | Ga0207670_10243975 | |||
| 1887 | Ga0207670_10742330 | |||
| 1888 | Ga0207670_11386692 | |||
| 1889 | Ga0207670_11394776 | |||
| 1890 | Ga0207669_10967732 | |||
| 1891 | Ga0207704_10064467 | |||
| 1892 | Ga0207704_10452168 | |||
| 1893 | Ga0207665_10038349 | |||
| 1894 | Ga0207665_10156163 | |||
| 1895 | Ga0207691_10008051 | |||
| 1896 | Ga0207691_10110280 | |||
| 1897 | Ga0207691_10604603 | |||
| 1898 | Ga0207691_10886894 | |||
| 1899 | Ga0207691_11235945 | |||
| 1900 | Ga0207711_10019925 | |||
| 1901 | Ga0207711_10069615 | |||
| 1902 | Ga0207711_10139558 | |||
| 1903 | Ga0207711_10141696 | |||
| 1904 | Ga0207711_10997529 | |||
| 1905 | Ga0207711_11468110 | |||
| 1906 | Ga0207689_10004147 | |||
| 1907 | Ga0207689_10059118 | |||
| 1908 | Ga0207689_10076002 | |||
| 1909 | Ga0207689_10076696 | |||
| 1910 | Ga0207689_10133582 | |||
| 1911 | Ga0207689_10389038 | |||
| 1912 | Ga0207689_10448631 | |||
| 1913 | Ga0207689_10462272 | |||
| 1914 | Ga0207689_10816609 | |||
| 1915 | Ga0207689_11100228 | |||
| 1916 | Ga0207689_11223102 | |||
| 1917 | Ga0207689_11480087 | |||
| 1918 | Ga0207679_10003210 | |||
| 1919 | Ga0207679_10012423 | |||
| 1920 | Ga0207679_10113981 | |||
| 1921 | Ga0207679_10239018 | |||
| 1922 | Ga0207679_10437624 | |||
| 1923 | Ga0207679_10482320 | |||
| 1924 | Ga0207667_11079466 | |||
| 1925 | Ga0207667_11608008 | |||
| 1926 | Ga0207651_10012392 | |||
| 1927 | Ga0207651_10027242 | |||
| 1928 | Ga0207651_10090316 | |||
| 1929 | Ga0207651_10092077 | |||
| 1930 | Ga0207651_10122328 | |||
| 1931 | Ga0207651_10214935 | |||
| 1932 | Ga0207651_11179880 | |||
| 1933 | Ga0207712_10000259 | |||
| 1934 | Ga0207712_10044518 | |||
| 1935 | Ga0207712_10143644 | |||
| 1936 | Ga0207712_10438836 | |||
| 1937 | Ga0207712_10570392 | |||
| 1938 | Ga0207668_10002115 | |||
| 1939 | Ga0207640_10063069 | |||
| 1940 | Ga0207640_10185759 | |||
| 1941 | Ga0207640_10480048 | |||
| 1942 | Ga0207640_10486217 | |||
| 1943 | Ga0207658_10033070 | |||
| 1944 | Ga0207658_10042921 | |||
| 1945 | Ga0207658_10155866 | |||
| 1946 | Ga0207658_11100662 | |||
| 1947 | Ga0207677_10150319 | |||
| 1948 | Ga0207677_10787276 | |||
| 1949 | Ga0207703_10026644 | |||
| 1950 | Ga0207703_10064730 | |||
| 1951 | Ga0207703_10139092 | |||
| 1952 | Ga0207703_11054430 | |||
| 1953 | Ga0207639_10069785 | |||
| 1954 | Ga0207708_10000471 | |||
| 1955 | Ga0207708_10001411 | |||
| 1956 | Ga0207708_10132149 | |||
| 1957 | Ga0207708_10201603 | |||
| 1958 | Ga0207708_10619079 | |||
| 1959 | Ga0207708_11266311 | |||
| 1960 | Ga0207702_10041969 | |||
| 1961 | Ga0207641_10000455 | |||
| 1962 | Ga0207641_10076480 | |||
| 1963 | Ga0207641_10152069 | |||
| 1964 | Ga0207641_10237590 | |||
| 1965 | Ga0207641_10252603 | |||
| 1966 | Ga0207641_10451214 | |||
| 1967 | Ga0207641_10619249 | |||
| 1968 | Ga0207641_10825714 | |||
| 1969 | Ga0207641_11019281 | |||
| 1970 | Ga0207641_11129768 | |||
| 1971 | Ga0207648_10048568 | |||
| 1972 | Ga0207648_10056466 | |||
| 1973 | Ga0207648_10141747 | |||
| 1974 | Ga0207648_10177024 | |||
| 1975 | Ga0207648_10262121 | |||
| 1976 | Ga0207648_10680775 | |||
| 1977 | Ga0207648_10802390 | |||
| 1978 | Ga0207676_10011121 | |||
| 1979 | Ga0207676_10019886 | |||
| 1980 | Ga0207676_10030591 | |||
| 1981 | Ga0207676_10064974 | |||
| 1982 | Ga0207676_10438402 | |||
| 1983 | Ga0207676_10441928 | |||
| 1984 | Ga0207676_10659201 | |||
| 1985 | Ga0207676_10660310 | |||
| 1986 | Ga0207676_10807246 | |||
| 1987 | Ga0207676_10925463 | |||
| 1988 | Ga0207676_11277421 | |||
| 1989 | Ga0207676_11551829 | |||
| 1990 | Ga0207674_10000058 | |||
| 1991 | Ga0207674_10217964 | |||
| 1992 | Ga0207674_10221298 | |||
| 1993 | Ga0207674_10255066 | |||
| 1994 | Ga0207674_10392750 | |||
| 1995 | Ga0207674_10656599 | |||
| 1996 | Ga0207674_10914826 | |||
| 1997 | Ga0207674_11620915 | |||
| 1998 | Ga0207675_100002898 | |||
| 1999 | Ga0207675_100019567 | |||
| 2000 | Ga0207675_100026731 | |||
| 2001 | Ga0207675_100113238 | |||
| 2002 | Ga0207675_100125281 | |||
| 2003 | Ga0207675_100134612 | |||
| 2004 | Ga0207675_100150254 | |||
| 2005 | Ga0207675_100156763 | |||
| 2006 | Ga0207675_100591707 | |||
| 2007 | Ga0207675_101649111 | |||
| 2008 | Ga0207675_101873541 | |||
| 2009 | Ga0207683_10056980 | |||
| 2010 | Ga0207683_10719957 | |||
| 2011 | Ga0207698_10557490 | |||
| 2012 | Ga0207428_10007052 | |||
| 2013 | Ga0207428_10036227 | |||
| 2014 | Ga0207428_10068145 | |||
| 2015 | Ga0207428_10111346 | |||
| 2016 | Ga0207428_10575612 | |||
| 2017 | Ga0268266_10514937 | |||
| 2018 | Ga0268266_11080657 | |||
| 2019 | Ga0268265_10028484 | |||
| 2020 | Ga0268265_10134675 | |||
| 2021 | Ga0268265_10142765 | |||
| 2022 | Ga0268265_10225450 | |||
| 2023 | Ga0268265_10402473 | |||
| 2024 | Ga0268265_10586864 | |||
| 2025 | Ga0268265_10891658 | |||
| 2026 | Ga0268265_10901930 | |||
| 2027 | Ga0268265_11045617 | |||
| 2028 | Ga0268265_11903632 | |||
| 2029 | Ga0268265_12038785 | |||
| 2030 | Ga0268265_12287803 | |||
| 2031 | Ga0268264_10009644 | |||
| 2032 | Ga0268264_10027485 | |||
| 2033 | Ga0268264_10029294 | |||
| 2034 | Ga0268264_10036951 | |||
| 2035 | Ga0268264_10113532 | |||
| 2036 | Ga0268264_10425474 | |||
| 2037 | Ga0268264_10464725 | |||
| 2038 | Ga0268264_10713852 | |||
| 2039 | Ga0268264_11058192 | |||
| 2040 | Ga0268264_11426039 | |||
| 2041 | Ga0268264_11698378 | |||
| 2042 | Ga0307513_10053961 | |||
| 2043 | Ga0307408_100002360 | |||
| 2044 | Ga0307408_100439096 | |||
| 2045 | Ga0307408_101294956 | |||
| 2046 | Ga0307405_10009530 | |||
| 2047 | Ga0307413_10388874 | |||
| 2048 | Ga0307410_10006757 | |||
| 2049 | Ga0307406_10001697 | |||
| 2050 | Ga0307406_11404745 | |||
| 2051 | Ga0307412_10008182 | |||
| 2052 | Ga0307416_100005462 | |||
| 2053 | Ga0307414_10003043 | |||
| 2054 | Ga0307411_10003209 | |||
| 2055 | Ga0307415_100004223 | |||
| 2056 | Ga0307415_100269584 | |||
| 2057 | Ga0373941_0270932 | |||
| 2058 | Ga0373954_0097166 | |||
| 2059 | Ga0373955_0063940 | |||
| 2060 | Ga0373962_0224676 | |||
| 2061 | Ga0373937_0055277 | |||
| 2062 | Ga0373937_0336553 | |||
| 2063 | Ga0395900_0253790 | |||
| 2064 | Ga0395900_0343334 | |||
| 2065 | Ga0395900_0467589 | |||
| 2066 | Ga0395900_0675956 | |||
| 2067 | Ga0395900_1227634 | |||
| 2068 | Ga0395900_1319390 | |||
| 2069 | Ga0395900_1361658 | |||
| 2070 | Ga0395900_1497721 | |||
| 2071 | Ga0395898_0222997 | |||
| 2072 | Ga0395898_0390591 | |||
| 2073 | Ga0395898_1274283 | |||
| 2074 | Ga0395898_1929259 | |||
| 2075 | Ga0395905_0108657 | |||
| 2076 | Ga0395905_0650880 | |||
| 2077 | Ga0395901_0311136 | |||
| 2078 | Ga0395901_0893072 | |||
| 2079 | Ga0242420_040628 | |||
| 2080 | Ga0436361_0038753 | |||
| 2081 | Ga0436361_0097781 | |||
| 2082 | Ga0436361_0273342 | |||
| 2083 | Ga0439439_0100287 | |||
| 2084 | Ga0439462_0152797 | |||
| 2085 | Ga0450889_030116 | |||
| 2086 | Ga0439458_0003430 | |||
| 2087 | Ga0439434_0312982 | |||
| 2088 | Ga0450893_0036950 | |||
| 2089 | Ga0453683_0002963 | |||
| 2090 | Ga0453683_0292847 | |||
| 2091 | Ga0453683_0463603 | |||
| 2092 | Ga0451576_0322812 | |||
| 2093 | Ga0451576_0334251 | |||
| 2094 | Ga0451576_0488737 | |||
| 2095 | Ga0495629_1136857 | |||
| 2096 | Ga0495664_0050191 | |||
| 2097 | Ga0495584_0297550 | |||
| 2098 | Ga0495610_0135710 | |||
| 2099 | Ga0495618_0065886 | |||
| 2100 | Ga0495663_0000141 | |||
| 2101 | Ga0495640_0249536 | |||
| 2102 | Ga0495598_0001391 | |||
| 2103 | Ga0495621_0003242 | |||
| 2104 | Ga0495621_0273970 | |||
| 2105 | Ga0495658_0965436 | |||
| 2106 | Ga0495613_0014721 | |||
| 2107 | Ga0495636_0015855 | |||
| 2108 | Ga0495636_0107152 | |||
| 2109 | Ga0495674_0085371 | |||
| 2110 | Ga0495672_0037470 | |||
| 2111 | Ga0495680_0547427 | |||
| 2112 | Ga0495684_0980728 | |||
| 2113 | Ga0496102_0027452 | |||
| 2114 | Ga0496104_0090421 | |||
| 2115 | Ga0496104_0388553 | |||
| 2116 | Ga0496105_1241206 | |||
| 2117 | Ga0496106_0070548 | |||
| 2118 | Ga0496106_0492228 | |||
| 2119 | Ga0496106_1185776 | |||
| 2120 | Ga0496107_0088036 | |||
| 2121 | Ga0496107_0140898 | |||
| 2122 | Ga0496108_0091443 | |||
| 2123 | Ga0496108_0332699 | |||
| 2124 | Ga0496109_0667197 | |||
| 2125 | Ga0496110_0176971 | |||
| 2126 | Ga0496110_0731137 | |||
| 2127 | Ga0496110_0805301 | |||
| 2128 | Ga0496112_0235439 | |||
| 2129 | Ga0496112_0285463 | |||
| 2130 | Ga0496114_0351036 | |||
| 2131 | Ga0501290_059572 | |||
| 2132 | Ga0501292_028310 | |||
| 2133 | Ga0501298_002414 | |||
| 2134 | Ga0501031_0284998 | |||
| 2135 | Ga0501076_0318873 | |||
| 2136 | Ga0501077_0885371 | |||
| 2137 | Ga0501198_066271 | |||
| 2138 | Ga0501202_000926 | |||
| 2139 | Ga0501202_008649 | |||
| 2140 | Ga0501207_019171 | |||
| 2141 | Ga0501208_001891 | |||
| 2142 | Ga0501216_000138 | |||
| 2143 | Ga0501217_000335 | |||
| 2144 | Ga0501223_014882 | |||
| 2145 | Ga0501227_003645 | |||
| 2146 | Ga0501233_011024 | |||
| 2147 | Ga0501235_000537 | |||
| 2148 | Ga0501236_019102 | |||
| 2149 | Ga0501253_026904 | |||
| 2150 | Ga0501257_079552 | |||
| 2151 | Ga0501260_008863 | |||
| 2152 | Ga0501225_0145736 | |||
| 2153 | Ga0501229_049613 | |||
| 2154 | Ga0501234_000512 | |||
| 2155 | Ga0501234_022848 | |||
| 2156 | Ga0501081_1173270 | |||
| 2157 | Ga0501268_067653 | |||
| 2158 | Ga0501272_013670 | |||
| 2159 | Ga0501273_000692 | |||
| 2160 | Ga0501045_0494458 | |||
| 2161 | Ga0501212_001963 | |||
| 2162 | Ga0501226_001384 | |||
| 2163 | nmdc:mga05p37_102984_c1 | |||
| 2164 | nmdc:mga05p37_1210226_c1 | |||
| 2165 | nmdc:mga05p37_127174_c1 | |||
| 2166 | nmdc:mga05p37_13047_c1 | |||
| 2167 | nmdc:mga05p37_1350539_c1 | |||
| 2168 | nmdc:mga05p37_1378107_c1 | |||
| 2169 | nmdc:mga05p37_1443240_c1 | |||
| 2170 | nmdc:mga05p37_1516577_c1 | |||
| 2171 | nmdc:mga05p37_158976_c1 | |||
| 2172 | nmdc:mga05p37_1620250_c1 | |||
| 2173 | nmdc:mga05p37_1660928_c1 | |||
| 2174 | nmdc:mga05p37_288194_c1 | |||
| 2175 | nmdc:mga05p37_358246_c1 | |||
| 2176 | nmdc:mga05p37_396613_c1 | |||
| 2177 | nmdc:mga05p37_448950_c1 | |||
| 2178 | nmdc:mga05p37_759313_c1 | |||
| 2179 | nmdc:mga05p37_775073_c1 | |||
| 2180 | nmdc:mga09592_132270_c1 | |||
| 2181 | nmdc:mga09592_671824_c1 | |||
| 2182 | nmdc:mga0qj67_359768_c1 | |||
| 2183 | nmdc:mga06r32_468566_c1 | |||
| 2184 | nmdc:mga08y16_106268_c1 | |||
| 2185 | nmdc:mga08y16_14107_c1 | |||
| 2186 | nmdc:mga08y16_164209_c1 | |||
| 2187 | nmdc:mga08y16_296197_c1 | |||
| 2188 | nmdc:mga08y16_39775_c1 | |||
| 2189 | nmdc:mga08y16_41891_c1 | |||
| 2190 | nmdc:mga08y16_85730_c1 | |||
| 2191 | nmdc:mga08y16_8851_c1 | |||
| 2192 | nmdc:mga0n895_360604_c1 | |||
| 2193 | nmdc:mga0n895_50076_c1 | |||
| 2194 | nmdc:mga0n895_66058_c1 | |||
| 2195 | nmdc:mga0n895_665477_c1 | |||
| 2196 | nmdc:mga0n895_72469_c1 | |||
| 2197 | nmdc:mga0rr50_148329_c1 | |||
| 2198 | nmdc:mga0rr50_151395_c1 | |||
| 2199 | nmdc:mga0rr50_173012_c1 | |||
| 2200 | nmdc:mga0rr50_61526_c1 | |||
| 2201 | nmdc:mga0rr50_729958_c1 | |||
| 2202 | nmdc:mga08x19_3501_c1 | |||
| 2203 | nmdc:mga0a205_1063216_c1 | |||
| 2204 | nmdc:mga0a205_1099872_c1 | |||
| 2205 | nmdc:mga0a205_112407_c1 | |||
| 2206 | nmdc:mga0a205_115612_c1 | |||
| 2207 | nmdc:mga0a205_17483_c1 | |||
| 2208 | nmdc:mga0a205_211349_c1 | |||
| 2209 | nmdc:mga0a205_25748_c1 | |||
| 2210 | nmdc:mga0a205_367832_c1 | |||
| 2211 | nmdc:mga0a205_412280_c1 | |||
| 2212 | nmdc:mga0a205_459292_c1 | |||
| 2213 | nmdc:mga0a205_527134_c1 | |||
| 2214 | nmdc:mga0a205_541756_c1 | |||
| 2215 | nmdc:mga0a205_600291_c1 | |||
| 2216 | nmdc:mga0a205_63102_c1 | |||
| 2217 | nmdc:mga0a205_64457_c1 | |||
| 2218 | nmdc:mga0a205_853929_c1 | |||
| 2219 | nmdc:mga0a205_88838_c1 | |||
| 2220 | Ga0501084_0073915 | |||
| 2221 | Ga0501084_0327543 | |||
| 2222 | Ga0530510_0662718 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4nb0-assembly1.cif.gz_A | crystal structure of fosb from staphylococcus aureus with bs-cys9 disulfide at 1.62 angstrom resolution | 0.8333 | 1 | 121 |
| 2p25-assembly1.cif.gz_A-2 | the crystal structure of the glyoxalase family protein from enterococcus faecalis | 0.833 | 2 | 122 |
| 1npb-assembly2.cif.gz_D | crystal structure of the fosfomycin resistance protein from transposon tn2921 | 0.8291 | 1 | 121 |
| 3l7t-assembly2.cif.gz_C | crystal structure of smu.1112c | 0.8285 | 1 | 122 |
| 2p7p-assembly2.cif.gz_D | crystal structure of genomically encoded fosfomycin resistance protein, fosx, from listeria monocytogenes complexed with mn(ii) and sulfate ion | 0.8229 | 1 | 123 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WKQ3_98_165_3.30.720.110 | Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; | 0.8627 | 71 | 127 | 3.30.720.110 |
| 3sk1C01 | Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; | 0.8472 | 1 | 50 | 3.30.720.120 |
| 3bt3B02 | Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; | 0.8278 | 72 | 124 | 3.30.720.110 |
| 5wewB00 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.8205 | 1 | 123 | 3.10.180.10 |
| 3sk1A02 | Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; | 0.8205 | 71 | 124 | 3.30.720.110 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3D5SMP5-F1-model_v4 | Glyoxalase/bleomycin resistance/dioxygenase family protein | 0.9772 | 1 | 127 |
GO:0004493
GO:0046491 GO:0051213 |
| AF-A0A3D5SMP5-F1-model_v4 | Glyoxalase/bleomycin resistance/dioxygenase family protein | 0.9697 | 1 | 127 |
GO:0004493
GO:0046491 GO:0051213 |
| AF-A0A537HBI7-F1-model_v4 | VOC family protein | 0.9652 | 70 | 127 |
|
| AF-A0A838DSU5-F1-model_v4 | VOC family protein | 0.9322 | 1 | 123 |
|
| AF-A0A151BPP0-F1-model_v4 | Glyoxalase/bleomycin resistance protein/dioxygenase | 0.9297 | 1 | 124 |
GO:0051213
|