F490038
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1099 | 470 | 1038 | 288 |
Family's Representative Sequence
| Representative Sequence | 3300025914|Ga0207671_10008592|Ga0207671_100085926 |
| Length | 325 |
| Sequence | MSVLVNKNTKVITQGFTGQQGTFHSEQALEYGTKLVGGVTPGKGGSEHIGLPVYNTVLDAVNDTGAEASMIFVPPPFAADAILEAADAGVKVIVAITEGIPVLDMLRVKNVLKDYPDTVLIGPNCPGIITPGECKIGIMPGHIHKPGKVGIVSRSGTLTYEAVFQTTNVGLGQSTCIGIGGDPINGLNFIDCLKLFQDDAQTEGIIMVGEIGGSAEEEAAEFIEEYVKKPVVAFIAGASAPAGKRMGHAGAIISGGKGTAAAKVRRAREGRRDDGEVAGGSRQDAGDEDEVRLCGRPLPACRPPSPASGGRNGKRSHSLGAQRQF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2537561836 | Rhodanobacter spathiphylli B39 | Isolate | Unclassified |
| 2 | 2576861471 | Stenotrophomonas rhizophila DSM 14405 | Isolate | Rhizosphere |
| 3 | 2593339238 | Luteibacter sp. UNCMF366Tsu5.1 | Isolate | Unclassified |
| 4 | 2593339239 | Luteibacter sp. UNCMF331Sha3.1 | Isolate | Unclassified |
| 5 | 2643221562 | Rhodanobacter sp. Root561 | Isolate | Unclassified |
| 6 | 2643221577 | Rhodanobacter sp. Root627 | Isolate | Unclassified |
| 7 | 2643221579 | Pseudoxanthomonas sp. Root630 | Isolate | Unclassified |
| 8 | 2643221581 | Pseudoxanthomonas sp. Root65 | Isolate | Unclassified |
| 9 | 2643221685 | Rhodanobacter sp. Root480 | Isolate | Unclassified |
| 10 | 2687453130 | Dyella thiooxydans ATSB10 | Isolate | Unclassified |
| 11 | 2718218334 | Luteibacter rhizovicinus LJ96 | Isolate | Rhizosphere |
| 12 | 2734482264 | Dyella sp. AD052 | Isolate | Unclassified |
| 13 | 2738543009 | Luteibacter sp. OK325 | Isolate | Unclassified |
| 14 | 2739367700 | Dyella sp. YR388 | Isolate | Unclassified |
| 15 | 2740891818 | Desulfofaba hansenii DSM 12642 | Isolate | Unclassified |
| 16 | 2747842428 | Stenotrophomonas sp. WCS2014-113 | Isolate | Unclassified |
| 17 | 2747842501 | Xanthomonas sp. WCS2014-23 | Isolate | Unclassified |
| 18 | 2765235840 | Stenotrophomonas maltophilia AA1 | Isolate | Unclassified |
| 19 | 2816332141 | Stenotrophomonas muris 1190 (v2) (version 2) | Isolate | Unclassified |
| 20 | 2818991438 | Novosphingobium barchaimii 1192 | Isolate | Unclassified |
| 21 | 2818991440 | Luteibacter yeojuensis 583 | Isolate | Unclassified |
| 22 | 2818991457 | Xanthomonas translucens 569 | Isolate | Unclassified |
| 23 | 2842391507 | Stenotrophomonas maltophilia SEMIA 4027 | Isolate | Nodule |
| 24 | 2842914999 | Luteibacter sp. R-72151 | Isolate | Unclassified |
| 25 | 2842918807 | Luteibacter sp. R-73110 | Isolate | Unclassified |
| 26 | 2852649853 | Stenotrophomonas sp. JAI102 | Isolate | Rhizosphere |
| 27 | 2852684882 | Xanthomonas sp. JAI131 | Isolate | Rhizosphere |
| 28 | 2857442823 | Stenotrophomonas sp. R-74235 | Isolate | Unclassified |
| 29 | 2874220319 | Stenotrophomonas maltophilia PS5 | Isolate | Unclassified |
| 30 | 2884338543 | Luteibacter pinisoli MAH-14 | Isolate | Rhizosphere |
| 31 | 2884411467 | Dyella sp. AD56 | Isolate | Rhizosphere |
| 32 | 2895395659 | Rhodanobacter sp. T12-5 | Isolate | Unclassified |
| 33 | 2904463128 | Luteibacter yeojuensis 3191 | Isolate | Unclassified |
| 34 | 2919085039 | Luteibacter sp. 1214 | Isolate | Unclassified |
| 35 | 2919089067 | Stenotrophomonas sp. 1337 | Isolate | Rhizosphere |
| 36 | 2919130084 | Xanthomonas sp. 1678 | Isolate | Rhizosphere |
| 37 | 2919134579 | Stenotrophomonas geniculata 1733 | Isolate | Rhizosphere |
| 38 | 2919404418 | Luteibacter sp. 3190 | Isolate | Unclassified |
| 39 | 2919513703 | Luteimonas sp. 3794 | Isolate | Unclassified |
| 40 | 2919675420 | Luteimonas terrae 4099 | Isolate | Unclassified |
| 41 | 2923516293 | Pseudoxanthomonas mexicana SLBN-89 | Isolate | Rhizosphere |
| 42 | 2928496128 | Stenotrophomonas indicatrix 1163 | Isolate | Unclassified |
| 43 | 2928963466 | Dyella japonica 1073 | Isolate | Unclassified |
| 44 | 2929195423 | Xanthomonas sp. R-73098 Hybrid assembly | Isolate | Unclassified |
| 45 | 2931380184 | Stenotrophomonas sp. DR822 | Isolate | Rhizosphere |
| 46 | 2937610967 | Stenotrophomonas maltophilia EP20 | Isolate | Unclassified |
| 47 | 2939589442 | Stenotrophomonas rhizophila 716 | Isolate | Rhizosphere |
| 48 | 2939611941 | Rhodanobacter soli 1757 | Isolate | Rhizosphere |
| 49 | 2939626828 | Stenotrophomonas sp. 2694 | Isolate | Rhizosphere |
| 50 | 2941471342 | Luteibacter sp. 621 | Isolate | Unclassified |
| 51 | 2941475908 | Stenotrophomonas rhizophila 2680 | Isolate | Rhizosphere |
| 52 | 2953994433 | Luteibacter sp. W1I16 | Isolate | Rhizosphere |
| 53 | 2961047084 | Stenotrophomonas maltophilia EP5 | Isolate | Unclassified |
| 54 | 2961064222 | Stenotrophomonas maltophilia EP13 | Isolate | Unclassified |
| 55 | 2974307012 | Stenotrophomonas sp. SORGH_AS_0282 | Isolate | Unclassified |
| 56 | 2977247770 | Stenotrophomonas rhizophila SORGH_AS 457 | Isolate | Unclassified |
| 57 | 2984514374 | Stenotrophomonas sp. SORGH_AS282 | Isolate | Aerial Root |
| 58 | 2987605356 | Stenotrophomonas sp. ATCM1_4 | Isolate | Unclassified |
| 59 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 60 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 61 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 62 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 63 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 64 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 65 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 66 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 67 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 68 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 69 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 70 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 71 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 72 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 73 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 74 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 75 | 3300003479 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_06_lowP_mix1_d1 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 76 | 3300003567 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_04_fullP_mix3_d1 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 77 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 78 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 79 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 80 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 81 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 82 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 83 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 84 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 85 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 86 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 87 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 88 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 89 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 90 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 91 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 92 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 93 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 94 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 95 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 96 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 99 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 100 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 101 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 102 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 104 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 105 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 106 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 107 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 108 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 109 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 110 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 111 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 112 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 113 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 114 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 115 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 116 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 117 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 118 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 119 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 120 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 121 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 122 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 123 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 124 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 125 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 126 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 127 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 128 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 129 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 130 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 131 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 132 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 133 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 134 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 135 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 136 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 137 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 138 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 139 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 140 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 141 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 142 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 143 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 144 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 145 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 146 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 147 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 148 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 149 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 150 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 151 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 152 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 153 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 154 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 155 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 156 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 157 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 158 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 159 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 160 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 161 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 162 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 163 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 165 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 166 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 167 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 168 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 170 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 171 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 172 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 174 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 175 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 176 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 177 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 178 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 179 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 180 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 181 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 182 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 183 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 184 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 185 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 186 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 187 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 188 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 189 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 190 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 191 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 192 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 193 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 194 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 195 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 196 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 197 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 198 | 3300015685 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 | Metagenome | Unclassified |
| 199 | 3300015687 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 | Metagenome | Rhizosphere |
| 200 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 201 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 202 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 203 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 204 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 205 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 206 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 207 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 208 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 209 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 210 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 211 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 212 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 213 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 214 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 215 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 216 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 217 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 218 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 219 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 220 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 221 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 222 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 223 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 224 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 225 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 226 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 227 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 228 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 229 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 230 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 231 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 232 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 233 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 234 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 268 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 270 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 271 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 272 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 273 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 274 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 275 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 276 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 277 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 278 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 279 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 280 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 281 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 282 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 283 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 284 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 285 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 286 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 287 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 288 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 289 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 290 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 291 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 292 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 293 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 294 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 295 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 296 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 297 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 298 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 299 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 300 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 301 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 302 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 303 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 304 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 305 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 306 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 307 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 308 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 309 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 310 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 311 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 312 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 313 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 314 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 315 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 316 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 317 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 318 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 319 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 320 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 321 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 322 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 323 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 324 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 325 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 326 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 327 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 328 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 329 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 330 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 331 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 332 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 333 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 334 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 335 | 3300044663 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA2E_TR | Metagenome | Unclassified |
| 336 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 337 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 338 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 339 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 340 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 341 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 342 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 343 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 344 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 345 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 346 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 393 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 394 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 395 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 396 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 397 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 398 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 399 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 400 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 401 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 402 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 403 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 404 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 405 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 406 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 407 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 408 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 409 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 410 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 411 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 412 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 413 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 414 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 415 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 416 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 419 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 420 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 421 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 422 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 423 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 424 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 425 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 426 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 427 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 428 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 429 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 430 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 431 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 432 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 433 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 434 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 435 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 436 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 437 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 438 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 439 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 440 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 441 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 442 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 443 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 444 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 445 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 446 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 447 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 448 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 449 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 450 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 451 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 452 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 453 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 454 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 455 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 456 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 457 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 458 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 459 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 460 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 461 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 462 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 463 | 3300059624 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 464 | 3300059627 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 465 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 466 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 467 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 468 | 8021622325 | Xanthomonas sp. LMG12462 | Isolate | Rhizosphere |
| 469 | 8021626552 | Xanthomonas sp. LMG12460 | Isolate | Rhizosphere |
| 470 | 8021648035 | Xanthomonas sp. LMG 12461 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.27 |
| Metatranscriptomes | 1.18 |
| Isolates | 5.55 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.09 |
| Bulb | 0 |
| Endosphere | 12.37 |
| Nodule | 0.09 |
| Rhizoplane | 2.46 |
| Rhizosphere | 76.43 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.55 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1000331 | 3300001904 | Bacteria | 8834 |
| 2 | JGI24736J21556_1000372 | 3300001904 | Bacteria | 8462 |
| 3 | JGI24741J21665_1002943 | 3300001915 | Bacteria | 4246 |
| 4 | JGI24740J21852_10004561 | 3300001979 | Bacteria | 5956 |
| 5 | JGI24740J21852_10007220 | 3300001979 | Bacteria | 4529 |
| 6 | JGI24740J21852_10016362 | 3300001979 | Bacteria | 2681 |
| 7 | JGI24739J22299_10002202 | 3300001989 | Bacteria | 7487 |
| 8 | JGI24739J22299_10010039 | 3300001989 | Bacteria | 3520 |
| 9 | JGI24739J22299_10050403 | 3300001989 | Bacteria | 1346 |
| 10 | JGI24737J22298_10008868 | 3300001990 | Bacteria | 3357 |
| 11 | JGI24737J22298_10009746 | 3300001990 | Bacteria | 3183 |
| 12 | JGI24737J22298_10011187 | 3300001990 | Bacteria | 2944 |
| 13 | JGI24735J21928_10004119 | 3300002067 | Bacteria | 4911 |
| 14 | JGI24735J21928_10012133 | 3300002067 | Bacteria | 2725 |
| 15 | JGI24738J21930_10000044 | 3300002075 | Bacteria | 24745 |
| 16 | JGI25162J39368_1000781 | 3300002737 | Bacteria | 21361 |
| 17 | JGI25162J39368_1001109 | 3300002737 | Bacteria | 16296 |
| 18 | JGI25162J39368_1001253 | 3300002737 | Bacteria | 14523 |
| 19 | JGI25162J39368_1001416 | 3300002737 | Bacteria | 13048 |
| 20 | JGI25162J39368_1003558 | 3300002737 | Bacteria | 4382 |
| 21 | JGI25162J39368_1005737 | 3300002737 | Bacteria | 2328 |
| 22 | JGI25154J39366_1006558 | 3300002738 | Bacteria | 1688 |
| 23 | JGI25157J39369_1001319 | 3300002741 | Bacteria | 9875 |
| 24 | JGI25163J39215_1000233 | 3300002771 | Bacteria | 20699 |
| 25 | JGI25164J39214_1000030 | 3300002772 | Bacteria | 145974 |
| 26 | JGI25164J39214_1000317 | 3300002772 | Bacteria | 31376 |
| 27 | JGI25164J39214_1000537 | 3300002772 | Bacteria | 17692 |
| 28 | JGI25164J39214_1000599 | 3300002772 | Bacteria | 15779 |
| 29 | JGI25150J39212_1000339 | 3300002774 | Bacteria | 23054 |
| 30 | JGI25151J46595_10000141 | 3300003187 | Bacteria | 95351 |
| 31 | JGI25165J46597_1000057 | 3300003214 | Bacteria | 217135 |
| 32 | JGI25165J46597_1000601 | 3300003214 | Bacteria | 30833 |
| 33 | JGI25165J46597_1001192 | 3300003214 | Bacteria | 15778 |
| 34 | JGI25165J46597_1011312 | 3300003214 | Bacteria | 1277 |
| 35 | JGI25153J46596_10000106 | 3300003215 | Bacteria | 95351 |
| 36 | Ga0006556J51387_1026971 | 3300003479 | Bacteria | 2132 |
| 37 | Ga0006554J51385_1022122 | 3300003567 | Bacteria | 2147 |
| 38 | Ga0006562J51391_1028372 | 3300003578 | Bacteria | 3720 |
| 39 | Ga0006562J51391_1068853 | 3300003578 | Bacteria | 6080 |
| 40 | Ga0006562J51391_1068854 | 3300003578 | Bacteria | 1150 |
| 41 | JGI25404J52841_10029262 | 3300003659 | Bacteria | 1181 |
| 42 | Ga0055538_1000663 | 3300003751 | Bacteria | 10792 |
| 43 | Ga0055539_1001886 | 3300003752 | Bacteria | 3518 |
| 44 | Ga0055533_1000475 | 3300003756 | Bacteria | 15066 |
| 45 | Ga0055533_1007185 | 3300003756 | Bacteria | 1542 |
| 46 | Ga0055525_1000093 | 3300003759 | Bacteria | 138423 |
| 47 | Ga0055527_1000245 | 3300003760 | Bacteria | 33608 |
| 48 | Ga0055527_1001066 | 3300003760 | Bacteria | 6500 |
| 49 | Ga0055535_1000732 | 3300003761 | Bacteria | 24695 |
| 50 | Ga0055535_1001158 | 3300003761 | Bacteria | 15527 |
| 51 | Ga0055535_1002441 | 3300003761 | Bacteria | 6500 |
| 52 | Ga0055542_1000432 | 3300003762 | Bacteria | 40265 |
| 53 | Ga0055542_1000599 | 3300003762 | Bacteria | 30833 |
| 54 | Ga0055542_1000751 | 3300003762 | Bacteria | 24695 |
| 55 | Ga0055542_1002340 | 3300003762 | Bacteria | 6500 |
| 56 | Ga0055529_1000961 | 3300003763 | Bacteria | 14876 |
| 57 | Ga0055529_1001551 | 3300003763 | Bacteria | 6500 |
| 58 | Ga0055537_1000210 | 3300003773 | Bacteria | 43507 |
| 59 | Ga0055524_1016435 | 3300003775 | Bacteria | 2655 |
| 60 | Ga0055536_1001544 | 3300003781 | Bacteria | 13827 |
| 61 | Ga0055536_1006384 | 3300003781 | Bacteria | 5521 |
| 62 | Ga0055534_1000276 | 3300003784 | Bacteria | 35065 |
| 63 | Ga0055528_1000121 | 3300003790 | Bacteria | 62003 |
| 64 | Ga0055531_10012029 | 3300003794 | Bacteria | 4109 |
| 65 | Ga0055531_10025591 | 3300003794 | Bacteria | 2137 |
| 66 | Ga0058692_1000013 | 3300003856 | Bacteria | 316299 |
| 67 | Ga0058692_1000033 | 3300003856 | Bacteria | 174393 |
| 68 | Ga0065165_1000201 | 3300005262 | Bacteria | 103327 |
| 69 | Ga0065704_10153275 | 3300005289 | Bacteria | 1412 |
| 70 | Ga0070658_10003002 | 3300005327 | Bacteria | 13959 |
| 71 | Ga0070658_10020121 | 3300005327 | Bacteria | 5346 |
| 72 | Ga0070658_10138710 | 3300005327 | Bacteria | 2030 |
| 73 | Ga0070676_10000019 | 3300005328 | Bacteria | 48919 |
| 74 | Ga0070683_100006950 | 3300005329 | Bacteria | 9515 |
| 75 | Ga0070683_100032813 | 3300005329 | Bacteria | 4732 |
| 76 | Ga0070683_100242923 | 3300005329 | Bacteria | 1713 |
| 77 | Ga0070683_100251255 | 3300005329 | Bacteria | 1682 |
| 78 | Ga0070690_100000062 | 3300005330 | Bacteria | 53686 |
| 79 | Ga0070670_100003783 | 3300005331 | Bacteria | 12599 |
| 80 | Ga0068869_100001311 | 3300005334 | Bacteria | 14729 |
| 81 | Ga0068869_100126787 | 3300005334 | Bacteria | 1958 |
| 82 | Ga0068869_100231768 | 3300005334 | Bacteria | 1467 |
| 83 | Ga0070666_10000037 | 3300005335 | Bacteria | 116528 |
| 84 | Ga0070680_100001055 | 3300005336 | Bacteria | 19733 |
| 85 | Ga0070680_100100839 | 3300005336 | Bacteria | 2396 |
| 86 | Ga0070682_100009277 | 3300005337 | Bacteria | 5568 |
| 87 | Ga0070682_100056300 | 3300005337 | Bacteria | 2472 |
| 88 | Ga0070682_100070382 | 3300005337 | Bacteria | 2236 |
| 89 | Ga0070682_100113106 | 3300005337 | Bacteria | 1812 |
| 90 | Ga0070682_100158789 | 3300005337 | Bacteria | 1559 |
| 91 | Ga0070682_100168330 | 3300005337 | Bacteria | 1520 |
| 92 | Ga0068868_100000002 | 3300005338 | Bacteria | 159433 |
| 93 | Ga0068868_100089278 | 3300005338 | Bacteria | 2481 |
| 94 | Ga0068868_100435306 | 3300005338 | Bacteria | 1138 |
| 95 | Ga0070660_100000539 | 3300005339 | Bacteria | 25340 |
| 96 | Ga0070660_100077659 | 3300005339 | Bacteria | 2602 |
| 97 | Ga0070660_100219938 | 3300005339 | Bacteria | 1543 |
| 98 | Ga0070660_100241840 | 3300005339 | Bacteria | 1470 |
| 99 | Ga0070660_100476096 | 3300005339 | Bacteria | 1037 |
| 100 | Ga0070689_100000206 | 3300005340 | Bacteria | 35564 |
| 101 | Ga0070689_100006941 | 3300005340 | Bacteria | 7887 |
| 102 | Ga0070689_100265442 | 3300005340 | Bacteria | 1420 |
| 103 | Ga0070691_10004209 | 3300005341 | Bacteria | 6540 |
| 104 | Ga0070687_100001583 | 3300005343 | Bacteria | 8085 |
| 105 | Ga0070661_100000194 | 3300005344 | Bacteria | 50226 |
| 106 | Ga0070661_100001553 | 3300005344 | Bacteria | 15964 |
| 107 | Ga0070661_100045981 | 3300005344 | Bacteria | 3192 |
| 108 | Ga0070661_100070505 | 3300005344 | Bacteria | 2570 |
| 109 | Ga0070661_100071088 | 3300005344 | Bacteria | 2560 |
| 110 | Ga0070661_100190400 | 3300005344 | Bacteria | 1564 |
| 111 | Ga0070661_100461724 | 3300005344 | Bacteria | 1011 |
| 112 | Ga0070692_10072430 | 3300005345 | Bacteria | 1838 |
| 113 | Ga0070668_100000813 | 3300005347 | Bacteria | 21511 |
| 114 | Ga0070668_100014195 | 3300005347 | Bacteria | 5950 |
| 115 | Ga0070668_100021628 | 3300005347 | Bacteria | 4859 |
| 116 | Ga0070668_100025263 | 3300005347 | Bacteria | 4503 |
| 117 | Ga0070669_100000294 | 3300005353 | Bacteria | 39148 |
| 118 | Ga0070675_100000104 | 3300005354 | Bacteria | 49929 |
| 119 | Ga0070671_100017824 | 3300005355 | Bacteria | 5755 |
| 120 | Ga0070674_100000045 | 3300005356 | Bacteria | 53267 |
| 121 | Ga0070673_100005351 | 3300005364 | Bacteria | 8201 |
| 122 | Ga0070673_100085963 | 3300005364 | Bacteria | 2562 |
| 123 | Ga0070688_100000668 | 3300005365 | Bacteria | 17060 |
| 124 | Ga0070688_100019868 | 3300005365 | Bacteria | 3897 |
| 125 | Ga0070659_100000029 | 3300005366 | Bacteria | 139518 |
| 126 | Ga0070659_100000112 | 3300005366 | Bacteria | 59916 |
| 127 | Ga0070659_100021635 | 3300005366 | Bacteria | 4901 |
| 128 | Ga0070659_100026223 | 3300005366 | Bacteria | 4482 |
| 129 | Ga0070659_100073578 | 3300005366 | Bacteria | 2720 |
| 130 | Ga0070659_100199321 | 3300005366 | Bacteria | 1647 |
| 131 | Ga0070667_100000102 | 3300005367 | Bacteria | 107693 |
| 132 | Ga0070667_100025660 | 3300005367 | Bacteria | 4900 |
| 133 | Ga0070667_100072489 | 3300005367 | Bacteria | 2935 |
| 134 | Ga0070667_100196355 | 3300005367 | Bacteria | 1789 |
| 135 | Ga0070667_100288958 | 3300005367 | Bacteria | 1474 |
| 136 | Ga0070714_100001345 | 3300005435 | Bacteria | 17773 |
| 137 | Ga0070714_100021967 | 3300005435 | Bacteria | 5227 |
| 138 | Ga0070713_100000055 | 3300005436 | Bacteria | 70759 |
| 139 | Ga0070713_100459128 | 3300005436 | Bacteria | 1197 |
| 140 | Ga0070701_10001321 | 3300005438 | Bacteria | 9133 |
| 141 | Ga0070711_100312550 | 3300005439 | Bacteria | 1253 |
| 142 | Ga0070705_100000656 | 3300005440 | Bacteria | 19788 |
| 143 | Ga0070708_100000059 | 3300005445 | Bacteria | 70999 |
| 144 | Ga0070663_100003975 | 3300005455 | Bacteria | 8626 |
| 145 | Ga0070663_100016964 | 3300005455 | Bacteria | 4740 |
| 146 | Ga0070663_100023904 | 3300005455 | Bacteria | 4102 |
| 147 | Ga0070663_100068877 | 3300005455 | Bacteria | 2569 |
| 148 | Ga0070663_100143396 | 3300005455 | Bacteria | 1826 |
| 149 | Ga0070663_100187385 | 3300005455 | Bacteria | 1608 |
| 150 | Ga0070663_100223072 | 3300005455 | Bacteria | 1481 |
| 151 | Ga0070678_100011266 | 3300005456 | Bacteria | 5508 |
| 152 | Ga0070662_100001839 | 3300005457 | Bacteria | 12998 |
| 153 | Ga0070662_100022409 | 3300005457 | Bacteria | 4325 |
| 154 | Ga0070662_100062140 | 3300005457 | Bacteria | 2728 |
| 155 | Ga0070681_10000012 | 3300005458 | Bacteria | 137191 |
| 156 | Ga0070681_10004142 | 3300005458 | Bacteria | 13717 |
| 157 | Ga0070681_10008223 | 3300005458 | Bacteria | 10207 |
| 158 | Ga0070681_10042989 | 3300005458 | Bacteria | 4527 |
| 159 | Ga0068867_100093916 | 3300005459 | Bacteria | 2280 |
| 160 | Ga0070685_10000264 | 3300005466 | Bacteria | 33696 |
| 161 | Ga0070685_10004503 | 3300005466 | Bacteria | 7054 |
| 162 | Ga0070679_100001207 | 3300005530 | Bacteria | 22745 |
| 163 | Ga0070679_100046312 | 3300005530 | Bacteria | 4334 |
| 164 | Ga0070679_100100781 | 3300005530 | Bacteria | 2874 |
| 165 | Ga0070679_100611914 | 3300005530 | Bacteria | 1033 |
| 166 | Ga0070684_100284771 | 3300005535 | Bacteria | 1514 |
| 167 | Ga0068853_100007490 | 3300005539 | Bacteria | 8740 |
| 168 | Ga0068853_100032467 | 3300005539 | Bacteria | 4423 |
| 169 | Ga0068853_100038741 | 3300005539 | Bacteria | 4061 |
| 170 | Ga0068853_100051238 | 3300005539 | Bacteria | 3553 |
| 171 | Ga0068853_100068171 | 3300005539 | Bacteria | 3092 |
| 172 | Ga0068853_100081447 | 3300005539 | Bacteria | 2834 |
| 173 | Ga0068853_100092077 | 3300005539 | Bacteria | 2666 |
| 174 | Ga0068853_100124983 | 3300005539 | Bacteria | 2297 |
| 175 | Ga0068853_100236550 | 3300005539 | Bacteria | 1672 |
| 176 | Ga0068853_100323764 | 3300005539 | Bacteria | 1429 |
| 177 | Ga0070672_100000051 | 3300005543 | Bacteria | 51735 |
| 178 | Ga0070686_100006277 | 3300005544 | Bacteria | 6601 |
| 179 | Ga0070695_100031546 | 3300005545 | Bacteria | 3307 |
| 180 | Ga0070696_100011107 | 3300005546 | Bacteria | 6026 |
| 181 | Ga0070696_100015936 | 3300005546 | Bacteria | 5054 |
| 182 | Ga0070696_100019688 | 3300005546 | Bacteria | 4572 |
| 183 | Ga0070696_100095863 | 3300005546 | Bacteria | 2119 |
| 184 | Ga0070696_100138591 | 3300005546 | Bacteria | 1775 |
| 185 | Ga0070696_100238707 | 3300005546 | Bacteria | 1370 |
| 186 | Ga0070693_100000849 | 3300005547 | Bacteria | 13601 |
| 187 | Ga0070693_100018210 | 3300005547 | Bacteria | 3665 |
| 188 | Ga0070693_100148187 | 3300005547 | Bacteria | 1483 |
| 189 | Ga0070665_100000092 | 3300005548 | Bacteria | 174397 |
| 190 | Ga0070665_100000154 | 3300005548 | Bacteria | 125835 |
| 191 | Ga0070665_100001688 | 3300005548 | Bacteria | 25443 |
| 192 | Ga0070665_100002811 | 3300005548 | Bacteria | 18845 |
| 193 | Ga0070665_100101092 | 3300005548 | Bacteria | 2887 |
| 194 | Ga0070665_100154396 | 3300005548 | Bacteria | 2297 |
| 195 | Ga0068855_100000331 | 3300005563 | Bacteria | 58972 |
| 196 | Ga0068855_100024007 | 3300005563 | Bacteria | 7300 |
| 197 | Ga0068855_100062160 | 3300005563 | Bacteria | 4360 |
| 198 | Ga0068855_100065071 | 3300005563 | Bacteria | 4250 |
| 199 | Ga0068855_100095437 | 3300005563 | Bacteria | 3427 |
| 200 | Ga0068855_100342779 | 3300005563 | Bacteria | 1647 |
| 201 | Ga0070664_100000273 | 3300005564 | Bacteria | 37194 |
| 202 | Ga0070664_100046093 | 3300005564 | Bacteria | 3682 |
| 203 | Ga0070664_100224010 | 3300005564 | Bacteria | 1683 |
| 204 | Ga0070664_100266445 | 3300005564 | Bacteria | 1542 |
| 205 | Ga0068857_100052691 | 3300005577 | Bacteria | 3609 |
| 206 | Ga0068857_100053896 | 3300005577 | Bacteria | 3568 |
| 207 | Ga0068857_100055324 | 3300005577 | Bacteria | 3521 |
| 208 | Ga0068857_100074753 | 3300005577 | Bacteria | 3020 |
| 209 | Ga0068854_100000084 | 3300005578 | Bacteria | 67929 |
| 210 | Ga0068854_100000786 | 3300005578 | Bacteria | 18878 |
| 211 | Ga0068854_100011358 | 3300005578 | Bacteria | 5794 |
| 212 | Ga0068854_100020186 | 3300005578 | Bacteria | 4503 |
| 213 | Ga0068854_100023245 | 3300005578 | Bacteria | 4232 |
| 214 | Ga0068856_100005579 | 3300005614 | Bacteria | 12390 |
| 215 | Ga0068856_100007033 | 3300005614 | Bacteria | 10994 |
| 216 | Ga0068856_100098538 | 3300005614 | Bacteria | 2913 |
| 217 | Ga0068856_100125991 | 3300005614 | Bacteria | 2564 |
| 218 | Ga0068856_100145680 | 3300005614 | Bacteria | 2376 |
| 219 | Ga0068856_100184413 | 3300005614 | Bacteria | 2100 |
| 220 | Ga0068856_100200222 | 3300005614 | Bacteria | 2011 |
| 221 | Ga0068856_100370297 | 3300005614 | Bacteria | 1451 |
| 222 | Ga0068852_100000125 | 3300005616 | Bacteria | 51289 |
| 223 | Ga0068852_100014115 | 3300005616 | Bacteria | 6135 |
| 224 | Ga0068852_100026612 | 3300005616 | Bacteria | 4705 |
| 225 | Ga0068852_100082733 | 3300005616 | Bacteria | 2853 |
| 226 | Ga0068852_100118615 | 3300005616 | Bacteria | 2418 |
| 227 | Ga0068852_100183424 | 3300005616 | Bacteria | 1969 |
| 228 | Ga0068852_100299682 | 3300005616 | Bacteria | 1556 |
| 229 | Ga0068852_100369704 | 3300005616 | Bacteria | 1404 |
| 230 | Ga0068859_100000584 | 3300005617 | Bacteria | 36403 |
| 231 | Ga0068859_100005779 | 3300005617 | Bacteria | 12568 |
| 232 | Ga0068864_100061987 | 3300005618 | Bacteria | 3239 |
| 233 | Ga0068866_10033926 | 3300005718 | Bacteria | 2481 |
| 234 | Ga0068861_100000212 | 3300005719 | Bacteria | 31389 |
| 235 | Ga0068851_10000296 | 3300005834 | Bacteria | 22769 |
| 236 | Ga0068851_10001581 | 3300005834 | Bacteria | 9995 |
| 237 | Ga0068851_10006366 | 3300005834 | Bacteria | 5389 |
| 238 | Ga0068851_10006888 | 3300005834 | Bacteria | 5208 |
| 239 | Ga0068851_10011383 | 3300005834 | Bacteria | 4170 |
| 240 | Ga0068870_10000270 | 3300005840 | Bacteria | 19231 |
| 241 | Ga0068863_100003408 | 3300005841 | Bacteria | 15676 |
| 242 | Ga0068858_100000235 | 3300005842 | Bacteria | 60058 |
| 243 | Ga0068858_100115444 | 3300005842 | Bacteria | 2509 |
| 244 | Ga0068858_100137002 | 3300005842 | Bacteria | 2297 |
| 245 | Ga0068858_100494183 | 3300005842 | Bacteria | 1182 |
| 246 | Ga0068860_100008370 | 3300005843 | Bacteria | 10299 |
| 247 | Ga0068860_100027269 | 3300005843 | Bacteria | 5503 |
| 248 | Ga0068860_100039323 | 3300005843 | Bacteria | 4523 |
| 249 | Ga0068860_100075407 | 3300005843 | Bacteria | 3208 |
| 250 | Ga0068860_100088566 | 3300005843 | Bacteria | 2946 |
| 251 | Ga0068860_100091046 | 3300005843 | Bacteria | 2906 |
| 252 | Ga0068860_100105022 | 3300005843 | Bacteria | 2697 |
| 253 | Ga0068860_100314870 | 3300005843 | Bacteria | 1535 |
| 254 | Ga0068862_100000715 | 3300005844 | Bacteria | 33766 |
| 255 | Ga0068862_100003864 | 3300005844 | Bacteria | 12752 |
| 256 | Ga0081540_1000271 | 3300005983 | Bacteria | 54093 |
| 257 | Ga0081540_1001028 | 3300005983 | Bacteria | 24988 |
| 258 | Ga0081540_1004991 | 3300005983 | Bacteria | 9974 |
| 259 | Ga0081540_1007399 | 3300005983 | Bacteria | 7831 |
| 260 | Ga0081539_10043946 | 3300005985 | Bacteria | 2584 |
| 261 | Ga0070717_10009369 | 3300006028 | Bacteria | 7353 |
| 262 | Ga0075369_10104623 | 3300006186 | Bacteria | 1272 |
| 263 | Ga0075366_10001930 | 3300006195 | Bacteria | 10472 |
| 264 | Ga0097621_100032392 | 3300006237 | Bacteria | 4154 |
| 265 | Ga0097621_100106252 | 3300006237 | Bacteria | 2368 |
| 266 | Ga0097621_100132123 | 3300006237 | Bacteria | 2126 |
| 267 | Ga0097621_100191043 | 3300006237 | Bacteria | 1773 |
| 268 | Ga0075370_10001519 | 3300006353 | Bacteria | 10149 |
| 269 | Ga0068871_100065145 | 3300006358 | Bacteria | 2984 |
| 270 | Ga0068871_100126293 | 3300006358 | Bacteria | 2165 |
| 271 | Ga0075428_100142370 | 3300006844 | Bacteria | 2607 |
| 272 | Ga0068865_100072891 | 3300006881 | Bacteria | 2440 |
| 273 | Ga0068865_100083654 | 3300006881 | Bacteria | 2297 |
| 274 | Ga0097620_100000584 | 3300006931 | Bacteria | 36403 |
| 275 | Ga0097620_100005779 | 3300006931 | Bacteria | 12568 |
| 276 | Ga0099794_10000152 | 3300007265 | Bacteria | 25621 |
| 277 | Ga0105251_10026384 | 3300009011 | Bacteria | 2959 |
| 278 | Ga0105240_10000705 | 3300009093 | Bacteria | 61261 |
| 279 | Ga0105240_10004295 | 3300009093 | Bacteria | 21764 |
| 280 | Ga0105240_10200597 | 3300009093 | Bacteria | 2338 |
| 281 | Ga0111539_10196364 | 3300009094 | Bacteria | 2354 |
| 282 | Ga0105245_10000012 | 3300009098 | Bacteria | 267151 |
| 283 | Ga0105245_10000233 | 3300009098 | Bacteria | 52960 |
| 284 | Ga0105245_10051880 | 3300009098 | Bacteria | 3677 |
| 285 | Ga0105245_10279655 | 3300009098 | Bacteria | 1630 |
| 286 | Ga0105247_10000321 | 3300009101 | Bacteria | 43053 |
| 287 | Ga0105247_10026871 | 3300009101 | Bacteria | 3479 |
| 288 | Ga0105247_10034781 | 3300009101 | Bacteria | 3069 |
| 289 | Ga0105243_10003969 | 3300009148 | Bacteria | 11799 |
| 290 | Ga0105243_10005321 | 3300009148 | Bacteria | 10058 |
| 291 | Ga0105241_10017112 | 3300009174 | Bacteria | 5324 |
| 292 | Ga0105241_10052667 | 3300009174 | Bacteria | 3109 |
| 293 | Ga0105241_10356023 | 3300009174 | Bacteria | 1272 |
| 294 | Ga0105242_10014473 | 3300009176 | Bacteria | 6112 |
| 295 | Ga0105242_10104859 | 3300009176 | Bacteria | 2401 |
| 296 | Ga0105242_10180272 | 3300009176 | Bacteria | 1863 |
| 297 | Ga0105248_10000022 | 3300009177 | Bacteria | 275935 |
| 298 | Ga0105248_10014599 | 3300009177 | Bacteria | 8643 |
| 299 | Ga0105248_10033425 | 3300009177 | Bacteria | 5745 |
| 300 | Ga0105248_10395772 | 3300009177 | Bacteria | 1555 |
| 301 | Ga0105237_10000084 | 3300009545 | Bacteria | 125742 |
| 302 | Ga0105237_10000549 | 3300009545 | Bacteria | 52724 |
| 303 | Ga0105237_10002875 | 3300009545 | Bacteria | 20938 |
| 304 | Ga0105237_10134869 | 3300009545 | Bacteria | 2463 |
| 305 | Ga0105238_10000154 | 3300009551 | Bacteria | 75243 |
| 306 | Ga0105238_10000805 | 3300009551 | Bacteria | 32542 |
| 307 | Ga0105238_10023407 | 3300009551 | Bacteria | 6295 |
| 308 | Ga0105238_10026777 | 3300009551 | Bacteria | 5877 |
| 309 | Ga0105238_10109990 | 3300009551 | Bacteria | 2737 |
| 310 | Ga0105238_10221147 | 3300009551 | Bacteria | 1870 |
| 311 | Ga0105238_10291842 | 3300009551 | Bacteria | 1613 |
| 312 | Ga0105238_10430241 | 3300009551 | Bacteria | 1315 |
| 313 | Ga0105249_10000265 | 3300009553 | Bacteria | 55931 |
| 314 | Ga0105249_10000533 | 3300009553 | Bacteria | 35077 |
| 315 | Ga0105249_10445725 | 3300009553 | Bacteria | 1332 |
| 316 | Ga0105239_10000174 | 3300010375 | Bacteria | 92922 |
| 317 | Ga0105239_10002920 | 3300010375 | Bacteria | 21346 |
| 318 | Ga0105239_10010596 | 3300010375 | Bacteria | 10308 |
| 319 | Ga0105239_10018941 | 3300010375 | Bacteria | 7607 |
| 320 | Ga0105239_10030730 | 3300010375 | Bacteria | 5908 |
| 321 | Ga0105239_10040597 | 3300010375 | Bacteria | 5098 |
| 322 | Ga0105239_10043604 | 3300010375 | Bacteria | 4918 |
| 323 | Ga0105239_10059993 | 3300010375 | Bacteria | 4174 |
| 324 | Ga0105239_10330830 | 3300010375 | Bacteria | 1719 |
| 325 | Ga0105246_10001791 | 3300011119 | Bacteria | 12843 |
| 326 | Ga0157373_10003504 | 3300013100 | Bacteria | 11871 |
| 327 | Ga0157373_10069220 | 3300013100 | Bacteria | 2495 |
| 328 | Ga0157371_10000351 | 3300013102 | Bacteria | 59170 |
| 329 | Ga0157371_10017314 | 3300013102 | Bacteria | 5358 |
| 330 | Ga0157371_10249288 | 3300013102 | Bacteria | 1278 |
| 331 | Ga0157370_10011552 | 3300013104 | Bacteria | 9219 |
| 332 | Ga0157370_10267377 | 3300013104 | Bacteria | 1580 |
| 333 | Ga0157369_10000001 | 3300013105 | Bacteria | 554908 |
| 334 | Ga0157369_10000829 | 3300013105 | Bacteria | 39534 |
| 335 | Ga0157369_10001552 | 3300013105 | Bacteria | 28103 |
| 336 | Ga0157369_10003652 | 3300013105 | Bacteria | 18258 |
| 337 | Ga0157369_10004125 | 3300013105 | Bacteria | 17212 |
| 338 | Ga0157369_10024303 | 3300013105 | Bacteria | 6744 |
| 339 | Ga0157369_10143836 | 3300013105 | Bacteria | 2522 |
| 340 | Ga0157369_10169829 | 3300013105 | Bacteria | 2298 |
| 341 | Ga0157369_10282190 | 3300013105 | Bacteria | 1730 |
| 342 | Ga0157374_10001656 | 3300013296 | Bacteria | 18645 |
| 343 | Ga0157374_10010042 | 3300013296 | Bacteria | 8128 |
| 344 | Ga0157374_10077334 | 3300013296 | Bacteria | 3149 |
| 345 | Ga0157374_10143264 | 3300013296 | Bacteria | 2320 |
| 346 | Ga0157378_10001829 | 3300013297 | Bacteria | 19101 |
| 347 | Ga0157378_10004285 | 3300013297 | Bacteria | 12561 |
| 348 | Ga0157378_10191648 | 3300013297 | Bacteria | 1928 |
| 349 | Ga0163162_10000017 | 3300013306 | Bacteria | 233474 |
| 350 | Ga0163162_10000647 | 3300013306 | Bacteria | 32241 |
| 351 | Ga0163162_10002285 | 3300013306 | Bacteria | 18000 |
| 352 | Ga0163162_10121814 | 3300013306 | Bacteria | 2713 |
| 353 | Ga0163162_10188995 | 3300013306 | Bacteria | 2187 |
| 354 | Ga0157372_10000403 | 3300013307 | Bacteria | 47787 |
| 355 | Ga0157372_10008020 | 3300013307 | Bacteria | 11231 |
| 356 | Ga0157372_10012371 | 3300013307 | Bacteria | 9094 |
| 357 | Ga0157372_10019600 | 3300013307 | Bacteria | 7289 |
| 358 | Ga0157372_10022364 | 3300013307 | Bacteria | 6840 |
| 359 | Ga0157372_10121202 | 3300013307 | Bacteria | 3004 |
| 360 | Ga0157372_10121718 | 3300013307 | Bacteria | 2998 |
| 361 | Ga0157372_10212098 | 3300013307 | Bacteria | 2244 |
| 362 | Ga0157372_10457316 | 3300013307 | Bacteria | 1488 |
| 363 | Ga0163163_10000024 | 3300014325 | Bacteria | 185100 |
| 364 | Ga0163163_10003591 | 3300014325 | Bacteria | 13184 |
| 365 | Ga0163163_10276924 | 3300014325 | Bacteria | 1729 |
| 366 | Ga0182008_10197902 | 3300014497 | Bacteria | 1022 |
| 367 | Ga0157379_10001292 | 3300014968 | Bacteria | 20382 |
| 368 | Ga0157379_10001814 | 3300014968 | Bacteria | 17638 |
| 369 | Ga0157376_10023151 | 3300014969 | Bacteria | 4857 |
| 370 | Ga0157376_10023163 | 3300014969 | Bacteria | 4856 |
| 371 | Ga0157376_10084869 | 3300014969 | Bacteria | 2727 |
| 372 | Ga0157376_10169901 | 3300014969 | Bacteria | 1984 |
| 373 | Ga0182006_1000061 | 3300015261 | Bacteria | 156823 |
| 374 | Ga0182006_1071795 | 3300015261 | Bacteria | 1282 |
| 375 | Ga0182007_10006307 | 3300015262 | Bacteria | 5101 |
| 376 | Ga0183369_1013 | 3300015685 | Bacteria | 222738 |
| 377 | Ga0183368_1003 | 3300015687 | Bacteria | 1276390 |
| 378 | Ga0163161_10025691 | 3300017792 | Bacteria | 4170 |
| 379 | Ga0163161_10068249 | 3300017792 | Bacteria | 2598 |
| 380 | Ga0206356_10807946 | 3300020070 | Bacteria | 4306 |
| 381 | Ga0206356_11496191 | 3300020070 | Bacteria | 2178 |
| 382 | Ga0206354_10278400 | 3300020081 | Bacteria | 2206 |
| 383 | Ga0206353_10351104 | 3300020082 | Bacteria | 4988 |
| 384 | Ga0224712_10023723 | 3300022467 | Bacteria | 2133 |
| 385 | Ga0209784_100011 | 3300025224 | Bacteria | 546770 |
| 386 | Ga0209566_101090 | 3300025225 | Bacteria | 10564 |
| 387 | Ga0209566_105364 | 3300025225 | Bacteria | 1622 |
| 388 | Ga0209674_100012 | 3300025226 | Bacteria | 950162 |
| 389 | Ga0209674_100427 | 3300025226 | Bacteria | 20350 |
| 390 | Ga0209674_100453 | 3300025226 | Bacteria | 18742 |
| 391 | Ga0209674_101324 | 3300025226 | Bacteria | 6830 |
| 392 | Ga0209672_100005 | 3300025228 | Bacteria | 1069303 |
| 393 | Ga0209672_100055 | 3300025228 | Bacteria | 221655 |
| 394 | Ga0209672_100124 | 3300025228 | Bacteria | 80646 |
| 395 | Ga0209672_100706 | 3300025228 | Bacteria | 16637 |
| 396 | Ga0209672_101177 | 3300025228 | Bacteria | 10674 |
| 397 | Ga0209147_103557 | 3300025229 | Bacteria | 2964 |
| 398 | Ga0209563_100045 | 3300025230 | Bacteria | 377102 |
| 399 | Ga0207427_100026 | 3300025231 | Bacteria | 412764 |
| 400 | Ga0207427_100053 | 3300025231 | Bacteria | 217191 |
| 401 | Ga0207427_100134 | 3300025231 | Bacteria | 91077 |
| 402 | Ga0207427_100150 | 3300025231 | Bacteria | 78685 |
| 403 | Ga0209437_100005 | 3300025233 | Bacteria | 1071596 |
| 404 | Ga0209437_100108 | 3300025233 | Bacteria | 217191 |
| 405 | Ga0209437_100200 | 3300025233 | Bacteria | 119306 |
| 406 | Ga0209437_100403 | 3300025233 | Bacteria | 40042 |
| 407 | Ga0209437_100470 | 3300025233 | Bacteria | 30896 |
| 408 | Ga0209437_102459 | 3300025233 | Bacteria | 3585 |
| 409 | Ga0209258_100006 | 3300025242 | Bacteria | 1069303 |
| 410 | Ga0209258_100012 | 3300025242 | Bacteria | 825544 |
| 411 | Ga0209258_100027 | 3300025242 | Bacteria | 518449 |
| 412 | Ga0209258_100055 | 3300025242 | Bacteria | 337291 |
| 413 | Ga0209258_100255 | 3300025242 | Bacteria | 94924 |
| 414 | Ga0207425_1000084 | 3300025245 | Bacteria | 95660 |
| 415 | Ga0209646_1000825 | 3300025246 | Bacteria | 10423 |
| 416 | Ga0209026_1000017 | 3300025250 | Bacteria | 385214 |
| 417 | Ga0209026_1000084 | 3300025250 | Bacteria | 186997 |
| 418 | Ga0209026_1000460 | 3300025250 | Bacteria | 31536 |
| 419 | Ga0209026_1000548 | 3300025250 | Bacteria | 25899 |
| 420 | Ga0209026_1001381 | 3300025250 | Bacteria | 10834 |
| 421 | Ga0209677_103582 | 3300025253 | Bacteria | 4935 |
| 422 | Ga0209148_1000001 | 3300025254 | Bacteria | 2545271 |
| 423 | Ga0209148_1000002 | 3300025254 | Bacteria | 2399500 |
| 424 | Ga0209148_1000012 | 3300025254 | Bacteria | 1069303 |
| 425 | Ga0209148_1000014 | 3300025254 | Bacteria | 925277 |
| 426 | Ga0209148_1000058 | 3300025254 | Bacteria | 357482 |
| 427 | Ga0209148_1000221 | 3300025254 | Bacteria | 94627 |
| 428 | Ga0209148_1002891 | 3300025254 | Bacteria | 5260 |
| 429 | Ga0209759_1000674 | 3300025256 | Bacteria | 31257 |
| 430 | Ga0209759_1000679 | 3300025256 | Bacteria | 30848 |
| 431 | Ga0209759_1001340 | 3300025256 | Bacteria | 14397 |
| 432 | Ga0209759_1012002 | 3300025256 | Bacteria | 2425 |
| 433 | Ga0209129_1000057 | 3300025258 | Bacteria | 253632 |
| 434 | Ga0209129_1000678 | 3300025258 | Bacteria | 22489 |
| 435 | Ga0209129_1004398 | 3300025258 | Bacteria | 5518 |
| 436 | Ga0209233_1000002 | 3300025261 | Bacteria | 2501366 |
| 437 | Ga0209233_1000011 | 3300025261 | Bacteria | 1071611 |
| 438 | Ga0209233_1000125 | 3300025261 | Bacteria | 217190 |
| 439 | Ga0209233_1000193 | 3300025261 | Bacteria | 126812 |
| 440 | Ga0209233_1000957 | 3300025261 | Bacteria | 12490 |
| 441 | Ga0209233_1018598 | 3300025261 | Bacteria | 1866 |
| 442 | Ga0209565_1000023 | 3300025263 | Bacteria | 388244 |
| 443 | Ga0209455_1000008 | 3300025272 | Bacteria | 1069303 |
| 444 | Ga0209455_1000014 | 3300025272 | Bacteria | 806601 |
| 445 | Ga0209455_1000018 | 3300025272 | Bacteria | 718034 |
| 446 | Ga0209455_1000019 | 3300025272 | Bacteria | 705658 |
| 447 | Ga0209455_1000266 | 3300025272 | Bacteria | 59221 |
| 448 | Ga0209673_1000116 | 3300025273 | Bacteria | 175933 |
| 449 | Ga0209130_1006082 | 3300025284 | Bacteria | 4000 |
| 450 | Ga0209675_1000016 | 3300025291 | Bacteria | 391965 |
| 451 | Ga0209676_1000027 | 3300025292 | Bacteria | 560222 |
| 452 | Ga0209676_1000037 | 3300025292 | Bacteria | 457562 |
| 453 | Ga0209676_1000770 | 3300025292 | Bacteria | 42881 |
| 454 | Ga0209676_1001488 | 3300025292 | Bacteria | 21557 |
| 455 | Ga0209025_1000013 | 3300025294 | Bacteria | 871757 |
| 456 | Ga0209564_1000347 | 3300025295 | Bacteria | 87112 |
| 457 | Ga0209758_1000014 | 3300025297 | Bacteria | 871757 |
| 458 | Ga0209758_1011282 | 3300025297 | Bacteria | 5199 |
| 459 | Ga0209050_1001666 | 3300025298 | Bacteria | 22438 |
| 460 | Ga0209051_1002629 | 3300025303 | Bacteria | 12613 |
| 461 | Ga0209051_1022652 | 3300025303 | Bacteria | 2639 |
| 462 | Ga0209257_1000067 | 3300025304 | Bacteria | 342468 |
| 463 | Ga0209257_1000868 | 3300025304 | Bacteria | 42949 |
| 464 | Ga0209257_1021765 | 3300025304 | Bacteria | 2314 |
| 465 | Ga0207656_10000273 | 3300025321 | Bacteria | 17896 |
| 466 | Ga0207656_10000936 | 3300025321 | Bacteria | 9521 |
| 467 | Ga0207656_10003921 | 3300025321 | Bacteria | 5149 |
| 468 | Ga0207656_10014641 | 3300025321 | Bacteria | 3026 |
| 469 | Ga0207656_10164515 | 3300025321 | Bacteria | 1057 |
| 470 | Ga0207713_1021190 | 3300025735 | Bacteria | 3122 |
| 471 | Ga0207653_10052734 | 3300025885 | Bacteria | 1357 |
| 472 | Ga0207642_10000233 | 3300025899 | Bacteria | 16508 |
| 473 | Ga0207710_10000918 | 3300025900 | Bacteria | 15745 |
| 474 | Ga0207710_10013427 | 3300025900 | Bacteria | 3446 |
| 475 | Ga0207710_10074039 | 3300025900 | Bacteria | 1567 |
| 476 | Ga0207688_10000282 | 3300025901 | Bacteria | 23216 |
| 477 | Ga0207680_10000001 | 3300025903 | Bacteria | 1091453 |
| 478 | Ga0207680_10045353 | 3300025903 | Bacteria | 2591 |
| 479 | Ga0207647_10000016 | 3300025904 | Bacteria | 130866 |
| 480 | Ga0207647_10000019 | 3300025904 | Bacteria | 123924 |
| 481 | Ga0207647_10001000 | 3300025904 | Bacteria | 21924 |
| 482 | Ga0207647_10003471 | 3300025904 | Bacteria | 11824 |
| 483 | Ga0207647_10040824 | 3300025904 | Bacteria | 2920 |
| 484 | Ga0207645_10000043 | 3300025907 | Bacteria | 85557 |
| 485 | Ga0207645_10059751 | 3300025907 | Bacteria | 2435 |
| 486 | Ga0207643_10000024 | 3300025908 | Bacteria | 103214 |
| 487 | Ga0207643_10070829 | 3300025908 | Bacteria | 2006 |
| 488 | Ga0207705_10002892 | 3300025909 | Bacteria | 13142 |
| 489 | Ga0207705_10004208 | 3300025909 | Bacteria | 10914 |
| 490 | Ga0207705_10007515 | 3300025909 | Bacteria | 8007 |
| 491 | Ga0207705_10007619 | 3300025909 | Bacteria | 7960 |
| 492 | Ga0207705_10030729 | 3300025909 | Bacteria | 3833 |
| 493 | Ga0207705_10040151 | 3300025909 | Bacteria | 3355 |
| 494 | Ga0207705_10065373 | 3300025909 | Bacteria | 2629 |
| 495 | Ga0207705_10069872 | 3300025909 | Bacteria | 2544 |
| 496 | Ga0207654_10000247 | 3300025911 | Bacteria | 32775 |
| 497 | Ga0207654_10111079 | 3300025911 | Bacteria | 1706 |
| 498 | Ga0207654_10176322 | 3300025911 | Bacteria | 1392 |
| 499 | Ga0207654_10278853 | 3300025911 | Bacteria | 1130 |
| 500 | Ga0207707_10000064 | 3300025912 | Bacteria | 107490 |
| 501 | Ga0207707_10000544 | 3300025912 | Bacteria | 38374 |
| 502 | Ga0207707_10000750 | 3300025912 | Bacteria | 31974 |
| 503 | Ga0207707_10000846 | 3300025912 | Bacteria | 29949 |
| 504 | Ga0207707_10014211 | 3300025912 | Bacteria | 6935 |
| 505 | Ga0207707_10047546 | 3300025912 | Bacteria | 3736 |
| 506 | Ga0207707_10056246 | 3300025912 | Bacteria | 3423 |
| 507 | Ga0207707_10096162 | 3300025912 | Bacteria | 2588 |
| 508 | Ga0207695_10000014 | 3300025913 | Bacteria | 812599 |
| 509 | Ga0207695_10000683 | 3300025913 | Bacteria | 66533 |
| 510 | Ga0207695_10006285 | 3300025913 | Bacteria | 15455 |
| 511 | Ga0207695_10011844 | 3300025913 | Bacteria | 10520 |
| 512 | Ga0207695_10014502 | 3300025913 | Bacteria | 9329 |
| 513 | Ga0207695_10024286 | 3300025913 | Bacteria | 6824 |
| 514 | Ga0207695_10025619 | 3300025913 | Bacteria | 6598 |
| 515 | Ga0207695_10065505 | 3300025913 | Bacteria | 3736 |
| 516 | Ga0207695_10072195 | 3300025913 | Bacteria | 3523 |
| 517 | Ga0207695_10166559 | 3300025913 | Bacteria | 2132 |
| 518 | Ga0207671_10000011 | 3300025914 | Bacteria | 530349 |
| 519 | Ga0207671_10000507 | 3300025914 | Bacteria | 52802 |
| 520 | Ga0207671_10000764 | 3300025914 | Bacteria | 40877 |
| 521 | Ga0207671_10008592 | 3300025914 | Bacteria | 8635 |
| 522 | Ga0207671_10020874 | 3300025914 | Bacteria | 4981 |
| 523 | Ga0207671_10023665 | 3300025914 | Bacteria | 4629 |
| 524 | Ga0207671_10083783 | 3300025914 | Bacteria | 2394 |
| 525 | Ga0207671_10100320 | 3300025914 | Bacteria | 2192 |
| 526 | Ga0207671_10253118 | 3300025914 | Bacteria | 1385 |
| 527 | Ga0207660_10001310 | 3300025917 | Bacteria | 16622 |
| 528 | Ga0207660_10011867 | 3300025917 | Bacteria | 5682 |
| 529 | Ga0207660_10020370 | 3300025917 | Bacteria | 4449 |
| 530 | Ga0207660_10031341 | 3300025917 | Bacteria | 3660 |
| 531 | Ga0207660_10279193 | 3300025917 | Bacteria | 1325 |
| 532 | Ga0207662_10000789 | 3300025918 | Bacteria | 14571 |
| 533 | Ga0207657_10000655 | 3300025919 | Bacteria | 36836 |
| 534 | Ga0207657_10001536 | 3300025919 | Bacteria | 24732 |
| 535 | Ga0207657_10012284 | 3300025919 | Bacteria | 8460 |
| 536 | Ga0207657_10070181 | 3300025919 | Bacteria | 2970 |
| 537 | Ga0207657_10128646 | 3300025919 | Bacteria | 2078 |
| 538 | Ga0207649_10000764 | 3300025920 | Bacteria | 20929 |
| 539 | Ga0207649_10002004 | 3300025920 | Bacteria | 11584 |
| 540 | Ga0207649_10005382 | 3300025920 | Bacteria | 6930 |
| 541 | Ga0207649_10007176 | 3300025920 | Bacteria | 6056 |
| 542 | Ga0207649_10016143 | 3300025920 | Bacteria | 4206 |
| 543 | Ga0207649_10031029 | 3300025920 | Bacteria | 3172 |
| 544 | Ga0207649_10136861 | 3300025920 | Bacteria | 1671 |
| 545 | Ga0207649_10160508 | 3300025920 | Bacteria | 1557 |
| 546 | Ga0207652_10000019 | 3300025921 | Bacteria | 164416 |
| 547 | Ga0207652_10010900 | 3300025921 | Bacteria | 7326 |
| 548 | Ga0207652_10012677 | 3300025921 | Bacteria | 6816 |
| 549 | Ga0207652_10032171 | 3300025921 | Bacteria | 4407 |
| 550 | Ga0207652_10067861 | 3300025921 | Bacteria | 3093 |
| 551 | Ga0207694_10000932 | 3300025924 | Bacteria | 25926 |
| 552 | Ga0207694_10002038 | 3300025924 | Bacteria | 16731 |
| 553 | Ga0207694_10018861 | 3300025924 | Bacteria | 5214 |
| 554 | Ga0207694_10022142 | 3300025924 | Bacteria | 4818 |
| 555 | Ga0207694_10034796 | 3300025924 | Bacteria | 3863 |
| 556 | Ga0207694_10165468 | 3300025924 | Bacteria | 1788 |
| 557 | Ga0207694_10366128 | 3300025924 | Bacteria | 1195 |
| 558 | Ga0207650_10000253 | 3300025925 | Bacteria | 58029 |
| 559 | Ga0207650_10004303 | 3300025925 | Bacteria | 9718 |
| 560 | Ga0207650_10033150 | 3300025925 | Bacteria | 3739 |
| 561 | Ga0207659_10000881 | 3300025926 | Bacteria | 17822 |
| 562 | Ga0207687_10000011 | 3300025927 | Bacteria | 388349 |
| 563 | Ga0207687_10011977 | 3300025927 | Bacteria | 5672 |
| 564 | Ga0207700_10000009 | 3300025928 | Bacteria | 314953 |
| 565 | Ga0207700_10035503 | 3300025928 | Bacteria | 3592 |
| 566 | Ga0207664_10000170 | 3300025929 | Bacteria | 51533 |
| 567 | Ga0207664_10001851 | 3300025929 | Bacteria | 13957 |
| 568 | Ga0207644_10001751 | 3300025931 | Bacteria | 14053 |
| 569 | Ga0207644_10021077 | 3300025931 | Bacteria | 4437 |
| 570 | Ga0207690_10000004 | 3300025932 | Bacteria | 746138 |
| 571 | Ga0207690_10000982 | 3300025932 | Bacteria | 18292 |
| 572 | Ga0207690_10003034 | 3300025932 | Bacteria | 10107 |
| 573 | Ga0207690_10013105 | 3300025932 | Bacteria | 4974 |
| 574 | Ga0207690_10030339 | 3300025932 | Bacteria | 3447 |
| 575 | Ga0207690_10056854 | 3300025932 | Bacteria | 2641 |
| 576 | Ga0207690_10098108 | 3300025932 | Bacteria | 2086 |
| 577 | Ga0207690_10142025 | 3300025932 | Bacteria | 1770 |
| 578 | Ga0207706_10003011 | 3300025933 | Bacteria | 16245 |
| 579 | Ga0207706_10006207 | 3300025933 | Bacteria | 11102 |
| 580 | Ga0207706_10044351 | 3300025933 | Bacteria | 3941 |
| 581 | Ga0207706_10069767 | 3300025933 | Bacteria | 3091 |
| 582 | Ga0207706_10301089 | 3300025933 | Bacteria | 1397 |
| 583 | Ga0207686_10006134 | 3300025934 | Bacteria | 6457 |
| 584 | Ga0207709_10001141 | 3300025935 | Bacteria | 19372 |
| 585 | Ga0207709_10131964 | 3300025935 | Bacteria | 1704 |
| 586 | Ga0207670_10000579 | 3300025936 | Bacteria | 20167 |
| 587 | Ga0207670_10001748 | 3300025936 | Bacteria | 11358 |
| 588 | Ga0207670_10271637 | 3300025936 | Bacteria | 1318 |
| 589 | Ga0207704_10002349 | 3300025938 | Bacteria | 8497 |
| 590 | Ga0207704_10072350 | 3300025938 | Bacteria | 2191 |
| 591 | Ga0207704_10088731 | 3300025938 | Bacteria | 2024 |
| 592 | Ga0207691_10000053 | 3300025940 | Bacteria | 91814 |
| 593 | Ga0207691_10019400 | 3300025940 | Bacteria | 6435 |
| 594 | Ga0207691_10285074 | 3300025940 | Bacteria | 1421 |
| 595 | Ga0207711_10000019 | 3300025941 | Bacteria | 412779 |
| 596 | Ga0207711_10000276 | 3300025941 | Bacteria | 55530 |
| 597 | Ga0207711_10008039 | 3300025941 | Bacteria | 8828 |
| 598 | Ga0207711_10332390 | 3300025941 | Bacteria | 1405 |
| 599 | Ga0207689_10000026 | 3300025942 | Bacteria | 103610 |
| 600 | Ga0207689_10150160 | 3300025942 | Bacteria | 1921 |
| 601 | Ga0207661_10004864 | 3300025944 | Bacteria | 9413 |
| 602 | Ga0207661_10027762 | 3300025944 | Bacteria | 4327 |
| 603 | Ga0207661_10073018 | 3300025944 | Bacteria | 2808 |
| 604 | Ga0207661_10079286 | 3300025944 | Bacteria | 2706 |
| 605 | Ga0207679_10003088 | 3300025945 | Bacteria | 10309 |
| 606 | Ga0207679_10012138 | 3300025945 | Bacteria | 5608 |
| 607 | Ga0207667_10002465 | 3300025949 | Bacteria | 23112 |
| 608 | Ga0207667_10007992 | 3300025949 | Bacteria | 12620 |
| 609 | Ga0207667_10010895 | 3300025949 | Bacteria | 10600 |
| 610 | Ga0207667_10018807 | 3300025949 | Bacteria | 7736 |
| 611 | Ga0207667_10019090 | 3300025949 | Bacteria | 7665 |
| 612 | Ga0207667_10105973 | 3300025949 | Bacteria | 2900 |
| 613 | Ga0207667_10138174 | 3300025949 | Bacteria | 2509 |
| 614 | Ga0207667_10177590 | 3300025949 | Bacteria | 2187 |
| 615 | Ga0207651_10006649 | 3300025960 | Bacteria | 6081 |
| 616 | Ga0207712_10000450 | 3300025961 | Bacteria | 34970 |
| 617 | Ga0207712_10000601 | 3300025961 | Bacteria | 28655 |
| 618 | Ga0207712_10001588 | 3300025961 | Bacteria | 15305 |
| 619 | Ga0207668_10007821 | 3300025972 | Bacteria | 6360 |
| 620 | Ga0207668_10045026 | 3300025972 | Bacteria | 3006 |
| 621 | Ga0207668_10098713 | 3300025972 | Bacteria | 2164 |
| 622 | Ga0207668_10177597 | 3300025972 | Bacteria | 1676 |
| 623 | Ga0207640_10000059 | 3300025981 | Bacteria | 90901 |
| 624 | Ga0207640_10000091 | 3300025981 | Bacteria | 71621 |
| 625 | Ga0207640_10006608 | 3300025981 | Bacteria | 6370 |
| 626 | Ga0207640_10010209 | 3300025981 | Bacteria | 5281 |
| 627 | Ga0207640_10012249 | 3300025981 | Bacteria | 4880 |
| 628 | Ga0207640_10030683 | 3300025981 | Bacteria | 3313 |
| 629 | Ga0207658_10000112 | 3300025986 | Bacteria | 89146 |
| 630 | Ga0207658_10000422 | 3300025986 | Bacteria | 40133 |
| 631 | Ga0207658_10018176 | 3300025986 | Bacteria | 4850 |
| 632 | Ga0207658_10140485 | 3300025986 | Bacteria | 1953 |
| 633 | Ga0207677_10000080 | 3300026023 | Bacteria | 79544 |
| 634 | Ga0207677_10000185 | 3300026023 | Bacteria | 50144 |
| 635 | Ga0207677_10131583 | 3300026023 | Bacteria | 1901 |
| 636 | Ga0207703_10000059 | 3300026035 | Bacteria | 134931 |
| 637 | Ga0207703_10000250 | 3300026035 | Bacteria | 60636 |
| 638 | Ga0207639_10000117 | 3300026041 | Bacteria | 61185 |
| 639 | Ga0207639_10000304 | 3300026041 | Bacteria | 34871 |
| 640 | Ga0207639_10000724 | 3300026041 | Bacteria | 22521 |
| 641 | Ga0207639_10001033 | 3300026041 | Bacteria | 18907 |
| 642 | Ga0207639_10001563 | 3300026041 | Bacteria | 15358 |
| 643 | Ga0207639_10006027 | 3300026041 | Bacteria | 8222 |
| 644 | Ga0207639_10021958 | 3300026041 | Bacteria | 4591 |
| 645 | Ga0207639_10022666 | 3300026041 | Bacteria | 4525 |
| 646 | Ga0207639_10047073 | 3300026041 | Bacteria | 3257 |
| 647 | Ga0207639_10080391 | 3300026041 | Bacteria | 2578 |
| 648 | Ga0207639_10152663 | 3300026041 | Bacteria | 1936 |
| 649 | Ga0207639_10249849 | 3300026041 | Bacteria | 1546 |
| 650 | Ga0207639_10255824 | 3300026041 | Bacteria | 1529 |
| 651 | Ga0207678_10001367 | 3300026067 | Bacteria | 22498 |
| 652 | Ga0207678_10004332 | 3300026067 | Bacteria | 12738 |
| 653 | Ga0207678_10012031 | 3300026067 | Bacteria | 7599 |
| 654 | Ga0207678_10019574 | 3300026067 | Bacteria | 5949 |
| 655 | Ga0207678_10068756 | 3300026067 | Bacteria | 3038 |
| 656 | Ga0207678_10084593 | 3300026067 | Bacteria | 2712 |
| 657 | Ga0207678_10123341 | 3300026067 | Bacteria | 2211 |
| 658 | Ga0207708_10027377 | 3300026075 | Bacteria | 4315 |
| 659 | Ga0207702_10000146 | 3300026078 | Bacteria | 82931 |
| 660 | Ga0207702_10002805 | 3300026078 | Bacteria | 16312 |
| 661 | Ga0207702_10009776 | 3300026078 | Bacteria | 8050 |
| 662 | Ga0207702_10096169 | 3300026078 | Bacteria | 2604 |
| 663 | Ga0207702_10147131 | 3300026078 | Bacteria | 2139 |
| 664 | Ga0207702_10210069 | 3300026078 | Bacteria | 1809 |
| 665 | Ga0207641_10000473 | 3300026088 | Bacteria | 45531 |
| 666 | Ga0207641_10354270 | 3300026088 | Bacteria | 1399 |
| 667 | Ga0207648_10000105 | 3300026089 | Bacteria | 81343 |
| 668 | Ga0207676_10000168 | 3300026095 | Bacteria | 57468 |
| 669 | Ga0207676_10021807 | 3300026095 | Bacteria | 4704 |
| 670 | Ga0207676_10711659 | 3300026095 | Bacteria | 974 |
| 671 | Ga0207674_10005910 | 3300026116 | Bacteria | 14481 |
| 672 | Ga0207674_10008599 | 3300026116 | Bacteria | 11768 |
| 673 | Ga0207674_10019736 | 3300026116 | Bacteria | 7295 |
| 674 | Ga0207674_10031405 | 3300026116 | Bacteria | 5581 |
| 675 | Ga0207674_10068238 | 3300026116 | Bacteria | 3579 |
| 676 | Ga0207674_10080365 | 3300026116 | Bacteria | 3264 |
| 677 | Ga0207674_10274224 | 3300026116 | Bacteria | 1634 |
| 678 | Ga0207675_100000233 | 3300026118 | Bacteria | 52659 |
| 679 | Ga0207683_10000167 | 3300026121 | Bacteria | 56257 |
| 680 | Ga0207683_10201255 | 3300026121 | Bacteria | 1810 |
| 681 | Ga0207698_10001598 | 3300026142 | Bacteria | 13185 |
| 682 | Ga0207698_10008057 | 3300026142 | Bacteria | 6644 |
| 683 | Ga0207698_10009637 | 3300026142 | Bacteria | 6167 |
| 684 | Ga0207698_10014742 | 3300026142 | Bacteria | 5208 |
| 685 | Ga0207698_10016187 | 3300026142 | Bacteria | 5019 |
| 686 | Ga0207698_10024256 | 3300026142 | Bacteria | 4254 |
| 687 | Ga0207698_10053204 | 3300026142 | Bacteria | 3106 |
| 688 | Ga0207698_10453690 | 3300026142 | Bacteria | 1238 |
| 689 | Ga0207698_10573335 | 3300026142 | Bacteria | 1109 |
| 690 | Ga0209371_1000007 | 3300027312 | Bacteria | 1050654 |
| 691 | Ga0209371_1000088 | 3300027312 | Bacteria | 174446 |
| 692 | Ga0209969_1021540 | 3300027360 | Bacteria | 962 |
| 693 | Ga0209967_1008434 | 3300027364 | Bacteria | 1419 |
| 694 | Ga0209999_1034164 | 3300027543 | Bacteria | 946 |
| 695 | Ga0209588_1000048 | 3300027671 | Bacteria | 46399 |
| 696 | Ga0209971_1002342 | 3300027682 | Bacteria | 4575 |
| 697 | Ga0209974_10010484 | 3300027876 | Bacteria | 3126 |
| 698 | Ga0209974_10053523 | 3300027876 | Bacteria | 1359 |
| 699 | Ga0268266_10000001 | 3300028379 | Bacteria | 4040580 |
| 700 | Ga0268266_10000007 | 3300028379 | Bacteria | 1372921 |
| 701 | Ga0268266_10000075 | 3300028379 | Bacteria | 218045 |
| 702 | Ga0268266_10000093 | 3300028379 | Bacteria | 191879 |
| 703 | Ga0268266_10000493 | 3300028379 | Bacteria | 56412 |
| 704 | Ga0268266_10000584 | 3300028379 | Bacteria | 50438 |
| 705 | Ga0268266_10037056 | 3300028379 | Bacteria | 4155 |
| 706 | Ga0268266_10061207 | 3300028379 | Bacteria | 3246 |
| 707 | Ga0268266_10063996 | 3300028379 | Bacteria | 3176 |
| 708 | Ga0268266_10079570 | 3300028379 | Bacteria | 2854 |
| 709 | Ga0268265_10006004 | 3300028380 | Bacteria | 8261 |
| 710 | Ga0268264_10000464 | 3300028381 | Bacteria | 55056 |
| 711 | Ga0268264_10007883 | 3300028381 | Bacteria | 8862 |
| 712 | Ga0268264_10016287 | 3300028381 | Bacteria | 6087 |
| 713 | Ga0268264_10036734 | 3300028381 | Bacteria | 4036 |
| 714 | Ga0268264_10067806 | 3300028381 | Bacteria | 3013 |
| 715 | Ga0268264_10072286 | 3300028381 | Bacteria | 2925 |
| 716 | Ga0268264_10281128 | 3300028381 | Bacteria | 1559 |
| 717 | Ga0268256_1000008 | 3300030500 | Bacteria | 1050654 |
| 718 | Ga0268256_1000079 | 3300030500 | Bacteria | 174445 |
| 719 | Ga0316182_1373831 | 3300030745 | Bacteria | 1336 |
| 720 | Ga0265332_10043912 | 3300031238 | Bacteria | 1929 |
| 721 | Ga0265327_10001583 | 3300031251 | Bacteria | 27733 |
| 722 | Ga0307516_10081484 | 3300031730 | Bacteria | 3079 |
| 723 | Ga0307516_10102430 | 3300031730 | Bacteria | 2677 |
| 724 | Ga0316577_10069180 | 3300031733 | Bacteria | 1972 |
| 725 | Ga0307413_10068707 | 3300031824 | Bacteria | 2220 |
| 726 | Ga0307406_10233448 | 3300031901 | Bacteria | 1375 |
| 727 | Ga0307412_10000964 | 3300031911 | Bacteria | 16440 |
| 728 | Ga0307416_100231026 | 3300032002 | Bacteria | 1783 |
| 729 | Ga0307414_10010846 | 3300032004 | Bacteria | 5314 |
| 730 | Ga0307414_10243913 | 3300032004 | Bacteria | 1489 |
| 731 | Ga0307510_10000590 | 3300033180 | Bacteria | 36615 |
| 732 | Ga0307510_10081025 | 3300033180 | Bacteria | 3151 |
| 733 | Ga0316588_1014000 | 3300033528 | Bacteria | 1750 |
| 734 | Ga0373930_0021398 | 3300034816 | Bacteria | 1270 |
| 735 | Ga0316582_0108121 | 3300036647 | Bacteria | 1849 |
| 736 | Ga0395899_0000076 | 3300037312 | Bacteria | 177673 |
| 737 | Ga0395899_0005634 | 3300037312 | Bacteria | 9720 |
| 738 | Ga0395899_0016051 | 3300037312 | Bacteria | 5709 |
| 739 | Ga0395899_0029824 | 3300037312 | Bacteria | 4103 |
| 740 | Ga0395899_0045910 | 3300037312 | Bacteria | 3255 |
| 741 | Ga0395900_0000024 | 3300037418 | Bacteria | 323480 |
| 742 | Ga0395900_0004448 | 3300037418 | Bacteria | 14847 |
| 743 | Ga0395900_0014472 | 3300037418 | Bacteria | 8051 |
| 744 | Ga0395900_0015314 | 3300037418 | Bacteria | 7817 |
| 745 | Ga0395900_0020273 | 3300037418 | Bacteria | 6785 |
| 746 | Ga0395900_0724568 | 3300037418 | Bacteria | 926 |
| 747 | Ga0395898_0000044 | 3300037466 | Bacteria | 298164 |
| 748 | Ga0395898_0000311 | 3300037466 | Bacteria | 112412 |
| 749 | Ga0395898_0003642 | 3300037466 | Bacteria | 17126 |
| 750 | Ga0395898_0249684 | 3300037466 | Bacteria | 1692 |
| 751 | Ga0395905_0004228 | 3300037471 | Bacteria | 15006 |
| 752 | Ga0395901_0008269 | 3300038443 | Bacteria | 10509 |
| 753 | Ga0395901_0035663 | 3300038443 | Bacteria | 5139 |
| 754 | Ga0395901_0315084 | 3300038443 | Bacteria | 1619 |
| 755 | Ga0395901_0412867 | 3300038443 | Bacteria | 1385 |
| 756 | Ga0237819_00065 | 3300038705 | Bacteria | 37820 |
| 757 | Ga0436365_1660443 | 3300039437 | Bacteria | 1237 |
| 758 | Ga0436361_0440406 | 3300039447 | Bacteria | 934 |
| 759 | Ga0436363_1508025 | 3300039450 | Bacteria | 1517 |
| 760 | Ga0439436_0000039 | 3300041404 | Bacteria | 41518 |
| 761 | Ga0451793_0318385 | 3300041452 | Bacteria | 1720 |
| 762 | Ga0451802_1800814 | 3300041460 | Bacteria | 1210 |
| 763 | Ga0451841_0314351 | 3300041498 | Bacteria | 1321 |
| 764 | Ga0451853_4032634 | 3300041512 | Bacteria | 1871 |
| 765 | Ga0439454_011437 | 3300042011 | Bacteria | 1186 |
| 766 | Ga0439458_0013252 | 3300042157 | Bacteria | 1856 |
| 767 | Ga0450908_016352 | 3300042184 | Bacteria | 1323 |
| 768 | Ga0451577_0019749 | 3300042876 | Bacteria | 6192 |
| 769 | Ga0451577_0156318 | 3300042876 | Bacteria | 2053 |
| 770 | Ga0466972_0120479 | 3300044658 | Bacteria | 1237 |
| 771 | Ga0466989_0131196 | 3300044663 | Bacteria | 1524 |
| 772 | Ga0466982_0000012 | 3300044672 | Bacteria | 166823 |
| 773 | Ga0466982_0000069 | 3300044672 | Bacteria | 28015 |
| 774 | Ga0466966_0013976 | 3300044684 | Bacteria | 5315 |
| 775 | Ga0466961_0006799 | 3300044693 | Bacteria | 7279 |
| 776 | Ga0466961_0020185 | 3300044693 | Bacteria | 4288 |
| 777 | Ga0466964_0020282 | 3300044706 | Bacteria | 2559 |
| 778 | Ga0466968_0000372 | 3300044735 | Bacteria | 14644 |
| 779 | Ga0466968_0038297 | 3300044735 | Bacteria | 2014 |
| 780 | Ga0466970_0001345 | 3300044765 | Bacteria | 11843 |
| 781 | Ga0466970_0021689 | 3300044765 | Bacteria | 3347 |
| 782 | Ga0466957_0000988 | 3300044842 | Bacteria | 14599 |
| 783 | Ga0466957_0007712 | 3300044842 | Bacteria | 6088 |
| 784 | Ga0466959_0000112 | 3300045049 | Bacteria | 52606 |
| 785 | Ga0466958_0041319 | 3300045836 | Bacteria | 2773 |
| 786 | Ga0466958_0085656 | 3300045836 | Bacteria | 1944 |
| 787 | Ga0466967_0225688 | 3300045976 | Bacteria | 1782 |
| 788 | Ga0466967_0372737 | 3300045976 | Bacteria | 1385 |
| 789 | Ga0495617_000544 | 3300046452 | Bacteria | 19512 |
| 790 | Ga0495592_0068831 | 3300046454 | Bacteria | 2583 |
| 791 | Ga0495629_0000028 | 3300046459 | Bacteria | 127409 |
| 792 | Ga0495638_0000019 | 3300046460 | Bacteria | 384671 |
| 793 | Ga0495638_0006348 | 3300046460 | Bacteria | 8610 |
| 794 | Ga0495638_0066790 | 3300046460 | Bacteria | 2209 |
| 795 | Ga0495638_0070634 | 3300046460 | Bacteria | 2137 |
| 796 | Ga0495641_0000012 | 3300046461 | Bacteria | 144818 |
| 797 | Ga0495641_0182027 | 3300046461 | Bacteria | 941 |
| 798 | Ga0495650_0000961 | 3300046471 | Bacteria | 33088 |
| 799 | Ga0495650_0001680 | 3300046471 | Bacteria | 20441 |
| 800 | Ga0495650_0001768 | 3300046471 | Bacteria | 19623 |
| 801 | Ga0495580_0036251 | 3300046472 | Bacteria | 3542 |
| 802 | Ga0495584_0000852 | 3300046491 | Bacteria | 19719 |
| 803 | Ga0495585_0001031 | 3300046492 | Bacteria | 23176 |
| 804 | Ga0495585_0005296 | 3300046492 | Bacteria | 8149 |
| 805 | Ga0495594_0083560 | 3300046499 | Bacteria | 1785 |
| 806 | Ga0495607_0000334 | 3300046501 | Bacteria | 48877 |
| 807 | Ga0495607_0003817 | 3300046501 | Bacteria | 11364 |
| 808 | Ga0495607_0011325 | 3300046501 | Bacteria | 5944 |
| 809 | Ga0495606_0000113 | 3300046507 | Bacteria | 136805 |
| 810 | Ga0495606_0000219 | 3300046507 | Bacteria | 101614 |
| 811 | Ga0495606_0003641 | 3300046507 | Bacteria | 16179 |
| 812 | Ga0495606_0108430 | 3300046507 | Bacteria | 1678 |
| 813 | Ga0495608_0000001 | 3300046511 | Bacteria | 411278 |
| 814 | Ga0495608_0003719 | 3300046511 | Bacteria | 10963 |
| 815 | Ga0495616_0117266 | 3300046513 | Bacteria | 1231 |
| 816 | Ga0495620_0000060 | 3300046515 | Bacteria | 95642 |
| 817 | Ga0495620_0001178 | 3300046515 | Bacteria | 16001 |
| 818 | Ga0495628_0035804 | 3300046516 | Bacteria | 3988 |
| 819 | Ga0495628_0058034 | 3300046516 | Bacteria | 3043 |
| 820 | Ga0495630_0000227 | 3300046517 | Bacteria | 44643 |
| 821 | Ga0495631_0058718 | 3300046518 | Bacteria | 1672 |
| 822 | Ga0495632_0000010 | 3300046519 | Bacteria | 272360 |
| 823 | Ga0495632_0059417 | 3300046519 | Bacteria | 1860 |
| 824 | Ga0495637_0085268 | 3300046520 | Bacteria | 1253 |
| 825 | Ga0495648_0001511 | 3300046524 | Bacteria | 22786 |
| 826 | Ga0495648_0099974 | 3300046524 | Bacteria | 1603 |
| 827 | Ga0495609_0020466 | 3300046538 | Bacteria | 3058 |
| 828 | Ga0495645_0224295 | 3300046543 | Bacteria | 1262 |
| 829 | Ga0495667_0188232 | 3300046559 | Bacteria | 1323 |
| 830 | Ga0495611_0000003 | 3300046648 | Bacteria | 395679 |
| 831 | Ga0495611_0000857 | 3300046648 | Bacteria | 16666 |
| 832 | Ga0495625_0000019 | 3300046660 | Bacteria | 298330 |
| 833 | Ga0495625_0037278 | 3300046660 | Bacteria | 3568 |
| 834 | Ga0495661_0057424 | 3300046665 | Bacteria | 2323 |
| 835 | Ga0495657_0000002 | 3300046675 | Bacteria | 411958 |
| 836 | Ga0495647_0000053 | 3300046681 | Bacteria | 31238 |
| 837 | Ga0495613_0000242 | 3300046689 | Bacteria | 51661 |
| 838 | Ga0495624_0000419 | 3300046690 | Bacteria | 33677 |
| 839 | Ga0495670_0002544 | 3300046691 | Bacteria | 9010 |
| 840 | Ga0495671_0001785 | 3300046692 | Bacteria | 13910 |
| 841 | Ga0495649_0000784 | 3300046694 | Bacteria | 25529 |
| 842 | Ga0495649_0002630 | 3300046694 | Bacteria | 12525 |
| 843 | Ga0495649_0045773 | 3300046694 | Bacteria | 2384 |
| 844 | Ga0495589_0000516 | 3300046794 | Bacteria | 27140 |
| 845 | Ga0495600_0037710 | 3300046809 | Bacteria | 3143 |
| 846 | Ga0495660_0000125 | 3300046810 | Bacteria | 84503 |
| 847 | Ga0495660_0002931 | 3300046810 | Bacteria | 10682 |
| 848 | Ga0495581_0130357 | 3300047315 | Bacteria | 1465 |
| 849 | Ga0495604_0001604 | 3300047317 | Bacteria | 18634 |
| 850 | Ga0495604_0098791 | 3300047317 | Bacteria | 2149 |
| 851 | Ga0495676_0001744 | 3300047321 | Bacteria | 19010 |
| 852 | Ga0495675_0000162 | 3300047444 | Bacteria | 47605 |
| 853 | Ga0495679_000017 | 3300047446 | Bacteria | 263230 |
| 854 | Ga0495673_0000004 | 3300047469 | Bacteria | 1354526 |
| 855 | Ga0495673_0012171 | 3300047469 | Bacteria | 4579 |
| 856 | Ga0495684_0007985 | 3300047471 | Bacteria | 8178 |
| 857 | Ga0495686_0000117 | 3300047472 | Bacteria | 166073 |
| 858 | Ga0495686_0004845 | 3300047472 | Bacteria | 10858 |
| 859 | Ga0495686_0025565 | 3300047472 | Bacteria | 3869 |
| 860 | Ga0495602_0000063 | 3300048088 | Bacteria | 104915 |
| 861 | Ga0495602_0203472 | 3300048088 | Bacteria | 1509 |
| 862 | Ga0496100_0005052 | 3300048903 | Bacteria | 7062 |
| 863 | Ga0496100_0083587 | 3300048903 | Bacteria | 2162 |
| 864 | Ga0496101_0296569 | 3300048904 | Bacteria | 1266 |
| 865 | Ga0496102_0032094 | 3300048905 | Bacteria | 4717 |
| 866 | Ga0496102_0422372 | 3300048905 | Bacteria | 1252 |
| 867 | Ga0496104_0000012 | 3300048907 | Bacteria | 438011 |
| 868 | Ga0496104_0467140 | 3300048907 | Bacteria | 1173 |
| 869 | Ga0496105_0000011 | 3300048908 | Bacteria | 302186 |
| 870 | Ga0496105_0000914 | 3300048908 | Bacteria | 20104 |
| 871 | Ga0496106_0000637 | 3300048909 | Bacteria | 25174 |
| 872 | Ga0496108_0000012 | 3300048911 | Bacteria | 258433 |
| 873 | Ga0496109_0000246 | 3300048912 | Bacteria | 52127 |
| 874 | Ga0496109_0012039 | 3300048912 | Bacteria | 7452 |
| 875 | Ga0496110_0362131 | 3300048913 | Bacteria | 1321 |
| 876 | Ga0496111_0015604 | 3300048914 | Bacteria | 5220 |
| 877 | Ga0496112_0003022 | 3300048915 | Bacteria | 13751 |
| 878 | Ga0496113_0147556 | 3300048916 | Bacteria | 1854 |
| 879 | Ga0496114_0115480 | 3300048917 | Bacteria | 2303 |
| 880 | Ga0496114_0246557 | 3300048917 | Bacteria | 1571 |
| 881 | Ga0496114_0333770 | 3300048917 | Bacteria | 1340 |
| 882 | Ga0496115_0000004 | 3300048918 | Bacteria | 319734 |
| 883 | Ga0496115_0000060 | 3300048918 | Bacteria | 101954 |
| 884 | Ga0496115_0000247 | 3300048918 | Bacteria | 48853 |
| 885 | Ga0496115_0002188 | 3300048918 | Bacteria | 13999 |
| 886 | Ga0496115_0052591 | 3300048918 | Bacteria | 3268 |
| 887 | Ga0496117_0023276 | 3300048920 | Bacteria | 4943 |
| 888 | Ga0496117_0100990 | 3300048920 | Bacteria | 1826 |
| 889 | Ga0496118_0001026 | 3300048921 | Bacteria | 43467 |
| 890 | Ga0496118_0004246 | 3300048921 | Bacteria | 17169 |
| 891 | Ga0496118_0008143 | 3300048921 | Bacteria | 10915 |
| 892 | Ga0496118_0017301 | 3300048921 | Bacteria | 6570 |
| 893 | Ga0496119_0000306 | 3300048922 | Bacteria | 68399 |
| 894 | Ga0496120_0000145 | 3300048923 | Bacteria | 119265 |
| 895 | Ga0496120_0056783 | 3300048923 | Bacteria | 2207 |
| 896 | Ga0496121_0000251 | 3300048924 | Bacteria | 113931 |
| 897 | Ga0496121_0000593 | 3300048924 | Bacteria | 67965 |
| 898 | Ga0496121_0018047 | 3300048924 | Bacteria | 7145 |
| 899 | Ga0496121_0041801 | 3300048924 | Bacteria | 4000 |
| 900 | Ga0496121_0240081 | 3300048924 | Bacteria | 1263 |
| 901 | Ga0496122_0008859 | 3300048925 | Bacteria | 10735 |
| 902 | Ga0496122_0029664 | 3300048925 | Bacteria | 4606 |
| 903 | Ga0496123_0009630 | 3300048926 | Bacteria | 8671 |
| 904 | Ga0496123_0018943 | 3300048926 | Bacteria | 5445 |
| 905 | Ga0496124_0001043 | 3300048927 | Bacteria | 43756 |
| 906 | Ga0496124_0244663 | 3300048927 | Bacteria | 1331 |
| 907 | Ga0496125_0000239 | 3300048928 | Bacteria | 112926 |
| 908 | Ga0496125_0023701 | 3300048928 | Bacteria | 5658 |
| 909 | Ga0496126_0000253 | 3300048929 | Bacteria | 115336 |
| 910 | Ga0496126_0000712 | 3300048929 | Bacteria | 60417 |
| 911 | Ga0496126_0115714 | 3300048929 | Bacteria | 2331 |
| 912 | Ga0496126_0256869 | 3300048929 | Bacteria | 1454 |
| 913 | Ga0495678_001135 | 3300049459 | Bacteria | 22118 |
| 914 | Ga0495678_067479 | 3300049459 | Bacteria | 1321 |
| 915 | Ga0495682_0035008 | 3300049460 | Bacteria | 1850 |
| 916 | Ga0501031_0029350 | 3300049568 | Bacteria | 3587 |
| 917 | Ga0501031_0045711 | 3300049568 | Bacteria | 2857 |
| 918 | Ga0501031_0138479 | 3300049568 | Bacteria | 1590 |
| 919 | Ga0501032_0009348 | 3300049569 | Bacteria | 7102 |
| 920 | Ga0501032_0045363 | 3300049569 | Bacteria | 2973 |
| 921 | Ga0501033_0001322 | 3300049570 | Bacteria | 22031 |
| 922 | Ga0501033_0001421 | 3300049570 | Bacteria | 21264 |
| 923 | Ga0501033_0095900 | 3300049570 | Bacteria | 2167 |
| 924 | Ga0501033_0382947 | 3300049570 | Bacteria | 982 |
| 925 | Ga0501034_0001157 | 3300049571 | Bacteria | 36580 |
| 926 | Ga0501034_0001814 | 3300049571 | Bacteria | 27184 |
| 927 | Ga0501034_0005729 | 3300049571 | Bacteria | 13505 |
| 928 | Ga0501034_0070822 | 3300049571 | Bacteria | 3497 |
| 929 | Ga0501034_0103290 | 3300049571 | Bacteria | 2843 |
| 930 | Ga0501034_0204653 | 3300049571 | Bacteria | 1930 |
| 931 | Ga0501034_0246131 | 3300049571 | Bacteria | 1733 |
| 932 | Ga0501036_0032187 | 3300049572 | Bacteria | 4431 |
| 933 | Ga0501036_0036254 | 3300049572 | Bacteria | 4173 |
| 934 | Ga0501036_0098182 | 3300049572 | Bacteria | 2476 |
| 935 | Ga0501036_0422905 | 3300049572 | Bacteria | 1111 |
| 936 | Ga0501037_0002431 | 3300049573 | Bacteria | 13468 |
| 937 | Ga0501037_0061848 | 3300049573 | Bacteria | 2730 |
| 938 | Ga0501037_0075291 | 3300049573 | Bacteria | 2451 |
| 939 | Ga0501038_0005383 | 3300049574 | Bacteria | 11892 |
| 940 | Ga0501038_0006872 | 3300049574 | Bacteria | 10509 |
| 941 | Ga0501038_0053267 | 3300049574 | Bacteria | 3484 |
| 942 | Ga0501038_0060385 | 3300049574 | Bacteria | 3245 |
| 943 | Ga0501038_0122747 | 3300049574 | Bacteria | 2140 |
| 944 | Ga0501038_0159177 | 3300049574 | Bacteria | 1836 |
| 945 | Ga0501039_0088674 | 3300049575 | Bacteria | 2409 |
| 946 | Ga0501042_0057834 | 3300049578 | Bacteria | 2767 |
| 947 | Ga0501043_0013218 | 3300049579 | Bacteria | 6454 |
| 948 | Ga0501043_0062761 | 3300049579 | Bacteria | 2918 |
| 949 | Ga0501043_0088370 | 3300049579 | Bacteria | 2435 |
| 950 | Ga0501043_0130484 | 3300049579 | Bacteria | 1969 |
| 951 | Ga0501043_0295356 | 3300049579 | Bacteria | 1239 |
| 952 | Ga0501046_0007493 | 3300049580 | Bacteria | 9580 |
| 953 | Ga0501046_0045641 | 3300049580 | Bacteria | 3480 |
| 954 | Ga0501046_0070638 | 3300049580 | Bacteria | 2714 |
| 955 | Ga0501046_0093723 | 3300049580 | Bacteria | 2308 |
| 956 | Ga0501047_0001250 | 3300049581 | Bacteria | 25172 |
| 957 | Ga0501047_0008124 | 3300049581 | Bacteria | 9905 |
| 958 | Ga0501047_0008409 | 3300049581 | Bacteria | 9739 |
| 959 | Ga0501047_0018198 | 3300049581 | Bacteria | 6733 |
| 960 | Ga0501047_0072439 | 3300049581 | Bacteria | 3316 |
| 961 | Ga0501047_0212484 | 3300049581 | Bacteria | 1792 |
| 962 | Ga0501047_0426161 | 3300049581 | Bacteria | 1158 |
| 963 | Ga0501047_0437589 | 3300049581 | Bacteria | 1138 |
| 964 | Ga0501048_0097270 | 3300049582 | Bacteria | 2076 |
| 965 | Ga0501048_0137690 | 3300049582 | Bacteria | 1725 |
| 966 | Ga0501067_0006675 | 3300049583 | Bacteria | 6405 |
| 967 | Ga0501067_0029608 | 3300049583 | Bacteria | 3034 |
| 968 | Ga0501068_0004484 | 3300049584 | Bacteria | 7604 |
| 969 | Ga0501068_0091867 | 3300049584 | Bacteria | 1873 |
| 970 | Ga0501068_0175762 | 3300049584 | Bacteria | 1353 |
| 971 | Ga0501070_0001427 | 3300049586 | Bacteria | 21397 |
| 972 | Ga0501070_0008994 | 3300049586 | Bacteria | 8450 |
| 973 | Ga0501070_0012316 | 3300049586 | Bacteria | 7217 |
| 974 | Ga0501070_0013528 | 3300049586 | Bacteria | 6878 |
| 975 | Ga0501070_0062366 | 3300049586 | Bacteria | 3088 |
| 976 | Ga0501070_0088946 | 3300049586 | Bacteria | 2556 |
| 977 | Ga0501070_0147010 | 3300049586 | Bacteria | 1945 |
| 978 | Ga0501071_0101198 | 3300049587 | Bacteria | 2124 |
| 979 | Ga0501073_0006900 | 3300049589 | Bacteria | 8451 |
| 980 | Ga0501073_0092302 | 3300049589 | Bacteria | 2104 |
| 981 | Ga0501073_0096487 | 3300049589 | Bacteria | 2053 |
| 982 | Ga0501073_0105507 | 3300049589 | Bacteria | 1955 |
| 983 | Ga0501073_0135853 | 3300049589 | Bacteria | 1704 |
| 984 | Ga0501074_0010104 | 3300049590 | Bacteria | 6853 |
| 985 | Ga0501074_0072163 | 3300049590 | Bacteria | 2480 |
| 986 | Ga0501074_0148951 | 3300049590 | Bacteria | 1673 |
| 987 | Ga0501075_0369376 | 3300049591 | Bacteria | 1093 |
| 988 | Ga0501076_0104928 | 3300049592 | Bacteria | 2281 |
| 989 | Ga0501076_0142888 | 3300049592 | Bacteria | 1945 |
| 990 | Ga0501079_0041666 | 3300049741 | Bacteria | 3545 |
| 991 | Ga0501079_0105838 | 3300049741 | Bacteria | 2183 |
| 992 | Ga0501079_0372548 | 3300049741 | Bacteria | 1119 |
| 993 | Ga0501080_0016955 | 3300049742 | Bacteria | 6726 |
| 994 | Ga0501080_0043756 | 3300049742 | Bacteria | 4169 |
| 995 | Ga0501080_0045456 | 3300049742 | Bacteria | 4087 |
| 996 | Ga0501080_0177449 | 3300049742 | Bacteria | 1962 |
| 997 | Ga0501083_0010479 | 3300049744 | Bacteria | 6525 |
| 998 | Ga0501083_0045729 | 3300049744 | Bacteria | 2960 |
| 999 | Ga0501035_0070197 | 3300049822 | Bacteria | 3103 |
| 1000 | Ga0501035_0128312 | 3300049822 | Bacteria | 2212 |
| 1001 | Ga0501035_0319937 | 3300049822 | Bacteria | 1303 |
| 1002 | Ga0501044_0065626 | 3300049823 | Bacteria | 3701 |
| 1003 | Ga0501044_0095901 | 3300049823 | Bacteria | 2988 |
| 1004 | Ga0501044_0337098 | 3300049823 | Bacteria | 1429 |
| 1005 | Ga0501045_0273219 | 3300049824 | Bacteria | 1258 |
| 1006 | Ga0495601_0000281 | 3300053077 | Bacteria | 27326 |
| 1007 | Ga0495601_0002233 | 3300053077 | Bacteria | 10903 |
| 1008 | Ga0500610_0018754 | 3300053079 | Bacteria | 3352 |
| 1009 | Ga0495595_0000001 | 3300053084 | Bacteria | 495226 |
| 1010 | Ga0495619_0000708 | 3300053085 | Bacteria | 21719 |
| 1011 | Ga0495619_0018450 | 3300053085 | Bacteria | 4426 |
| 1012 | Ga0500643_000004 | 3300053087 | Bacteria | 857484 |
| 1013 | Ga0500643_000223 | 3300053087 | Bacteria | 52940 |
| 1014 | Ga0500643_002293 | 3300053087 | Bacteria | 10032 |
| 1015 | Ga0500651_0000244 | 3300053093 | Bacteria | 33238 |
| 1016 | Ga0500651_0000401 | 3300053093 | Bacteria | 23578 |
| 1017 | Ga0500555_000290 | 3300053103 | Bacteria | 21695 |
| 1018 | Ga0500597_077126 | 3300053120 | Bacteria | 1444 |
| 1019 | Ga0500607_001366 | 3300053121 | Bacteria | 22173 |
| 1020 | Ga0500614_001872 | 3300053123 | Bacteria | 4853 |
| 1021 | Ga0500559_0003476 | 3300053136 | Bacteria | 7731 |
| 1022 | Ga0500568_0005462 | 3300053139 | Bacteria | 6563 |
| 1023 | Ga0500604_0000017 | 3300053151 | Bacteria | 82010 |
| 1024 | Ga0500616_0003013 | 3300053153 | Bacteria | 13278 |
| 1025 | Ga0500616_0004209 | 3300053153 | Bacteria | 10369 |
| 1026 | Ga0500622_0018882 | 3300053156 | Bacteria | 3664 |
| 1027 | Ga0500645_000648 | 3300053730 | Bacteria | 22062 |
| 1028 | Ga0500645_000748 | 3300053730 | Bacteria | 19970 |
| 1029 | Ga0500645_006858 | 3300053730 | Bacteria | 4024 |
| 1030 | Ga0500587_005038 | 3300053739 | Bacteria | 1792 |
| 1031 | Ga0501084_0089267 | 3300054114 | Bacteria | 2587 |
| 1032 | Ga0587109_029276 | 3300059624 | Bacteria | 1036 |
| 1033 | Ga0587117_014431 | 3300059627 | Bacteria | 1026 |
| 1034 | Ga0501082_0000524 | 3300060353 | Bacteria | 34045 |
| 1035 | Ga0466962_0011774 | 3300061719 | Bacteria | 4213 |
| 1036 | Ga0466962_0020327 | 3300061719 | Bacteria | 3190 |
| 1037 | Ga0466962_0087573 | 3300061719 | Bacteria | 1491 |
| 1038 | Ga0530510_0162010 | 3300061734 | Bacteria | 1655 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300013105 | Ga0157369_10000001 | Ga0157369_10000001237 | 227 |
| 2 | 3300006237 | Ga0097621_100132123 | Ga0097621_1001321232 | 248 |
| 3 | 3300013105 | Ga0157369_10024303 | Ga0157369_100243036 | 248 |
| 4 | 3300013307 | Ga0157372_10022364 | Ga0157372_100223645 | 248 |
| 5 | 3300048088 | Ga0495602_0203472 | Ga0495602_0203472_123_1004 | 260 |
| 6 | 3300053085 | Ga0495619_0018450 | Ga0495619_0018450_229_1110 | 260 |
| 7 | 3300053077 | Ga0495601_0002233 | Ga0495601_0002233_4213_5094 | 261 |
| 8 | 3300053151 | Ga0500604_0000017 | Ga0500604_0000017_10378_11229 | 267 |
| 9 | 3300042157 | Ga0439458_0013252 | Ga0439458_0013252_163_1053 | 268 |
| 10 | 3300005334 | Ga0068869_100126787 | Ga0068869_1001267872 | 269 |
| 11 | 3300047315 | Ga0495581_0130357 | Ga0495581_0130357_315_1232 | 269 |
| 12 | 3300010375 | Ga0105239_10010596 | Ga0105239_100105966 | 270 |
| 13 | 3300006237 | Ga0097621_100106252 | Ga0097621_1001062522 | 271 |
| 14 | 3300014325 | Ga0163163_10000024 | Ga0163163_1000002414 | 271 |
| 15 | 3300031901 | Ga0307406_10233448 | Ga0307406_102334481 | 274 |
| 16 | 3300006353 | Ga0075370_10001519 | Ga0075370_100015192 | 275 |
| 17 | 3300049571 | Ga0501034_0246131 | Ga0501034_0246131_499_1383 | 275 |
| 18 | 3300049572 | Ga0501036_0422905 | Ga0501036_0422905_32_907 | 275 |
| 19 | 3300053121 | Ga0500607_001366 | Ga0500607_001366_12905_13795 | 275 |
| 20 | 3300053136 | Ga0500559_0003476 | Ga0500559_0003476_6073_6963 | 275 |
| 21 | 3300053156 | Ga0500622_0018882 | Ga0500622_0018882_935_1825 | 275 |
| 22 | 3300053730 | Ga0500645_000748 | Ga0500645_000748_7334_8224 | 275 |
| 23 | 3300005338 | Ga0068868_100435306 | Ga0068868_1004353061 | 276 |
| 24 | 3300005439 | Ga0070711_100312550 | Ga0070711_1003125502 | 276 |
| 25 | 3300005548 | Ga0070665_100101092 | Ga0070665_1001010922 | 276 |
| 26 | 3300005618 | Ga0068864_100061987 | Ga0068864_1000619873 | 276 |
| 27 | 3300005843 | Ga0068860_100105022 | Ga0068860_1001050223 | 276 |
| 28 | 3300009553 | Ga0105249_10445725 | Ga0105249_104457251 | 276 |
| 29 | 3300013306 | Ga0163162_10188995 | Ga0163162_101889952 | 276 |
| 30 | 3300014325 | Ga0163163_10003591 | Ga0163163_100035917 | 276 |
| 31 | 3300014968 | Ga0157379_10001814 | Ga0157379_1000181412 | 276 |
| 32 | 3300025924 | Ga0207694_10366128 | Ga0207694_103661281 | 276 |
| 33 | 3300026088 | Ga0207641_10354270 | Ga0207641_103542702 | 276 |
| 34 | 3300026095 | Ga0207676_10021807 | Ga0207676_100218072 | 276 |
| 35 | 3300028379 | Ga0268266_10079570 | Ga0268266_100795701 | 276 |
| 36 | 3300028381 | Ga0268264_10036734 | Ga0268264_100367342 | 276 |
| 37 | 3300034816 | Ga0373930_0021398 | Ga0373930_0021398_65_949 | 276 |
| 38 | 3300041512 | Ga0451853_4032634 | Ga0451853_4032634_301_1176 | 276 |
| 39 | 3300048917 | Ga0496114_0333770 | Ga0496114_0333770_78_953 | 276 |
| 40 | 3300048918 | Ga0496115_0052591 | Ga0496115_0052591_1934_2815 | 276 |
| 41 | 3300049568 | Ga0501031_0029350 | Ga0501031_0029350_108_980 | 276 |
| 42 | 3300049570 | Ga0501033_0001421 | Ga0501033_0001421_708_1580 | 276 |
| 43 | 3300049571 | Ga0501034_0103290 | Ga0501034_0103290_1264_2136 | 276 |
| 44 | 3300049572 | Ga0501036_0036254 | Ga0501036_0036254_3270_4142 | 276 |
| 45 | 3300049573 | Ga0501037_0061848 | Ga0501037_0061848_1263_2135 | 276 |
| 46 | 3300049574 | Ga0501038_0006872 | Ga0501038_0006872_4892_5764 | 276 |
| 47 | 3300049575 | Ga0501039_0088674 | Ga0501039_0088674_801_1673 | 276 |
| 48 | 3300049578 | Ga0501042_0057834 | Ga0501042_0057834_95_967 | 276 |
| 49 | 3300049579 | Ga0501043_0013218 | Ga0501043_0013218_3431_4303 | 276 |
| 50 | 3300049580 | Ga0501046_0045641 | Ga0501046_0045641_344_1216 | 276 |
| 51 | 3300049582 | Ga0501048_0137690 | Ga0501048_0137690_301_1173 | 276 |
| 52 | 3300049583 | Ga0501067_0029608 | Ga0501067_0029608_552_1424 | 276 |
| 53 | 3300049584 | Ga0501068_0175762 | Ga0501068_0175762_48_923 | 276 |
| 54 | 3300049586 | Ga0501070_0013528 | Ga0501070_0013528_4920_5792 | 276 |
| 55 | 3300049587 | Ga0501071_0101198 | Ga0501071_0101198_374_1246 | 276 |
| 56 | 3300049589 | Ga0501073_0006900 | Ga0501073_0006900_2393_3265 | 276 |
| 57 | 3300049589 | Ga0501073_0135853 | Ga0501073_0135853_715_1587 | 276 |
| 58 | 3300049590 | Ga0501074_0072163 | Ga0501074_0072163_1169_2041 | 276 |
| 59 | 3300049590 | Ga0501074_0148951 | Ga0501074_0148951_416_1288 | 276 |
| 60 | 3300049592 | Ga0501076_0142888 | Ga0501076_0142888_984_1856 | 276 |
| 61 | 3300049741 | Ga0501079_0041666 | Ga0501079_0041666_1825_2697 | 276 |
| 62 | 3300049744 | Ga0501083_0045729 | Ga0501083_0045729_1971_2843 | 276 |
| 63 | 3300049822 | Ga0501035_0128312 | Ga0501035_0128312_1264_2136 | 276 |
| 64 | 3300049822 | Ga0501035_0319937 | Ga0501035_0319937_386_1258 | 276 |
| 65 | 3300049823 | Ga0501044_0095901 | Ga0501044_0095901_1682_2554 | 276 |
| 66 | 3300049823 | Ga0501044_0337098 | Ga0501044_0337098_60_932 | 276 |
| 67 | 3300061734 | Ga0530510_0162010 | Ga0530510_0162010_657_1529 | 276 |
| 68 | 3300005458 | Ga0070681_10000012 | Ga0070681_1000001244 | 277 |
| 69 | 3300005530 | Ga0070679_100611914 | Ga0070679_1006119141 | 277 |
| 70 | 3300005539 | Ga0068853_100092077 | Ga0068853_1000920772 | 277 |
| 71 | 3300005547 | Ga0070693_100018210 | Ga0070693_1000182102 | 277 |
| 72 | 3300005614 | Ga0068856_100370297 | Ga0068856_1003702972 | 277 |
| 73 | 3300005616 | Ga0068852_100183424 | Ga0068852_1001834242 | 277 |
| 74 | 3300005834 | Ga0068851_10011383 | Ga0068851_100113832 | 277 |
| 75 | 3300006237 | Ga0097621_100191043 | Ga0097621_1001910432 | 277 |
| 76 | 3300006881 | Ga0068865_100083654 | Ga0068865_1000836542 | 277 |
| 77 | 3300013296 | Ga0157374_10077334 | Ga0157374_100773342 | 277 |
| 78 | 3300025912 | Ga0207707_10000544 | Ga0207707_100005443 | 277 |
| 79 | 3300025938 | Ga0207704_10088731 | Ga0207704_100887311 | 277 |
| 80 | 3300026041 | Ga0207639_10080391 | Ga0207639_100803912 | 277 |
| 81 | 3300026041 | Ga0207639_10249849 | Ga0207639_102498491 | 277 |
| 82 | 3300026116 | Ga0207674_10274224 | Ga0207674_102742242 | 277 |
| 83 | 3300026142 | Ga0207698_10453690 | Ga0207698_104536902 | 277 |
| 84 | 3300031824 | Ga0307413_10068707 | Ga0307413_100687072 | 277 |
| 85 | 3300032004 | Ga0307414_10010846 | Ga0307414_100108462 | 277 |
| 86 | 3300045976 | Ga0466967_0372737 | Ga0466967_0372737_457_1335 | 277 |
| 87 | 3300049574 | Ga0501038_0053267 | Ga0501038_0053267_444_1322 | 277 |
| 88 | 3300053087 | Ga0500643_000004 | Ga0500643_000004_628729_629619 | 277 |
| 89 | 3300053153 | Ga0500616_0004209 | Ga0500616_0004209_8947_9837 | 277 |
| 90 | 3300003214 | JGI25165J46597_1011312 | JGI25165J46597_10113122 | 279 |
| 91 | 3300005336 | Ga0070680_100100839 | Ga0070680_1001008392 | 279 |
| 92 | 3300005337 | Ga0070682_100009277 | Ga0070682_1000092775 | 279 |
| 93 | 3300005337 | Ga0070682_100158789 | Ga0070682_1001587891 | 279 |
| 94 | 3300005337 | Ga0070682_100168330 | Ga0070682_1001683302 | 279 |
| 95 | 3300005339 | Ga0070660_100476096 | Ga0070660_1004760961 | 279 |
| 96 | 3300005340 | Ga0070689_100265442 | Ga0070689_1002654421 | 279 |
| 97 | 3300005344 | Ga0070661_100045981 | Ga0070661_1000459812 | 279 |
| 98 | 3300005366 | Ga0070659_100026223 | Ga0070659_1000262232 | 279 |
| 99 | 3300005458 | Ga0070681_10042989 | Ga0070681_100429893 | 279 |
| 100 | 3300005530 | Ga0070679_100046312 | Ga0070679_1000463122 | 279 |
| 101 | 3300005539 | Ga0068853_100068171 | Ga0068853_1000681712 | 279 |
| 102 | 3300005546 | Ga0070696_100011107 | Ga0070696_1000111075 | 279 |
| 103 | 3300005547 | Ga0070693_100148187 | Ga0070693_1001481872 | 279 |
| 104 | 3300005614 | Ga0068856_100200222 | Ga0068856_1002002222 | 279 |
| 105 | 3300005843 | Ga0068860_100088566 | Ga0068860_1000885662 | 279 |
| 106 | 3300009174 | Ga0105241_10356023 | Ga0105241_103560232 | 279 |
| 107 | 3300009176 | Ga0105242_10180272 | Ga0105242_101802723 | 279 |
| 108 | 3300009551 | Ga0105238_10026777 | Ga0105238_100267774 | 279 |
| 109 | 3300009551 | Ga0105238_10109990 | Ga0105238_101099902 | 279 |
| 110 | 3300009551 | Ga0105238_10291842 | Ga0105238_102918421 | 279 |
| 111 | 3300013102 | Ga0157371_10249288 | Ga0157371_102492882 | 279 |
| 112 | 3300013105 | Ga0157369_10282190 | Ga0157369_102821902 | 279 |
| 113 | 3300013307 | Ga0157372_10019600 | Ga0157372_100196004 | 279 |
| 114 | 3300014497 | Ga0182008_10197902 | Ga0182008_101979021 | 279 |
| 115 | 3300025907 | Ga0207645_10059751 | Ga0207645_100597513 | 279 |
| 116 | 3300025908 | Ga0207643_10070829 | Ga0207643_100708292 | 279 |
| 117 | 3300025909 | Ga0207705_10065373 | Ga0207705_100653732 | 279 |
| 118 | 3300025911 | Ga0207654_10000247 | Ga0207654_1000024727 | 279 |
| 119 | 3300025911 | Ga0207654_10176322 | Ga0207654_101763222 | 279 |
| 120 | 3300025912 | Ga0207707_10056246 | Ga0207707_100562462 | 279 |
| 121 | 3300025913 | Ga0207695_10166559 | Ga0207695_101665595 | 279 |
| 122 | 3300025917 | Ga0207660_10031341 | Ga0207660_100313412 | 279 |
| 123 | 3300025921 | Ga0207652_10032171 | Ga0207652_100321712 | 279 |
| 124 | 3300025924 | Ga0207694_10022142 | Ga0207694_100221422 | 279 |
| 125 | 3300025924 | Ga0207694_10165468 | Ga0207694_101654682 | 279 |
| 126 | 3300025929 | Ga0207664_10000170 | Ga0207664_100001709 | 279 |
| 127 | 3300025932 | Ga0207690_10013105 | Ga0207690_100131051 | 279 |
| 128 | 3300025934 | Ga0207686_10006134 | Ga0207686_100061346 | 279 |
| 129 | 3300025940 | Ga0207691_10019400 | Ga0207691_100194004 | 279 |
| 130 | 3300025949 | Ga0207667_10002465 | Ga0207667_1000246513 | 279 |
| 131 | 3300026041 | Ga0207639_10001563 | Ga0207639_1000156310 | 279 |
| 132 | 3300026116 | Ga0207674_10080365 | Ga0207674_100803653 | 279 |
| 133 | 3300028381 | Ga0268264_10007883 | Ga0268264_100078834 | 279 |
| 134 | 3300031251 | Ga0265327_10001583 | Ga0265327_1000158314 | 279 |
| 135 | 3300038443 | Ga0395901_0008269 | Ga0395901_0008269_9584_10456 | 279 |
| 136 | 3300046543 | Ga0495645_0224295 | Ga0495645_0224295_201_1076 | 279 |
| 137 | 3300048907 | Ga0496104_0000012 | Ga0496104_0000012_166517_167389 | 279 |
| 138 | 3300048908 | Ga0496105_0000011 | Ga0496105_0000011_270626_271498 | 279 |
| 139 | 3300049571 | Ga0501034_0001157 | Ga0501034_0001157_624_1496 | 279 |
| 140 | 3300049571 | Ga0501034_0070822 | Ga0501034_0070822_852_1724 | 279 |
| 141 | 3300049572 | Ga0501036_0098182 | Ga0501036_0098182_1097_1969 | 279 |
| 142 | 3300049574 | Ga0501038_0060385 | Ga0501038_0060385_1480_2352 | 279 |
| 143 | 3300049579 | Ga0501043_0062761 | Ga0501043_0062761_2019_2891 | 279 |
| 144 | 3300049579 | Ga0501043_0295356 | Ga0501043_0295356_240_1112 | 279 |
| 145 | 3300049580 | Ga0501046_0070638 | Ga0501046_0070638_1565_2437 | 279 |
| 146 | 3300049581 | Ga0501047_0001250 | Ga0501047_0001250_23670_24542 | 279 |
| 147 | 3300049581 | Ga0501047_0008409 | Ga0501047_0008409_8805_9677 | 279 |
| 148 | 3300049581 | Ga0501047_0072439 | Ga0501047_0072439_1939_2811 | 279 |
| 149 | 3300049583 | Ga0501067_0006675 | Ga0501067_0006675_694_1566 | 279 |
| 150 | 3300049584 | Ga0501068_0004484 | Ga0501068_0004484_1122_1994 | 279 |
| 151 | 3300049584 | Ga0501068_0091867 | Ga0501068_0091867_318_1190 | 279 |
| 152 | 3300049586 | Ga0501070_0012316 | Ga0501070_0012316_478_1350 | 279 |
| 153 | 3300049586 | Ga0501070_0147010 | Ga0501070_0147010_550_1422 | 279 |
| 154 | 3300049589 | Ga0501073_0092302 | Ga0501073_0092302_750_1622 | 279 |
| 155 | 3300049589 | Ga0501073_0096487 | Ga0501073_0096487_286_1158 | 279 |
| 156 | 3300049590 | Ga0501074_0010104 | Ga0501074_0010104_4389_5261 | 279 |
| 157 | 3300049741 | Ga0501079_0105838 | Ga0501079_0105838_1275_2147 | 279 |
| 158 | 3300049741 | Ga0501079_0372548 | Ga0501079_0372548_54_926 | 279 |
| 159 | 3300049742 | Ga0501080_0016955 | Ga0501080_0016955_4668_5540 | 279 |
| 160 | 3300049742 | Ga0501080_0043756 | Ga0501080_0043756_631_1503 | 279 |
| 161 | 3300049742 | Ga0501080_0045456 | Ga0501080_0045456_2075_2947 | 279 |
| 162 | 3300049742 | Ga0501080_0177449 | Ga0501080_0177449_711_1583 | 279 |
| 163 | 3300049744 | Ga0501083_0010479 | Ga0501083_0010479_5326_6198 | 279 |
| 164 | 3300059624 | Ga0587109_029276 | Ga0587109_029276_47_1003 | 279 |
| 165 | 3300059627 | Ga0587117_014431 | Ga0587117_014431_26_982 | 279 |
| 166 | 3300001979 | JGI24740J21852_10007220 | JGI24740J21852_100072203 | 280 |
| 167 | 3300005327 | Ga0070658_10138710 | Ga0070658_101387102 | 280 |
| 168 | 3300005336 | Ga0070680_100001055 | Ga0070680_10000105522 | 280 |
| 169 | 3300005337 | Ga0070682_100113106 | Ga0070682_1001131061 | 280 |
| 170 | 3300005339 | Ga0070660_100241840 | Ga0070660_1002418402 | 280 |
| 171 | 3300005341 | Ga0070691_10004209 | Ga0070691_100042092 | 280 |
| 172 | 3300005345 | Ga0070692_10072430 | Ga0070692_100724302 | 280 |
| 173 | 3300005366 | Ga0070659_100199321 | Ga0070659_1001993212 | 280 |
| 174 | 3300005435 | Ga0070714_100001345 | Ga0070714_10000134514 | 280 |
| 175 | 3300005457 | Ga0070662_100062140 | Ga0070662_1000621402 | 280 |
| 176 | 3300005458 | Ga0070681_10004142 | Ga0070681_1000414215 | 280 |
| 177 | 3300005458 | Ga0070681_10008223 | Ga0070681_100082234 | 280 |
| 178 | 3300005530 | Ga0070679_100001207 | Ga0070679_10000120725 | 280 |
| 179 | 3300005539 | Ga0068853_100081447 | Ga0068853_1000814472 | 280 |
| 180 | 3300005546 | Ga0070696_100015936 | Ga0070696_1000159362 | 280 |
| 181 | 3300005546 | Ga0070696_100019688 | Ga0070696_1000196884 | 280 |
| 182 | 3300005546 | Ga0070696_100095863 | Ga0070696_1000958632 | 280 |
| 183 | 3300005563 | Ga0068855_100342779 | Ga0068855_1003427792 | 280 |
| 184 | 3300005564 | Ga0070664_100224010 | Ga0070664_1002240102 | 280 |
| 185 | 3300005578 | Ga0068854_100020186 | Ga0068854_1000201864 | 280 |
| 186 | 3300005614 | Ga0068856_100098538 | Ga0068856_1000985382 | 280 |
| 187 | 3300005614 | Ga0068856_100145680 | Ga0068856_1001456802 | 280 |
| 188 | 3300005616 | Ga0068852_100026612 | Ga0068852_1000266125 | 280 |
| 189 | 3300005616 | Ga0068852_100369704 | Ga0068852_1003697042 | 280 |
| 190 | 3300005834 | Ga0068851_10001581 | Ga0068851_100015812 | 280 |
| 191 | 3300009174 | Ga0105241_10052667 | Ga0105241_100526672 | 280 |
| 192 | 3300009551 | Ga0105238_10023407 | Ga0105238_100234075 | 280 |
| 193 | 3300013100 | Ga0157373_10069220 | Ga0157373_100692201 | 280 |
| 194 | 3300013102 | Ga0157371_10017314 | Ga0157371_100173145 | 280 |
| 195 | 3300013104 | Ga0157370_10011552 | Ga0157370_100115528 | 280 |
| 196 | 3300013104 | Ga0157370_10267377 | Ga0157370_102673772 | 280 |
| 197 | 3300013105 | Ga0157369_10169829 | Ga0157369_101698292 | 280 |
| 198 | 3300013296 | Ga0157374_10010042 | Ga0157374_100100428 | 280 |
| 199 | 3300013306 | Ga0163162_10000017 | Ga0163162_10000017160 | 280 |
| 200 | 3300013307 | Ga0157372_10212098 | Ga0157372_102120982 | 280 |
| 201 | 3300014969 | Ga0157376_10169901 | Ga0157376_101699011 | 280 |
| 202 | 3300020070 | Ga0206356_10807946 | Ga0206356_108079462 | 280 |
| 203 | 3300020082 | Ga0206353_10351104 | Ga0206353_103511042 | 280 |
| 204 | 3300025321 | Ga0207656_10014641 | Ga0207656_100146412 | 280 |
| 205 | 3300025904 | Ga0207647_10001000 | Ga0207647_1000100021 | 280 |
| 206 | 3300025909 | Ga0207705_10002892 | Ga0207705_100028925 | 280 |
| 207 | 3300025909 | Ga0207705_10004208 | Ga0207705_1000420812 | 280 |
| 208 | 3300025909 | Ga0207705_10040151 | Ga0207705_100401513 | 280 |
| 209 | 3300025911 | Ga0207654_10111079 | Ga0207654_101110792 | 280 |
| 210 | 3300025912 | Ga0207707_10000064 | Ga0207707_1000006489 | 280 |
| 211 | 3300025912 | Ga0207707_10000750 | Ga0207707_1000075021 | 280 |
| 212 | 3300025912 | Ga0207707_10000846 | Ga0207707_1000084623 | 280 |
| 213 | 3300025912 | Ga0207707_10014211 | Ga0207707_100142116 | 280 |
| 214 | 3300025913 | Ga0207695_10006285 | Ga0207695_100062858 | 280 |
| 215 | 3300025913 | Ga0207695_10011844 | Ga0207695_100118447 | 280 |
| 216 | 3300025913 | Ga0207695_10024286 | Ga0207695_100242866 | 280 |
| 217 | 3300025917 | Ga0207660_10001310 | Ga0207660_100013101 | 280 |
| 218 | 3300025917 | Ga0207660_10011867 | Ga0207660_100118674 | 280 |
| 219 | 3300025917 | Ga0207660_10279193 | Ga0207660_102791932 | 280 |
| 220 | 3300025919 | Ga0207657_10012284 | Ga0207657_100122842 | 280 |
| 221 | 3300025920 | Ga0207649_10005382 | Ga0207649_100053822 | 280 |
| 222 | 3300025920 | Ga0207649_10031029 | Ga0207649_100310292 | 280 |
| 223 | 3300025921 | Ga0207652_10000019 | Ga0207652_1000001965 | 280 |
| 224 | 3300025921 | Ga0207652_10010900 | Ga0207652_100109004 | 280 |
| 225 | 3300025921 | Ga0207652_10012677 | Ga0207652_100126774 | 280 |
| 226 | 3300025924 | Ga0207694_10018861 | Ga0207694_100188612 | 280 |
| 227 | 3300025924 | Ga0207694_10034796 | Ga0207694_100347964 | 280 |
| 228 | 3300025929 | Ga0207664_10001851 | Ga0207664_100018512 | 280 |
| 229 | 3300025932 | Ga0207690_10000982 | Ga0207690_100009824 | 280 |
| 230 | 3300025932 | Ga0207690_10142025 | Ga0207690_101420251 | 280 |
| 231 | 3300025933 | Ga0207706_10006207 | Ga0207706_100062078 | 280 |
| 232 | 3300025933 | Ga0207706_10044351 | Ga0207706_100443512 | 280 |
| 233 | 3300025938 | Ga0207704_10072350 | Ga0207704_100723502 | 280 |
| 234 | 3300025944 | Ga0207661_10004864 | Ga0207661_1000486410 | 280 |
| 235 | 3300025944 | Ga0207661_10073018 | Ga0207661_100730182 | 280 |
| 236 | 3300025945 | Ga0207679_10003088 | Ga0207679_1000308812 | 280 |
| 237 | 3300025949 | Ga0207667_10007992 | Ga0207667_100079924 | 280 |
| 238 | 3300025949 | Ga0207667_10018807 | Ga0207667_100188077 | 280 |
| 239 | 3300025981 | Ga0207640_10006608 | Ga0207640_100066082 | 280 |
| 240 | 3300025981 | Ga0207640_10012249 | Ga0207640_100122492 | 280 |
| 241 | 3300026041 | Ga0207639_10000724 | Ga0207639_100007245 | 280 |
| 242 | 3300026041 | Ga0207639_10006027 | Ga0207639_100060272 | 280 |
| 243 | 3300026067 | Ga0207678_10019574 | Ga0207678_100195742 | 280 |
| 244 | 3300026067 | Ga0207678_10123341 | Ga0207678_101233412 | 280 |
| 245 | 3300026078 | Ga0207702_10009776 | Ga0207702_100097766 | 280 |
| 246 | 3300026078 | Ga0207702_10210069 | Ga0207702_102100692 | 280 |
| 247 | 3300026116 | Ga0207674_10019736 | Ga0207674_100197364 | 280 |
| 248 | 3300026142 | Ga0207698_10001598 | Ga0207698_100015985 | 280 |
| 249 | 3300026142 | Ga0207698_10016187 | Ga0207698_100161872 | 280 |
| 250 | 3300038443 | Ga0395901_0035663 | Ga0395901_0035663_584_1477 | 280 |
| 251 | 3300039437 | Ga0436365_1660443 | Ga0436365_1660443_99_974 | 280 |
| 252 | 3300045976 | Ga0466967_0225688 | Ga0466967_0225688_779_1654 | 280 |
| 253 | 3300048918 | Ga0496115_0000060 | Ga0496115_0000060_52832_53707 | 280 |
| 254 | 3300048929 | Ga0496126_0000253 | Ga0496126_0000253_48260_49135 | 280 |
| 255 | 3300049571 | Ga0501034_0204653 | Ga0501034_0204653_436_1311 | 280 |
| 256 | 3300049586 | Ga0501070_0001427 | Ga0501070_0001427_3905_4798 | 280 |
| 257 | 3300001989 | JGI24739J22299_10050403 | JGI24739J22299_100504031 | 281 |
| 258 | 3300001990 | JGI24737J22298_10011187 | JGI24737J22298_100111872 | 281 |
| 259 | 3300002737 | JGI25162J39368_1001253 | JGI25162J39368_10012531 | 281 |
| 260 | 3300002737 | JGI25162J39368_1001416 | JGI25162J39368_100141611 | 281 |
| 261 | 3300002741 | JGI25157J39369_1001319 | JGI25157J39369_10013192 | 281 |
| 262 | 3300002771 | JGI25163J39215_1000233 | JGI25163J39215_10002334 | 281 |
| 263 | 3300002772 | JGI25164J39214_1000317 | JGI25164J39214_100031710 | 281 |
| 264 | 3300003214 | JGI25165J46597_1000601 | JGI25165J46597_100060111 | 281 |
| 265 | 3300003751 | Ga0055538_1000663 | Ga0055538_10006639 | 281 |
| 266 | 3300003756 | Ga0055533_1000475 | Ga0055533_10004755 | 281 |
| 267 | 3300003761 | Ga0055535_1001158 | Ga0055535_100115813 | 281 |
| 268 | 3300003762 | Ga0055542_1000432 | Ga0055542_100043213 | 281 |
| 269 | 3300003762 | Ga0055542_1000599 | Ga0055542_100059911 | 281 |
| 270 | 3300003763 | Ga0055529_1000961 | Ga0055529_100096111 | 281 |
| 271 | 3300005340 | Ga0070689_100006941 | Ga0070689_1000069414 | 281 |
| 272 | 3300005365 | Ga0070688_100019868 | Ga0070688_1000198681 | 281 |
| 273 | 3300005455 | Ga0070663_100223072 | Ga0070663_1002230722 | 281 |
| 274 | 3300015687 | Ga0183368_1003 | Ga0183368_1003382 | 281 |
| 275 | 3300025224 | Ga0209784_100011 | Ga0209784_100011452 | 281 |
| 276 | 3300025225 | Ga0209566_101090 | Ga0209566_1010904 | 281 |
| 277 | 3300025226 | Ga0209674_100012 | Ga0209674_100012122 | 281 |
| 278 | 3300025228 | Ga0209672_100706 | Ga0209672_1007063 | 281 |
| 279 | 3300025231 | Ga0207427_100026 | Ga0207427_100026340 | 281 |
| 280 | 3300025233 | Ga0209437_100403 | Ga0209437_10040318 | 281 |
| 281 | 3300025233 | Ga0209437_100470 | Ga0209437_10047011 | 281 |
| 282 | 3300025242 | Ga0209258_100027 | Ga0209258_10002795 | 281 |
| 283 | 3300025246 | Ga0209646_1000825 | Ga0209646_10008259 | 281 |
| 284 | 3300025250 | Ga0209026_1000460 | Ga0209026_100046010 | 281 |
| 285 | 3300025250 | Ga0209026_1001381 | Ga0209026_10013817 | 281 |
| 286 | 3300025254 | Ga0209148_1000001 | Ga0209148_1000001833 | 281 |
| 287 | 3300025254 | Ga0209148_1000002 | Ga0209148_1000002941 | 281 |
| 288 | 3300025256 | Ga0209759_1000679 | Ga0209759_100067911 | 281 |
| 289 | 3300025261 | Ga0209233_1000002 | Ga0209233_10000021397 | 281 |
| 290 | 3300025261 | Ga0209233_1018598 | Ga0209233_10185982 | 281 |
| 291 | 3300025272 | Ga0209455_1000019 | Ga0209455_1000019162 | 281 |
| 292 | 3300025936 | Ga0207670_10001748 | Ga0207670_100017487 | 281 |
| 293 | 3300025936 | Ga0207670_10271637 | Ga0207670_102716371 | 281 |
| 294 | 3300026067 | Ga0207678_10084593 | Ga0207678_100845932 | 281 |
| 295 | 3300027876 | Ga0209974_10010484 | Ga0209974_100104842 | 281 |
| 296 | 3300033180 | Ga0307510_10081025 | Ga0307510_100810252 | 281 |
| 297 | 3300033528 | Ga0316588_1014000 | Ga0316588_10140002 | 281 |
| 298 | 3300041460 | Ga0451802_1800814 | Ga0451802_1800814_209_1078 | 281 |
| 299 | 3300046460 | Ga0495638_0066790 | Ga0495638_0066790_57_932 | 281 |
| 300 | 3300046460 | Ga0495638_0070634 | Ga0495638_0070634_57_932 | 281 |
| 301 | 3300046471 | Ga0495650_0000961 | Ga0495650_0000961_12160_13035 | 281 |
| 302 | 3300046507 | Ga0495606_0000113 | Ga0495606_0000113_19811_20686 | 281 |
| 303 | 3300046513 | Ga0495616_0117266 | Ga0495616_0117266_164_1060 | 281 |
| 304 | 3300046516 | Ga0495628_0058034 | Ga0495628_0058034_1456_2361 | 281 |
| 305 | 3300046660 | Ga0495625_0037278 | Ga0495625_0037278_204_1079 | 281 |
| 306 | 3300046694 | Ga0495649_0000784 | Ga0495649_0000784_4840_5715 | 281 |
| 307 | 3300047471 | Ga0495684_0007985 | Ga0495684_0007985_7169_8074 | 281 |
| 308 | 3300048918 | Ga0496115_0000247 | Ga0496115_0000247_20531_21406 | 281 |
| 309 | 3300048918 | Ga0496115_0002188 | Ga0496115_0002188_11926_12801 | 281 |
| 310 | 3300049459 | Ga0495678_067479 | Ga0495678_067479_152_1027 | 281 |
| 311 | 3300005548 | Ga0070665_100000154 | Ga0070665_10000015477 | 282 |
| 312 | 3300005548 | Ga0070665_100001688 | Ga0070665_10000168825 | 282 |
| 313 | 3300006195 | Ga0075366_10001930 | Ga0075366_100019307 | 282 |
| 314 | 3300025298 | Ga0209050_1001666 | Ga0209050_10016663 | 282 |
| 315 | 3300028379 | Ga0268266_10000093 | Ga0268266_10000093107 | 282 |
| 316 | 3300028379 | Ga0268266_10000584 | Ga0268266_1000058416 | 282 |
| 317 | 3300031730 | Ga0307516_10102430 | Ga0307516_101024302 | 282 |
| 318 | 3300048924 | Ga0496121_0018047 | Ga0496121_0018047_5671_6561 | 282 |
| 319 | 3300053079 | Ga0500610_0018754 | Ga0500610_0018754_2158_3030 | 282 |
| 320 | 3300053153 | Ga0500616_0003013 | Ga0500616_0003013_10992_11888 | 282 |
| 321 | 3300053730 | Ga0500645_006858 | Ga0500645_006858_706_1590 | 282 |
| 322 | 3300053739 | Ga0500587_005038 | Ga0500587_005038_603_1499 | 282 |
| 323 | 3300013306 | Ga0163162_10121814 | Ga0163162_101218143 | 283 |
| 324 | 3300013297 | Ga0157378_10191648 | Ga0157378_101916482 | 284 |
| 325 | 3300049824 | Ga0501045_0273219 | Ga0501045_0273219_137_1048 | 284 |
| 326 | 3300009098 | Ga0105245_10279655 | Ga0105245_102796552 | 285 |
| 327 | iso_pu_bacteria | 2740891818 | 2740990744 | 285 |
| 328 | iso_pu_bacteria | 2537561836 | 2538834230 | 286 |
| 329 | iso_pu_bacteria | 2576861471 | 2578457247 | 286 |
| 330 | iso_pu_bacteria | 2593339238 | 2595447846 | 286 |
| 331 | iso_pu_bacteria | 2593339239 | 2595451163 | 286 |
| 332 | iso_pu_bacteria | 2643221562 | 2643831252 | 286 |
| 333 | iso_pu_bacteria | 2643221577 | 2643895656 | 286 |
| 334 | iso_pu_bacteria | 2643221685 | 2644477850 | 286 |
| 335 | iso_pu_bacteria | 2687453130 | 2687584348 | 286 |
| 336 | iso_pu_bacteria | 2718218334 | 2721025989 | 286 |
| 337 | iso_pu_bacteria | 2734482264 | 2735834048 | 286 |
| 338 | iso_pu_bacteria | 2738543009 | 2739225458 | 286 |
| 339 | iso_pu_bacteria | 2747842428 | 2747948363 | 286 |
| 340 | iso_pu_bacteria | 2747842501 | 2748016769 | 286 |
| 341 | iso_pu_bacteria | 2765235840 | 2765580245 | 286 |
| 342 | iso_pu_bacteria | 2816332141 | 2816518727 | 286 |
| 343 | iso_pu_bacteria | 2818991438 | 2819552513 | 286 |
| 344 | iso_pu_bacteria | 2818991440 | 2819565985 | 286 |
| 345 | iso_pu_bacteria | 2818991457 | 2819660951 | 286 |
| 346 | iso_pu_bacteria | 2842391507 | 2842395562 | 286 |
| 347 | iso_pu_bacteria | 2842914999 | 2842917787 | 286 |
| 348 | iso_pu_bacteria | 2852649853 | 2852652369 | 286 |
| 349 | iso_pu_bacteria | 2852684882 | 2852686826 | 286 |
| 350 | iso_pu_bacteria | 2857442823 | 2857445208 | 286 |
| 351 | iso_pu_bacteria | 2874220319 | 2874222922 | 286 |
| 352 | iso_pu_bacteria | 2884338543 | 2884342032 | 286 |
| 353 | iso_pu_bacteria | 2895395659 | 2895397436 | 286 |
| 354 | iso_pu_bacteria | 2904463128 | 2904466256 | 286 |
| 355 | iso_pu_bacteria | 2919085039 | 2919085992 | 286 |
| 356 | iso_pu_bacteria | 2919089067 | 2919092893 | 286 |
| 357 | iso_pu_bacteria | 2919130084 | 2919133980 | 286 |
| 358 | iso_pu_bacteria | 2919134579 | 2919138691 | 286 |
| 359 | iso_pu_bacteria | 2919404418 | 2919408044 | 286 |
| 360 | iso_pu_bacteria | 2919513703 | 2919514991 | 286 |
| 361 | iso_pu_bacteria | 2919675420 | 2919676389 | 286 |
| 362 | iso_pu_bacteria | 2928496128 | 2928499256 | 286 |
| 363 | iso_pu_bacteria | 2929195423 | 2929196631 | 286 |
| 364 | iso_pu_bacteria | 2931380184 | 2931383615 | 286 |
| 365 | iso_pu_bacteria | 2937610967 | 2937614886 | 286 |
| 366 | iso_pu_bacteria | 2939589442 | 2939589537 | 286 |
| 367 | iso_pu_bacteria | 2939611941 | 2939614917 | 286 |
| 368 | iso_pu_bacteria | 2939626828 | 2939630563 | 286 |
| 369 | iso_pu_bacteria | 2941471342 | 2941474036 | 286 |
| 370 | iso_pu_bacteria | 2941475908 | 2941478989 | 286 |
| 371 | iso_pu_bacteria | 2961047084 | 2961049687 | 286 |
| 372 | iso_pu_bacteria | 2961064222 | 2961066636 | 286 |
| 373 | iso_pu_bacteria | 2974307012 | 2974307889 | 286 |
| 374 | iso_pu_bacteria | 2977247770 | 2977248625 | 286 |
| 375 | iso_pu_bacteria | 2984514374 | 2984516906 | 286 |
| 376 | iso_pu_bacteria | 2987605356 | 2987608508 | 286 |
| 377 | iso_pu_bacteria | 8021622325 | 8021625112 | 286 |
| 378 | iso_pu_bacteria | 8021626552 | 8021627800 | 286 |
| 379 | iso_pu_bacteria | 8021648035 | 8021649443 | 286 |
| 380 | iso_pu_bacteria | 2643221579 | 2643905357 | 287 |
| 381 | iso_pu_bacteria | 2643221581 | 2643915040 | 287 |
| 382 | iso_pu_bacteria | 2739367700 | 2739732452 | 287 |
| 383 | iso_pu_bacteria | 2842918807 | 2842922040 | 287 |
| 384 | iso_pu_bacteria | 2884411467 | 2884412516 | 287 |
| 385 | iso_pu_bacteria | 2923516293 | 2923517470 | 287 |
| 386 | iso_pu_bacteria | 2928963466 | 2928965137 | 287 |
| 387 | iso_pu_bacteria | 2953994433 | 2953997150 | 287 |
| 388 | 3300014969 | Ga0157376_10084869 | Ga0157376_100848693 | 288 |
| 389 | 3300025885 | Ga0207653_10052734 | Ga0207653_100527342 | 288 |
| 390 | 3300003659 | JGI25404J52841_10029262 | JGI25404J52841_100292621 | 289 |
| 391 | 3300005329 | Ga0070683_100251255 | Ga0070683_1002512552 | 289 |
| 392 | 3300005366 | Ga0070659_100021635 | Ga0070659_1000216352 | 289 |
| 393 | 3300005436 | Ga0070713_100000055 | Ga0070713_10000005560 | 289 |
| 394 | 3300005539 | Ga0068853_100032467 | Ga0068853_1000324673 | 289 |
| 395 | 3300005563 | Ga0068855_100024007 | Ga0068855_1000240074 | 289 |
| 396 | 3300005563 | Ga0068855_100095437 | Ga0068855_1000954371 | 289 |
| 397 | 3300005578 | Ga0068854_100023245 | Ga0068854_1000232454 | 289 |
| 398 | 3300005834 | Ga0068851_10000296 | Ga0068851_100002962 | 289 |
| 399 | 3300005983 | Ga0081540_1000271 | Ga0081540_100027146 | 289 |
| 400 | 3300009098 | Ga0105245_10000012 | Ga0105245_10000012256 | 289 |
| 401 | 3300009098 | Ga0105245_10051880 | Ga0105245_100518802 | 289 |
| 402 | 3300009177 | Ga0105248_10000022 | Ga0105248_10000022210 | 289 |
| 403 | 3300013307 | Ga0157372_10008020 | Ga0157372_100080205 | 289 |
| 404 | 3300013307 | Ga0157372_10457316 | Ga0157372_104573162 | 289 |
| 405 | 3300025303 | Ga0209051_1022652 | Ga0209051_10226522 | 289 |
| 406 | 3300025321 | Ga0207656_10000273 | Ga0207656_1000027314 | 289 |
| 407 | 3300025909 | Ga0207705_10069872 | Ga0207705_100698722 | 289 |
| 408 | 3300025927 | Ga0207687_10000011 | Ga0207687_10000011310 | 289 |
| 409 | 3300025927 | Ga0207687_10011977 | Ga0207687_100119772 | 289 |
| 410 | 3300025928 | Ga0207700_10000009 | Ga0207700_10000009255 | 289 |
| 411 | 3300025932 | Ga0207690_10003034 | Ga0207690_100030342 | 289 |
| 412 | 3300025941 | Ga0207711_10000019 | Ga0207711_10000019129 | 289 |
| 413 | 3300025949 | Ga0207667_10019090 | Ga0207667_100190903 | 289 |
| 414 | 3300025949 | Ga0207667_10105973 | Ga0207667_101059732 | 289 |
| 415 | 3300025981 | Ga0207640_10000059 | Ga0207640_100000594 | 289 |
| 416 | 3300026041 | Ga0207639_10021958 | Ga0207639_100219583 | 289 |
| 417 | 3300026041 | Ga0207639_10022666 | Ga0207639_100226663 | 289 |
| 418 | 3300028379 | Ga0268266_10063996 | Ga0268266_100639963 | 289 |
| 419 | 3300031733 | Ga0316577_10069180 | Ga0316577_100691801 | 289 |
| 420 | 3300036647 | Ga0316582_0108121 | Ga0316582_0108121_287_1162 | 289 |
| 421 | 3300037466 | Ga0395898_0249684 | Ga0395898_0249684_684_1595 | 289 |
| 422 | 3300044842 | Ga0466957_0007712 | Ga0466957_0007712_5079_5954 | 289 |
| 423 | 3300046459 | Ga0495629_0000028 | Ga0495629_0000028_5828_6703 | 289 |
| 424 | 3300046461 | Ga0495641_0000012 | Ga0495641_0000012_49029_49904 | 289 |
| 425 | 3300046461 | Ga0495641_0182027 | Ga0495641_0182027_15_890 | 289 |
| 426 | 3300046507 | Ga0495606_0000219 | Ga0495606_0000219_84933_85808 | 289 |
| 427 | 3300046511 | Ga0495608_0000001 | Ga0495608_0000001_276462_277337 | 289 |
| 428 | 3300046515 | Ga0495620_0000060 | Ga0495620_0000060_78401_79276 | 289 |
| 429 | 3300046517 | Ga0495630_0000227 | Ga0495630_0000227_11035_11910 | 289 |
| 430 | 3300046675 | Ga0495657_0000002 | Ga0495657_0000002_277142_278017 | 289 |
| 431 | 3300046681 | Ga0495647_0000053 | Ga0495647_0000053_14202_15077 | 289 |
| 432 | 3300046689 | Ga0495613_0000242 | Ga0495613_0000242_21786_22661 | 289 |
| 433 | 3300046690 | Ga0495624_0000419 | Ga0495624_0000419_15971_16846 | 289 |
| 434 | 3300046694 | Ga0495649_0002630 | Ga0495649_0002630_5784_6659 | 289 |
| 435 | 3300046809 | Ga0495600_0037710 | Ga0495600_0037710_423_1298 | 289 |
| 436 | 3300047317 | Ga0495604_0001604 | Ga0495604_0001604_12367_13242 | 289 |
| 437 | 3300047317 | Ga0495604_0098791 | Ga0495604_0098791_1196_2071 | 289 |
| 438 | 3300047321 | Ga0495676_0001744 | Ga0495676_0001744_10172_11110 | 289 |
| 439 | 3300047444 | Ga0495675_0000162 | Ga0495675_0000162_33840_34715 | 289 |
| 440 | 3300048088 | Ga0495602_0000063 | Ga0495602_0000063_13726_14601 | 289 |
| 441 | 3300048911 | Ga0496108_0000012 | Ga0496108_0000012_228891_229766 | 289 |
| 442 | 3300048912 | Ga0496109_0000246 | Ga0496109_0000246_3629_4504 | 289 |
| 443 | 3300048913 | Ga0496110_0362131 | Ga0496110_0362131_229_1104 | 289 |
| 444 | 3300048914 | Ga0496111_0015604 | Ga0496111_0015604_3952_4827 | 289 |
| 445 | 3300048916 | Ga0496113_0147556 | Ga0496113_0147556_384_1259 | 289 |
| 446 | 3300048917 | Ga0496114_0115480 | Ga0496114_0115480_924_1796 | 289 |
| 447 | 3300048917 | Ga0496114_0246557 | Ga0496114_0246557_234_1109 | 289 |
| 448 | 3300048918 | Ga0496115_0000004 | Ga0496115_0000004_166682_167557 | 289 |
| 449 | 3300049569 | Ga0501032_0009348 | Ga0501032_0009348_24_893 | 289 |
| 450 | 3300049571 | Ga0501034_0005729 | Ga0501034_0005729_11795_12664 | 289 |
| 451 | 3300049572 | Ga0501036_0032187 | Ga0501036_0032187_1533_2402 | 289 |
| 452 | 3300049573 | Ga0501037_0002431 | Ga0501037_0002431_1526_2395 | 289 |
| 453 | 3300049574 | Ga0501038_0005383 | Ga0501038_0005383_755_1624 | 289 |
| 454 | 3300049579 | Ga0501043_0088370 | Ga0501043_0088370_939_1808 | 289 |
| 455 | 3300049580 | Ga0501046_0007493 | Ga0501046_0007493_2076_2945 | 289 |
| 456 | 3300049581 | Ga0501047_0018198 | Ga0501047_0018198_660_1529 | 289 |
| 457 | 3300049581 | Ga0501047_0437589 | Ga0501047_0437589_136_1011 | 289 |
| 458 | 3300049586 | Ga0501070_0062366 | Ga0501070_0062366_717_1592 | 289 |
| 459 | 3300049822 | Ga0501035_0070197 | Ga0501035_0070197_33_902 | 289 |
| 460 | 3300053077 | Ga0495601_0000281 | Ga0495601_0000281_497_1372 | 289 |
| 461 | 3300053084 | Ga0495595_0000001 | Ga0495595_0000001_133942_134817 | 289 |
| 462 | 3300053085 | Ga0495619_0000708 | Ga0495619_0000708_12885_13760 | 289 |
| 463 | 3300053123 | Ga0500614_001872 | Ga0500614_001872_2940_3815 | 289 |
| 464 | 3300054114 | Ga0501084_0089267 | Ga0501084_0089267_1689_2570 | 289 |
| 465 | 3300001904 | JGI24736J21556_1000372 | JGI24736J21556_10003724 | 290 |
| 466 | 3300001915 | JGI24741J21665_1002943 | JGI24741J21665_10029433 | 290 |
| 467 | 3300001979 | JGI24740J21852_10004561 | JGI24740J21852_100045615 | 290 |
| 468 | 3300001989 | JGI24739J22299_10010039 | JGI24739J22299_100100392 | 290 |
| 469 | 3300001990 | JGI24737J22298_10009746 | JGI24737J22298_100097463 | 290 |
| 470 | 3300002067 | JGI24735J21928_10004119 | JGI24735J21928_100041193 | 290 |
| 471 | 3300002737 | JGI25162J39368_1001109 | JGI25162J39368_10011096 | 290 |
| 472 | 3300002737 | JGI25162J39368_1005737 | JGI25162J39368_10057372 | 290 |
| 473 | 3300002738 | JGI25154J39366_1006558 | JGI25154J39366_10065581 | 290 |
| 474 | 3300002772 | JGI25164J39214_1000030 | JGI25164J39214_100003033 | 290 |
| 475 | 3300003214 | JGI25165J46597_1000057 | JGI25165J46597_100005793 | 290 |
| 476 | 3300003479 | Ga0006556J51387_1026971 | Ga0006556J51387_10269712 | 290 |
| 477 | 3300003567 | Ga0006554J51385_1022122 | Ga0006554J51385_10221222 | 290 |
| 478 | 3300003578 | Ga0006562J51391_1068853 | Ga0006562J51391_10688535 | 290 |
| 479 | 3300003578 | Ga0006562J51391_1068854 | Ga0006562J51391_10688541 | 290 |
| 480 | 3300003756 | Ga0055533_1007185 | Ga0055533_10071851 | 290 |
| 481 | 3300003773 | Ga0055537_1000210 | Ga0055537_100021026 | 290 |
| 482 | 3300003775 | Ga0055524_1016435 | Ga0055524_10164352 | 290 |
| 483 | 3300003781 | Ga0055536_1006384 | Ga0055536_10063842 | 290 |
| 484 | 3300003784 | Ga0055534_1000276 | Ga0055534_100027621 | 290 |
| 485 | 3300003790 | Ga0055528_1000121 | Ga0055528_10001213 | 290 |
| 486 | 3300003794 | Ga0055531_10012029 | Ga0055531_100120291 | 290 |
| 487 | 3300003794 | Ga0055531_10025591 | Ga0055531_100255913 | 290 |
| 488 | 3300003856 | Ga0058692_1000013 | Ga0058692_100001334 | 290 |
| 489 | 3300003856 | Ga0058692_1000033 | Ga0058692_100003314 | 290 |
| 490 | 3300005262 | Ga0065165_1000201 | Ga0065165_100020154 | 290 |
| 491 | 3300005289 | Ga0065704_10153275 | Ga0065704_101532752 | 290 |
| 492 | 3300005327 | Ga0070658_10020121 | Ga0070658_100201213 | 290 |
| 493 | 3300005328 | Ga0070676_10000019 | Ga0070676_1000001933 | 290 |
| 494 | 3300005329 | Ga0070683_100006950 | Ga0070683_1000069506 | 290 |
| 495 | 3300005329 | Ga0070683_100032813 | Ga0070683_1000328133 | 290 |
| 496 | 3300005329 | Ga0070683_100242923 | Ga0070683_1002429231 | 290 |
| 497 | 3300005330 | Ga0070690_100000062 | Ga0070690_10000006233 | 290 |
| 498 | 3300005331 | Ga0070670_100003783 | Ga0070670_10000378311 | 290 |
| 499 | 3300005334 | Ga0068869_100001311 | Ga0068869_10000131111 | 290 |
| 500 | 3300005334 | Ga0068869_100231768 | Ga0068869_1002317682 | 290 |
| 501 | 3300005335 | Ga0070666_10000037 | Ga0070666_1000003774 | 290 |
| 502 | 3300005337 | Ga0070682_100070382 | Ga0070682_1000703823 | 290 |
| 503 | 3300005338 | Ga0068868_100000002 | Ga0068868_100000002159 | 290 |
| 504 | 3300005338 | Ga0068868_100089278 | Ga0068868_1000892783 | 290 |
| 505 | 3300005339 | Ga0070660_100000539 | Ga0070660_1000005399 | 290 |
| 506 | 3300005339 | Ga0070660_100077659 | Ga0070660_1000776593 | 290 |
| 507 | 3300005339 | Ga0070660_100219938 | Ga0070660_1002199382 | 290 |
| 508 | 3300005340 | Ga0070689_100000206 | Ga0070689_10000020633 | 290 |
| 509 | 3300005343 | Ga0070687_100001583 | Ga0070687_1000015832 | 290 |
| 510 | 3300005344 | Ga0070661_100000194 | Ga0070661_10000019445 | 290 |
| 511 | 3300005344 | Ga0070661_100001553 | Ga0070661_10000155312 | 290 |
| 512 | 3300005344 | Ga0070661_100071088 | Ga0070661_1000710883 | 290 |
| 513 | 3300005347 | Ga0070668_100000813 | Ga0070668_1000008134 | 290 |
| 514 | 3300005347 | Ga0070668_100021628 | Ga0070668_1000216282 | 290 |
| 515 | 3300005353 | Ga0070669_100000294 | Ga0070669_1000002942 | 290 |
| 516 | 3300005354 | Ga0070675_100000104 | Ga0070675_10000010413 | 290 |
| 517 | 3300005356 | Ga0070674_100000045 | Ga0070674_10000004537 | 290 |
| 518 | 3300005364 | Ga0070673_100005351 | Ga0070673_1000053513 | 290 |
| 519 | 3300005365 | Ga0070688_100000668 | Ga0070688_1000006683 | 290 |
| 520 | 3300005366 | Ga0070659_100000029 | Ga0070659_100000029103 | 290 |
| 521 | 3300005366 | Ga0070659_100000112 | Ga0070659_10000011241 | 290 |
| 522 | 3300005367 | Ga0070667_100000102 | Ga0070667_10000010271 | 290 |
| 523 | 3300005367 | Ga0070667_100025660 | Ga0070667_1000256603 | 290 |
| 524 | 3300005367 | Ga0070667_100196355 | Ga0070667_1001963552 | 290 |
| 525 | 3300005367 | Ga0070667_100288958 | Ga0070667_1002889582 | 290 |
| 526 | 3300005435 | Ga0070714_100021967 | Ga0070714_1000219674 | 290 |
| 527 | 3300005436 | Ga0070713_100459128 | Ga0070713_1004591282 | 290 |
| 528 | 3300005438 | Ga0070701_10001321 | Ga0070701_100013215 | 290 |
| 529 | 3300005440 | Ga0070705_100000656 | Ga0070705_10000065617 | 290 |
| 530 | 3300005455 | Ga0070663_100003975 | Ga0070663_1000039753 | 290 |
| 531 | 3300005455 | Ga0070663_100068877 | Ga0070663_1000688773 | 290 |
| 532 | 3300005455 | Ga0070663_100187385 | Ga0070663_1001873852 | 290 |
| 533 | 3300005456 | Ga0070678_100011266 | Ga0070678_1000112664 | 290 |
| 534 | 3300005457 | Ga0070662_100001839 | Ga0070662_1000018393 | 290 |
| 535 | 3300005459 | Ga0068867_100093916 | Ga0068867_1000939163 | 290 |
| 536 | 3300005466 | Ga0070685_10000264 | Ga0070685_1000026430 | 290 |
| 537 | 3300005530 | Ga0070679_100100781 | Ga0070679_1001007812 | 290 |
| 538 | 3300005535 | Ga0070684_100284771 | Ga0070684_1002847712 | 290 |
| 539 | 3300005539 | Ga0068853_100007490 | Ga0068853_1000074908 | 290 |
| 540 | 3300005539 | Ga0068853_100124983 | Ga0068853_1001249833 | 290 |
| 541 | 3300005539 | Ga0068853_100236550 | Ga0068853_1002365501 | 290 |
| 542 | 3300005539 | Ga0068853_100323764 | Ga0068853_1003237642 | 290 |
| 543 | 3300005543 | Ga0070672_100000051 | Ga0070672_10000005115 | 290 |
| 544 | 3300005544 | Ga0070686_100006277 | Ga0070686_1000062778 | 290 |
| 545 | 3300005545 | Ga0070695_100031546 | Ga0070695_1000315462 | 290 |
| 546 | 3300005546 | Ga0070696_100238707 | Ga0070696_1002387071 | 290 |
| 547 | 3300005547 | Ga0070693_100000849 | Ga0070693_10000084911 | 290 |
| 548 | 3300005548 | Ga0070665_100000092 | Ga0070665_10000009285 | 290 |
| 549 | 3300005548 | Ga0070665_100154396 | Ga0070665_1001543963 | 290 |
| 550 | 3300005563 | Ga0068855_100000331 | Ga0068855_10000033137 | 290 |
| 551 | 3300005563 | Ga0068855_100065071 | Ga0068855_1000650713 | 290 |
| 552 | 3300005564 | Ga0070664_100000273 | Ga0070664_10000027311 | 290 |
| 553 | 3300005564 | Ga0070664_100046093 | Ga0070664_1000460933 | 290 |
| 554 | 3300005564 | Ga0070664_100266445 | Ga0070664_1002664452 | 290 |
| 555 | 3300005577 | Ga0068857_100052691 | Ga0068857_1000526913 | 290 |
| 556 | 3300005577 | Ga0068857_100053896 | Ga0068857_1000538964 | 290 |
| 557 | 3300005577 | Ga0068857_100055324 | Ga0068857_1000553243 | 290 |
| 558 | 3300005577 | Ga0068857_100074753 | Ga0068857_1000747532 | 290 |
| 559 | 3300005578 | Ga0068854_100000084 | Ga0068854_1000000847 | 290 |
| 560 | 3300005578 | Ga0068854_100011358 | Ga0068854_1000113584 | 290 |
| 561 | 3300005614 | Ga0068856_100007033 | Ga0068856_1000070332 | 290 |
| 562 | 3300005614 | Ga0068856_100125991 | Ga0068856_1001259911 | 290 |
| 563 | 3300005614 | Ga0068856_100184413 | Ga0068856_1001844132 | 290 |
| 564 | 3300005616 | Ga0068852_100000125 | Ga0068852_10000012535 | 290 |
| 565 | 3300005616 | Ga0068852_100299682 | Ga0068852_1002996822 | 290 |
| 566 | 3300005617 | Ga0068859_100005779 | Ga0068859_10000577911 | 290 |
| 567 | 3300005718 | Ga0068866_10033926 | Ga0068866_100339263 | 290 |
| 568 | 3300005719 | Ga0068861_100000212 | Ga0068861_10000021211 | 290 |
| 569 | 3300005834 | Ga0068851_10006888 | Ga0068851_100068884 | 290 |
| 570 | 3300005840 | Ga0068870_10000270 | Ga0068870_1000027015 | 290 |
| 571 | 3300005841 | Ga0068863_100003408 | Ga0068863_10000340814 | 290 |
| 572 | 3300005842 | Ga0068858_100115444 | Ga0068858_1001154442 | 290 |
| 573 | 3300005842 | Ga0068858_100137002 | Ga0068858_1001370023 | 290 |
| 574 | 3300005843 | Ga0068860_100008370 | Ga0068860_1000083702 | 290 |
| 575 | 3300005843 | Ga0068860_100039323 | Ga0068860_1000393232 | 290 |
| 576 | 3300005843 | Ga0068860_100091046 | Ga0068860_1000910462 | 290 |
| 577 | 3300005843 | Ga0068860_100314870 | Ga0068860_1003148701 | 290 |
| 578 | 3300005844 | Ga0068862_100003864 | Ga0068862_1000038643 | 290 |
| 579 | 3300005983 | Ga0081540_1001028 | Ga0081540_10010285 | 290 |
| 580 | 3300005983 | Ga0081540_1004991 | Ga0081540_10049918 | 290 |
| 581 | 3300005983 | Ga0081540_1007399 | Ga0081540_10073992 | 290 |
| 582 | 3300005985 | Ga0081539_10043946 | Ga0081539_100439462 | 290 |
| 583 | 3300006186 | Ga0075369_10104623 | Ga0075369_101046232 | 290 |
| 584 | 3300006358 | Ga0068871_100126293 | Ga0068871_1001262933 | 290 |
| 585 | 3300006844 | Ga0075428_100142370 | Ga0075428_1001423701 | 290 |
| 586 | 3300006881 | Ga0068865_100072891 | Ga0068865_1000728913 | 290 |
| 587 | 3300006931 | Ga0097620_100005779 | Ga0097620_1000057793 | 290 |
| 588 | 3300009011 | Ga0105251_10026384 | Ga0105251_100263841 | 290 |
| 589 | 3300009093 | Ga0105240_10004295 | Ga0105240_1000429517 | 290 |
| 590 | 3300009094 | Ga0111539_10196364 | Ga0111539_101963643 | 290 |
| 591 | 3300009098 | Ga0105245_10000233 | Ga0105245_1000023340 | 290 |
| 592 | 3300009101 | Ga0105247_10000321 | Ga0105247_1000032116 | 290 |
| 593 | 3300009101 | Ga0105247_10026871 | Ga0105247_100268713 | 290 |
| 594 | 3300009148 | Ga0105243_10003969 | Ga0105243_100039694 | 290 |
| 595 | 3300009148 | Ga0105243_10005321 | Ga0105243_100053215 | 290 |
| 596 | 3300009174 | Ga0105241_10017112 | Ga0105241_100171124 | 290 |
| 597 | 3300009176 | Ga0105242_10014473 | Ga0105242_100144738 | 290 |
| 598 | 3300009176 | Ga0105242_10104859 | Ga0105242_101048592 | 290 |
| 599 | 3300009177 | Ga0105248_10014599 | Ga0105248_100145993 | 290 |
| 600 | 3300009177 | Ga0105248_10033425 | Ga0105248_100334254 | 290 |
| 601 | 3300009545 | Ga0105237_10000549 | Ga0105237_1000054947 | 290 |
| 602 | 3300009545 | Ga0105237_10002875 | Ga0105237_100028759 | 290 |
| 603 | 3300009545 | Ga0105237_10134869 | Ga0105237_101348693 | 290 |
| 604 | 3300009551 | Ga0105238_10000154 | Ga0105238_1000015448 | 290 |
| 605 | 3300009551 | Ga0105238_10000805 | Ga0105238_1000080516 | 290 |
| 606 | 3300009551 | Ga0105238_10430241 | Ga0105238_104302412 | 290 |
| 607 | 3300009553 | Ga0105249_10000265 | Ga0105249_1000026515 | 290 |
| 608 | 3300009553 | Ga0105249_10000533 | Ga0105249_1000053338 | 290 |
| 609 | 3300010375 | Ga0105239_10000174 | Ga0105239_1000017413 | 290 |
| 610 | 3300010375 | Ga0105239_10002920 | Ga0105239_100029205 | 290 |
| 611 | 3300010375 | Ga0105239_10030730 | Ga0105239_100307306 | 290 |
| 612 | 3300011119 | Ga0105246_10001791 | Ga0105246_100017916 | 290 |
| 613 | 3300013100 | Ga0157373_10003504 | Ga0157373_1000350411 | 290 |
| 614 | 3300013102 | Ga0157371_10000351 | Ga0157371_1000035115 | 290 |
| 615 | 3300013105 | Ga0157369_10000829 | Ga0157369_1000082917 | 290 |
| 616 | 3300013105 | Ga0157369_10001552 | Ga0157369_1000155221 | 290 |
| 617 | 3300013105 | Ga0157369_10003652 | Ga0157369_1000365213 | 290 |
| 618 | 3300013105 | Ga0157369_10143836 | Ga0157369_101438362 | 290 |
| 619 | 3300013296 | Ga0157374_10001656 | Ga0157374_1000165614 | 290 |
| 620 | 3300013297 | Ga0157378_10004285 | Ga0157378_100042858 | 290 |
| 621 | 3300013306 | Ga0163162_10000647 | Ga0163162_1000064713 | 290 |
| 622 | 3300013306 | Ga0163162_10002285 | Ga0163162_100022855 | 290 |
| 623 | 3300013307 | Ga0157372_10000403 | Ga0157372_1000040313 | 290 |
| 624 | 3300013307 | Ga0157372_10012371 | Ga0157372_100123717 | 290 |
| 625 | 3300013307 | Ga0157372_10121202 | Ga0157372_101212023 | 290 |
| 626 | 3300013307 | Ga0157372_10121718 | Ga0157372_101217182 | 290 |
| 627 | 3300014325 | Ga0163163_10276924 | Ga0163163_102769241 | 290 |
| 628 | 3300014968 | Ga0157379_10001292 | Ga0157379_100012925 | 290 |
| 629 | 3300014969 | Ga0157376_10023151 | Ga0157376_100231514 | 290 |
| 630 | 3300015261 | Ga0182006_1000061 | Ga0182006_100006110 | 290 |
| 631 | 3300015261 | Ga0182006_1071795 | Ga0182006_10717952 | 290 |
| 632 | 3300015262 | Ga0182007_10006307 | Ga0182007_100063075 | 290 |
| 633 | 3300015685 | Ga0183369_1013 | Ga0183369_101331 | 290 |
| 634 | 3300017792 | Ga0163161_10025691 | Ga0163161_100256913 | 290 |
| 635 | 3300017792 | Ga0163161_10068249 | Ga0163161_100682492 | 290 |
| 636 | 3300025226 | Ga0209674_100427 | Ga0209674_1004277 | 290 |
| 637 | 3300025228 | Ga0209672_100124 | Ga0209672_1001241 | 290 |
| 638 | 3300025229 | Ga0209147_103557 | Ga0209147_1035572 | 290 |
| 639 | 3300025231 | Ga0207427_100053 | Ga0207427_10005392 | 290 |
| 640 | 3300025233 | Ga0209437_100108 | Ga0209437_10010891 | 290 |
| 641 | 3300025233 | Ga0209437_102459 | Ga0209437_1024592 | 290 |
| 642 | 3300025242 | Ga0209258_100055 | Ga0209258_10005573 | 290 |
| 643 | 3300025250 | Ga0209026_1000548 | Ga0209026_10005489 | 290 |
| 644 | 3300025254 | Ga0209148_1000058 | Ga0209148_1000058198 | 290 |
| 645 | 3300025254 | Ga0209148_1002891 | Ga0209148_10028914 | 290 |
| 646 | 3300025256 | Ga0209759_1000674 | Ga0209759_10006747 | 290 |
| 647 | 3300025258 | Ga0209129_1000678 | Ga0209129_100067815 | 290 |
| 648 | 3300025261 | Ga0209233_1000125 | Ga0209233_100012592 | 290 |
| 649 | 3300025263 | Ga0209565_1000023 | Ga0209565_1000023152 | 290 |
| 650 | 3300025272 | Ga0209455_1000018 | Ga0209455_1000018198 | 290 |
| 651 | 3300025273 | Ga0209673_1000116 | Ga0209673_1000116138 | 290 |
| 652 | 3300025284 | Ga0209130_1006082 | Ga0209130_10060822 | 290 |
| 653 | 3300025291 | Ga0209675_1000016 | Ga0209675_1000016258 | 290 |
| 654 | 3300025292 | Ga0209676_1000037 | Ga0209676_1000037226 | 290 |
| 655 | 3300025292 | Ga0209676_1000770 | Ga0209676_100077029 | 290 |
| 656 | 3300025292 | Ga0209676_1001488 | Ga0209676_100148816 | 290 |
| 657 | 3300025295 | Ga0209564_1000347 | Ga0209564_100034749 | 290 |
| 658 | 3300025297 | Ga0209758_1011282 | Ga0209758_10112825 | 290 |
| 659 | 3300025303 | Ga0209051_1002629 | Ga0209051_10026292 | 290 |
| 660 | 3300025304 | Ga0209257_1000067 | Ga0209257_1000067176 | 290 |
| 661 | 3300025304 | Ga0209257_1000868 | Ga0209257_10008682 | 290 |
| 662 | 3300025304 | Ga0209257_1021765 | Ga0209257_10217652 | 290 |
| 663 | 3300025321 | Ga0207656_10003921 | Ga0207656_100039214 | 290 |
| 664 | 3300025321 | Ga0207656_10164515 | Ga0207656_101645152 | 290 |
| 665 | 3300025735 | Ga0207713_1021190 | Ga0207713_10211903 | 290 |
| 666 | 3300025899 | Ga0207642_10000233 | Ga0207642_100002334 | 290 |
| 667 | 3300025900 | Ga0207710_10000918 | Ga0207710_1000091812 | 290 |
| 668 | 3300025900 | Ga0207710_10013427 | Ga0207710_100134273 | 290 |
| 669 | 3300025901 | Ga0207688_10000282 | Ga0207688_1000028211 | 290 |
| 670 | 3300025903 | Ga0207680_10000001 | Ga0207680_10000001378 | 290 |
| 671 | 3300025904 | Ga0207647_10000016 | Ga0207647_1000001628 | 290 |
| 672 | 3300025904 | Ga0207647_10003471 | Ga0207647_100034719 | 290 |
| 673 | 3300025907 | Ga0207645_10000043 | Ga0207645_1000004341 | 290 |
| 674 | 3300025908 | Ga0207643_10000024 | Ga0207643_1000002415 | 290 |
| 675 | 3300025909 | Ga0207705_10007515 | Ga0207705_100075156 | 290 |
| 676 | 3300025909 | Ga0207705_10030729 | Ga0207705_100307292 | 290 |
| 677 | 3300025912 | Ga0207707_10047546 | Ga0207707_100475463 | 290 |
| 678 | 3300025912 | Ga0207707_10096162 | Ga0207707_100961622 | 290 |
| 679 | 3300025913 | Ga0207695_10014502 | Ga0207695_100145024 | 290 |
| 680 | 3300025913 | Ga0207695_10072195 | Ga0207695_100721953 | 290 |
| 681 | 3300025914 | Ga0207671_10083783 | Ga0207671_100837832 | 290 |
| 682 | 3300025914 | Ga0207671_10100320 | Ga0207671_101003202 | 290 |
| 683 | 3300025917 | Ga0207660_10020370 | Ga0207660_100203702 | 290 |
| 684 | 3300025918 | Ga0207662_10000789 | Ga0207662_100007896 | 290 |
| 685 | 3300025919 | Ga0207657_10000655 | Ga0207657_1000065532 | 290 |
| 686 | 3300025919 | Ga0207657_10001536 | Ga0207657_1000153614 | 290 |
| 687 | 3300025919 | Ga0207657_10070181 | Ga0207657_100701813 | 290 |
| 688 | 3300025919 | Ga0207657_10128646 | Ga0207657_101286462 | 290 |
| 689 | 3300025920 | Ga0207649_10000764 | Ga0207649_100007642 | 290 |
| 690 | 3300025920 | Ga0207649_10007176 | Ga0207649_100071762 | 290 |
| 691 | 3300025920 | Ga0207649_10016143 | Ga0207649_100161432 | 290 |
| 692 | 3300025920 | Ga0207649_10136861 | Ga0207649_101368612 | 290 |
| 693 | 3300025921 | Ga0207652_10067861 | Ga0207652_100678613 | 290 |
| 694 | 3300025925 | Ga0207650_10000253 | Ga0207650_1000025318 | 290 |
| 695 | 3300025925 | Ga0207650_10033150 | Ga0207650_100331502 | 290 |
| 696 | 3300025926 | Ga0207659_10000881 | Ga0207659_100008815 | 290 |
| 697 | 3300025931 | Ga0207644_10001751 | Ga0207644_1000175112 | 290 |
| 698 | 3300025932 | Ga0207690_10000004 | Ga0207690_10000004690 | 290 |
| 699 | 3300025932 | Ga0207690_10030339 | Ga0207690_100303392 | 290 |
| 700 | 3300025932 | Ga0207690_10056854 | Ga0207690_100568542 | 290 |
| 701 | 3300025932 | Ga0207690_10098108 | Ga0207690_100981081 | 290 |
| 702 | 3300025933 | Ga0207706_10003011 | Ga0207706_1000301114 | 290 |
| 703 | 3300025933 | Ga0207706_10069767 | Ga0207706_100697673 | 290 |
| 704 | 3300025935 | Ga0207709_10001141 | Ga0207709_1000114112 | 290 |
| 705 | 3300025935 | Ga0207709_10131964 | Ga0207709_101319642 | 290 |
| 706 | 3300025936 | Ga0207670_10000579 | Ga0207670_100005794 | 290 |
| 707 | 3300025938 | Ga0207704_10002349 | Ga0207704_100023493 | 290 |
| 708 | 3300025940 | Ga0207691_10000053 | Ga0207691_1000005332 | 290 |
| 709 | 3300025940 | Ga0207691_10285074 | Ga0207691_102850742 | 290 |
| 710 | 3300025941 | Ga0207711_10000276 | Ga0207711_1000027619 | 290 |
| 711 | 3300025941 | Ga0207711_10008039 | Ga0207711_100080393 | 290 |
| 712 | 3300025942 | Ga0207689_10000026 | Ga0207689_1000002652 | 290 |
| 713 | 3300025942 | Ga0207689_10150160 | Ga0207689_101501602 | 290 |
| 714 | 3300025944 | Ga0207661_10027762 | Ga0207661_100277622 | 290 |
| 715 | 3300025944 | Ga0207661_10079286 | Ga0207661_100792862 | 290 |
| 716 | 3300025945 | Ga0207679_10012138 | Ga0207679_100121383 | 290 |
| 717 | 3300025949 | Ga0207667_10138174 | Ga0207667_101381743 | 290 |
| 718 | 3300025949 | Ga0207667_10177590 | Ga0207667_101775902 | 290 |
| 719 | 3300025960 | Ga0207651_10006649 | Ga0207651_100066492 | 290 |
| 720 | 3300025961 | Ga0207712_10000450 | Ga0207712_1000045039 | 290 |
| 721 | 3300025961 | Ga0207712_10001588 | Ga0207712_100015885 | 290 |
| 722 | 3300025972 | Ga0207668_10007821 | Ga0207668_100078215 | 290 |
| 723 | 3300025972 | Ga0207668_10177597 | Ga0207668_101775972 | 290 |
| 724 | 3300025981 | Ga0207640_10030683 | Ga0207640_100306832 | 290 |
| 725 | 3300025986 | Ga0207658_10000112 | Ga0207658_1000011268 | 290 |
| 726 | 3300025986 | Ga0207658_10000422 | Ga0207658_1000042233 | 290 |
| 727 | 3300025986 | Ga0207658_10018176 | Ga0207658_100181762 | 290 |
| 728 | 3300026023 | Ga0207677_10000080 | Ga0207677_1000008047 | 290 |
| 729 | 3300026023 | Ga0207677_10000185 | Ga0207677_1000018511 | 290 |
| 730 | 3300026035 | Ga0207703_10000059 | Ga0207703_1000005938 | 290 |
| 731 | 3300026041 | Ga0207639_10001033 | Ga0207639_1000103315 | 290 |
| 732 | 3300026041 | Ga0207639_10152663 | Ga0207639_101526631 | 290 |
| 733 | 3300026041 | Ga0207639_10255824 | Ga0207639_102558241 | 290 |
| 734 | 3300026067 | Ga0207678_10001367 | Ga0207678_100013679 | 290 |
| 735 | 3300026067 | Ga0207678_10004332 | Ga0207678_100043328 | 290 |
| 736 | 3300026067 | Ga0207678_10012031 | Ga0207678_100120314 | 290 |
| 737 | 3300026075 | Ga0207708_10027377 | Ga0207708_100273773 | 290 |
| 738 | 3300026078 | Ga0207702_10147131 | Ga0207702_101471312 | 290 |
| 739 | 3300026088 | Ga0207641_10000473 | Ga0207641_1000047313 | 290 |
| 740 | 3300026089 | Ga0207648_10000105 | Ga0207648_1000010515 | 290 |
| 741 | 3300026095 | Ga0207676_10000168 | Ga0207676_1000016837 | 290 |
| 742 | 3300026116 | Ga0207674_10005910 | Ga0207674_100059107 | 290 |
| 743 | 3300026116 | Ga0207674_10008599 | Ga0207674_100085994 | 290 |
| 744 | 3300026116 | Ga0207674_10031405 | Ga0207674_100314054 | 290 |
| 745 | 3300026116 | Ga0207674_10068238 | Ga0207674_100682383 | 290 |
| 746 | 3300026118 | Ga0207675_100000233 | Ga0207675_10000023339 | 290 |
| 747 | 3300026121 | Ga0207683_10000167 | Ga0207683_100001679 | 290 |
| 748 | 3300026121 | Ga0207683_10201255 | Ga0207683_102012552 | 290 |
| 749 | 3300026142 | Ga0207698_10008057 | Ga0207698_100080572 | 290 |
| 750 | 3300026142 | Ga0207698_10024256 | Ga0207698_100242563 | 290 |
| 751 | 3300027312 | Ga0209371_1000007 | Ga0209371_1000007715 | 290 |
| 752 | 3300027312 | Ga0209371_1000088 | Ga0209371_1000088122 | 290 |
| 753 | 3300028379 | Ga0268266_10000001 | Ga0268266_100000013563 | 290 |
| 754 | 3300028379 | Ga0268266_10000075 | Ga0268266_10000075122 | 290 |
| 755 | 3300028379 | Ga0268266_10000493 | Ga0268266_1000049339 | 290 |
| 756 | 3300028379 | Ga0268266_10061207 | Ga0268266_100612072 | 290 |
| 757 | 3300028381 | Ga0268264_10000464 | Ga0268264_1000046416 | 290 |
| 758 | 3300028381 | Ga0268264_10072286 | Ga0268264_100722862 | 290 |
| 759 | 3300028381 | Ga0268264_10281128 | Ga0268264_102811282 | 290 |
| 760 | 3300030500 | Ga0268256_1000008 | Ga0268256_1000008236 | 290 |
| 761 | 3300030500 | Ga0268256_1000079 | Ga0268256_100007915 | 290 |
| 762 | 3300030745 | Ga0316182_1373831 | Ga0316182_13738311 | 290 |
| 763 | 3300032002 | Ga0307416_100231026 | Ga0307416_1002310262 | 290 |
| 764 | 3300033180 | Ga0307510_10000590 | Ga0307510_100005907 | 290 |
| 765 | 3300037312 | Ga0395899_0016051 | Ga0395899_0016051_12_884 | 290 |
| 766 | 3300037312 | Ga0395899_0029824 | Ga0395899_0029824_3181_4053 | 290 |
| 767 | 3300037418 | Ga0395900_0014472 | Ga0395900_0014472_12_884 | 290 |
| 768 | 3300037418 | Ga0395900_0020273 | Ga0395900_0020273_5688_6560 | 290 |
| 769 | 3300037418 | Ga0395900_0724568 | Ga0395900_0724568_12_884 | 290 |
| 770 | 3300037466 | Ga0395898_0003642 | Ga0395898_0003642_1136_2008 | 290 |
| 771 | 3300039450 | Ga0436363_1508025 | Ga0436363_1508025_294_1181 | 290 |
| 772 | 3300041452 | Ga0451793_0318385 | Ga0451793_0318385_466_1338 | 290 |
| 773 | 3300041498 | Ga0451841_0314351 | Ga0451841_0314351_152_1027 | 290 |
| 774 | 3300042011 | Ga0439454_011437 | Ga0439454_011437_291_1163 | 290 |
| 775 | 3300042184 | Ga0450908_016352 | Ga0450908_016352_279_1151 | 290 |
| 776 | 3300042876 | Ga0451577_0019749 | Ga0451577_0019749_1910_2782 | 290 |
| 777 | 3300042876 | Ga0451577_0156318 | Ga0451577_0156318_819_1706 | 290 |
| 778 | 3300044672 | Ga0466982_0000069 | Ga0466982_0000069_59_931 | 290 |
| 779 | 3300044765 | Ga0466970_0001345 | Ga0466970_0001345_5979_6851 | 290 |
| 780 | 3300046452 | Ga0495617_000544 | Ga0495617_000544_18552_19424 | 290 |
| 781 | 3300046460 | Ga0495638_0000019 | Ga0495638_0000019_276196_277068 | 290 |
| 782 | 3300046460 | Ga0495638_0006348 | Ga0495638_0006348_249_1121 | 290 |
| 783 | 3300046471 | Ga0495650_0001680 | Ga0495650_0001680_8219_9091 | 290 |
| 784 | 3300046471 | Ga0495650_0001768 | Ga0495650_0001768_18115_18987 | 290 |
| 785 | 3300046472 | Ga0495580_0036251 | Ga0495580_0036251_1905_2795 | 290 |
| 786 | 3300046491 | Ga0495584_0000852 | Ga0495584_0000852_3983_4855 | 290 |
| 787 | 3300046492 | Ga0495585_0001031 | Ga0495585_0001031_1082_1954 | 290 |
| 788 | 3300046492 | Ga0495585_0005296 | Ga0495585_0005296_2452_3324 | 290 |
| 789 | 3300046501 | Ga0495607_0000334 | Ga0495607_0000334_1035_1907 | 290 |
| 790 | 3300046501 | Ga0495607_0003817 | Ga0495607_0003817_9293_10165 | 290 |
| 791 | 3300046501 | Ga0495607_0011325 | Ga0495607_0011325_304_1176 | 290 |
| 792 | 3300046507 | Ga0495606_0003641 | Ga0495606_0003641_9029_9901 | 290 |
| 793 | 3300046507 | Ga0495606_0108430 | Ga0495606_0108430_599_1471 | 290 |
| 794 | 3300046515 | Ga0495620_0001178 | Ga0495620_0001178_1124_1996 | 290 |
| 795 | 3300046518 | Ga0495631_0058718 | Ga0495631_0058718_365_1237 | 290 |
| 796 | 3300046519 | Ga0495632_0000010 | Ga0495632_0000010_110245_111117 | 290 |
| 797 | 3300046519 | Ga0495632_0059417 | Ga0495632_0059417_851_1723 | 290 |
| 798 | 3300046520 | Ga0495637_0085268 | Ga0495637_0085268_329_1201 | 290 |
| 799 | 3300046524 | Ga0495648_0001511 | Ga0495648_0001511_20762_21634 | 290 |
| 800 | 3300046524 | Ga0495648_0099974 | Ga0495648_0099974_436_1308 | 290 |
| 801 | 3300046538 | Ga0495609_0020466 | Ga0495609_0020466_190_1062 | 290 |
| 802 | 3300046648 | Ga0495611_0000003 | Ga0495611_0000003_262077_262949 | 290 |
| 803 | 3300046648 | Ga0495611_0000857 | Ga0495611_0000857_15416_16288 | 290 |
| 804 | 3300046660 | Ga0495625_0000019 | Ga0495625_0000019_43707_44579 | 290 |
| 805 | 3300046665 | Ga0495661_0057424 | Ga0495661_0057424_352_1224 | 290 |
| 806 | 3300046692 | Ga0495671_0001785 | Ga0495671_0001785_913_1785 | 290 |
| 807 | 3300046794 | Ga0495589_0000516 | Ga0495589_0000516_284_1156 | 290 |
| 808 | 3300046810 | Ga0495660_0000125 | Ga0495660_0000125_34081_34953 | 290 |
| 809 | 3300046810 | Ga0495660_0002931 | Ga0495660_0002931_1167_2039 | 290 |
| 810 | 3300047446 | Ga0495679_000017 | Ga0495679_000017_285_1157 | 290 |
| 811 | 3300047469 | Ga0495673_0000004 | Ga0495673_0000004_696709_697581 | 290 |
| 812 | 3300047469 | Ga0495673_0012171 | Ga0495673_0012171_3366_4238 | 290 |
| 813 | 3300047472 | Ga0495686_0000117 | Ga0495686_0000117_164229_165101 | 290 |
| 814 | 3300047472 | Ga0495686_0004845 | Ga0495686_0004845_6983_7855 | 290 |
| 815 | 3300047472 | Ga0495686_0025565 | Ga0495686_0025565_2614_3486 | 290 |
| 816 | 3300048903 | Ga0496100_0005052 | Ga0496100_0005052_4435_5307 | 290 |
| 817 | 3300048903 | Ga0496100_0083587 | Ga0496100_0083587_847_1719 | 290 |
| 818 | 3300048904 | Ga0496101_0296569 | Ga0496101_0296569_157_1044 | 290 |
| 819 | 3300048905 | Ga0496102_0032094 | Ga0496102_0032094_1265_2152 | 290 |
| 820 | 3300048905 | Ga0496102_0422372 | Ga0496102_0422372_242_1114 | 290 |
| 821 | 3300048908 | Ga0496105_0000914 | Ga0496105_0000914_3411_4283 | 290 |
| 822 | 3300048909 | Ga0496106_0000637 | Ga0496106_0000637_21469_22356 | 290 |
| 823 | 3300048912 | Ga0496109_0012039 | Ga0496109_0012039_2319_3206 | 290 |
| 824 | 3300048915 | Ga0496112_0003022 | Ga0496112_0003022_10821_11708 | 290 |
| 825 | 3300048920 | Ga0496117_0023276 | Ga0496117_0023276_3670_4542 | 290 |
| 826 | 3300048920 | Ga0496117_0100990 | Ga0496117_0100990_536_1408 | 290 |
| 827 | 3300048921 | Ga0496118_0001026 | Ga0496118_0001026_27604_28476 | 290 |
| 828 | 3300048921 | Ga0496118_0004246 | Ga0496118_0004246_15702_16574 | 290 |
| 829 | 3300048921 | Ga0496118_0008143 | Ga0496118_0008143_2737_3609 | 290 |
| 830 | 3300048921 | Ga0496118_0017301 | Ga0496118_0017301_5175_6047 | 290 |
| 831 | 3300048922 | Ga0496119_0000306 | Ga0496119_0000306_64145_65017 | 290 |
| 832 | 3300048923 | Ga0496120_0000145 | Ga0496120_0000145_63692_64564 | 290 |
| 833 | 3300048924 | Ga0496121_0000251 | Ga0496121_0000251_48347_49219 | 290 |
| 834 | 3300048924 | Ga0496121_0000593 | Ga0496121_0000593_44253_45125 | 290 |
| 835 | 3300048924 | Ga0496121_0041801 | Ga0496121_0041801_2844_3716 | 290 |
| 836 | 3300048924 | Ga0496121_0240081 | Ga0496121_0240081_67_939 | 290 |
| 837 | 3300048925 | Ga0496122_0008859 | Ga0496122_0008859_2826_3698 | 290 |
| 838 | 3300048925 | Ga0496122_0029664 | Ga0496122_0029664_2129_3001 | 290 |
| 839 | 3300048926 | Ga0496123_0009630 | Ga0496123_0009630_1086_1958 | 290 |
| 840 | 3300048926 | Ga0496123_0018943 | Ga0496123_0018943_1626_2498 | 290 |
| 841 | 3300048927 | Ga0496124_0001043 | Ga0496124_0001043_42869_43741 | 290 |
| 842 | 3300048927 | Ga0496124_0244663 | Ga0496124_0244663_306_1226 | 290 |
| 843 | 3300048928 | Ga0496125_0023701 | Ga0496125_0023701_208_1080 | 290 |
| 844 | 3300048929 | Ga0496126_0000712 | Ga0496126_0000712_38621_39493 | 290 |
| 845 | 3300048929 | Ga0496126_0115714 | Ga0496126_0115714_446_1318 | 290 |
| 846 | 3300048929 | Ga0496126_0256869 | Ga0496126_0256869_479_1351 | 290 |
| 847 | 3300049459 | Ga0495678_001135 | Ga0495678_001135_228_1100 | 290 |
| 848 | 3300049460 | Ga0495682_0035008 | Ga0495682_0035008_51_923 | 290 |
| 849 | 3300049568 | Ga0501031_0045711 | Ga0501031_0045711_799_1671 | 290 |
| 850 | 3300049568 | Ga0501031_0138479 | Ga0501031_0138479_57_929 | 290 |
| 851 | 3300049569 | Ga0501032_0045363 | Ga0501032_0045363_631_1503 | 290 |
| 852 | 3300049570 | Ga0501033_0001322 | Ga0501033_0001322_20311_21183 | 290 |
| 853 | 3300049570 | Ga0501033_0382947 | Ga0501033_0382947_95_967 | 290 |
| 854 | 3300049573 | Ga0501037_0075291 | Ga0501037_0075291_661_1533 | 290 |
| 855 | 3300049574 | Ga0501038_0122747 | Ga0501038_0122747_1015_1986 | 290 |
| 856 | 3300049574 | Ga0501038_0159177 | Ga0501038_0159177_770_1642 | 290 |
| 857 | 3300049579 | Ga0501043_0130484 | Ga0501043_0130484_1059_1931 | 290 |
| 858 | 3300049581 | Ga0501047_0008124 | Ga0501047_0008124_95_967 | 290 |
| 859 | 3300049581 | Ga0501047_0212484 | Ga0501047_0212484_679_1551 | 290 |
| 860 | 3300049581 | Ga0501047_0426161 | Ga0501047_0426161_254_1126 | 290 |
| 861 | 3300049582 | Ga0501048_0097270 | Ga0501048_0097270_237_1109 | 290 |
| 862 | 3300049586 | Ga0501070_0008994 | Ga0501070_0008994_7246_8118 | 290 |
| 863 | 3300049591 | Ga0501075_0369376 | Ga0501075_0369376_51_935 | 290 |
| 864 | 3300049592 | Ga0501076_0104928 | Ga0501076_0104928_1277_2161 | 290 |
| 865 | 3300049823 | Ga0501044_0065626 | Ga0501044_0065626_181_1053 | 290 |
| 866 | 3300053087 | Ga0500643_000223 | Ga0500643_000223_569_1441 | 290 |
| 867 | 3300053087 | Ga0500643_002293 | Ga0500643_002293_90_962 | 290 |
| 868 | 3300053093 | Ga0500651_0000244 | Ga0500651_0000244_22730_23602 | 290 |
| 869 | 3300053093 | Ga0500651_0000401 | Ga0500651_0000401_7867_8739 | 290 |
| 870 | 3300053103 | Ga0500555_000290 | Ga0500555_000290_171_1043 | 290 |
| 871 | 3300053120 | Ga0500597_077126 | Ga0500597_077126_370_1242 | 290 |
| 872 | 3300053730 | Ga0500645_000648 | Ga0500645_000648_20851_21723 | 290 |
| 873 | 3300001904 | JGI24736J21556_1000331 | JGI24736J21556_10003312 | 291 |
| 874 | 3300001979 | JGI24740J21852_10016362 | JGI24740J21852_100163622 | 291 |
| 875 | 3300001989 | JGI24739J22299_10002202 | JGI24739J22299_100022027 | 291 |
| 876 | 3300001990 | JGI24737J22298_10008868 | JGI24737J22298_100088683 | 291 |
| 877 | 3300002067 | JGI24735J21928_10012133 | JGI24735J21928_100121333 | 291 |
| 878 | 3300002075 | JGI24738J21930_10000044 | JGI24738J21930_100000445 | 291 |
| 879 | 3300002737 | JGI25162J39368_1000781 | JGI25162J39368_10007812 | 291 |
| 880 | 3300002737 | JGI25162J39368_1003558 | JGI25162J39368_10035584 | 291 |
| 881 | 3300002772 | JGI25164J39214_1000537 | JGI25164J39214_100053715 | 291 |
| 882 | 3300002772 | JGI25164J39214_1000599 | JGI25164J39214_10005992 | 291 |
| 883 | 3300002774 | JGI25150J39212_1000339 | JGI25150J39212_10003395 | 291 |
| 884 | 3300003187 | JGI25151J46595_10000141 | JGI25151J46595_1000014142 | 291 |
| 885 | 3300003214 | JGI25165J46597_1001192 | JGI25165J46597_10011922 | 291 |
| 886 | 3300003215 | JGI25153J46596_10000106 | JGI25153J46596_1000010642 | 291 |
| 887 | 3300003578 | Ga0006562J51391_1028372 | Ga0006562J51391_10283722 | 291 |
| 888 | 3300003752 | Ga0055539_1001886 | Ga0055539_10018861 | 291 |
| 889 | 3300003759 | Ga0055525_1000093 | Ga0055525_10000933 | 291 |
| 890 | 3300003760 | Ga0055527_1000245 | Ga0055527_10002451 | 291 |
| 891 | 3300003760 | Ga0055527_1001066 | Ga0055527_10010666 | 291 |
| 892 | 3300003761 | Ga0055535_1000732 | Ga0055535_10007322 | 291 |
| 893 | 3300003761 | Ga0055535_1002441 | Ga0055535_10024416 | 291 |
| 894 | 3300003762 | Ga0055542_1000751 | Ga0055542_100075122 | 291 |
| 895 | 3300003762 | Ga0055542_1002340 | Ga0055542_10023406 | 291 |
| 896 | 3300003763 | Ga0055529_1001551 | Ga0055529_10015516 | 291 |
| 897 | 3300003781 | Ga0055536_1001544 | Ga0055536_10015443 | 291 |
| 898 | 3300005327 | Ga0070658_10003002 | Ga0070658_1000300213 | 291 |
| 899 | 3300005337 | Ga0070682_100056300 | Ga0070682_1000563001 | 291 |
| 900 | 3300005344 | Ga0070661_100070505 | Ga0070661_1000705052 | 291 |
| 901 | 3300005344 | Ga0070661_100190400 | Ga0070661_1001904002 | 291 |
| 902 | 3300005344 | Ga0070661_100461724 | Ga0070661_1004617241 | 291 |
| 903 | 3300005347 | Ga0070668_100014195 | Ga0070668_1000141953 | 291 |
| 904 | 3300005347 | Ga0070668_100025263 | Ga0070668_1000252632 | 291 |
| 905 | 3300005355 | Ga0070671_100017824 | Ga0070671_1000178245 | 291 |
| 906 | 3300005364 | Ga0070673_100085963 | Ga0070673_1000859634 | 291 |
| 907 | 3300005366 | Ga0070659_100073578 | Ga0070659_1000735784 | 291 |
| 908 | 3300005367 | Ga0070667_100072489 | Ga0070667_1000724892 | 291 |
| 909 | 3300005445 | Ga0070708_100000059 | Ga0070708_10000005922 | 291 |
| 910 | 3300005455 | Ga0070663_100016964 | Ga0070663_1000169644 | 291 |
| 911 | 3300005455 | Ga0070663_100023904 | Ga0070663_1000239044 | 291 |
| 912 | 3300005455 | Ga0070663_100143396 | Ga0070663_1001433962 | 291 |
| 913 | 3300005457 | Ga0070662_100022409 | Ga0070662_1000224093 | 291 |
| 914 | 3300005466 | Ga0070685_10004503 | Ga0070685_100045033 | 291 |
| 915 | 3300005539 | Ga0068853_100038741 | Ga0068853_1000387413 | 291 |
| 916 | 3300005539 | Ga0068853_100051238 | Ga0068853_1000512382 | 291 |
| 917 | 3300005546 | Ga0070696_100138591 | Ga0070696_1001385912 | 291 |
| 918 | 3300005548 | Ga0070665_100002811 | Ga0070665_1000028115 | 291 |
| 919 | 3300005563 | Ga0068855_100062160 | Ga0068855_1000621602 | 291 |
| 920 | 3300005578 | Ga0068854_100000786 | Ga0068854_1000007867 | 291 |
| 921 | 3300005614 | Ga0068856_100005579 | Ga0068856_1000055793 | 291 |
| 922 | 3300005616 | Ga0068852_100014115 | Ga0068852_1000141153 | 291 |
| 923 | 3300005616 | Ga0068852_100082733 | Ga0068852_1000827332 | 291 |
| 924 | 3300005616 | Ga0068852_100118615 | Ga0068852_1001186152 | 291 |
| 925 | 3300005617 | Ga0068859_100000584 | Ga0068859_1000005844 | 291 |
| 926 | 3300005834 | Ga0068851_10006366 | Ga0068851_100063665 | 291 |
| 927 | 3300005842 | Ga0068858_100000235 | Ga0068858_10000023521 | 291 |
| 928 | 3300005842 | Ga0068858_100494183 | Ga0068858_1004941832 | 291 |
| 929 | 3300005843 | Ga0068860_100027269 | Ga0068860_1000272693 | 291 |
| 930 | 3300005843 | Ga0068860_100075407 | Ga0068860_1000754074 | 291 |
| 931 | 3300005844 | Ga0068862_100000715 | Ga0068862_10000071524 | 291 |
| 932 | 3300006028 | Ga0070717_10009369 | Ga0070717_100093692 | 291 |
| 933 | 3300006237 | Ga0097621_100032392 | Ga0097621_1000323922 | 291 |
| 934 | 3300006358 | Ga0068871_100065145 | Ga0068871_1000651453 | 291 |
| 935 | 3300006931 | Ga0097620_100000584 | Ga0097620_10000058427 | 291 |
| 936 | 3300007265 | Ga0099794_10000152 | Ga0099794_1000015210 | 291 |
| 937 | 3300009093 | Ga0105240_10000705 | Ga0105240_1000070545 | 291 |
| 938 | 3300009093 | Ga0105240_10200597 | Ga0105240_102005972 | 291 |
| 939 | 3300009101 | Ga0105247_10034781 | Ga0105247_100347812 | 291 |
| 940 | 3300009177 | Ga0105248_10395772 | Ga0105248_103957721 | 291 |
| 941 | 3300009545 | Ga0105237_10000084 | Ga0105237_1000008411 | 291 |
| 942 | 3300009551 | Ga0105238_10221147 | Ga0105238_102211472 | 291 |
| 943 | 3300010375 | Ga0105239_10018941 | Ga0105239_100189415 | 291 |
| 944 | 3300010375 | Ga0105239_10040597 | Ga0105239_100405972 | 291 |
| 945 | 3300010375 | Ga0105239_10043604 | Ga0105239_100436043 | 291 |
| 946 | 3300010375 | Ga0105239_10059993 | Ga0105239_100599934 | 291 |
| 947 | 3300010375 | Ga0105239_10330830 | Ga0105239_103308302 | 291 |
| 948 | 3300013105 | Ga0157369_10004125 | Ga0157369_100041257 | 291 |
| 949 | 3300013296 | Ga0157374_10143264 | Ga0157374_101432642 | 291 |
| 950 | 3300013297 | Ga0157378_10001829 | Ga0157378_100018298 | 291 |
| 951 | 3300014969 | Ga0157376_10023163 | Ga0157376_100231633 | 291 |
| 952 | 3300020070 | Ga0206356_11496191 | Ga0206356_114961912 | 291 |
| 953 | 3300020081 | Ga0206354_10278400 | Ga0206354_102784001 | 291 |
| 954 | 3300022467 | Ga0224712_10023723 | Ga0224712_100237232 | 291 |
| 955 | 3300025225 | Ga0209566_105364 | Ga0209566_1053642 | 291 |
| 956 | 3300025226 | Ga0209674_100453 | Ga0209674_10045312 | 291 |
| 957 | 3300025226 | Ga0209674_101324 | Ga0209674_1013242 | 291 |
| 958 | 3300025228 | Ga0209672_100005 | Ga0209672_100005184 | 291 |
| 959 | 3300025228 | Ga0209672_100055 | Ga0209672_100055109 | 291 |
| 960 | 3300025228 | Ga0209672_101177 | Ga0209672_1011772 | 291 |
| 961 | 3300025230 | Ga0209563_100045 | Ga0209563_100045124 | 291 |
| 962 | 3300025231 | Ga0207427_100134 | Ga0207427_10013419 | 291 |
| 963 | 3300025231 | Ga0207427_100150 | Ga0207427_10015017 | 291 |
| 964 | 3300025233 | Ga0209437_100005 | Ga0209437_100005723 | 291 |
| 965 | 3300025233 | Ga0209437_100200 | Ga0209437_10020017 | 291 |
| 966 | 3300025242 | Ga0209258_100006 | Ga0209258_100006184 | 291 |
| 967 | 3300025242 | Ga0209258_100012 | Ga0209258_10001256 | 291 |
| 968 | 3300025242 | Ga0209258_100255 | Ga0209258_10025545 | 291 |
| 969 | 3300025245 | Ga0207425_1000084 | Ga0207425_100008444 | 291 |
| 970 | 3300025250 | Ga0209026_1000017 | Ga0209026_1000017293 | 291 |
| 971 | 3300025250 | Ga0209026_1000084 | Ga0209026_100008487 | 291 |
| 972 | 3300025253 | Ga0209677_103582 | Ga0209677_1035823 | 291 |
| 973 | 3300025254 | Ga0209148_1000012 | Ga0209148_1000012184 | 291 |
| 974 | 3300025254 | Ga0209148_1000014 | Ga0209148_1000014599 | 291 |
| 975 | 3300025254 | Ga0209148_1000221 | Ga0209148_100022145 | 291 |
| 976 | 3300025256 | Ga0209759_1001340 | Ga0209759_10013409 | 291 |
| 977 | 3300025256 | Ga0209759_1012002 | Ga0209759_10120022 | 291 |
| 978 | 3300025258 | Ga0209129_1000057 | Ga0209129_1000057174 | 291 |
| 979 | 3300025258 | Ga0209129_1004398 | Ga0209129_10043984 | 291 |
| 980 | 3300025261 | Ga0209233_1000011 | Ga0209233_1000011219 | 291 |
| 981 | 3300025261 | Ga0209233_1000193 | Ga0209233_100019317 | 291 |
| 982 | 3300025261 | Ga0209233_1000957 | Ga0209233_10009577 | 291 |
| 983 | 3300025272 | Ga0209455_1000008 | Ga0209455_1000008184 | 291 |
| 984 | 3300025272 | Ga0209455_1000014 | Ga0209455_1000014487 | 291 |
| 985 | 3300025272 | Ga0209455_1000266 | Ga0209455_100026639 | 291 |
| 986 | 3300025292 | Ga0209676_1000027 | Ga0209676_1000027275 | 291 |
| 987 | 3300025294 | Ga0209025_1000013 | Ga0209025_1000013241 | 291 |
| 988 | 3300025297 | Ga0209758_1000014 | Ga0209758_1000014241 | 291 |
| 989 | 3300025321 | Ga0207656_10000936 | Ga0207656_100009364 | 291 |
| 990 | 3300025900 | Ga0207710_10074039 | Ga0207710_100740392 | 291 |
| 991 | 3300025903 | Ga0207680_10045353 | Ga0207680_100453532 | 291 |
| 992 | 3300025904 | Ga0207647_10000019 | Ga0207647_1000001979 | 291 |
| 993 | 3300025904 | Ga0207647_10040824 | Ga0207647_100408242 | 291 |
| 994 | 3300025909 | Ga0207705_10007619 | Ga0207705_100076196 | 291 |
| 995 | 3300025911 | Ga0207654_10278853 | Ga0207654_102788531 | 291 |
| 996 | 3300025913 | Ga0207695_10000014 | Ga0207695_10000014215 | 291 |
| 997 | 3300025913 | Ga0207695_10000683 | Ga0207695_1000068359 | 291 |
| 998 | 3300025913 | Ga0207695_10025619 | Ga0207695_100256194 | 291 |
| 999 | 3300025913 | Ga0207695_10065505 | Ga0207695_100655053 | 291 |
| 1000 | 3300025914 | Ga0207671_10000011 | Ga0207671_10000011307 | 291 |
| 1001 | 3300025914 | Ga0207671_10000507 | Ga0207671_1000050731 | 291 |
| 1002 | 3300025914 | Ga0207671_10000764 | Ga0207671_100007642 | 291 |
| 1003 | 3300025914 | Ga0207671_10008592 | Ga0207671_100085926 | 291 |
| 1004 | 3300025914 | Ga0207671_10020874 | Ga0207671_100208743 | 291 |
| 1005 | 3300025914 | Ga0207671_10023665 | Ga0207671_100236653 | 291 |
| 1006 | 3300025914 | Ga0207671_10253118 | Ga0207671_102531182 | 291 |
| 1007 | 3300025920 | Ga0207649_10002004 | Ga0207649_100020046 | 291 |
| 1008 | 3300025920 | Ga0207649_10160508 | Ga0207649_101605082 | 291 |
| 1009 | 3300025924 | Ga0207694_10000932 | Ga0207694_100009322 | 291 |
| 1010 | 3300025924 | Ga0207694_10002038 | Ga0207694_1000203811 | 291 |
| 1011 | 3300025925 | Ga0207650_10004303 | Ga0207650_100043032 | 291 |
| 1012 | 3300025928 | Ga0207700_10035503 | Ga0207700_100355033 | 291 |
| 1013 | 3300025931 | Ga0207644_10021077 | Ga0207644_100210774 | 291 |
| 1014 | 3300025933 | Ga0207706_10301089 | Ga0207706_103010891 | 291 |
| 1015 | 3300025941 | Ga0207711_10332390 | Ga0207711_103323901 | 291 |
| 1016 | 3300025949 | Ga0207667_10010895 | Ga0207667_100108957 | 291 |
| 1017 | 3300025961 | Ga0207712_10000601 | Ga0207712_100006011 | 291 |
| 1018 | 3300025972 | Ga0207668_10045026 | Ga0207668_100450262 | 291 |
| 1019 | 3300025972 | Ga0207668_10098713 | Ga0207668_100987132 | 291 |
| 1020 | 3300025981 | Ga0207640_10000091 | Ga0207640_100000913 | 291 |
| 1021 | 3300025981 | Ga0207640_10010209 | Ga0207640_100102094 | 291 |
| 1022 | 3300025986 | Ga0207658_10140485 | Ga0207658_101404852 | 291 |
| 1023 | 3300026023 | Ga0207677_10131583 | Ga0207677_101315832 | 291 |
| 1024 | 3300026035 | Ga0207703_10000250 | Ga0207703_1000025012 | 291 |
| 1025 | 3300026041 | Ga0207639_10000117 | Ga0207639_1000011714 | 291 |
| 1026 | 3300026041 | Ga0207639_10000304 | Ga0207639_1000030428 | 291 |
| 1027 | 3300026041 | Ga0207639_10047073 | Ga0207639_100470732 | 291 |
| 1028 | 3300026067 | Ga0207678_10068756 | Ga0207678_100687561 | 291 |
| 1029 | 3300026078 | Ga0207702_10000146 | Ga0207702_1000014635 | 291 |
| 1030 | 3300026078 | Ga0207702_10002805 | Ga0207702_100028058 | 291 |
| 1031 | 3300026078 | Ga0207702_10096169 | Ga0207702_100961692 | 291 |
| 1032 | 3300026095 | Ga0207676_10711659 | Ga0207676_107116591 | 291 |
| 1033 | 3300026142 | Ga0207698_10009637 | Ga0207698_100096373 | 291 |
| 1034 | 3300026142 | Ga0207698_10014742 | Ga0207698_100147422 | 291 |
| 1035 | 3300026142 | Ga0207698_10053204 | Ga0207698_100532044 | 291 |
| 1036 | 3300026142 | Ga0207698_10573335 | Ga0207698_105733351 | 291 |
| 1037 | 3300027360 | Ga0209969_1021540 | Ga0209969_10215401 | 291 |
| 1038 | 3300027364 | Ga0209967_1008434 | Ga0209967_10084342 | 291 |
| 1039 | 3300027543 | Ga0209999_1034164 | Ga0209999_10341641 | 291 |
| 1040 | 3300027671 | Ga0209588_1000048 | Ga0209588_100004821 | 291 |
| 1041 | 3300027682 | Ga0209971_1002342 | Ga0209971_10023421 | 291 |
| 1042 | 3300027876 | Ga0209974_10053523 | Ga0209974_100535231 | 291 |
| 1043 | 3300028379 | Ga0268266_10000007 | Ga0268266_10000007488 | 291 |
| 1044 | 3300028379 | Ga0268266_10037056 | Ga0268266_100370562 | 291 |
| 1045 | 3300028380 | Ga0268265_10006004 | Ga0268265_100060043 | 291 |
| 1046 | 3300028381 | Ga0268264_10016287 | Ga0268264_100162873 | 291 |
| 1047 | 3300028381 | Ga0268264_10067806 | Ga0268264_100678062 | 291 |
| 1048 | 3300031238 | Ga0265332_10043912 | Ga0265332_100439122 | 291 |
| 1049 | 3300031730 | Ga0307516_10081484 | Ga0307516_100814842 | 291 |
| 1050 | 3300031911 | Ga0307412_10000964 | Ga0307412_100009649 | 291 |
| 1051 | 3300032004 | Ga0307414_10243913 | Ga0307414_102439131 | 291 |
| 1052 | 3300037312 | Ga0395899_0000076 | Ga0395899_0000076_28013_28888 | 291 |
| 1053 | 3300037312 | Ga0395899_0005634 | Ga0395899_0005634_8219_9094 | 291 |
| 1054 | 3300037312 | Ga0395899_0045910 | Ga0395899_0045910_1152_2027 | 291 |
| 1055 | 3300037418 | Ga0395900_0000024 | Ga0395900_0000024_247667_248542 | 291 |
| 1056 | 3300037418 | Ga0395900_0004448 | Ga0395900_0004448_6343_7218 | 291 |
| 1057 | 3300037418 | Ga0395900_0015314 | Ga0395900_0015314_4921_5796 | 291 |
| 1058 | 3300037466 | Ga0395898_0000044 | Ga0395898_0000044_41419_42294 | 291 |
| 1059 | 3300037466 | Ga0395898_0000311 | Ga0395898_0000311_57655_58530 | 291 |
| 1060 | 3300037471 | Ga0395905_0004228 | Ga0395905_0004228_2890_3765 | 291 |
| 1061 | 3300038443 | Ga0395901_0315084 | Ga0395901_0315084_409_1284 | 291 |
| 1062 | 3300038443 | Ga0395901_0412867 | Ga0395901_0412867_102_977 | 291 |
| 1063 | 3300038705 | Ga0237819_00065 | Ga0237819_00065_12099_12977 | 291 |
| 1064 | 3300039447 | Ga0436361_0440406 | Ga0436361_0440406_16_897 | 291 |
| 1065 | 3300041404 | Ga0439436_0000039 | Ga0439436_0000039_21406_22281 | 291 |
| 1066 | 3300044658 | Ga0466972_0120479 | Ga0466972_0120479_202_1077 | 291 |
| 1067 | 3300044663 | Ga0466989_0131196 | Ga0466989_0131196_479_1354 | 291 |
| 1068 | 3300044672 | Ga0466982_0000012 | Ga0466982_0000012_17975_18850 | 291 |
| 1069 | 3300044684 | Ga0466966_0013976 | Ga0466966_0013976_4069_4944 | 291 |
| 1070 | 3300044693 | Ga0466961_0006799 | Ga0466961_0006799_5830_6705 | 291 |
| 1071 | 3300044693 | Ga0466961_0020185 | Ga0466961_0020185_2512_3387 | 291 |
| 1072 | 3300044706 | Ga0466964_0020282 | Ga0466964_0020282_336_1211 | 291 |
| 1073 | 3300044735 | Ga0466968_0000372 | Ga0466968_0000372_10569_11444 | 291 |
| 1074 | 3300044735 | Ga0466968_0038297 | Ga0466968_0038297_955_1830 | 291 |
| 1075 | 3300044765 | Ga0466970_0021689 | Ga0466970_0021689_1989_2864 | 291 |
| 1076 | 3300044842 | Ga0466957_0000988 | Ga0466957_0000988_11844_12719 | 291 |
| 1077 | 3300045049 | Ga0466959_0000112 | Ga0466959_0000112_49161_50036 | 291 |
| 1078 | 3300045836 | Ga0466958_0041319 | Ga0466958_0041319_1699_2574 | 291 |
| 1079 | 3300045836 | Ga0466958_0085656 | Ga0466958_0085656_815_1690 | 291 |
| 1080 | 3300046454 | Ga0495592_0068831 | Ga0495592_0068831_690_1595 | 291 |
| 1081 | 3300046499 | Ga0495594_0083560 | Ga0495594_0083560_522_1418 | 291 |
| 1082 | 3300046511 | Ga0495608_0003719 | Ga0495608_0003719_7609_8514 | 291 |
| 1083 | 3300046516 | Ga0495628_0035804 | Ga0495628_0035804_329_1234 | 291 |
| 1084 | 3300046559 | Ga0495667_0188232 | Ga0495667_0188232_360_1265 | 291 |
| 1085 | 3300046691 | Ga0495670_0002544 | Ga0495670_0002544_363_1238 | 291 |
| 1086 | 3300046694 | Ga0495649_0045773 | Ga0495649_0045773_410_1288 | 291 |
| 1087 | 3300048907 | Ga0496104_0467140 | Ga0496104_0467140_267_1142 | 291 |
| 1088 | 3300048923 | Ga0496120_0056783 | Ga0496120_0056783_74_949 | 291 |
| 1089 | 3300048928 | Ga0496125_0000239 | Ga0496125_0000239_46227_47102 | 291 |
| 1090 | 3300049570 | Ga0501033_0095900 | Ga0501033_0095900_596_1471 | 291 |
| 1091 | 3300049571 | Ga0501034_0001814 | Ga0501034_0001814_26177_27052 | 291 |
| 1092 | 3300049580 | Ga0501046_0093723 | Ga0501046_0093723_61_939 | 291 |
| 1093 | 3300049586 | Ga0501070_0088946 | Ga0501070_0088946_731_1606 | 291 |
| 1094 | 3300049589 | Ga0501073_0105507 | Ga0501073_0105507_667_1545 | 291 |
| 1095 | 3300053139 | Ga0500568_0005462 | Ga0500568_0005462_3128_4006 | 291 |
| 1096 | 3300060353 | Ga0501082_0000524 | Ga0501082_0000524_27014_27892 | 291 |
| 1097 | 3300061719 | Ga0466962_0011774 | Ga0466962_0011774_282_1157 | 291 |
| 1098 | 3300061719 | Ga0466962_0020327 | Ga0466962_0020327_2144_3019 | 291 |
| 1099 | 3300061719 | Ga0466962_0087573 | Ga0466962_0087573_223_1098 | 291 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6mgg-assembly1.cif.gz_A | succinyl-coa synthase from francisella tularensis, phosphorylated, in complex with coa | 0.9736 | 2 | 283 |
| 6pfn-assembly2.cif.gz_C | succinyl-coa synthase from francisella tularensis | 0.9731 | 2 | 283 |
| 2nua-assembly1.cif.gz_A | c123av mutant of e. coli succinyl-coa synthetase | 0.9729 | 2 | 287 |
| 7mss-assembly1.cif.gz_A | human e105qa gtp-specific succinyl-coa synthetase complexed with succinate, magnesium ion and coa | 0.9724 | 3 | 290 |
| 2nu9-assembly1.cif.gz_A | c123at mutant of e. coli succinyl-coa synthetase orthorhombic crystal form | 0.9721 | 2 | 287 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A1D6EZI1_156_262_3.40.50.261 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Succinyl-CoA synthetase domains | 1.001 | 122 | 207 | 3.40.50.261 |
| 1jllA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9735 | 2 | 124 | 3.40.50.720 |
| 1jllA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9658 | 2 | 124 | 3.40.50.720 |
| 2yv2A01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9617 | 4 | 124 | 3.40.50.720 |
| 2yv2A01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.954 | 4 | 124 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A438H262-F1-model_v4 | Succinate--CoA ligase [ADP-forming] subunit alpha-1, mitochondrial | 1.001 | 3 | 105 |
GO:0016874
|
| AF-A0A4Q3HXK0-F1-model_v4 | deleted | 0.9999 | 1 | 235 |
|
| AF-A0A7C5M1I3-F1-model_v4 | Succinate--CoA ligase subunit alpha | 0.9983 | 1 | 180 |
GO:0004775
GO:0004776 GO:0006099 GO:0009361 |
| AF-A0A2D4K3L3-F1-model_v4 | CoA-binding domain-containing protein | 0.9978 | 5 | 107 |
GO:0004775
GO:0004776 GO:0005739 GO:0006099 GO:0009361 |
| AF-A0A2N1XEF4-F1-model_v4 | Succinate--CoA ligase subunit alpha (EC 6.2.1.5) | 0.9977 | 1 | 181 |
GO:0004775
GO:0004776 GO:0006099 GO:0009361 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar