F490038

General Info

Members Datasets Scaffolds Average Seq Length
1099 470 1038 288

Family's Representative Sequence

Representative Sequence 3300025914|Ga0207671_10008592|Ga0207671_100085926
Length 325
Sequence MSVLVNKNTKVITQGFTGQQGTFHSEQALEYGTKLVGGVTPGKGGSEHIGLPVYNTVLDAVNDTGAEASMIFVPPPFAADAILEAADAGVKVIVAITEGIPVLDMLRVKNVLKDYPDTVLIGPNCPGIITPGECKIGIMPGHIHKPGKVGIVSRSGTLTYEAVFQTTNVGLGQSTCIGIGGDPINGLNFIDCLKLFQDDAQTEGIIMVGEIGGSAEEEAAEFIEEYVKKPVVAFIAGASAPAGKRMGHAGAIISGGKGTAAAKVRRAREGRRDDGEVAGGSRQDAGDEDEVRLCGRPLPACRPPSPASGGRNGKRSHSLGAQRQF

Samples

Sample ID Description Type Environment
1 2537561836 Rhodanobacter spathiphylli B39 Isolate Unclassified
2 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
3 2593339238 Luteibacter sp. UNCMF366Tsu5.1 Isolate Unclassified
4 2593339239 Luteibacter sp. UNCMF331Sha3.1 Isolate Unclassified
5 2643221562 Rhodanobacter sp. Root561 Isolate Unclassified
6 2643221577 Rhodanobacter sp. Root627 Isolate Unclassified
7 2643221579 Pseudoxanthomonas sp. Root630 Isolate Unclassified
8 2643221581 Pseudoxanthomonas sp. Root65 Isolate Unclassified
9 2643221685 Rhodanobacter sp. Root480 Isolate Unclassified
10 2687453130 Dyella thiooxydans ATSB10 Isolate Unclassified
11 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere
12 2734482264 Dyella sp. AD052 Isolate Unclassified
13 2738543009 Luteibacter sp. OK325 Isolate Unclassified
14 2739367700 Dyella sp. YR388 Isolate Unclassified
15 2740891818 Desulfofaba hansenii DSM 12642 Isolate Unclassified
16 2747842428 Stenotrophomonas sp. WCS2014-113 Isolate Unclassified
17 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
18 2765235840 Stenotrophomonas maltophilia AA1 Isolate Unclassified
19 2816332141 Stenotrophomonas muris 1190 (v2) (version 2) Isolate Unclassified
20 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
21 2818991440 Luteibacter yeojuensis 583 Isolate Unclassified
22 2818991457 Xanthomonas translucens 569 Isolate Unclassified
23 2842391507 Stenotrophomonas maltophilia SEMIA 4027 Isolate Nodule
24 2842914999 Luteibacter sp. R-72151 Isolate Unclassified
25 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
26 2852649853 Stenotrophomonas sp. JAI102 Isolate Rhizosphere
27 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
28 2857442823 Stenotrophomonas sp. R-74235 Isolate Unclassified
29 2874220319 Stenotrophomonas maltophilia PS5 Isolate Unclassified
30 2884338543 Luteibacter pinisoli MAH-14 Isolate Rhizosphere
31 2884411467 Dyella sp. AD56 Isolate Rhizosphere
32 2895395659 Rhodanobacter sp. T12-5 Isolate Unclassified
33 2904463128 Luteibacter yeojuensis 3191 Isolate Unclassified
34 2919085039 Luteibacter sp. 1214 Isolate Unclassified
35 2919089067 Stenotrophomonas sp. 1337 Isolate Rhizosphere
36 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
37 2919134579 Stenotrophomonas geniculata 1733 Isolate Rhizosphere
38 2919404418 Luteibacter sp. 3190 Isolate Unclassified
39 2919513703 Luteimonas sp. 3794 Isolate Unclassified
40 2919675420 Luteimonas terrae 4099 Isolate Unclassified
41 2923516293 Pseudoxanthomonas mexicana SLBN-89 Isolate Rhizosphere
42 2928496128 Stenotrophomonas indicatrix 1163 Isolate Unclassified
43 2928963466 Dyella japonica 1073 Isolate Unclassified
44 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
45 2931380184 Stenotrophomonas sp. DR822 Isolate Rhizosphere
46 2937610967 Stenotrophomonas maltophilia EP20 Isolate Unclassified
47 2939589442 Stenotrophomonas rhizophila 716 Isolate Rhizosphere
48 2939611941 Rhodanobacter soli 1757 Isolate Rhizosphere
49 2939626828 Stenotrophomonas sp. 2694 Isolate Rhizosphere
50 2941471342 Luteibacter sp. 621 Isolate Unclassified
51 2941475908 Stenotrophomonas rhizophila 2680 Isolate Rhizosphere
52 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere
53 2961047084 Stenotrophomonas maltophilia EP5 Isolate Unclassified
54 2961064222 Stenotrophomonas maltophilia EP13 Isolate Unclassified
55 2974307012 Stenotrophomonas sp. SORGH_AS_0282 Isolate Unclassified
56 2977247770 Stenotrophomonas rhizophila SORGH_AS 457 Isolate Unclassified
57 2984514374 Stenotrophomonas sp. SORGH_AS282 Isolate Aerial Root
58 2987605356 Stenotrophomonas sp. ATCM1_4 Isolate Unclassified
59 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
60 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
61 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
62 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
63 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
64 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
65 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
66 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
67 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
68 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
69 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
70 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
71 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
72 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
73 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
74 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
75 3300003479 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_06_lowP_mix1_d1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
76 3300003567 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_04_fullP_mix3_d1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
77 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
78 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
79 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
80 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
81 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
82 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
83 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
84 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
85 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
86 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
87 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
88 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
89 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
90 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
91 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
92 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
93 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
94 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
95 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
96 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
97 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
98 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
99 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
100 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
101 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
102 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
103 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
104 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
105 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
106 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
107 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
108 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
109 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
110 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
111 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
112 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
113 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
114 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
115 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
116 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
117 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
118 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
119 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
120 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
121 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
122 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
123 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
124 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
125 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
126 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
127 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
128 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
129 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
130 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
131 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
132 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
133 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
134 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
135 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
136 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
137 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
138 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
139 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
140 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
141 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
142 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
143 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
144 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
145 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
146 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
147 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
148 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
149 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
150 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
151 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
152 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
153 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
154 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
155 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
156 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
157 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
158 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
159 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
160 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
161 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
162 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
163 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
164 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
165 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
166 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
167 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
168 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
169 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
170 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
171 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
172 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
173 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
174 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
175 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
176 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
177 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
178 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
179 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
180 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
181 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
182 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
183 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
184 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
185 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
186 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
187 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
188 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
189 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
190 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
191 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
192 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
193 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
194 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
195 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
196 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
197 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
198 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
199 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
200 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
201 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
202 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
203 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
204 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
205 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
206 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
207 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
208 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
209 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
210 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
211 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
212 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
213 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
214 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
215 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
216 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
217 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
218 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
219 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
220 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
221 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
222 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
223 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
224 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
225 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
226 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
227 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
228 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
229 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
230 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
231 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
232 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
233 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
234 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
264 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
265 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
266 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
267 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
268 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
269 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
270 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
271 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
272 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
273 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
274 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
275 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
276 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
277 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
278 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
279 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
280 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
281 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
282 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
283 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
284 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
285 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
286 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
287 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
288 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
289 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
290 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
291 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
292 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
293 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
294 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
295 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
296 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
297 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
298 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
299 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
300 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
301 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
302 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
303 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
304 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
305 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
306 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
307 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
308 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
309 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
310 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
311 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
312 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
313 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
314 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
315 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
316 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
317 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
318 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
319 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
320 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
321 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
322 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
323 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
324 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
325 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
326 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
327 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
328 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
329 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
330 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
331 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
332 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
333 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
334 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
335 3300044663 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA2E_TR Metagenome Unclassified
336 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
337 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
338 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
339 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
340 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
341 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
342 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
343 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
344 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
345 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
346 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
347 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
348 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
349 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
350 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
351 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
352 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
353 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
354 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
355 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
356 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
357 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
358 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
359 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
360 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
361 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
362 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
363 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
364 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
365 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
366 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
367 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
368 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
369 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
370 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
371 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
372 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
373 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
374 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
375 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
376 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
377 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
378 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
379 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
380 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
381 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
382 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
383 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
384 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
385 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
386 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
387 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
388 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
389 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
390 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
391 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
392 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
393 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
394 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
395 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
396 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
397 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
398 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
399 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
400 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
401 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
402 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
403 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
404 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
405 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
406 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
407 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
408 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
409 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
410 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
411 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
412 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
413 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
414 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
415 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
416 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
417 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
418 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
419 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
420 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
421 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
422 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
423 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
424 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
425 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
426 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
427 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
428 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
429 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
430 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
431 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
432 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
433 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
434 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
435 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
436 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
437 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
438 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
439 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
440 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
441 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
442 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
443 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
444 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
445 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
446 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
447 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
448 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
449 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
450 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
451 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
452 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
453 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
454 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
455 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
456 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
457 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
458 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
459 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
460 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
461 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
462 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
463 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
464 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
465 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
466 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
467 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
468 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
469 8021626552 Xanthomonas sp. LMG12460 Isolate Rhizosphere
470 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.27
Metatranscriptomes 1.18
Isolates 5.55

Biome Distribution

Category Percentage (%)
Aerial Root 0.09
Bulb 0
Endosphere 12.37
Nodule 0.09
Rhizoplane 2.46
Rhizosphere 76.43
Stem 0
Stem Tuber 0
Unclassified 8.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1000331 3300001904 Bacteria 8834
2 JGI24736J21556_1000372 3300001904 Bacteria 8462
3 JGI24741J21665_1002943 3300001915 Bacteria 4246
4 JGI24740J21852_10004561 3300001979 Bacteria 5956
5 JGI24740J21852_10007220 3300001979 Bacteria 4529
6 JGI24740J21852_10016362 3300001979 Bacteria 2681
7 JGI24739J22299_10002202 3300001989 Bacteria 7487
8 JGI24739J22299_10010039 3300001989 Bacteria 3520
9 JGI24739J22299_10050403 3300001989 Bacteria 1346
10 JGI24737J22298_10008868 3300001990 Bacteria 3357
11 JGI24737J22298_10009746 3300001990 Bacteria 3183
12 JGI24737J22298_10011187 3300001990 Bacteria 2944
13 JGI24735J21928_10004119 3300002067 Bacteria 4911
14 JGI24735J21928_10012133 3300002067 Bacteria 2725
15 JGI24738J21930_10000044 3300002075 Bacteria 24745
16 JGI25162J39368_1000781 3300002737 Bacteria 21361
17 JGI25162J39368_1001109 3300002737 Bacteria 16296
18 JGI25162J39368_1001253 3300002737 Bacteria 14523
19 JGI25162J39368_1001416 3300002737 Bacteria 13048
20 JGI25162J39368_1003558 3300002737 Bacteria 4382
21 JGI25162J39368_1005737 3300002737 Bacteria 2328
22 JGI25154J39366_1006558 3300002738 Bacteria 1688
23 JGI25157J39369_1001319 3300002741 Bacteria 9875
24 JGI25163J39215_1000233 3300002771 Bacteria 20699
25 JGI25164J39214_1000030 3300002772 Bacteria 145974
26 JGI25164J39214_1000317 3300002772 Bacteria 31376
27 JGI25164J39214_1000537 3300002772 Bacteria 17692
28 JGI25164J39214_1000599 3300002772 Bacteria 15779
29 JGI25150J39212_1000339 3300002774 Bacteria 23054
30 JGI25151J46595_10000141 3300003187 Bacteria 95351
31 JGI25165J46597_1000057 3300003214 Bacteria 217135
32 JGI25165J46597_1000601 3300003214 Bacteria 30833
33 JGI25165J46597_1001192 3300003214 Bacteria 15778
34 JGI25165J46597_1011312 3300003214 Bacteria 1277
35 JGI25153J46596_10000106 3300003215 Bacteria 95351
36 Ga0006556J51387_1026971 3300003479 Bacteria 2132
37 Ga0006554J51385_1022122 3300003567 Bacteria 2147
38 Ga0006562J51391_1028372 3300003578 Bacteria 3720
39 Ga0006562J51391_1068853 3300003578 Bacteria 6080
40 Ga0006562J51391_1068854 3300003578 Bacteria 1150
41 JGI25404J52841_10029262 3300003659 Bacteria 1181
42 Ga0055538_1000663 3300003751 Bacteria 10792
43 Ga0055539_1001886 3300003752 Bacteria 3518
44 Ga0055533_1000475 3300003756 Bacteria 15066
45 Ga0055533_1007185 3300003756 Bacteria 1542
46 Ga0055525_1000093 3300003759 Bacteria 138423
47 Ga0055527_1000245 3300003760 Bacteria 33608
48 Ga0055527_1001066 3300003760 Bacteria 6500
49 Ga0055535_1000732 3300003761 Bacteria 24695
50 Ga0055535_1001158 3300003761 Bacteria 15527
51 Ga0055535_1002441 3300003761 Bacteria 6500
52 Ga0055542_1000432 3300003762 Bacteria 40265
53 Ga0055542_1000599 3300003762 Bacteria 30833
54 Ga0055542_1000751 3300003762 Bacteria 24695
55 Ga0055542_1002340 3300003762 Bacteria 6500
56 Ga0055529_1000961 3300003763 Bacteria 14876
57 Ga0055529_1001551 3300003763 Bacteria 6500
58 Ga0055537_1000210 3300003773 Bacteria 43507
59 Ga0055524_1016435 3300003775 Bacteria 2655
60 Ga0055536_1001544 3300003781 Bacteria 13827
61 Ga0055536_1006384 3300003781 Bacteria 5521
62 Ga0055534_1000276 3300003784 Bacteria 35065
63 Ga0055528_1000121 3300003790 Bacteria 62003
64 Ga0055531_10012029 3300003794 Bacteria 4109
65 Ga0055531_10025591 3300003794 Bacteria 2137
66 Ga0058692_1000013 3300003856 Bacteria 316299
67 Ga0058692_1000033 3300003856 Bacteria 174393
68 Ga0065165_1000201 3300005262 Bacteria 103327
69 Ga0065704_10153275 3300005289 Bacteria 1412
70 Ga0070658_10003002 3300005327 Bacteria 13959
71 Ga0070658_10020121 3300005327 Bacteria 5346
72 Ga0070658_10138710 3300005327 Bacteria 2030
73 Ga0070676_10000019 3300005328 Bacteria 48919
74 Ga0070683_100006950 3300005329 Bacteria 9515
75 Ga0070683_100032813 3300005329 Bacteria 4732
76 Ga0070683_100242923 3300005329 Bacteria 1713
77 Ga0070683_100251255 3300005329 Bacteria 1682
78 Ga0070690_100000062 3300005330 Bacteria 53686
79 Ga0070670_100003783 3300005331 Bacteria 12599
80 Ga0068869_100001311 3300005334 Bacteria 14729
81 Ga0068869_100126787 3300005334 Bacteria 1958
82 Ga0068869_100231768 3300005334 Bacteria 1467
83 Ga0070666_10000037 3300005335 Bacteria 116528
84 Ga0070680_100001055 3300005336 Bacteria 19733
85 Ga0070680_100100839 3300005336 Bacteria 2396
86 Ga0070682_100009277 3300005337 Bacteria 5568
87 Ga0070682_100056300 3300005337 Bacteria 2472
88 Ga0070682_100070382 3300005337 Bacteria 2236
89 Ga0070682_100113106 3300005337 Bacteria 1812
90 Ga0070682_100158789 3300005337 Bacteria 1559
91 Ga0070682_100168330 3300005337 Bacteria 1520
92 Ga0068868_100000002 3300005338 Bacteria 159433
93 Ga0068868_100089278 3300005338 Bacteria 2481
94 Ga0068868_100435306 3300005338 Bacteria 1138
95 Ga0070660_100000539 3300005339 Bacteria 25340
96 Ga0070660_100077659 3300005339 Bacteria 2602
97 Ga0070660_100219938 3300005339 Bacteria 1543
98 Ga0070660_100241840 3300005339 Bacteria 1470
99 Ga0070660_100476096 3300005339 Bacteria 1037
100 Ga0070689_100000206 3300005340 Bacteria 35564
101 Ga0070689_100006941 3300005340 Bacteria 7887
102 Ga0070689_100265442 3300005340 Bacteria 1420
103 Ga0070691_10004209 3300005341 Bacteria 6540
104 Ga0070687_100001583 3300005343 Bacteria 8085
105 Ga0070661_100000194 3300005344 Bacteria 50226
106 Ga0070661_100001553 3300005344 Bacteria 15964
107 Ga0070661_100045981 3300005344 Bacteria 3192
108 Ga0070661_100070505 3300005344 Bacteria 2570
109 Ga0070661_100071088 3300005344 Bacteria 2560
110 Ga0070661_100190400 3300005344 Bacteria 1564
111 Ga0070661_100461724 3300005344 Bacteria 1011
112 Ga0070692_10072430 3300005345 Bacteria 1838
113 Ga0070668_100000813 3300005347 Bacteria 21511
114 Ga0070668_100014195 3300005347 Bacteria 5950
115 Ga0070668_100021628 3300005347 Bacteria 4859
116 Ga0070668_100025263 3300005347 Bacteria 4503
117 Ga0070669_100000294 3300005353 Bacteria 39148
118 Ga0070675_100000104 3300005354 Bacteria 49929
119 Ga0070671_100017824 3300005355 Bacteria 5755
120 Ga0070674_100000045 3300005356 Bacteria 53267
121 Ga0070673_100005351 3300005364 Bacteria 8201
122 Ga0070673_100085963 3300005364 Bacteria 2562
123 Ga0070688_100000668 3300005365 Bacteria 17060
124 Ga0070688_100019868 3300005365 Bacteria 3897
125 Ga0070659_100000029 3300005366 Bacteria 139518
126 Ga0070659_100000112 3300005366 Bacteria 59916
127 Ga0070659_100021635 3300005366 Bacteria 4901
128 Ga0070659_100026223 3300005366 Bacteria 4482
129 Ga0070659_100073578 3300005366 Bacteria 2720
130 Ga0070659_100199321 3300005366 Bacteria 1647
131 Ga0070667_100000102 3300005367 Bacteria 107693
132 Ga0070667_100025660 3300005367 Bacteria 4900
133 Ga0070667_100072489 3300005367 Bacteria 2935
134 Ga0070667_100196355 3300005367 Bacteria 1789
135 Ga0070667_100288958 3300005367 Bacteria 1474
136 Ga0070714_100001345 3300005435 Bacteria 17773
137 Ga0070714_100021967 3300005435 Bacteria 5227
138 Ga0070713_100000055 3300005436 Bacteria 70759
139 Ga0070713_100459128 3300005436 Bacteria 1197
140 Ga0070701_10001321 3300005438 Bacteria 9133
141 Ga0070711_100312550 3300005439 Bacteria 1253
142 Ga0070705_100000656 3300005440 Bacteria 19788
143 Ga0070708_100000059 3300005445 Bacteria 70999
144 Ga0070663_100003975 3300005455 Bacteria 8626
145 Ga0070663_100016964 3300005455 Bacteria 4740
146 Ga0070663_100023904 3300005455 Bacteria 4102
147 Ga0070663_100068877 3300005455 Bacteria 2569
148 Ga0070663_100143396 3300005455 Bacteria 1826
149 Ga0070663_100187385 3300005455 Bacteria 1608
150 Ga0070663_100223072 3300005455 Bacteria 1481
151 Ga0070678_100011266 3300005456 Bacteria 5508
152 Ga0070662_100001839 3300005457 Bacteria 12998
153 Ga0070662_100022409 3300005457 Bacteria 4325
154 Ga0070662_100062140 3300005457 Bacteria 2728
155 Ga0070681_10000012 3300005458 Bacteria 137191
156 Ga0070681_10004142 3300005458 Bacteria 13717
157 Ga0070681_10008223 3300005458 Bacteria 10207
158 Ga0070681_10042989 3300005458 Bacteria 4527
159 Ga0068867_100093916 3300005459 Bacteria 2280
160 Ga0070685_10000264 3300005466 Bacteria 33696
161 Ga0070685_10004503 3300005466 Bacteria 7054
162 Ga0070679_100001207 3300005530 Bacteria 22745
163 Ga0070679_100046312 3300005530 Bacteria 4334
164 Ga0070679_100100781 3300005530 Bacteria 2874
165 Ga0070679_100611914 3300005530 Bacteria 1033
166 Ga0070684_100284771 3300005535 Bacteria 1514
167 Ga0068853_100007490 3300005539 Bacteria 8740
168 Ga0068853_100032467 3300005539 Bacteria 4423
169 Ga0068853_100038741 3300005539 Bacteria 4061
170 Ga0068853_100051238 3300005539 Bacteria 3553
171 Ga0068853_100068171 3300005539 Bacteria 3092
172 Ga0068853_100081447 3300005539 Bacteria 2834
173 Ga0068853_100092077 3300005539 Bacteria 2666
174 Ga0068853_100124983 3300005539 Bacteria 2297
175 Ga0068853_100236550 3300005539 Bacteria 1672
176 Ga0068853_100323764 3300005539 Bacteria 1429
177 Ga0070672_100000051 3300005543 Bacteria 51735
178 Ga0070686_100006277 3300005544 Bacteria 6601
179 Ga0070695_100031546 3300005545 Bacteria 3307
180 Ga0070696_100011107 3300005546 Bacteria 6026
181 Ga0070696_100015936 3300005546 Bacteria 5054
182 Ga0070696_100019688 3300005546 Bacteria 4572
183 Ga0070696_100095863 3300005546 Bacteria 2119
184 Ga0070696_100138591 3300005546 Bacteria 1775
185 Ga0070696_100238707 3300005546 Bacteria 1370
186 Ga0070693_100000849 3300005547 Bacteria 13601
187 Ga0070693_100018210 3300005547 Bacteria 3665
188 Ga0070693_100148187 3300005547 Bacteria 1483
189 Ga0070665_100000092 3300005548 Bacteria 174397
190 Ga0070665_100000154 3300005548 Bacteria 125835
191 Ga0070665_100001688 3300005548 Bacteria 25443
192 Ga0070665_100002811 3300005548 Bacteria 18845
193 Ga0070665_100101092 3300005548 Bacteria 2887
194 Ga0070665_100154396 3300005548 Bacteria 2297
195 Ga0068855_100000331 3300005563 Bacteria 58972
196 Ga0068855_100024007 3300005563 Bacteria 7300
197 Ga0068855_100062160 3300005563 Bacteria 4360
198 Ga0068855_100065071 3300005563 Bacteria 4250
199 Ga0068855_100095437 3300005563 Bacteria 3427
200 Ga0068855_100342779 3300005563 Bacteria 1647
201 Ga0070664_100000273 3300005564 Bacteria 37194
202 Ga0070664_100046093 3300005564 Bacteria 3682
203 Ga0070664_100224010 3300005564 Bacteria 1683
204 Ga0070664_100266445 3300005564 Bacteria 1542
205 Ga0068857_100052691 3300005577 Bacteria 3609
206 Ga0068857_100053896 3300005577 Bacteria 3568
207 Ga0068857_100055324 3300005577 Bacteria 3521
208 Ga0068857_100074753 3300005577 Bacteria 3020
209 Ga0068854_100000084 3300005578 Bacteria 67929
210 Ga0068854_100000786 3300005578 Bacteria 18878
211 Ga0068854_100011358 3300005578 Bacteria 5794
212 Ga0068854_100020186 3300005578 Bacteria 4503
213 Ga0068854_100023245 3300005578 Bacteria 4232
214 Ga0068856_100005579 3300005614 Bacteria 12390
215 Ga0068856_100007033 3300005614 Bacteria 10994
216 Ga0068856_100098538 3300005614 Bacteria 2913
217 Ga0068856_100125991 3300005614 Bacteria 2564
218 Ga0068856_100145680 3300005614 Bacteria 2376
219 Ga0068856_100184413 3300005614 Bacteria 2100
220 Ga0068856_100200222 3300005614 Bacteria 2011
221 Ga0068856_100370297 3300005614 Bacteria 1451
222 Ga0068852_100000125 3300005616 Bacteria 51289
223 Ga0068852_100014115 3300005616 Bacteria 6135
224 Ga0068852_100026612 3300005616 Bacteria 4705
225 Ga0068852_100082733 3300005616 Bacteria 2853
226 Ga0068852_100118615 3300005616 Bacteria 2418
227 Ga0068852_100183424 3300005616 Bacteria 1969
228 Ga0068852_100299682 3300005616 Bacteria 1556
229 Ga0068852_100369704 3300005616 Bacteria 1404
230 Ga0068859_100000584 3300005617 Bacteria 36403
231 Ga0068859_100005779 3300005617 Bacteria 12568
232 Ga0068864_100061987 3300005618 Bacteria 3239
233 Ga0068866_10033926 3300005718 Bacteria 2481
234 Ga0068861_100000212 3300005719 Bacteria 31389
235 Ga0068851_10000296 3300005834 Bacteria 22769
236 Ga0068851_10001581 3300005834 Bacteria 9995
237 Ga0068851_10006366 3300005834 Bacteria 5389
238 Ga0068851_10006888 3300005834 Bacteria 5208
239 Ga0068851_10011383 3300005834 Bacteria 4170
240 Ga0068870_10000270 3300005840 Bacteria 19231
241 Ga0068863_100003408 3300005841 Bacteria 15676
242 Ga0068858_100000235 3300005842 Bacteria 60058
243 Ga0068858_100115444 3300005842 Bacteria 2509
244 Ga0068858_100137002 3300005842 Bacteria 2297
245 Ga0068858_100494183 3300005842 Bacteria 1182
246 Ga0068860_100008370 3300005843 Bacteria 10299
247 Ga0068860_100027269 3300005843 Bacteria 5503
248 Ga0068860_100039323 3300005843 Bacteria 4523
249 Ga0068860_100075407 3300005843 Bacteria 3208
250 Ga0068860_100088566 3300005843 Bacteria 2946
251 Ga0068860_100091046 3300005843 Bacteria 2906
252 Ga0068860_100105022 3300005843 Bacteria 2697
253 Ga0068860_100314870 3300005843 Bacteria 1535
254 Ga0068862_100000715 3300005844 Bacteria 33766
255 Ga0068862_100003864 3300005844 Bacteria 12752
256 Ga0081540_1000271 3300005983 Bacteria 54093
257 Ga0081540_1001028 3300005983 Bacteria 24988
258 Ga0081540_1004991 3300005983 Bacteria 9974
259 Ga0081540_1007399 3300005983 Bacteria 7831
260 Ga0081539_10043946 3300005985 Bacteria 2584
261 Ga0070717_10009369 3300006028 Bacteria 7353
262 Ga0075369_10104623 3300006186 Bacteria 1272
263 Ga0075366_10001930 3300006195 Bacteria 10472
264 Ga0097621_100032392 3300006237 Bacteria 4154
265 Ga0097621_100106252 3300006237 Bacteria 2368
266 Ga0097621_100132123 3300006237 Bacteria 2126
267 Ga0097621_100191043 3300006237 Bacteria 1773
268 Ga0075370_10001519 3300006353 Bacteria 10149
269 Ga0068871_100065145 3300006358 Bacteria 2984
270 Ga0068871_100126293 3300006358 Bacteria 2165
271 Ga0075428_100142370 3300006844 Bacteria 2607
272 Ga0068865_100072891 3300006881 Bacteria 2440
273 Ga0068865_100083654 3300006881 Bacteria 2297
274 Ga0097620_100000584 3300006931 Bacteria 36403
275 Ga0097620_100005779 3300006931 Bacteria 12568
276 Ga0099794_10000152 3300007265 Bacteria 25621
277 Ga0105251_10026384 3300009011 Bacteria 2959
278 Ga0105240_10000705 3300009093 Bacteria 61261
279 Ga0105240_10004295 3300009093 Bacteria 21764
280 Ga0105240_10200597 3300009093 Bacteria 2338
281 Ga0111539_10196364 3300009094 Bacteria 2354
282 Ga0105245_10000012 3300009098 Bacteria 267151
283 Ga0105245_10000233 3300009098 Bacteria 52960
284 Ga0105245_10051880 3300009098 Bacteria 3677
285 Ga0105245_10279655 3300009098 Bacteria 1630
286 Ga0105247_10000321 3300009101 Bacteria 43053
287 Ga0105247_10026871 3300009101 Bacteria 3479
288 Ga0105247_10034781 3300009101 Bacteria 3069
289 Ga0105243_10003969 3300009148 Bacteria 11799
290 Ga0105243_10005321 3300009148 Bacteria 10058
291 Ga0105241_10017112 3300009174 Bacteria 5324
292 Ga0105241_10052667 3300009174 Bacteria 3109
293 Ga0105241_10356023 3300009174 Bacteria 1272
294 Ga0105242_10014473 3300009176 Bacteria 6112
295 Ga0105242_10104859 3300009176 Bacteria 2401
296 Ga0105242_10180272 3300009176 Bacteria 1863
297 Ga0105248_10000022 3300009177 Bacteria 275935
298 Ga0105248_10014599 3300009177 Bacteria 8643
299 Ga0105248_10033425 3300009177 Bacteria 5745
300 Ga0105248_10395772 3300009177 Bacteria 1555
301 Ga0105237_10000084 3300009545 Bacteria 125742
302 Ga0105237_10000549 3300009545 Bacteria 52724
303 Ga0105237_10002875 3300009545 Bacteria 20938
304 Ga0105237_10134869 3300009545 Bacteria 2463
305 Ga0105238_10000154 3300009551 Bacteria 75243
306 Ga0105238_10000805 3300009551 Bacteria 32542
307 Ga0105238_10023407 3300009551 Bacteria 6295
308 Ga0105238_10026777 3300009551 Bacteria 5877
309 Ga0105238_10109990 3300009551 Bacteria 2737
310 Ga0105238_10221147 3300009551 Bacteria 1870
311 Ga0105238_10291842 3300009551 Bacteria 1613
312 Ga0105238_10430241 3300009551 Bacteria 1315
313 Ga0105249_10000265 3300009553 Bacteria 55931
314 Ga0105249_10000533 3300009553 Bacteria 35077
315 Ga0105249_10445725 3300009553 Bacteria 1332
316 Ga0105239_10000174 3300010375 Bacteria 92922
317 Ga0105239_10002920 3300010375 Bacteria 21346
318 Ga0105239_10010596 3300010375 Bacteria 10308
319 Ga0105239_10018941 3300010375 Bacteria 7607
320 Ga0105239_10030730 3300010375 Bacteria 5908
321 Ga0105239_10040597 3300010375 Bacteria 5098
322 Ga0105239_10043604 3300010375 Bacteria 4918
323 Ga0105239_10059993 3300010375 Bacteria 4174
324 Ga0105239_10330830 3300010375 Bacteria 1719
325 Ga0105246_10001791 3300011119 Bacteria 12843
326 Ga0157373_10003504 3300013100 Bacteria 11871
327 Ga0157373_10069220 3300013100 Bacteria 2495
328 Ga0157371_10000351 3300013102 Bacteria 59170
329 Ga0157371_10017314 3300013102 Bacteria 5358
330 Ga0157371_10249288 3300013102 Bacteria 1278
331 Ga0157370_10011552 3300013104 Bacteria 9219
332 Ga0157370_10267377 3300013104 Bacteria 1580
333 Ga0157369_10000001 3300013105 Bacteria 554908
334 Ga0157369_10000829 3300013105 Bacteria 39534
335 Ga0157369_10001552 3300013105 Bacteria 28103
336 Ga0157369_10003652 3300013105 Bacteria 18258
337 Ga0157369_10004125 3300013105 Bacteria 17212
338 Ga0157369_10024303 3300013105 Bacteria 6744
339 Ga0157369_10143836 3300013105 Bacteria 2522
340 Ga0157369_10169829 3300013105 Bacteria 2298
341 Ga0157369_10282190 3300013105 Bacteria 1730
342 Ga0157374_10001656 3300013296 Bacteria 18645
343 Ga0157374_10010042 3300013296 Bacteria 8128
344 Ga0157374_10077334 3300013296 Bacteria 3149
345 Ga0157374_10143264 3300013296 Bacteria 2320
346 Ga0157378_10001829 3300013297 Bacteria 19101
347 Ga0157378_10004285 3300013297 Bacteria 12561
348 Ga0157378_10191648 3300013297 Bacteria 1928
349 Ga0163162_10000017 3300013306 Bacteria 233474
350 Ga0163162_10000647 3300013306 Bacteria 32241
351 Ga0163162_10002285 3300013306 Bacteria 18000
352 Ga0163162_10121814 3300013306 Bacteria 2713
353 Ga0163162_10188995 3300013306 Bacteria 2187
354 Ga0157372_10000403 3300013307 Bacteria 47787
355 Ga0157372_10008020 3300013307 Bacteria 11231
356 Ga0157372_10012371 3300013307 Bacteria 9094
357 Ga0157372_10019600 3300013307 Bacteria 7289
358 Ga0157372_10022364 3300013307 Bacteria 6840
359 Ga0157372_10121202 3300013307 Bacteria 3004
360 Ga0157372_10121718 3300013307 Bacteria 2998
361 Ga0157372_10212098 3300013307 Bacteria 2244
362 Ga0157372_10457316 3300013307 Bacteria 1488
363 Ga0163163_10000024 3300014325 Bacteria 185100
364 Ga0163163_10003591 3300014325 Bacteria 13184
365 Ga0163163_10276924 3300014325 Bacteria 1729
366 Ga0182008_10197902 3300014497 Bacteria 1022
367 Ga0157379_10001292 3300014968 Bacteria 20382
368 Ga0157379_10001814 3300014968 Bacteria 17638
369 Ga0157376_10023151 3300014969 Bacteria 4857
370 Ga0157376_10023163 3300014969 Bacteria 4856
371 Ga0157376_10084869 3300014969 Bacteria 2727
372 Ga0157376_10169901 3300014969 Bacteria 1984
373 Ga0182006_1000061 3300015261 Bacteria 156823
374 Ga0182006_1071795 3300015261 Bacteria 1282
375 Ga0182007_10006307 3300015262 Bacteria 5101
376 Ga0183369_1013 3300015685 Bacteria 222738
377 Ga0183368_1003 3300015687 Bacteria 1276390
378 Ga0163161_10025691 3300017792 Bacteria 4170
379 Ga0163161_10068249 3300017792 Bacteria 2598
380 Ga0206356_10807946 3300020070 Bacteria 4306
381 Ga0206356_11496191 3300020070 Bacteria 2178
382 Ga0206354_10278400 3300020081 Bacteria 2206
383 Ga0206353_10351104 3300020082 Bacteria 4988
384 Ga0224712_10023723 3300022467 Bacteria 2133
385 Ga0209784_100011 3300025224 Bacteria 546770
386 Ga0209566_101090 3300025225 Bacteria 10564
387 Ga0209566_105364 3300025225 Bacteria 1622
388 Ga0209674_100012 3300025226 Bacteria 950162
389 Ga0209674_100427 3300025226 Bacteria 20350
390 Ga0209674_100453 3300025226 Bacteria 18742
391 Ga0209674_101324 3300025226 Bacteria 6830
392 Ga0209672_100005 3300025228 Bacteria 1069303
393 Ga0209672_100055 3300025228 Bacteria 221655
394 Ga0209672_100124 3300025228 Bacteria 80646
395 Ga0209672_100706 3300025228 Bacteria 16637
396 Ga0209672_101177 3300025228 Bacteria 10674
397 Ga0209147_103557 3300025229 Bacteria 2964
398 Ga0209563_100045 3300025230 Bacteria 377102
399 Ga0207427_100026 3300025231 Bacteria 412764
400 Ga0207427_100053 3300025231 Bacteria 217191
401 Ga0207427_100134 3300025231 Bacteria 91077
402 Ga0207427_100150 3300025231 Bacteria 78685
403 Ga0209437_100005 3300025233 Bacteria 1071596
404 Ga0209437_100108 3300025233 Bacteria 217191
405 Ga0209437_100200 3300025233 Bacteria 119306
406 Ga0209437_100403 3300025233 Bacteria 40042
407 Ga0209437_100470 3300025233 Bacteria 30896
408 Ga0209437_102459 3300025233 Bacteria 3585
409 Ga0209258_100006 3300025242 Bacteria 1069303
410 Ga0209258_100012 3300025242 Bacteria 825544
411 Ga0209258_100027 3300025242 Bacteria 518449
412 Ga0209258_100055 3300025242 Bacteria 337291
413 Ga0209258_100255 3300025242 Bacteria 94924
414 Ga0207425_1000084 3300025245 Bacteria 95660
415 Ga0209646_1000825 3300025246 Bacteria 10423
416 Ga0209026_1000017 3300025250 Bacteria 385214
417 Ga0209026_1000084 3300025250 Bacteria 186997
418 Ga0209026_1000460 3300025250 Bacteria 31536
419 Ga0209026_1000548 3300025250 Bacteria 25899
420 Ga0209026_1001381 3300025250 Bacteria 10834
421 Ga0209677_103582 3300025253 Bacteria 4935
422 Ga0209148_1000001 3300025254 Bacteria 2545271
423 Ga0209148_1000002 3300025254 Bacteria 2399500
424 Ga0209148_1000012 3300025254 Bacteria 1069303
425 Ga0209148_1000014 3300025254 Bacteria 925277
426 Ga0209148_1000058 3300025254 Bacteria 357482
427 Ga0209148_1000221 3300025254 Bacteria 94627
428 Ga0209148_1002891 3300025254 Bacteria 5260
429 Ga0209759_1000674 3300025256 Bacteria 31257
430 Ga0209759_1000679 3300025256 Bacteria 30848
431 Ga0209759_1001340 3300025256 Bacteria 14397
432 Ga0209759_1012002 3300025256 Bacteria 2425
433 Ga0209129_1000057 3300025258 Bacteria 253632
434 Ga0209129_1000678 3300025258 Bacteria 22489
435 Ga0209129_1004398 3300025258 Bacteria 5518
436 Ga0209233_1000002 3300025261 Bacteria 2501366
437 Ga0209233_1000011 3300025261 Bacteria 1071611
438 Ga0209233_1000125 3300025261 Bacteria 217190
439 Ga0209233_1000193 3300025261 Bacteria 126812
440 Ga0209233_1000957 3300025261 Bacteria 12490
441 Ga0209233_1018598 3300025261 Bacteria 1866
442 Ga0209565_1000023 3300025263 Bacteria 388244
443 Ga0209455_1000008 3300025272 Bacteria 1069303
444 Ga0209455_1000014 3300025272 Bacteria 806601
445 Ga0209455_1000018 3300025272 Bacteria 718034
446 Ga0209455_1000019 3300025272 Bacteria 705658
447 Ga0209455_1000266 3300025272 Bacteria 59221
448 Ga0209673_1000116 3300025273 Bacteria 175933
449 Ga0209130_1006082 3300025284 Bacteria 4000
450 Ga0209675_1000016 3300025291 Bacteria 391965
451 Ga0209676_1000027 3300025292 Bacteria 560222
452 Ga0209676_1000037 3300025292 Bacteria 457562
453 Ga0209676_1000770 3300025292 Bacteria 42881
454 Ga0209676_1001488 3300025292 Bacteria 21557
455 Ga0209025_1000013 3300025294 Bacteria 871757
456 Ga0209564_1000347 3300025295 Bacteria 87112
457 Ga0209758_1000014 3300025297 Bacteria 871757
458 Ga0209758_1011282 3300025297 Bacteria 5199
459 Ga0209050_1001666 3300025298 Bacteria 22438
460 Ga0209051_1002629 3300025303 Bacteria 12613
461 Ga0209051_1022652 3300025303 Bacteria 2639
462 Ga0209257_1000067 3300025304 Bacteria 342468
463 Ga0209257_1000868 3300025304 Bacteria 42949
464 Ga0209257_1021765 3300025304 Bacteria 2314
465 Ga0207656_10000273 3300025321 Bacteria 17896
466 Ga0207656_10000936 3300025321 Bacteria 9521
467 Ga0207656_10003921 3300025321 Bacteria 5149
468 Ga0207656_10014641 3300025321 Bacteria 3026
469 Ga0207656_10164515 3300025321 Bacteria 1057
470 Ga0207713_1021190 3300025735 Bacteria 3122
471 Ga0207653_10052734 3300025885 Bacteria 1357
472 Ga0207642_10000233 3300025899 Bacteria 16508
473 Ga0207710_10000918 3300025900 Bacteria 15745
474 Ga0207710_10013427 3300025900 Bacteria 3446
475 Ga0207710_10074039 3300025900 Bacteria 1567
476 Ga0207688_10000282 3300025901 Bacteria 23216
477 Ga0207680_10000001 3300025903 Bacteria 1091453
478 Ga0207680_10045353 3300025903 Bacteria 2591
479 Ga0207647_10000016 3300025904 Bacteria 130866
480 Ga0207647_10000019 3300025904 Bacteria 123924
481 Ga0207647_10001000 3300025904 Bacteria 21924
482 Ga0207647_10003471 3300025904 Bacteria 11824
483 Ga0207647_10040824 3300025904 Bacteria 2920
484 Ga0207645_10000043 3300025907 Bacteria 85557
485 Ga0207645_10059751 3300025907 Bacteria 2435
486 Ga0207643_10000024 3300025908 Bacteria 103214
487 Ga0207643_10070829 3300025908 Bacteria 2006
488 Ga0207705_10002892 3300025909 Bacteria 13142
489 Ga0207705_10004208 3300025909 Bacteria 10914
490 Ga0207705_10007515 3300025909 Bacteria 8007
491 Ga0207705_10007619 3300025909 Bacteria 7960
492 Ga0207705_10030729 3300025909 Bacteria 3833
493 Ga0207705_10040151 3300025909 Bacteria 3355
494 Ga0207705_10065373 3300025909 Bacteria 2629
495 Ga0207705_10069872 3300025909 Bacteria 2544
496 Ga0207654_10000247 3300025911 Bacteria 32775
497 Ga0207654_10111079 3300025911 Bacteria 1706
498 Ga0207654_10176322 3300025911 Bacteria 1392
499 Ga0207654_10278853 3300025911 Bacteria 1130
500 Ga0207707_10000064 3300025912 Bacteria 107490
501 Ga0207707_10000544 3300025912 Bacteria 38374
502 Ga0207707_10000750 3300025912 Bacteria 31974
503 Ga0207707_10000846 3300025912 Bacteria 29949
504 Ga0207707_10014211 3300025912 Bacteria 6935
505 Ga0207707_10047546 3300025912 Bacteria 3736
506 Ga0207707_10056246 3300025912 Bacteria 3423
507 Ga0207707_10096162 3300025912 Bacteria 2588
508 Ga0207695_10000014 3300025913 Bacteria 812599
509 Ga0207695_10000683 3300025913 Bacteria 66533
510 Ga0207695_10006285 3300025913 Bacteria 15455
511 Ga0207695_10011844 3300025913 Bacteria 10520
512 Ga0207695_10014502 3300025913 Bacteria 9329
513 Ga0207695_10024286 3300025913 Bacteria 6824
514 Ga0207695_10025619 3300025913 Bacteria 6598
515 Ga0207695_10065505 3300025913 Bacteria 3736
516 Ga0207695_10072195 3300025913 Bacteria 3523
517 Ga0207695_10166559 3300025913 Bacteria 2132
518 Ga0207671_10000011 3300025914 Bacteria 530349
519 Ga0207671_10000507 3300025914 Bacteria 52802
520 Ga0207671_10000764 3300025914 Bacteria 40877
521 Ga0207671_10008592 3300025914 Bacteria 8635
522 Ga0207671_10020874 3300025914 Bacteria 4981
523 Ga0207671_10023665 3300025914 Bacteria 4629
524 Ga0207671_10083783 3300025914 Bacteria 2394
525 Ga0207671_10100320 3300025914 Bacteria 2192
526 Ga0207671_10253118 3300025914 Bacteria 1385
527 Ga0207660_10001310 3300025917 Bacteria 16622
528 Ga0207660_10011867 3300025917 Bacteria 5682
529 Ga0207660_10020370 3300025917 Bacteria 4449
530 Ga0207660_10031341 3300025917 Bacteria 3660
531 Ga0207660_10279193 3300025917 Bacteria 1325
532 Ga0207662_10000789 3300025918 Bacteria 14571
533 Ga0207657_10000655 3300025919 Bacteria 36836
534 Ga0207657_10001536 3300025919 Bacteria 24732
535 Ga0207657_10012284 3300025919 Bacteria 8460
536 Ga0207657_10070181 3300025919 Bacteria 2970
537 Ga0207657_10128646 3300025919 Bacteria 2078
538 Ga0207649_10000764 3300025920 Bacteria 20929
539 Ga0207649_10002004 3300025920 Bacteria 11584
540 Ga0207649_10005382 3300025920 Bacteria 6930
541 Ga0207649_10007176 3300025920 Bacteria 6056
542 Ga0207649_10016143 3300025920 Bacteria 4206
543 Ga0207649_10031029 3300025920 Bacteria 3172
544 Ga0207649_10136861 3300025920 Bacteria 1671
545 Ga0207649_10160508 3300025920 Bacteria 1557
546 Ga0207652_10000019 3300025921 Bacteria 164416
547 Ga0207652_10010900 3300025921 Bacteria 7326
548 Ga0207652_10012677 3300025921 Bacteria 6816
549 Ga0207652_10032171 3300025921 Bacteria 4407
550 Ga0207652_10067861 3300025921 Bacteria 3093
551 Ga0207694_10000932 3300025924 Bacteria 25926
552 Ga0207694_10002038 3300025924 Bacteria 16731
553 Ga0207694_10018861 3300025924 Bacteria 5214
554 Ga0207694_10022142 3300025924 Bacteria 4818
555 Ga0207694_10034796 3300025924 Bacteria 3863
556 Ga0207694_10165468 3300025924 Bacteria 1788
557 Ga0207694_10366128 3300025924 Bacteria 1195
558 Ga0207650_10000253 3300025925 Bacteria 58029
559 Ga0207650_10004303 3300025925 Bacteria 9718
560 Ga0207650_10033150 3300025925 Bacteria 3739
561 Ga0207659_10000881 3300025926 Bacteria 17822
562 Ga0207687_10000011 3300025927 Bacteria 388349
563 Ga0207687_10011977 3300025927 Bacteria 5672
564 Ga0207700_10000009 3300025928 Bacteria 314953
565 Ga0207700_10035503 3300025928 Bacteria 3592
566 Ga0207664_10000170 3300025929 Bacteria 51533
567 Ga0207664_10001851 3300025929 Bacteria 13957
568 Ga0207644_10001751 3300025931 Bacteria 14053
569 Ga0207644_10021077 3300025931 Bacteria 4437
570 Ga0207690_10000004 3300025932 Bacteria 746138
571 Ga0207690_10000982 3300025932 Bacteria 18292
572 Ga0207690_10003034 3300025932 Bacteria 10107
573 Ga0207690_10013105 3300025932 Bacteria 4974
574 Ga0207690_10030339 3300025932 Bacteria 3447
575 Ga0207690_10056854 3300025932 Bacteria 2641
576 Ga0207690_10098108 3300025932 Bacteria 2086
577 Ga0207690_10142025 3300025932 Bacteria 1770
578 Ga0207706_10003011 3300025933 Bacteria 16245
579 Ga0207706_10006207 3300025933 Bacteria 11102
580 Ga0207706_10044351 3300025933 Bacteria 3941
581 Ga0207706_10069767 3300025933 Bacteria 3091
582 Ga0207706_10301089 3300025933 Bacteria 1397
583 Ga0207686_10006134 3300025934 Bacteria 6457
584 Ga0207709_10001141 3300025935 Bacteria 19372
585 Ga0207709_10131964 3300025935 Bacteria 1704
586 Ga0207670_10000579 3300025936 Bacteria 20167
587 Ga0207670_10001748 3300025936 Bacteria 11358
588 Ga0207670_10271637 3300025936 Bacteria 1318
589 Ga0207704_10002349 3300025938 Bacteria 8497
590 Ga0207704_10072350 3300025938 Bacteria 2191
591 Ga0207704_10088731 3300025938 Bacteria 2024
592 Ga0207691_10000053 3300025940 Bacteria 91814
593 Ga0207691_10019400 3300025940 Bacteria 6435
594 Ga0207691_10285074 3300025940 Bacteria 1421
595 Ga0207711_10000019 3300025941 Bacteria 412779
596 Ga0207711_10000276 3300025941 Bacteria 55530
597 Ga0207711_10008039 3300025941 Bacteria 8828
598 Ga0207711_10332390 3300025941 Bacteria 1405
599 Ga0207689_10000026 3300025942 Bacteria 103610
600 Ga0207689_10150160 3300025942 Bacteria 1921
601 Ga0207661_10004864 3300025944 Bacteria 9413
602 Ga0207661_10027762 3300025944 Bacteria 4327
603 Ga0207661_10073018 3300025944 Bacteria 2808
604 Ga0207661_10079286 3300025944 Bacteria 2706
605 Ga0207679_10003088 3300025945 Bacteria 10309
606 Ga0207679_10012138 3300025945 Bacteria 5608
607 Ga0207667_10002465 3300025949 Bacteria 23112
608 Ga0207667_10007992 3300025949 Bacteria 12620
609 Ga0207667_10010895 3300025949 Bacteria 10600
610 Ga0207667_10018807 3300025949 Bacteria 7736
611 Ga0207667_10019090 3300025949 Bacteria 7665
612 Ga0207667_10105973 3300025949 Bacteria 2900
613 Ga0207667_10138174 3300025949 Bacteria 2509
614 Ga0207667_10177590 3300025949 Bacteria 2187
615 Ga0207651_10006649 3300025960 Bacteria 6081
616 Ga0207712_10000450 3300025961 Bacteria 34970
617 Ga0207712_10000601 3300025961 Bacteria 28655
618 Ga0207712_10001588 3300025961 Bacteria 15305
619 Ga0207668_10007821 3300025972 Bacteria 6360
620 Ga0207668_10045026 3300025972 Bacteria 3006
621 Ga0207668_10098713 3300025972 Bacteria 2164
622 Ga0207668_10177597 3300025972 Bacteria 1676
623 Ga0207640_10000059 3300025981 Bacteria 90901
624 Ga0207640_10000091 3300025981 Bacteria 71621
625 Ga0207640_10006608 3300025981 Bacteria 6370
626 Ga0207640_10010209 3300025981 Bacteria 5281
627 Ga0207640_10012249 3300025981 Bacteria 4880
628 Ga0207640_10030683 3300025981 Bacteria 3313
629 Ga0207658_10000112 3300025986 Bacteria 89146
630 Ga0207658_10000422 3300025986 Bacteria 40133
631 Ga0207658_10018176 3300025986 Bacteria 4850
632 Ga0207658_10140485 3300025986 Bacteria 1953
633 Ga0207677_10000080 3300026023 Bacteria 79544
634 Ga0207677_10000185 3300026023 Bacteria 50144
635 Ga0207677_10131583 3300026023 Bacteria 1901
636 Ga0207703_10000059 3300026035 Bacteria 134931
637 Ga0207703_10000250 3300026035 Bacteria 60636
638 Ga0207639_10000117 3300026041 Bacteria 61185
639 Ga0207639_10000304 3300026041 Bacteria 34871
640 Ga0207639_10000724 3300026041 Bacteria 22521
641 Ga0207639_10001033 3300026041 Bacteria 18907
642 Ga0207639_10001563 3300026041 Bacteria 15358
643 Ga0207639_10006027 3300026041 Bacteria 8222
644 Ga0207639_10021958 3300026041 Bacteria 4591
645 Ga0207639_10022666 3300026041 Bacteria 4525
646 Ga0207639_10047073 3300026041 Bacteria 3257
647 Ga0207639_10080391 3300026041 Bacteria 2578
648 Ga0207639_10152663 3300026041 Bacteria 1936
649 Ga0207639_10249849 3300026041 Bacteria 1546
650 Ga0207639_10255824 3300026041 Bacteria 1529
651 Ga0207678_10001367 3300026067 Bacteria 22498
652 Ga0207678_10004332 3300026067 Bacteria 12738
653 Ga0207678_10012031 3300026067 Bacteria 7599
654 Ga0207678_10019574 3300026067 Bacteria 5949
655 Ga0207678_10068756 3300026067 Bacteria 3038
656 Ga0207678_10084593 3300026067 Bacteria 2712
657 Ga0207678_10123341 3300026067 Bacteria 2211
658 Ga0207708_10027377 3300026075 Bacteria 4315
659 Ga0207702_10000146 3300026078 Bacteria 82931
660 Ga0207702_10002805 3300026078 Bacteria 16312
661 Ga0207702_10009776 3300026078 Bacteria 8050
662 Ga0207702_10096169 3300026078 Bacteria 2604
663 Ga0207702_10147131 3300026078 Bacteria 2139
664 Ga0207702_10210069 3300026078 Bacteria 1809
665 Ga0207641_10000473 3300026088 Bacteria 45531
666 Ga0207641_10354270 3300026088 Bacteria 1399
667 Ga0207648_10000105 3300026089 Bacteria 81343
668 Ga0207676_10000168 3300026095 Bacteria 57468
669 Ga0207676_10021807 3300026095 Bacteria 4704
670 Ga0207676_10711659 3300026095 Bacteria 974
671 Ga0207674_10005910 3300026116 Bacteria 14481
672 Ga0207674_10008599 3300026116 Bacteria 11768
673 Ga0207674_10019736 3300026116 Bacteria 7295
674 Ga0207674_10031405 3300026116 Bacteria 5581
675 Ga0207674_10068238 3300026116 Bacteria 3579
676 Ga0207674_10080365 3300026116 Bacteria 3264
677 Ga0207674_10274224 3300026116 Bacteria 1634
678 Ga0207675_100000233 3300026118 Bacteria 52659
679 Ga0207683_10000167 3300026121 Bacteria 56257
680 Ga0207683_10201255 3300026121 Bacteria 1810
681 Ga0207698_10001598 3300026142 Bacteria 13185
682 Ga0207698_10008057 3300026142 Bacteria 6644
683 Ga0207698_10009637 3300026142 Bacteria 6167
684 Ga0207698_10014742 3300026142 Bacteria 5208
685 Ga0207698_10016187 3300026142 Bacteria 5019
686 Ga0207698_10024256 3300026142 Bacteria 4254
687 Ga0207698_10053204 3300026142 Bacteria 3106
688 Ga0207698_10453690 3300026142 Bacteria 1238
689 Ga0207698_10573335 3300026142 Bacteria 1109
690 Ga0209371_1000007 3300027312 Bacteria 1050654
691 Ga0209371_1000088 3300027312 Bacteria 174446
692 Ga0209969_1021540 3300027360 Bacteria 962
693 Ga0209967_1008434 3300027364 Bacteria 1419
694 Ga0209999_1034164 3300027543 Bacteria 946
695 Ga0209588_1000048 3300027671 Bacteria 46399
696 Ga0209971_1002342 3300027682 Bacteria 4575
697 Ga0209974_10010484 3300027876 Bacteria 3126
698 Ga0209974_10053523 3300027876 Bacteria 1359
699 Ga0268266_10000001 3300028379 Bacteria 4040580
700 Ga0268266_10000007 3300028379 Bacteria 1372921
701 Ga0268266_10000075 3300028379 Bacteria 218045
702 Ga0268266_10000093 3300028379 Bacteria 191879
703 Ga0268266_10000493 3300028379 Bacteria 56412
704 Ga0268266_10000584 3300028379 Bacteria 50438
705 Ga0268266_10037056 3300028379 Bacteria 4155
706 Ga0268266_10061207 3300028379 Bacteria 3246
707 Ga0268266_10063996 3300028379 Bacteria 3176
708 Ga0268266_10079570 3300028379 Bacteria 2854
709 Ga0268265_10006004 3300028380 Bacteria 8261
710 Ga0268264_10000464 3300028381 Bacteria 55056
711 Ga0268264_10007883 3300028381 Bacteria 8862
712 Ga0268264_10016287 3300028381 Bacteria 6087
713 Ga0268264_10036734 3300028381 Bacteria 4036
714 Ga0268264_10067806 3300028381 Bacteria 3013
715 Ga0268264_10072286 3300028381 Bacteria 2925
716 Ga0268264_10281128 3300028381 Bacteria 1559
717 Ga0268256_1000008 3300030500 Bacteria 1050654
718 Ga0268256_1000079 3300030500 Bacteria 174445
719 Ga0316182_1373831 3300030745 Bacteria 1336
720 Ga0265332_10043912 3300031238 Bacteria 1929
721 Ga0265327_10001583 3300031251 Bacteria 27733
722 Ga0307516_10081484 3300031730 Bacteria 3079
723 Ga0307516_10102430 3300031730 Bacteria 2677
724 Ga0316577_10069180 3300031733 Bacteria 1972
725 Ga0307413_10068707 3300031824 Bacteria 2220
726 Ga0307406_10233448 3300031901 Bacteria 1375
727 Ga0307412_10000964 3300031911 Bacteria 16440
728 Ga0307416_100231026 3300032002 Bacteria 1783
729 Ga0307414_10010846 3300032004 Bacteria 5314
730 Ga0307414_10243913 3300032004 Bacteria 1489
731 Ga0307510_10000590 3300033180 Bacteria 36615
732 Ga0307510_10081025 3300033180 Bacteria 3151
733 Ga0316588_1014000 3300033528 Bacteria 1750
734 Ga0373930_0021398 3300034816 Bacteria 1270
735 Ga0316582_0108121 3300036647 Bacteria 1849
736 Ga0395899_0000076 3300037312 Bacteria 177673
737 Ga0395899_0005634 3300037312 Bacteria 9720
738 Ga0395899_0016051 3300037312 Bacteria 5709
739 Ga0395899_0029824 3300037312 Bacteria 4103
740 Ga0395899_0045910 3300037312 Bacteria 3255
741 Ga0395900_0000024 3300037418 Bacteria 323480
742 Ga0395900_0004448 3300037418 Bacteria 14847
743 Ga0395900_0014472 3300037418 Bacteria 8051
744 Ga0395900_0015314 3300037418 Bacteria 7817
745 Ga0395900_0020273 3300037418 Bacteria 6785
746 Ga0395900_0724568 3300037418 Bacteria 926
747 Ga0395898_0000044 3300037466 Bacteria 298164
748 Ga0395898_0000311 3300037466 Bacteria 112412
749 Ga0395898_0003642 3300037466 Bacteria 17126
750 Ga0395898_0249684 3300037466 Bacteria 1692
751 Ga0395905_0004228 3300037471 Bacteria 15006
752 Ga0395901_0008269 3300038443 Bacteria 10509
753 Ga0395901_0035663 3300038443 Bacteria 5139
754 Ga0395901_0315084 3300038443 Bacteria 1619
755 Ga0395901_0412867 3300038443 Bacteria 1385
756 Ga0237819_00065 3300038705 Bacteria 37820
757 Ga0436365_1660443 3300039437 Bacteria 1237
758 Ga0436361_0440406 3300039447 Bacteria 934
759 Ga0436363_1508025 3300039450 Bacteria 1517
760 Ga0439436_0000039 3300041404 Bacteria 41518
761 Ga0451793_0318385 3300041452 Bacteria 1720
762 Ga0451802_1800814 3300041460 Bacteria 1210
763 Ga0451841_0314351 3300041498 Bacteria 1321
764 Ga0451853_4032634 3300041512 Bacteria 1871
765 Ga0439454_011437 3300042011 Bacteria 1186
766 Ga0439458_0013252 3300042157 Bacteria 1856
767 Ga0450908_016352 3300042184 Bacteria 1323
768 Ga0451577_0019749 3300042876 Bacteria 6192
769 Ga0451577_0156318 3300042876 Bacteria 2053
770 Ga0466972_0120479 3300044658 Bacteria 1237
771 Ga0466989_0131196 3300044663 Bacteria 1524
772 Ga0466982_0000012 3300044672 Bacteria 166823
773 Ga0466982_0000069 3300044672 Bacteria 28015
774 Ga0466966_0013976 3300044684 Bacteria 5315
775 Ga0466961_0006799 3300044693 Bacteria 7279
776 Ga0466961_0020185 3300044693 Bacteria 4288
777 Ga0466964_0020282 3300044706 Bacteria 2559
778 Ga0466968_0000372 3300044735 Bacteria 14644
779 Ga0466968_0038297 3300044735 Bacteria 2014
780 Ga0466970_0001345 3300044765 Bacteria 11843
781 Ga0466970_0021689 3300044765 Bacteria 3347
782 Ga0466957_0000988 3300044842 Bacteria 14599
783 Ga0466957_0007712 3300044842 Bacteria 6088
784 Ga0466959_0000112 3300045049 Bacteria 52606
785 Ga0466958_0041319 3300045836 Bacteria 2773
786 Ga0466958_0085656 3300045836 Bacteria 1944
787 Ga0466967_0225688 3300045976 Bacteria 1782
788 Ga0466967_0372737 3300045976 Bacteria 1385
789 Ga0495617_000544 3300046452 Bacteria 19512
790 Ga0495592_0068831 3300046454 Bacteria 2583
791 Ga0495629_0000028 3300046459 Bacteria 127409
792 Ga0495638_0000019 3300046460 Bacteria 384671
793 Ga0495638_0006348 3300046460 Bacteria 8610
794 Ga0495638_0066790 3300046460 Bacteria 2209
795 Ga0495638_0070634 3300046460 Bacteria 2137
796 Ga0495641_0000012 3300046461 Bacteria 144818
797 Ga0495641_0182027 3300046461 Bacteria 941
798 Ga0495650_0000961 3300046471 Bacteria 33088
799 Ga0495650_0001680 3300046471 Bacteria 20441
800 Ga0495650_0001768 3300046471 Bacteria 19623
801 Ga0495580_0036251 3300046472 Bacteria 3542
802 Ga0495584_0000852 3300046491 Bacteria 19719
803 Ga0495585_0001031 3300046492 Bacteria 23176
804 Ga0495585_0005296 3300046492 Bacteria 8149
805 Ga0495594_0083560 3300046499 Bacteria 1785
806 Ga0495607_0000334 3300046501 Bacteria 48877
807 Ga0495607_0003817 3300046501 Bacteria 11364
808 Ga0495607_0011325 3300046501 Bacteria 5944
809 Ga0495606_0000113 3300046507 Bacteria 136805
810 Ga0495606_0000219 3300046507 Bacteria 101614
811 Ga0495606_0003641 3300046507 Bacteria 16179
812 Ga0495606_0108430 3300046507 Bacteria 1678
813 Ga0495608_0000001 3300046511 Bacteria 411278
814 Ga0495608_0003719 3300046511 Bacteria 10963
815 Ga0495616_0117266 3300046513 Bacteria 1231
816 Ga0495620_0000060 3300046515 Bacteria 95642
817 Ga0495620_0001178 3300046515 Bacteria 16001
818 Ga0495628_0035804 3300046516 Bacteria 3988
819 Ga0495628_0058034 3300046516 Bacteria 3043
820 Ga0495630_0000227 3300046517 Bacteria 44643
821 Ga0495631_0058718 3300046518 Bacteria 1672
822 Ga0495632_0000010 3300046519 Bacteria 272360
823 Ga0495632_0059417 3300046519 Bacteria 1860
824 Ga0495637_0085268 3300046520 Bacteria 1253
825 Ga0495648_0001511 3300046524 Bacteria 22786
826 Ga0495648_0099974 3300046524 Bacteria 1603
827 Ga0495609_0020466 3300046538 Bacteria 3058
828 Ga0495645_0224295 3300046543 Bacteria 1262
829 Ga0495667_0188232 3300046559 Bacteria 1323
830 Ga0495611_0000003 3300046648 Bacteria 395679
831 Ga0495611_0000857 3300046648 Bacteria 16666
832 Ga0495625_0000019 3300046660 Bacteria 298330
833 Ga0495625_0037278 3300046660 Bacteria 3568
834 Ga0495661_0057424 3300046665 Bacteria 2323
835 Ga0495657_0000002 3300046675 Bacteria 411958
836 Ga0495647_0000053 3300046681 Bacteria 31238
837 Ga0495613_0000242 3300046689 Bacteria 51661
838 Ga0495624_0000419 3300046690 Bacteria 33677
839 Ga0495670_0002544 3300046691 Bacteria 9010
840 Ga0495671_0001785 3300046692 Bacteria 13910
841 Ga0495649_0000784 3300046694 Bacteria 25529
842 Ga0495649_0002630 3300046694 Bacteria 12525
843 Ga0495649_0045773 3300046694 Bacteria 2384
844 Ga0495589_0000516 3300046794 Bacteria 27140
845 Ga0495600_0037710 3300046809 Bacteria 3143
846 Ga0495660_0000125 3300046810 Bacteria 84503
847 Ga0495660_0002931 3300046810 Bacteria 10682
848 Ga0495581_0130357 3300047315 Bacteria 1465
849 Ga0495604_0001604 3300047317 Bacteria 18634
850 Ga0495604_0098791 3300047317 Bacteria 2149
851 Ga0495676_0001744 3300047321 Bacteria 19010
852 Ga0495675_0000162 3300047444 Bacteria 47605
853 Ga0495679_000017 3300047446 Bacteria 263230
854 Ga0495673_0000004 3300047469 Bacteria 1354526
855 Ga0495673_0012171 3300047469 Bacteria 4579
856 Ga0495684_0007985 3300047471 Bacteria 8178
857 Ga0495686_0000117 3300047472 Bacteria 166073
858 Ga0495686_0004845 3300047472 Bacteria 10858
859 Ga0495686_0025565 3300047472 Bacteria 3869
860 Ga0495602_0000063 3300048088 Bacteria 104915
861 Ga0495602_0203472 3300048088 Bacteria 1509
862 Ga0496100_0005052 3300048903 Bacteria 7062
863 Ga0496100_0083587 3300048903 Bacteria 2162
864 Ga0496101_0296569 3300048904 Bacteria 1266
865 Ga0496102_0032094 3300048905 Bacteria 4717
866 Ga0496102_0422372 3300048905 Bacteria 1252
867 Ga0496104_0000012 3300048907 Bacteria 438011
868 Ga0496104_0467140 3300048907 Bacteria 1173
869 Ga0496105_0000011 3300048908 Bacteria 302186
870 Ga0496105_0000914 3300048908 Bacteria 20104
871 Ga0496106_0000637 3300048909 Bacteria 25174
872 Ga0496108_0000012 3300048911 Bacteria 258433
873 Ga0496109_0000246 3300048912 Bacteria 52127
874 Ga0496109_0012039 3300048912 Bacteria 7452
875 Ga0496110_0362131 3300048913 Bacteria 1321
876 Ga0496111_0015604 3300048914 Bacteria 5220
877 Ga0496112_0003022 3300048915 Bacteria 13751
878 Ga0496113_0147556 3300048916 Bacteria 1854
879 Ga0496114_0115480 3300048917 Bacteria 2303
880 Ga0496114_0246557 3300048917 Bacteria 1571
881 Ga0496114_0333770 3300048917 Bacteria 1340
882 Ga0496115_0000004 3300048918 Bacteria 319734
883 Ga0496115_0000060 3300048918 Bacteria 101954
884 Ga0496115_0000247 3300048918 Bacteria 48853
885 Ga0496115_0002188 3300048918 Bacteria 13999
886 Ga0496115_0052591 3300048918 Bacteria 3268
887 Ga0496117_0023276 3300048920 Bacteria 4943
888 Ga0496117_0100990 3300048920 Bacteria 1826
889 Ga0496118_0001026 3300048921 Bacteria 43467
890 Ga0496118_0004246 3300048921 Bacteria 17169
891 Ga0496118_0008143 3300048921 Bacteria 10915
892 Ga0496118_0017301 3300048921 Bacteria 6570
893 Ga0496119_0000306 3300048922 Bacteria 68399
894 Ga0496120_0000145 3300048923 Bacteria 119265
895 Ga0496120_0056783 3300048923 Bacteria 2207
896 Ga0496121_0000251 3300048924 Bacteria 113931
897 Ga0496121_0000593 3300048924 Bacteria 67965
898 Ga0496121_0018047 3300048924 Bacteria 7145
899 Ga0496121_0041801 3300048924 Bacteria 4000
900 Ga0496121_0240081 3300048924 Bacteria 1263
901 Ga0496122_0008859 3300048925 Bacteria 10735
902 Ga0496122_0029664 3300048925 Bacteria 4606
903 Ga0496123_0009630 3300048926 Bacteria 8671
904 Ga0496123_0018943 3300048926 Bacteria 5445
905 Ga0496124_0001043 3300048927 Bacteria 43756
906 Ga0496124_0244663 3300048927 Bacteria 1331
907 Ga0496125_0000239 3300048928 Bacteria 112926
908 Ga0496125_0023701 3300048928 Bacteria 5658
909 Ga0496126_0000253 3300048929 Bacteria 115336
910 Ga0496126_0000712 3300048929 Bacteria 60417
911 Ga0496126_0115714 3300048929 Bacteria 2331
912 Ga0496126_0256869 3300048929 Bacteria 1454
913 Ga0495678_001135 3300049459 Bacteria 22118
914 Ga0495678_067479 3300049459 Bacteria 1321
915 Ga0495682_0035008 3300049460 Bacteria 1850
916 Ga0501031_0029350 3300049568 Bacteria 3587
917 Ga0501031_0045711 3300049568 Bacteria 2857
918 Ga0501031_0138479 3300049568 Bacteria 1590
919 Ga0501032_0009348 3300049569 Bacteria 7102
920 Ga0501032_0045363 3300049569 Bacteria 2973
921 Ga0501033_0001322 3300049570 Bacteria 22031
922 Ga0501033_0001421 3300049570 Bacteria 21264
923 Ga0501033_0095900 3300049570 Bacteria 2167
924 Ga0501033_0382947 3300049570 Bacteria 982
925 Ga0501034_0001157 3300049571 Bacteria 36580
926 Ga0501034_0001814 3300049571 Bacteria 27184
927 Ga0501034_0005729 3300049571 Bacteria 13505
928 Ga0501034_0070822 3300049571 Bacteria 3497
929 Ga0501034_0103290 3300049571 Bacteria 2843
930 Ga0501034_0204653 3300049571 Bacteria 1930
931 Ga0501034_0246131 3300049571 Bacteria 1733
932 Ga0501036_0032187 3300049572 Bacteria 4431
933 Ga0501036_0036254 3300049572 Bacteria 4173
934 Ga0501036_0098182 3300049572 Bacteria 2476
935 Ga0501036_0422905 3300049572 Bacteria 1111
936 Ga0501037_0002431 3300049573 Bacteria 13468
937 Ga0501037_0061848 3300049573 Bacteria 2730
938 Ga0501037_0075291 3300049573 Bacteria 2451
939 Ga0501038_0005383 3300049574 Bacteria 11892
940 Ga0501038_0006872 3300049574 Bacteria 10509
941 Ga0501038_0053267 3300049574 Bacteria 3484
942 Ga0501038_0060385 3300049574 Bacteria 3245
943 Ga0501038_0122747 3300049574 Bacteria 2140
944 Ga0501038_0159177 3300049574 Bacteria 1836
945 Ga0501039_0088674 3300049575 Bacteria 2409
946 Ga0501042_0057834 3300049578 Bacteria 2767
947 Ga0501043_0013218 3300049579 Bacteria 6454
948 Ga0501043_0062761 3300049579 Bacteria 2918
949 Ga0501043_0088370 3300049579 Bacteria 2435
950 Ga0501043_0130484 3300049579 Bacteria 1969
951 Ga0501043_0295356 3300049579 Bacteria 1239
952 Ga0501046_0007493 3300049580 Bacteria 9580
953 Ga0501046_0045641 3300049580 Bacteria 3480
954 Ga0501046_0070638 3300049580 Bacteria 2714
955 Ga0501046_0093723 3300049580 Bacteria 2308
956 Ga0501047_0001250 3300049581 Bacteria 25172
957 Ga0501047_0008124 3300049581 Bacteria 9905
958 Ga0501047_0008409 3300049581 Bacteria 9739
959 Ga0501047_0018198 3300049581 Bacteria 6733
960 Ga0501047_0072439 3300049581 Bacteria 3316
961 Ga0501047_0212484 3300049581 Bacteria 1792
962 Ga0501047_0426161 3300049581 Bacteria 1158
963 Ga0501047_0437589 3300049581 Bacteria 1138
964 Ga0501048_0097270 3300049582 Bacteria 2076
965 Ga0501048_0137690 3300049582 Bacteria 1725
966 Ga0501067_0006675 3300049583 Bacteria 6405
967 Ga0501067_0029608 3300049583 Bacteria 3034
968 Ga0501068_0004484 3300049584 Bacteria 7604
969 Ga0501068_0091867 3300049584 Bacteria 1873
970 Ga0501068_0175762 3300049584 Bacteria 1353
971 Ga0501070_0001427 3300049586 Bacteria 21397
972 Ga0501070_0008994 3300049586 Bacteria 8450
973 Ga0501070_0012316 3300049586 Bacteria 7217
974 Ga0501070_0013528 3300049586 Bacteria 6878
975 Ga0501070_0062366 3300049586 Bacteria 3088
976 Ga0501070_0088946 3300049586 Bacteria 2556
977 Ga0501070_0147010 3300049586 Bacteria 1945
978 Ga0501071_0101198 3300049587 Bacteria 2124
979 Ga0501073_0006900 3300049589 Bacteria 8451
980 Ga0501073_0092302 3300049589 Bacteria 2104
981 Ga0501073_0096487 3300049589 Bacteria 2053
982 Ga0501073_0105507 3300049589 Bacteria 1955
983 Ga0501073_0135853 3300049589 Bacteria 1704
984 Ga0501074_0010104 3300049590 Bacteria 6853
985 Ga0501074_0072163 3300049590 Bacteria 2480
986 Ga0501074_0148951 3300049590 Bacteria 1673
987 Ga0501075_0369376 3300049591 Bacteria 1093
988 Ga0501076_0104928 3300049592 Bacteria 2281
989 Ga0501076_0142888 3300049592 Bacteria 1945
990 Ga0501079_0041666 3300049741 Bacteria 3545
991 Ga0501079_0105838 3300049741 Bacteria 2183
992 Ga0501079_0372548 3300049741 Bacteria 1119
993 Ga0501080_0016955 3300049742 Bacteria 6726
994 Ga0501080_0043756 3300049742 Bacteria 4169
995 Ga0501080_0045456 3300049742 Bacteria 4087
996 Ga0501080_0177449 3300049742 Bacteria 1962
997 Ga0501083_0010479 3300049744 Bacteria 6525
998 Ga0501083_0045729 3300049744 Bacteria 2960
999 Ga0501035_0070197 3300049822 Bacteria 3103
1000 Ga0501035_0128312 3300049822 Bacteria 2212
1001 Ga0501035_0319937 3300049822 Bacteria 1303
1002 Ga0501044_0065626 3300049823 Bacteria 3701
1003 Ga0501044_0095901 3300049823 Bacteria 2988
1004 Ga0501044_0337098 3300049823 Bacteria 1429
1005 Ga0501045_0273219 3300049824 Bacteria 1258
1006 Ga0495601_0000281 3300053077 Bacteria 27326
1007 Ga0495601_0002233 3300053077 Bacteria 10903
1008 Ga0500610_0018754 3300053079 Bacteria 3352
1009 Ga0495595_0000001 3300053084 Bacteria 495226
1010 Ga0495619_0000708 3300053085 Bacteria 21719
1011 Ga0495619_0018450 3300053085 Bacteria 4426
1012 Ga0500643_000004 3300053087 Bacteria 857484
1013 Ga0500643_000223 3300053087 Bacteria 52940
1014 Ga0500643_002293 3300053087 Bacteria 10032
1015 Ga0500651_0000244 3300053093 Bacteria 33238
1016 Ga0500651_0000401 3300053093 Bacteria 23578
1017 Ga0500555_000290 3300053103 Bacteria 21695
1018 Ga0500597_077126 3300053120 Bacteria 1444
1019 Ga0500607_001366 3300053121 Bacteria 22173
1020 Ga0500614_001872 3300053123 Bacteria 4853
1021 Ga0500559_0003476 3300053136 Bacteria 7731
1022 Ga0500568_0005462 3300053139 Bacteria 6563
1023 Ga0500604_0000017 3300053151 Bacteria 82010
1024 Ga0500616_0003013 3300053153 Bacteria 13278
1025 Ga0500616_0004209 3300053153 Bacteria 10369
1026 Ga0500622_0018882 3300053156 Bacteria 3664
1027 Ga0500645_000648 3300053730 Bacteria 22062
1028 Ga0500645_000748 3300053730 Bacteria 19970
1029 Ga0500645_006858 3300053730 Bacteria 4024
1030 Ga0500587_005038 3300053739 Bacteria 1792
1031 Ga0501084_0089267 3300054114 Bacteria 2587
1032 Ga0587109_029276 3300059624 Bacteria 1036
1033 Ga0587117_014431 3300059627 Bacteria 1026
1034 Ga0501082_0000524 3300060353 Bacteria 34045
1035 Ga0466962_0011774 3300061719 Bacteria 4213
1036 Ga0466962_0020327 3300061719 Bacteria 3190
1037 Ga0466962_0087573 3300061719 Bacteria 1491
1038 Ga0530510_0162010 3300061734 Bacteria 1655

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013105 Ga0157369_10000001 Ga0157369_10000001237 227
2 3300006237 Ga0097621_100132123 Ga0097621_1001321232 248
3 3300013105 Ga0157369_10024303 Ga0157369_100243036 248
4 3300013307 Ga0157372_10022364 Ga0157372_100223645 248
5 3300048088 Ga0495602_0203472 Ga0495602_0203472_123_1004 260
6 3300053085 Ga0495619_0018450 Ga0495619_0018450_229_1110 260
7 3300053077 Ga0495601_0002233 Ga0495601_0002233_4213_5094 261
8 3300053151 Ga0500604_0000017 Ga0500604_0000017_10378_11229 267
9 3300042157 Ga0439458_0013252 Ga0439458_0013252_163_1053 268
10 3300005334 Ga0068869_100126787 Ga0068869_1001267872 269
11 3300047315 Ga0495581_0130357 Ga0495581_0130357_315_1232 269
12 3300010375 Ga0105239_10010596 Ga0105239_100105966 270
13 3300006237 Ga0097621_100106252 Ga0097621_1001062522 271
14 3300014325 Ga0163163_10000024 Ga0163163_1000002414 271
15 3300031901 Ga0307406_10233448 Ga0307406_102334481 274
16 3300006353 Ga0075370_10001519 Ga0075370_100015192 275
17 3300049571 Ga0501034_0246131 Ga0501034_0246131_499_1383 275
18 3300049572 Ga0501036_0422905 Ga0501036_0422905_32_907 275
19 3300053121 Ga0500607_001366 Ga0500607_001366_12905_13795 275
20 3300053136 Ga0500559_0003476 Ga0500559_0003476_6073_6963 275
21 3300053156 Ga0500622_0018882 Ga0500622_0018882_935_1825 275
22 3300053730 Ga0500645_000748 Ga0500645_000748_7334_8224 275
23 3300005338 Ga0068868_100435306 Ga0068868_1004353061 276
24 3300005439 Ga0070711_100312550 Ga0070711_1003125502 276
25 3300005548 Ga0070665_100101092 Ga0070665_1001010922 276
26 3300005618 Ga0068864_100061987 Ga0068864_1000619873 276
27 3300005843 Ga0068860_100105022 Ga0068860_1001050223 276
28 3300009553 Ga0105249_10445725 Ga0105249_104457251 276
29 3300013306 Ga0163162_10188995 Ga0163162_101889952 276
30 3300014325 Ga0163163_10003591 Ga0163163_100035917 276
31 3300014968 Ga0157379_10001814 Ga0157379_1000181412 276
32 3300025924 Ga0207694_10366128 Ga0207694_103661281 276
33 3300026088 Ga0207641_10354270 Ga0207641_103542702 276
34 3300026095 Ga0207676_10021807 Ga0207676_100218072 276
35 3300028379 Ga0268266_10079570 Ga0268266_100795701 276
36 3300028381 Ga0268264_10036734 Ga0268264_100367342 276
37 3300034816 Ga0373930_0021398 Ga0373930_0021398_65_949 276
38 3300041512 Ga0451853_4032634 Ga0451853_4032634_301_1176 276
39 3300048917 Ga0496114_0333770 Ga0496114_0333770_78_953 276
40 3300048918 Ga0496115_0052591 Ga0496115_0052591_1934_2815 276
41 3300049568 Ga0501031_0029350 Ga0501031_0029350_108_980 276
42 3300049570 Ga0501033_0001421 Ga0501033_0001421_708_1580 276
43 3300049571 Ga0501034_0103290 Ga0501034_0103290_1264_2136 276
44 3300049572 Ga0501036_0036254 Ga0501036_0036254_3270_4142 276
45 3300049573 Ga0501037_0061848 Ga0501037_0061848_1263_2135 276
46 3300049574 Ga0501038_0006872 Ga0501038_0006872_4892_5764 276
47 3300049575 Ga0501039_0088674 Ga0501039_0088674_801_1673 276
48 3300049578 Ga0501042_0057834 Ga0501042_0057834_95_967 276
49 3300049579 Ga0501043_0013218 Ga0501043_0013218_3431_4303 276
50 3300049580 Ga0501046_0045641 Ga0501046_0045641_344_1216 276
51 3300049582 Ga0501048_0137690 Ga0501048_0137690_301_1173 276
52 3300049583 Ga0501067_0029608 Ga0501067_0029608_552_1424 276
53 3300049584 Ga0501068_0175762 Ga0501068_0175762_48_923 276
54 3300049586 Ga0501070_0013528 Ga0501070_0013528_4920_5792 276
55 3300049587 Ga0501071_0101198 Ga0501071_0101198_374_1246 276
56 3300049589 Ga0501073_0006900 Ga0501073_0006900_2393_3265 276
57 3300049589 Ga0501073_0135853 Ga0501073_0135853_715_1587 276
58 3300049590 Ga0501074_0072163 Ga0501074_0072163_1169_2041 276
59 3300049590 Ga0501074_0148951 Ga0501074_0148951_416_1288 276
60 3300049592 Ga0501076_0142888 Ga0501076_0142888_984_1856 276
61 3300049741 Ga0501079_0041666 Ga0501079_0041666_1825_2697 276
62 3300049744 Ga0501083_0045729 Ga0501083_0045729_1971_2843 276
63 3300049822 Ga0501035_0128312 Ga0501035_0128312_1264_2136 276
64 3300049822 Ga0501035_0319937 Ga0501035_0319937_386_1258 276
65 3300049823 Ga0501044_0095901 Ga0501044_0095901_1682_2554 276
66 3300049823 Ga0501044_0337098 Ga0501044_0337098_60_932 276
67 3300061734 Ga0530510_0162010 Ga0530510_0162010_657_1529 276
68 3300005458 Ga0070681_10000012 Ga0070681_1000001244 277
69 3300005530 Ga0070679_100611914 Ga0070679_1006119141 277
70 3300005539 Ga0068853_100092077 Ga0068853_1000920772 277
71 3300005547 Ga0070693_100018210 Ga0070693_1000182102 277
72 3300005614 Ga0068856_100370297 Ga0068856_1003702972 277
73 3300005616 Ga0068852_100183424 Ga0068852_1001834242 277
74 3300005834 Ga0068851_10011383 Ga0068851_100113832 277
75 3300006237 Ga0097621_100191043 Ga0097621_1001910432 277
76 3300006881 Ga0068865_100083654 Ga0068865_1000836542 277
77 3300013296 Ga0157374_10077334 Ga0157374_100773342 277
78 3300025912 Ga0207707_10000544 Ga0207707_100005443 277
79 3300025938 Ga0207704_10088731 Ga0207704_100887311 277
80 3300026041 Ga0207639_10080391 Ga0207639_100803912 277
81 3300026041 Ga0207639_10249849 Ga0207639_102498491 277
82 3300026116 Ga0207674_10274224 Ga0207674_102742242 277
83 3300026142 Ga0207698_10453690 Ga0207698_104536902 277
84 3300031824 Ga0307413_10068707 Ga0307413_100687072 277
85 3300032004 Ga0307414_10010846 Ga0307414_100108462 277
86 3300045976 Ga0466967_0372737 Ga0466967_0372737_457_1335 277
87 3300049574 Ga0501038_0053267 Ga0501038_0053267_444_1322 277
88 3300053087 Ga0500643_000004 Ga0500643_000004_628729_629619 277
89 3300053153 Ga0500616_0004209 Ga0500616_0004209_8947_9837 277
90 3300003214 JGI25165J46597_1011312 JGI25165J46597_10113122 279
91 3300005336 Ga0070680_100100839 Ga0070680_1001008392 279
92 3300005337 Ga0070682_100009277 Ga0070682_1000092775 279
93 3300005337 Ga0070682_100158789 Ga0070682_1001587891 279
94 3300005337 Ga0070682_100168330 Ga0070682_1001683302 279
95 3300005339 Ga0070660_100476096 Ga0070660_1004760961 279
96 3300005340 Ga0070689_100265442 Ga0070689_1002654421 279
97 3300005344 Ga0070661_100045981 Ga0070661_1000459812 279
98 3300005366 Ga0070659_100026223 Ga0070659_1000262232 279
99 3300005458 Ga0070681_10042989 Ga0070681_100429893 279
100 3300005530 Ga0070679_100046312 Ga0070679_1000463122 279
101 3300005539 Ga0068853_100068171 Ga0068853_1000681712 279
102 3300005546 Ga0070696_100011107 Ga0070696_1000111075 279
103 3300005547 Ga0070693_100148187 Ga0070693_1001481872 279
104 3300005614 Ga0068856_100200222 Ga0068856_1002002222 279
105 3300005843 Ga0068860_100088566 Ga0068860_1000885662 279
106 3300009174 Ga0105241_10356023 Ga0105241_103560232 279
107 3300009176 Ga0105242_10180272 Ga0105242_101802723 279
108 3300009551 Ga0105238_10026777 Ga0105238_100267774 279
109 3300009551 Ga0105238_10109990 Ga0105238_101099902 279
110 3300009551 Ga0105238_10291842 Ga0105238_102918421 279
111 3300013102 Ga0157371_10249288 Ga0157371_102492882 279
112 3300013105 Ga0157369_10282190 Ga0157369_102821902 279
113 3300013307 Ga0157372_10019600 Ga0157372_100196004 279
114 3300014497 Ga0182008_10197902 Ga0182008_101979021 279
115 3300025907 Ga0207645_10059751 Ga0207645_100597513 279
116 3300025908 Ga0207643_10070829 Ga0207643_100708292 279
117 3300025909 Ga0207705_10065373 Ga0207705_100653732 279
118 3300025911 Ga0207654_10000247 Ga0207654_1000024727 279
119 3300025911 Ga0207654_10176322 Ga0207654_101763222 279
120 3300025912 Ga0207707_10056246 Ga0207707_100562462 279
121 3300025913 Ga0207695_10166559 Ga0207695_101665595 279
122 3300025917 Ga0207660_10031341 Ga0207660_100313412 279
123 3300025921 Ga0207652_10032171 Ga0207652_100321712 279
124 3300025924 Ga0207694_10022142 Ga0207694_100221422 279
125 3300025924 Ga0207694_10165468 Ga0207694_101654682 279
126 3300025929 Ga0207664_10000170 Ga0207664_100001709 279
127 3300025932 Ga0207690_10013105 Ga0207690_100131051 279
128 3300025934 Ga0207686_10006134 Ga0207686_100061346 279
129 3300025940 Ga0207691_10019400 Ga0207691_100194004 279
130 3300025949 Ga0207667_10002465 Ga0207667_1000246513 279
131 3300026041 Ga0207639_10001563 Ga0207639_1000156310 279
132 3300026116 Ga0207674_10080365 Ga0207674_100803653 279
133 3300028381 Ga0268264_10007883 Ga0268264_100078834 279
134 3300031251 Ga0265327_10001583 Ga0265327_1000158314 279
135 3300038443 Ga0395901_0008269 Ga0395901_0008269_9584_10456 279
136 3300046543 Ga0495645_0224295 Ga0495645_0224295_201_1076 279
137 3300048907 Ga0496104_0000012 Ga0496104_0000012_166517_167389 279
138 3300048908 Ga0496105_0000011 Ga0496105_0000011_270626_271498 279
139 3300049571 Ga0501034_0001157 Ga0501034_0001157_624_1496 279
140 3300049571 Ga0501034_0070822 Ga0501034_0070822_852_1724 279
141 3300049572 Ga0501036_0098182 Ga0501036_0098182_1097_1969 279
142 3300049574 Ga0501038_0060385 Ga0501038_0060385_1480_2352 279
143 3300049579 Ga0501043_0062761 Ga0501043_0062761_2019_2891 279
144 3300049579 Ga0501043_0295356 Ga0501043_0295356_240_1112 279
145 3300049580 Ga0501046_0070638 Ga0501046_0070638_1565_2437 279
146 3300049581 Ga0501047_0001250 Ga0501047_0001250_23670_24542 279
147 3300049581 Ga0501047_0008409 Ga0501047_0008409_8805_9677 279
148 3300049581 Ga0501047_0072439 Ga0501047_0072439_1939_2811 279
149 3300049583 Ga0501067_0006675 Ga0501067_0006675_694_1566 279
150 3300049584 Ga0501068_0004484 Ga0501068_0004484_1122_1994 279
151 3300049584 Ga0501068_0091867 Ga0501068_0091867_318_1190 279
152 3300049586 Ga0501070_0012316 Ga0501070_0012316_478_1350 279
153 3300049586 Ga0501070_0147010 Ga0501070_0147010_550_1422 279
154 3300049589 Ga0501073_0092302 Ga0501073_0092302_750_1622 279
155 3300049589 Ga0501073_0096487 Ga0501073_0096487_286_1158 279
156 3300049590 Ga0501074_0010104 Ga0501074_0010104_4389_5261 279
157 3300049741 Ga0501079_0105838 Ga0501079_0105838_1275_2147 279
158 3300049741 Ga0501079_0372548 Ga0501079_0372548_54_926 279
159 3300049742 Ga0501080_0016955 Ga0501080_0016955_4668_5540 279
160 3300049742 Ga0501080_0043756 Ga0501080_0043756_631_1503 279
161 3300049742 Ga0501080_0045456 Ga0501080_0045456_2075_2947 279
162 3300049742 Ga0501080_0177449 Ga0501080_0177449_711_1583 279
163 3300049744 Ga0501083_0010479 Ga0501083_0010479_5326_6198 279
164 3300059624 Ga0587109_029276 Ga0587109_029276_47_1003 279
165 3300059627 Ga0587117_014431 Ga0587117_014431_26_982 279
166 3300001979 JGI24740J21852_10007220 JGI24740J21852_100072203 280
167 3300005327 Ga0070658_10138710 Ga0070658_101387102 280
168 3300005336 Ga0070680_100001055 Ga0070680_10000105522 280
169 3300005337 Ga0070682_100113106 Ga0070682_1001131061 280
170 3300005339 Ga0070660_100241840 Ga0070660_1002418402 280
171 3300005341 Ga0070691_10004209 Ga0070691_100042092 280
172 3300005345 Ga0070692_10072430 Ga0070692_100724302 280
173 3300005366 Ga0070659_100199321 Ga0070659_1001993212 280
174 3300005435 Ga0070714_100001345 Ga0070714_10000134514 280
175 3300005457 Ga0070662_100062140 Ga0070662_1000621402 280
176 3300005458 Ga0070681_10004142 Ga0070681_1000414215 280
177 3300005458 Ga0070681_10008223 Ga0070681_100082234 280
178 3300005530 Ga0070679_100001207 Ga0070679_10000120725 280
179 3300005539 Ga0068853_100081447 Ga0068853_1000814472 280
180 3300005546 Ga0070696_100015936 Ga0070696_1000159362 280
181 3300005546 Ga0070696_100019688 Ga0070696_1000196884 280
182 3300005546 Ga0070696_100095863 Ga0070696_1000958632 280
183 3300005563 Ga0068855_100342779 Ga0068855_1003427792 280
184 3300005564 Ga0070664_100224010 Ga0070664_1002240102 280
185 3300005578 Ga0068854_100020186 Ga0068854_1000201864 280
186 3300005614 Ga0068856_100098538 Ga0068856_1000985382 280
187 3300005614 Ga0068856_100145680 Ga0068856_1001456802 280
188 3300005616 Ga0068852_100026612 Ga0068852_1000266125 280
189 3300005616 Ga0068852_100369704 Ga0068852_1003697042 280
190 3300005834 Ga0068851_10001581 Ga0068851_100015812 280
191 3300009174 Ga0105241_10052667 Ga0105241_100526672 280
192 3300009551 Ga0105238_10023407 Ga0105238_100234075 280
193 3300013100 Ga0157373_10069220 Ga0157373_100692201 280
194 3300013102 Ga0157371_10017314 Ga0157371_100173145 280
195 3300013104 Ga0157370_10011552 Ga0157370_100115528 280
196 3300013104 Ga0157370_10267377 Ga0157370_102673772 280
197 3300013105 Ga0157369_10169829 Ga0157369_101698292 280
198 3300013296 Ga0157374_10010042 Ga0157374_100100428 280
199 3300013306 Ga0163162_10000017 Ga0163162_10000017160 280
200 3300013307 Ga0157372_10212098 Ga0157372_102120982 280
201 3300014969 Ga0157376_10169901 Ga0157376_101699011 280
202 3300020070 Ga0206356_10807946 Ga0206356_108079462 280
203 3300020082 Ga0206353_10351104 Ga0206353_103511042 280
204 3300025321 Ga0207656_10014641 Ga0207656_100146412 280
205 3300025904 Ga0207647_10001000 Ga0207647_1000100021 280
206 3300025909 Ga0207705_10002892 Ga0207705_100028925 280
207 3300025909 Ga0207705_10004208 Ga0207705_1000420812 280
208 3300025909 Ga0207705_10040151 Ga0207705_100401513 280
209 3300025911 Ga0207654_10111079 Ga0207654_101110792 280
210 3300025912 Ga0207707_10000064 Ga0207707_1000006489 280
211 3300025912 Ga0207707_10000750 Ga0207707_1000075021 280
212 3300025912 Ga0207707_10000846 Ga0207707_1000084623 280
213 3300025912 Ga0207707_10014211 Ga0207707_100142116 280
214 3300025913 Ga0207695_10006285 Ga0207695_100062858 280
215 3300025913 Ga0207695_10011844 Ga0207695_100118447 280
216 3300025913 Ga0207695_10024286 Ga0207695_100242866 280
217 3300025917 Ga0207660_10001310 Ga0207660_100013101 280
218 3300025917 Ga0207660_10011867 Ga0207660_100118674 280
219 3300025917 Ga0207660_10279193 Ga0207660_102791932 280
220 3300025919 Ga0207657_10012284 Ga0207657_100122842 280
221 3300025920 Ga0207649_10005382 Ga0207649_100053822 280
222 3300025920 Ga0207649_10031029 Ga0207649_100310292 280
223 3300025921 Ga0207652_10000019 Ga0207652_1000001965 280
224 3300025921 Ga0207652_10010900 Ga0207652_100109004 280
225 3300025921 Ga0207652_10012677 Ga0207652_100126774 280
226 3300025924 Ga0207694_10018861 Ga0207694_100188612 280
227 3300025924 Ga0207694_10034796 Ga0207694_100347964 280
228 3300025929 Ga0207664_10001851 Ga0207664_100018512 280
229 3300025932 Ga0207690_10000982 Ga0207690_100009824 280
230 3300025932 Ga0207690_10142025 Ga0207690_101420251 280
231 3300025933 Ga0207706_10006207 Ga0207706_100062078 280
232 3300025933 Ga0207706_10044351 Ga0207706_100443512 280
233 3300025938 Ga0207704_10072350 Ga0207704_100723502 280
234 3300025944 Ga0207661_10004864 Ga0207661_1000486410 280
235 3300025944 Ga0207661_10073018 Ga0207661_100730182 280
236 3300025945 Ga0207679_10003088 Ga0207679_1000308812 280
237 3300025949 Ga0207667_10007992 Ga0207667_100079924 280
238 3300025949 Ga0207667_10018807 Ga0207667_100188077 280
239 3300025981 Ga0207640_10006608 Ga0207640_100066082 280
240 3300025981 Ga0207640_10012249 Ga0207640_100122492 280
241 3300026041 Ga0207639_10000724 Ga0207639_100007245 280
242 3300026041 Ga0207639_10006027 Ga0207639_100060272 280
243 3300026067 Ga0207678_10019574 Ga0207678_100195742 280
244 3300026067 Ga0207678_10123341 Ga0207678_101233412 280
245 3300026078 Ga0207702_10009776 Ga0207702_100097766 280
246 3300026078 Ga0207702_10210069 Ga0207702_102100692 280
247 3300026116 Ga0207674_10019736 Ga0207674_100197364 280
248 3300026142 Ga0207698_10001598 Ga0207698_100015985 280
249 3300026142 Ga0207698_10016187 Ga0207698_100161872 280
250 3300038443 Ga0395901_0035663 Ga0395901_0035663_584_1477 280
251 3300039437 Ga0436365_1660443 Ga0436365_1660443_99_974 280
252 3300045976 Ga0466967_0225688 Ga0466967_0225688_779_1654 280
253 3300048918 Ga0496115_0000060 Ga0496115_0000060_52832_53707 280
254 3300048929 Ga0496126_0000253 Ga0496126_0000253_48260_49135 280
255 3300049571 Ga0501034_0204653 Ga0501034_0204653_436_1311 280
256 3300049586 Ga0501070_0001427 Ga0501070_0001427_3905_4798 280
257 3300001989 JGI24739J22299_10050403 JGI24739J22299_100504031 281
258 3300001990 JGI24737J22298_10011187 JGI24737J22298_100111872 281
259 3300002737 JGI25162J39368_1001253 JGI25162J39368_10012531 281
260 3300002737 JGI25162J39368_1001416 JGI25162J39368_100141611 281
261 3300002741 JGI25157J39369_1001319 JGI25157J39369_10013192 281
262 3300002771 JGI25163J39215_1000233 JGI25163J39215_10002334 281
263 3300002772 JGI25164J39214_1000317 JGI25164J39214_100031710 281
264 3300003214 JGI25165J46597_1000601 JGI25165J46597_100060111 281
265 3300003751 Ga0055538_1000663 Ga0055538_10006639 281
266 3300003756 Ga0055533_1000475 Ga0055533_10004755 281
267 3300003761 Ga0055535_1001158 Ga0055535_100115813 281
268 3300003762 Ga0055542_1000432 Ga0055542_100043213 281
269 3300003762 Ga0055542_1000599 Ga0055542_100059911 281
270 3300003763 Ga0055529_1000961 Ga0055529_100096111 281
271 3300005340 Ga0070689_100006941 Ga0070689_1000069414 281
272 3300005365 Ga0070688_100019868 Ga0070688_1000198681 281
273 3300005455 Ga0070663_100223072 Ga0070663_1002230722 281
274 3300015687 Ga0183368_1003 Ga0183368_1003382 281
275 3300025224 Ga0209784_100011 Ga0209784_100011452 281
276 3300025225 Ga0209566_101090 Ga0209566_1010904 281
277 3300025226 Ga0209674_100012 Ga0209674_100012122 281
278 3300025228 Ga0209672_100706 Ga0209672_1007063 281
279 3300025231 Ga0207427_100026 Ga0207427_100026340 281
280 3300025233 Ga0209437_100403 Ga0209437_10040318 281
281 3300025233 Ga0209437_100470 Ga0209437_10047011 281
282 3300025242 Ga0209258_100027 Ga0209258_10002795 281
283 3300025246 Ga0209646_1000825 Ga0209646_10008259 281
284 3300025250 Ga0209026_1000460 Ga0209026_100046010 281
285 3300025250 Ga0209026_1001381 Ga0209026_10013817 281
286 3300025254 Ga0209148_1000001 Ga0209148_1000001833 281
287 3300025254 Ga0209148_1000002 Ga0209148_1000002941 281
288 3300025256 Ga0209759_1000679 Ga0209759_100067911 281
289 3300025261 Ga0209233_1000002 Ga0209233_10000021397 281
290 3300025261 Ga0209233_1018598 Ga0209233_10185982 281
291 3300025272 Ga0209455_1000019 Ga0209455_1000019162 281
292 3300025936 Ga0207670_10001748 Ga0207670_100017487 281
293 3300025936 Ga0207670_10271637 Ga0207670_102716371 281
294 3300026067 Ga0207678_10084593 Ga0207678_100845932 281
295 3300027876 Ga0209974_10010484 Ga0209974_100104842 281
296 3300033180 Ga0307510_10081025 Ga0307510_100810252 281
297 3300033528 Ga0316588_1014000 Ga0316588_10140002 281
298 3300041460 Ga0451802_1800814 Ga0451802_1800814_209_1078 281
299 3300046460 Ga0495638_0066790 Ga0495638_0066790_57_932 281
300 3300046460 Ga0495638_0070634 Ga0495638_0070634_57_932 281
301 3300046471 Ga0495650_0000961 Ga0495650_0000961_12160_13035 281
302 3300046507 Ga0495606_0000113 Ga0495606_0000113_19811_20686 281
303 3300046513 Ga0495616_0117266 Ga0495616_0117266_164_1060 281
304 3300046516 Ga0495628_0058034 Ga0495628_0058034_1456_2361 281
305 3300046660 Ga0495625_0037278 Ga0495625_0037278_204_1079 281
306 3300046694 Ga0495649_0000784 Ga0495649_0000784_4840_5715 281
307 3300047471 Ga0495684_0007985 Ga0495684_0007985_7169_8074 281
308 3300048918 Ga0496115_0000247 Ga0496115_0000247_20531_21406 281
309 3300048918 Ga0496115_0002188 Ga0496115_0002188_11926_12801 281
310 3300049459 Ga0495678_067479 Ga0495678_067479_152_1027 281
311 3300005548 Ga0070665_100000154 Ga0070665_10000015477 282
312 3300005548 Ga0070665_100001688 Ga0070665_10000168825 282
313 3300006195 Ga0075366_10001930 Ga0075366_100019307 282
314 3300025298 Ga0209050_1001666 Ga0209050_10016663 282
315 3300028379 Ga0268266_10000093 Ga0268266_10000093107 282
316 3300028379 Ga0268266_10000584 Ga0268266_1000058416 282
317 3300031730 Ga0307516_10102430 Ga0307516_101024302 282
318 3300048924 Ga0496121_0018047 Ga0496121_0018047_5671_6561 282
319 3300053079 Ga0500610_0018754 Ga0500610_0018754_2158_3030 282
320 3300053153 Ga0500616_0003013 Ga0500616_0003013_10992_11888 282
321 3300053730 Ga0500645_006858 Ga0500645_006858_706_1590 282
322 3300053739 Ga0500587_005038 Ga0500587_005038_603_1499 282
323 3300013306 Ga0163162_10121814 Ga0163162_101218143 283
324 3300013297 Ga0157378_10191648 Ga0157378_101916482 284
325 3300049824 Ga0501045_0273219 Ga0501045_0273219_137_1048 284
326 3300009098 Ga0105245_10279655 Ga0105245_102796552 285
327 iso_pu_bacteria 2740891818 2740990744 285
328 iso_pu_bacteria 2537561836 2538834230 286
329 iso_pu_bacteria 2576861471 2578457247 286
330 iso_pu_bacteria 2593339238 2595447846 286
331 iso_pu_bacteria 2593339239 2595451163 286
332 iso_pu_bacteria 2643221562 2643831252 286
333 iso_pu_bacteria 2643221577 2643895656 286
334 iso_pu_bacteria 2643221685 2644477850 286
335 iso_pu_bacteria 2687453130 2687584348 286
336 iso_pu_bacteria 2718218334 2721025989 286
337 iso_pu_bacteria 2734482264 2735834048 286
338 iso_pu_bacteria 2738543009 2739225458 286
339 iso_pu_bacteria 2747842428 2747948363 286
340 iso_pu_bacteria 2747842501 2748016769 286
341 iso_pu_bacteria 2765235840 2765580245 286
342 iso_pu_bacteria 2816332141 2816518727 286
343 iso_pu_bacteria 2818991438 2819552513 286
344 iso_pu_bacteria 2818991440 2819565985 286
345 iso_pu_bacteria 2818991457 2819660951 286
346 iso_pu_bacteria 2842391507 2842395562 286
347 iso_pu_bacteria 2842914999 2842917787 286
348 iso_pu_bacteria 2852649853 2852652369 286
349 iso_pu_bacteria 2852684882 2852686826 286
350 iso_pu_bacteria 2857442823 2857445208 286
351 iso_pu_bacteria 2874220319 2874222922 286
352 iso_pu_bacteria 2884338543 2884342032 286
353 iso_pu_bacteria 2895395659 2895397436 286
354 iso_pu_bacteria 2904463128 2904466256 286
355 iso_pu_bacteria 2919085039 2919085992 286
356 iso_pu_bacteria 2919089067 2919092893 286
357 iso_pu_bacteria 2919130084 2919133980 286
358 iso_pu_bacteria 2919134579 2919138691 286
359 iso_pu_bacteria 2919404418 2919408044 286
360 iso_pu_bacteria 2919513703 2919514991 286
361 iso_pu_bacteria 2919675420 2919676389 286
362 iso_pu_bacteria 2928496128 2928499256 286
363 iso_pu_bacteria 2929195423 2929196631 286
364 iso_pu_bacteria 2931380184 2931383615 286
365 iso_pu_bacteria 2937610967 2937614886 286
366 iso_pu_bacteria 2939589442 2939589537 286
367 iso_pu_bacteria 2939611941 2939614917 286
368 iso_pu_bacteria 2939626828 2939630563 286
369 iso_pu_bacteria 2941471342 2941474036 286
370 iso_pu_bacteria 2941475908 2941478989 286
371 iso_pu_bacteria 2961047084 2961049687 286
372 iso_pu_bacteria 2961064222 2961066636 286
373 iso_pu_bacteria 2974307012 2974307889 286
374 iso_pu_bacteria 2977247770 2977248625 286
375 iso_pu_bacteria 2984514374 2984516906 286
376 iso_pu_bacteria 2987605356 2987608508 286
377 iso_pu_bacteria 8021622325 8021625112 286
378 iso_pu_bacteria 8021626552 8021627800 286
379 iso_pu_bacteria 8021648035 8021649443 286
380 iso_pu_bacteria 2643221579 2643905357 287
381 iso_pu_bacteria 2643221581 2643915040 287
382 iso_pu_bacteria 2739367700 2739732452 287
383 iso_pu_bacteria 2842918807 2842922040 287
384 iso_pu_bacteria 2884411467 2884412516 287
385 iso_pu_bacteria 2923516293 2923517470 287
386 iso_pu_bacteria 2928963466 2928965137 287
387 iso_pu_bacteria 2953994433 2953997150 287
388 3300014969 Ga0157376_10084869 Ga0157376_100848693 288
389 3300025885 Ga0207653_10052734 Ga0207653_100527342 288
390 3300003659 JGI25404J52841_10029262 JGI25404J52841_100292621 289
391 3300005329 Ga0070683_100251255 Ga0070683_1002512552 289
392 3300005366 Ga0070659_100021635 Ga0070659_1000216352 289
393 3300005436 Ga0070713_100000055 Ga0070713_10000005560 289
394 3300005539 Ga0068853_100032467 Ga0068853_1000324673 289
395 3300005563 Ga0068855_100024007 Ga0068855_1000240074 289
396 3300005563 Ga0068855_100095437 Ga0068855_1000954371 289
397 3300005578 Ga0068854_100023245 Ga0068854_1000232454 289
398 3300005834 Ga0068851_10000296 Ga0068851_100002962 289
399 3300005983 Ga0081540_1000271 Ga0081540_100027146 289
400 3300009098 Ga0105245_10000012 Ga0105245_10000012256 289
401 3300009098 Ga0105245_10051880 Ga0105245_100518802 289
402 3300009177 Ga0105248_10000022 Ga0105248_10000022210 289
403 3300013307 Ga0157372_10008020 Ga0157372_100080205 289
404 3300013307 Ga0157372_10457316 Ga0157372_104573162 289
405 3300025303 Ga0209051_1022652 Ga0209051_10226522 289
406 3300025321 Ga0207656_10000273 Ga0207656_1000027314 289
407 3300025909 Ga0207705_10069872 Ga0207705_100698722 289
408 3300025927 Ga0207687_10000011 Ga0207687_10000011310 289
409 3300025927 Ga0207687_10011977 Ga0207687_100119772 289
410 3300025928 Ga0207700_10000009 Ga0207700_10000009255 289
411 3300025932 Ga0207690_10003034 Ga0207690_100030342 289
412 3300025941 Ga0207711_10000019 Ga0207711_10000019129 289
413 3300025949 Ga0207667_10019090 Ga0207667_100190903 289
414 3300025949 Ga0207667_10105973 Ga0207667_101059732 289
415 3300025981 Ga0207640_10000059 Ga0207640_100000594 289
416 3300026041 Ga0207639_10021958 Ga0207639_100219583 289
417 3300026041 Ga0207639_10022666 Ga0207639_100226663 289
418 3300028379 Ga0268266_10063996 Ga0268266_100639963 289
419 3300031733 Ga0316577_10069180 Ga0316577_100691801 289
420 3300036647 Ga0316582_0108121 Ga0316582_0108121_287_1162 289
421 3300037466 Ga0395898_0249684 Ga0395898_0249684_684_1595 289
422 3300044842 Ga0466957_0007712 Ga0466957_0007712_5079_5954 289
423 3300046459 Ga0495629_0000028 Ga0495629_0000028_5828_6703 289
424 3300046461 Ga0495641_0000012 Ga0495641_0000012_49029_49904 289
425 3300046461 Ga0495641_0182027 Ga0495641_0182027_15_890 289
426 3300046507 Ga0495606_0000219 Ga0495606_0000219_84933_85808 289
427 3300046511 Ga0495608_0000001 Ga0495608_0000001_276462_277337 289
428 3300046515 Ga0495620_0000060 Ga0495620_0000060_78401_79276 289
429 3300046517 Ga0495630_0000227 Ga0495630_0000227_11035_11910 289
430 3300046675 Ga0495657_0000002 Ga0495657_0000002_277142_278017 289
431 3300046681 Ga0495647_0000053 Ga0495647_0000053_14202_15077 289
432 3300046689 Ga0495613_0000242 Ga0495613_0000242_21786_22661 289
433 3300046690 Ga0495624_0000419 Ga0495624_0000419_15971_16846 289
434 3300046694 Ga0495649_0002630 Ga0495649_0002630_5784_6659 289
435 3300046809 Ga0495600_0037710 Ga0495600_0037710_423_1298 289
436 3300047317 Ga0495604_0001604 Ga0495604_0001604_12367_13242 289
437 3300047317 Ga0495604_0098791 Ga0495604_0098791_1196_2071 289
438 3300047321 Ga0495676_0001744 Ga0495676_0001744_10172_11110 289
439 3300047444 Ga0495675_0000162 Ga0495675_0000162_33840_34715 289
440 3300048088 Ga0495602_0000063 Ga0495602_0000063_13726_14601 289
441 3300048911 Ga0496108_0000012 Ga0496108_0000012_228891_229766 289
442 3300048912 Ga0496109_0000246 Ga0496109_0000246_3629_4504 289
443 3300048913 Ga0496110_0362131 Ga0496110_0362131_229_1104 289
444 3300048914 Ga0496111_0015604 Ga0496111_0015604_3952_4827 289
445 3300048916 Ga0496113_0147556 Ga0496113_0147556_384_1259 289
446 3300048917 Ga0496114_0115480 Ga0496114_0115480_924_1796 289
447 3300048917 Ga0496114_0246557 Ga0496114_0246557_234_1109 289
448 3300048918 Ga0496115_0000004 Ga0496115_0000004_166682_167557 289
449 3300049569 Ga0501032_0009348 Ga0501032_0009348_24_893 289
450 3300049571 Ga0501034_0005729 Ga0501034_0005729_11795_12664 289
451 3300049572 Ga0501036_0032187 Ga0501036_0032187_1533_2402 289
452 3300049573 Ga0501037_0002431 Ga0501037_0002431_1526_2395 289
453 3300049574 Ga0501038_0005383 Ga0501038_0005383_755_1624 289
454 3300049579 Ga0501043_0088370 Ga0501043_0088370_939_1808 289
455 3300049580 Ga0501046_0007493 Ga0501046_0007493_2076_2945 289
456 3300049581 Ga0501047_0018198 Ga0501047_0018198_660_1529 289
457 3300049581 Ga0501047_0437589 Ga0501047_0437589_136_1011 289
458 3300049586 Ga0501070_0062366 Ga0501070_0062366_717_1592 289
459 3300049822 Ga0501035_0070197 Ga0501035_0070197_33_902 289
460 3300053077 Ga0495601_0000281 Ga0495601_0000281_497_1372 289
461 3300053084 Ga0495595_0000001 Ga0495595_0000001_133942_134817 289
462 3300053085 Ga0495619_0000708 Ga0495619_0000708_12885_13760 289
463 3300053123 Ga0500614_001872 Ga0500614_001872_2940_3815 289
464 3300054114 Ga0501084_0089267 Ga0501084_0089267_1689_2570 289
465 3300001904 JGI24736J21556_1000372 JGI24736J21556_10003724 290
466 3300001915 JGI24741J21665_1002943 JGI24741J21665_10029433 290
467 3300001979 JGI24740J21852_10004561 JGI24740J21852_100045615 290
468 3300001989 JGI24739J22299_10010039 JGI24739J22299_100100392 290
469 3300001990 JGI24737J22298_10009746 JGI24737J22298_100097463 290
470 3300002067 JGI24735J21928_10004119 JGI24735J21928_100041193 290
471 3300002737 JGI25162J39368_1001109 JGI25162J39368_10011096 290
472 3300002737 JGI25162J39368_1005737 JGI25162J39368_10057372 290
473 3300002738 JGI25154J39366_1006558 JGI25154J39366_10065581 290
474 3300002772 JGI25164J39214_1000030 JGI25164J39214_100003033 290
475 3300003214 JGI25165J46597_1000057 JGI25165J46597_100005793 290
476 3300003479 Ga0006556J51387_1026971 Ga0006556J51387_10269712 290
477 3300003567 Ga0006554J51385_1022122 Ga0006554J51385_10221222 290
478 3300003578 Ga0006562J51391_1068853 Ga0006562J51391_10688535 290
479 3300003578 Ga0006562J51391_1068854 Ga0006562J51391_10688541 290
480 3300003756 Ga0055533_1007185 Ga0055533_10071851 290
481 3300003773 Ga0055537_1000210 Ga0055537_100021026 290
482 3300003775 Ga0055524_1016435 Ga0055524_10164352 290
483 3300003781 Ga0055536_1006384 Ga0055536_10063842 290
484 3300003784 Ga0055534_1000276 Ga0055534_100027621 290
485 3300003790 Ga0055528_1000121 Ga0055528_10001213 290
486 3300003794 Ga0055531_10012029 Ga0055531_100120291 290
487 3300003794 Ga0055531_10025591 Ga0055531_100255913 290
488 3300003856 Ga0058692_1000013 Ga0058692_100001334 290
489 3300003856 Ga0058692_1000033 Ga0058692_100003314 290
490 3300005262 Ga0065165_1000201 Ga0065165_100020154 290
491 3300005289 Ga0065704_10153275 Ga0065704_101532752 290
492 3300005327 Ga0070658_10020121 Ga0070658_100201213 290
493 3300005328 Ga0070676_10000019 Ga0070676_1000001933 290
494 3300005329 Ga0070683_100006950 Ga0070683_1000069506 290
495 3300005329 Ga0070683_100032813 Ga0070683_1000328133 290
496 3300005329 Ga0070683_100242923 Ga0070683_1002429231 290
497 3300005330 Ga0070690_100000062 Ga0070690_10000006233 290
498 3300005331 Ga0070670_100003783 Ga0070670_10000378311 290
499 3300005334 Ga0068869_100001311 Ga0068869_10000131111 290
500 3300005334 Ga0068869_100231768 Ga0068869_1002317682 290
501 3300005335 Ga0070666_10000037 Ga0070666_1000003774 290
502 3300005337 Ga0070682_100070382 Ga0070682_1000703823 290
503 3300005338 Ga0068868_100000002 Ga0068868_100000002159 290
504 3300005338 Ga0068868_100089278 Ga0068868_1000892783 290
505 3300005339 Ga0070660_100000539 Ga0070660_1000005399 290
506 3300005339 Ga0070660_100077659 Ga0070660_1000776593 290
507 3300005339 Ga0070660_100219938 Ga0070660_1002199382 290
508 3300005340 Ga0070689_100000206 Ga0070689_10000020633 290
509 3300005343 Ga0070687_100001583 Ga0070687_1000015832 290
510 3300005344 Ga0070661_100000194 Ga0070661_10000019445 290
511 3300005344 Ga0070661_100001553 Ga0070661_10000155312 290
512 3300005344 Ga0070661_100071088 Ga0070661_1000710883 290
513 3300005347 Ga0070668_100000813 Ga0070668_1000008134 290
514 3300005347 Ga0070668_100021628 Ga0070668_1000216282 290
515 3300005353 Ga0070669_100000294 Ga0070669_1000002942 290
516 3300005354 Ga0070675_100000104 Ga0070675_10000010413 290
517 3300005356 Ga0070674_100000045 Ga0070674_10000004537 290
518 3300005364 Ga0070673_100005351 Ga0070673_1000053513 290
519 3300005365 Ga0070688_100000668 Ga0070688_1000006683 290
520 3300005366 Ga0070659_100000029 Ga0070659_100000029103 290
521 3300005366 Ga0070659_100000112 Ga0070659_10000011241 290
522 3300005367 Ga0070667_100000102 Ga0070667_10000010271 290
523 3300005367 Ga0070667_100025660 Ga0070667_1000256603 290
524 3300005367 Ga0070667_100196355 Ga0070667_1001963552 290
525 3300005367 Ga0070667_100288958 Ga0070667_1002889582 290
526 3300005435 Ga0070714_100021967 Ga0070714_1000219674 290
527 3300005436 Ga0070713_100459128 Ga0070713_1004591282 290
528 3300005438 Ga0070701_10001321 Ga0070701_100013215 290
529 3300005440 Ga0070705_100000656 Ga0070705_10000065617 290
530 3300005455 Ga0070663_100003975 Ga0070663_1000039753 290
531 3300005455 Ga0070663_100068877 Ga0070663_1000688773 290
532 3300005455 Ga0070663_100187385 Ga0070663_1001873852 290
533 3300005456 Ga0070678_100011266 Ga0070678_1000112664 290
534 3300005457 Ga0070662_100001839 Ga0070662_1000018393 290
535 3300005459 Ga0068867_100093916 Ga0068867_1000939163 290
536 3300005466 Ga0070685_10000264 Ga0070685_1000026430 290
537 3300005530 Ga0070679_100100781 Ga0070679_1001007812 290
538 3300005535 Ga0070684_100284771 Ga0070684_1002847712 290
539 3300005539 Ga0068853_100007490 Ga0068853_1000074908 290
540 3300005539 Ga0068853_100124983 Ga0068853_1001249833 290
541 3300005539 Ga0068853_100236550 Ga0068853_1002365501 290
542 3300005539 Ga0068853_100323764 Ga0068853_1003237642 290
543 3300005543 Ga0070672_100000051 Ga0070672_10000005115 290
544 3300005544 Ga0070686_100006277 Ga0070686_1000062778 290
545 3300005545 Ga0070695_100031546 Ga0070695_1000315462 290
546 3300005546 Ga0070696_100238707 Ga0070696_1002387071 290
547 3300005547 Ga0070693_100000849 Ga0070693_10000084911 290
548 3300005548 Ga0070665_100000092 Ga0070665_10000009285 290
549 3300005548 Ga0070665_100154396 Ga0070665_1001543963 290
550 3300005563 Ga0068855_100000331 Ga0068855_10000033137 290
551 3300005563 Ga0068855_100065071 Ga0068855_1000650713 290
552 3300005564 Ga0070664_100000273 Ga0070664_10000027311 290
553 3300005564 Ga0070664_100046093 Ga0070664_1000460933 290
554 3300005564 Ga0070664_100266445 Ga0070664_1002664452 290
555 3300005577 Ga0068857_100052691 Ga0068857_1000526913 290
556 3300005577 Ga0068857_100053896 Ga0068857_1000538964 290
557 3300005577 Ga0068857_100055324 Ga0068857_1000553243 290
558 3300005577 Ga0068857_100074753 Ga0068857_1000747532 290
559 3300005578 Ga0068854_100000084 Ga0068854_1000000847 290
560 3300005578 Ga0068854_100011358 Ga0068854_1000113584 290
561 3300005614 Ga0068856_100007033 Ga0068856_1000070332 290
562 3300005614 Ga0068856_100125991 Ga0068856_1001259911 290
563 3300005614 Ga0068856_100184413 Ga0068856_1001844132 290
564 3300005616 Ga0068852_100000125 Ga0068852_10000012535 290
565 3300005616 Ga0068852_100299682 Ga0068852_1002996822 290
566 3300005617 Ga0068859_100005779 Ga0068859_10000577911 290
567 3300005718 Ga0068866_10033926 Ga0068866_100339263 290
568 3300005719 Ga0068861_100000212 Ga0068861_10000021211 290
569 3300005834 Ga0068851_10006888 Ga0068851_100068884 290
570 3300005840 Ga0068870_10000270 Ga0068870_1000027015 290
571 3300005841 Ga0068863_100003408 Ga0068863_10000340814 290
572 3300005842 Ga0068858_100115444 Ga0068858_1001154442 290
573 3300005842 Ga0068858_100137002 Ga0068858_1001370023 290
574 3300005843 Ga0068860_100008370 Ga0068860_1000083702 290
575 3300005843 Ga0068860_100039323 Ga0068860_1000393232 290
576 3300005843 Ga0068860_100091046 Ga0068860_1000910462 290
577 3300005843 Ga0068860_100314870 Ga0068860_1003148701 290
578 3300005844 Ga0068862_100003864 Ga0068862_1000038643 290
579 3300005983 Ga0081540_1001028 Ga0081540_10010285 290
580 3300005983 Ga0081540_1004991 Ga0081540_10049918 290
581 3300005983 Ga0081540_1007399 Ga0081540_10073992 290
582 3300005985 Ga0081539_10043946 Ga0081539_100439462 290
583 3300006186 Ga0075369_10104623 Ga0075369_101046232 290
584 3300006358 Ga0068871_100126293 Ga0068871_1001262933 290
585 3300006844 Ga0075428_100142370 Ga0075428_1001423701 290
586 3300006881 Ga0068865_100072891 Ga0068865_1000728913 290
587 3300006931 Ga0097620_100005779 Ga0097620_1000057793 290
588 3300009011 Ga0105251_10026384 Ga0105251_100263841 290
589 3300009093 Ga0105240_10004295 Ga0105240_1000429517 290
590 3300009094 Ga0111539_10196364 Ga0111539_101963643 290
591 3300009098 Ga0105245_10000233 Ga0105245_1000023340 290
592 3300009101 Ga0105247_10000321 Ga0105247_1000032116 290
593 3300009101 Ga0105247_10026871 Ga0105247_100268713 290
594 3300009148 Ga0105243_10003969 Ga0105243_100039694 290
595 3300009148 Ga0105243_10005321 Ga0105243_100053215 290
596 3300009174 Ga0105241_10017112 Ga0105241_100171124 290
597 3300009176 Ga0105242_10014473 Ga0105242_100144738 290
598 3300009176 Ga0105242_10104859 Ga0105242_101048592 290
599 3300009177 Ga0105248_10014599 Ga0105248_100145993 290
600 3300009177 Ga0105248_10033425 Ga0105248_100334254 290
601 3300009545 Ga0105237_10000549 Ga0105237_1000054947 290
602 3300009545 Ga0105237_10002875 Ga0105237_100028759 290
603 3300009545 Ga0105237_10134869 Ga0105237_101348693 290
604 3300009551 Ga0105238_10000154 Ga0105238_1000015448 290
605 3300009551 Ga0105238_10000805 Ga0105238_1000080516 290
606 3300009551 Ga0105238_10430241 Ga0105238_104302412 290
607 3300009553 Ga0105249_10000265 Ga0105249_1000026515 290
608 3300009553 Ga0105249_10000533 Ga0105249_1000053338 290
609 3300010375 Ga0105239_10000174 Ga0105239_1000017413 290
610 3300010375 Ga0105239_10002920 Ga0105239_100029205 290
611 3300010375 Ga0105239_10030730 Ga0105239_100307306 290
612 3300011119 Ga0105246_10001791 Ga0105246_100017916 290
613 3300013100 Ga0157373_10003504 Ga0157373_1000350411 290
614 3300013102 Ga0157371_10000351 Ga0157371_1000035115 290
615 3300013105 Ga0157369_10000829 Ga0157369_1000082917 290
616 3300013105 Ga0157369_10001552 Ga0157369_1000155221 290
617 3300013105 Ga0157369_10003652 Ga0157369_1000365213 290
618 3300013105 Ga0157369_10143836 Ga0157369_101438362 290
619 3300013296 Ga0157374_10001656 Ga0157374_1000165614 290
620 3300013297 Ga0157378_10004285 Ga0157378_100042858 290
621 3300013306 Ga0163162_10000647 Ga0163162_1000064713 290
622 3300013306 Ga0163162_10002285 Ga0163162_100022855 290
623 3300013307 Ga0157372_10000403 Ga0157372_1000040313 290
624 3300013307 Ga0157372_10012371 Ga0157372_100123717 290
625 3300013307 Ga0157372_10121202 Ga0157372_101212023 290
626 3300013307 Ga0157372_10121718 Ga0157372_101217182 290
627 3300014325 Ga0163163_10276924 Ga0163163_102769241 290
628 3300014968 Ga0157379_10001292 Ga0157379_100012925 290
629 3300014969 Ga0157376_10023151 Ga0157376_100231514 290
630 3300015261 Ga0182006_1000061 Ga0182006_100006110 290
631 3300015261 Ga0182006_1071795 Ga0182006_10717952 290
632 3300015262 Ga0182007_10006307 Ga0182007_100063075 290
633 3300015685 Ga0183369_1013 Ga0183369_101331 290
634 3300017792 Ga0163161_10025691 Ga0163161_100256913 290
635 3300017792 Ga0163161_10068249 Ga0163161_100682492 290
636 3300025226 Ga0209674_100427 Ga0209674_1004277 290
637 3300025228 Ga0209672_100124 Ga0209672_1001241 290
638 3300025229 Ga0209147_103557 Ga0209147_1035572 290
639 3300025231 Ga0207427_100053 Ga0207427_10005392 290
640 3300025233 Ga0209437_100108 Ga0209437_10010891 290
641 3300025233 Ga0209437_102459 Ga0209437_1024592 290
642 3300025242 Ga0209258_100055 Ga0209258_10005573 290
643 3300025250 Ga0209026_1000548 Ga0209026_10005489 290
644 3300025254 Ga0209148_1000058 Ga0209148_1000058198 290
645 3300025254 Ga0209148_1002891 Ga0209148_10028914 290
646 3300025256 Ga0209759_1000674 Ga0209759_10006747 290
647 3300025258 Ga0209129_1000678 Ga0209129_100067815 290
648 3300025261 Ga0209233_1000125 Ga0209233_100012592 290
649 3300025263 Ga0209565_1000023 Ga0209565_1000023152 290
650 3300025272 Ga0209455_1000018 Ga0209455_1000018198 290
651 3300025273 Ga0209673_1000116 Ga0209673_1000116138 290
652 3300025284 Ga0209130_1006082 Ga0209130_10060822 290
653 3300025291 Ga0209675_1000016 Ga0209675_1000016258 290
654 3300025292 Ga0209676_1000037 Ga0209676_1000037226 290
655 3300025292 Ga0209676_1000770 Ga0209676_100077029 290
656 3300025292 Ga0209676_1001488 Ga0209676_100148816 290
657 3300025295 Ga0209564_1000347 Ga0209564_100034749 290
658 3300025297 Ga0209758_1011282 Ga0209758_10112825 290
659 3300025303 Ga0209051_1002629 Ga0209051_10026292 290
660 3300025304 Ga0209257_1000067 Ga0209257_1000067176 290
661 3300025304 Ga0209257_1000868 Ga0209257_10008682 290
662 3300025304 Ga0209257_1021765 Ga0209257_10217652 290
663 3300025321 Ga0207656_10003921 Ga0207656_100039214 290
664 3300025321 Ga0207656_10164515 Ga0207656_101645152 290
665 3300025735 Ga0207713_1021190 Ga0207713_10211903 290
666 3300025899 Ga0207642_10000233 Ga0207642_100002334 290
667 3300025900 Ga0207710_10000918 Ga0207710_1000091812 290
668 3300025900 Ga0207710_10013427 Ga0207710_100134273 290
669 3300025901 Ga0207688_10000282 Ga0207688_1000028211 290
670 3300025903 Ga0207680_10000001 Ga0207680_10000001378 290
671 3300025904 Ga0207647_10000016 Ga0207647_1000001628 290
672 3300025904 Ga0207647_10003471 Ga0207647_100034719 290
673 3300025907 Ga0207645_10000043 Ga0207645_1000004341 290
674 3300025908 Ga0207643_10000024 Ga0207643_1000002415 290
675 3300025909 Ga0207705_10007515 Ga0207705_100075156 290
676 3300025909 Ga0207705_10030729 Ga0207705_100307292 290
677 3300025912 Ga0207707_10047546 Ga0207707_100475463 290
678 3300025912 Ga0207707_10096162 Ga0207707_100961622 290
679 3300025913 Ga0207695_10014502 Ga0207695_100145024 290
680 3300025913 Ga0207695_10072195 Ga0207695_100721953 290
681 3300025914 Ga0207671_10083783 Ga0207671_100837832 290
682 3300025914 Ga0207671_10100320 Ga0207671_101003202 290
683 3300025917 Ga0207660_10020370 Ga0207660_100203702 290
684 3300025918 Ga0207662_10000789 Ga0207662_100007896 290
685 3300025919 Ga0207657_10000655 Ga0207657_1000065532 290
686 3300025919 Ga0207657_10001536 Ga0207657_1000153614 290
687 3300025919 Ga0207657_10070181 Ga0207657_100701813 290
688 3300025919 Ga0207657_10128646 Ga0207657_101286462 290
689 3300025920 Ga0207649_10000764 Ga0207649_100007642 290
690 3300025920 Ga0207649_10007176 Ga0207649_100071762 290
691 3300025920 Ga0207649_10016143 Ga0207649_100161432 290
692 3300025920 Ga0207649_10136861 Ga0207649_101368612 290
693 3300025921 Ga0207652_10067861 Ga0207652_100678613 290
694 3300025925 Ga0207650_10000253 Ga0207650_1000025318 290
695 3300025925 Ga0207650_10033150 Ga0207650_100331502 290
696 3300025926 Ga0207659_10000881 Ga0207659_100008815 290
697 3300025931 Ga0207644_10001751 Ga0207644_1000175112 290
698 3300025932 Ga0207690_10000004 Ga0207690_10000004690 290
699 3300025932 Ga0207690_10030339 Ga0207690_100303392 290
700 3300025932 Ga0207690_10056854 Ga0207690_100568542 290
701 3300025932 Ga0207690_10098108 Ga0207690_100981081 290
702 3300025933 Ga0207706_10003011 Ga0207706_1000301114 290
703 3300025933 Ga0207706_10069767 Ga0207706_100697673 290
704 3300025935 Ga0207709_10001141 Ga0207709_1000114112 290
705 3300025935 Ga0207709_10131964 Ga0207709_101319642 290
706 3300025936 Ga0207670_10000579 Ga0207670_100005794 290
707 3300025938 Ga0207704_10002349 Ga0207704_100023493 290
708 3300025940 Ga0207691_10000053 Ga0207691_1000005332 290
709 3300025940 Ga0207691_10285074 Ga0207691_102850742 290
710 3300025941 Ga0207711_10000276 Ga0207711_1000027619 290
711 3300025941 Ga0207711_10008039 Ga0207711_100080393 290
712 3300025942 Ga0207689_10000026 Ga0207689_1000002652 290
713 3300025942 Ga0207689_10150160 Ga0207689_101501602 290
714 3300025944 Ga0207661_10027762 Ga0207661_100277622 290
715 3300025944 Ga0207661_10079286 Ga0207661_100792862 290
716 3300025945 Ga0207679_10012138 Ga0207679_100121383 290
717 3300025949 Ga0207667_10138174 Ga0207667_101381743 290
718 3300025949 Ga0207667_10177590 Ga0207667_101775902 290
719 3300025960 Ga0207651_10006649 Ga0207651_100066492 290
720 3300025961 Ga0207712_10000450 Ga0207712_1000045039 290
721 3300025961 Ga0207712_10001588 Ga0207712_100015885 290
722 3300025972 Ga0207668_10007821 Ga0207668_100078215 290
723 3300025972 Ga0207668_10177597 Ga0207668_101775972 290
724 3300025981 Ga0207640_10030683 Ga0207640_100306832 290
725 3300025986 Ga0207658_10000112 Ga0207658_1000011268 290
726 3300025986 Ga0207658_10000422 Ga0207658_1000042233 290
727 3300025986 Ga0207658_10018176 Ga0207658_100181762 290
728 3300026023 Ga0207677_10000080 Ga0207677_1000008047 290
729 3300026023 Ga0207677_10000185 Ga0207677_1000018511 290
730 3300026035 Ga0207703_10000059 Ga0207703_1000005938 290
731 3300026041 Ga0207639_10001033 Ga0207639_1000103315 290
732 3300026041 Ga0207639_10152663 Ga0207639_101526631 290
733 3300026041 Ga0207639_10255824 Ga0207639_102558241 290
734 3300026067 Ga0207678_10001367 Ga0207678_100013679 290
735 3300026067 Ga0207678_10004332 Ga0207678_100043328 290
736 3300026067 Ga0207678_10012031 Ga0207678_100120314 290
737 3300026075 Ga0207708_10027377 Ga0207708_100273773 290
738 3300026078 Ga0207702_10147131 Ga0207702_101471312 290
739 3300026088 Ga0207641_10000473 Ga0207641_1000047313 290
740 3300026089 Ga0207648_10000105 Ga0207648_1000010515 290
741 3300026095 Ga0207676_10000168 Ga0207676_1000016837 290
742 3300026116 Ga0207674_10005910 Ga0207674_100059107 290
743 3300026116 Ga0207674_10008599 Ga0207674_100085994 290
744 3300026116 Ga0207674_10031405 Ga0207674_100314054 290
745 3300026116 Ga0207674_10068238 Ga0207674_100682383 290
746 3300026118 Ga0207675_100000233 Ga0207675_10000023339 290
747 3300026121 Ga0207683_10000167 Ga0207683_100001679 290
748 3300026121 Ga0207683_10201255 Ga0207683_102012552 290
749 3300026142 Ga0207698_10008057 Ga0207698_100080572 290
750 3300026142 Ga0207698_10024256 Ga0207698_100242563 290
751 3300027312 Ga0209371_1000007 Ga0209371_1000007715 290
752 3300027312 Ga0209371_1000088 Ga0209371_1000088122 290
753 3300028379 Ga0268266_10000001 Ga0268266_100000013563 290
754 3300028379 Ga0268266_10000075 Ga0268266_10000075122 290
755 3300028379 Ga0268266_10000493 Ga0268266_1000049339 290
756 3300028379 Ga0268266_10061207 Ga0268266_100612072 290
757 3300028381 Ga0268264_10000464 Ga0268264_1000046416 290
758 3300028381 Ga0268264_10072286 Ga0268264_100722862 290
759 3300028381 Ga0268264_10281128 Ga0268264_102811282 290
760 3300030500 Ga0268256_1000008 Ga0268256_1000008236 290
761 3300030500 Ga0268256_1000079 Ga0268256_100007915 290
762 3300030745 Ga0316182_1373831 Ga0316182_13738311 290
763 3300032002 Ga0307416_100231026 Ga0307416_1002310262 290
764 3300033180 Ga0307510_10000590 Ga0307510_100005907 290
765 3300037312 Ga0395899_0016051 Ga0395899_0016051_12_884 290
766 3300037312 Ga0395899_0029824 Ga0395899_0029824_3181_4053 290
767 3300037418 Ga0395900_0014472 Ga0395900_0014472_12_884 290
768 3300037418 Ga0395900_0020273 Ga0395900_0020273_5688_6560 290
769 3300037418 Ga0395900_0724568 Ga0395900_0724568_12_884 290
770 3300037466 Ga0395898_0003642 Ga0395898_0003642_1136_2008 290
771 3300039450 Ga0436363_1508025 Ga0436363_1508025_294_1181 290
772 3300041452 Ga0451793_0318385 Ga0451793_0318385_466_1338 290
773 3300041498 Ga0451841_0314351 Ga0451841_0314351_152_1027 290
774 3300042011 Ga0439454_011437 Ga0439454_011437_291_1163 290
775 3300042184 Ga0450908_016352 Ga0450908_016352_279_1151 290
776 3300042876 Ga0451577_0019749 Ga0451577_0019749_1910_2782 290
777 3300042876 Ga0451577_0156318 Ga0451577_0156318_819_1706 290
778 3300044672 Ga0466982_0000069 Ga0466982_0000069_59_931 290
779 3300044765 Ga0466970_0001345 Ga0466970_0001345_5979_6851 290
780 3300046452 Ga0495617_000544 Ga0495617_000544_18552_19424 290
781 3300046460 Ga0495638_0000019 Ga0495638_0000019_276196_277068 290
782 3300046460 Ga0495638_0006348 Ga0495638_0006348_249_1121 290
783 3300046471 Ga0495650_0001680 Ga0495650_0001680_8219_9091 290
784 3300046471 Ga0495650_0001768 Ga0495650_0001768_18115_18987 290
785 3300046472 Ga0495580_0036251 Ga0495580_0036251_1905_2795 290
786 3300046491 Ga0495584_0000852 Ga0495584_0000852_3983_4855 290
787 3300046492 Ga0495585_0001031 Ga0495585_0001031_1082_1954 290
788 3300046492 Ga0495585_0005296 Ga0495585_0005296_2452_3324 290
789 3300046501 Ga0495607_0000334 Ga0495607_0000334_1035_1907 290
790 3300046501 Ga0495607_0003817 Ga0495607_0003817_9293_10165 290
791 3300046501 Ga0495607_0011325 Ga0495607_0011325_304_1176 290
792 3300046507 Ga0495606_0003641 Ga0495606_0003641_9029_9901 290
793 3300046507 Ga0495606_0108430 Ga0495606_0108430_599_1471 290
794 3300046515 Ga0495620_0001178 Ga0495620_0001178_1124_1996 290
795 3300046518 Ga0495631_0058718 Ga0495631_0058718_365_1237 290
796 3300046519 Ga0495632_0000010 Ga0495632_0000010_110245_111117 290
797 3300046519 Ga0495632_0059417 Ga0495632_0059417_851_1723 290
798 3300046520 Ga0495637_0085268 Ga0495637_0085268_329_1201 290
799 3300046524 Ga0495648_0001511 Ga0495648_0001511_20762_21634 290
800 3300046524 Ga0495648_0099974 Ga0495648_0099974_436_1308 290
801 3300046538 Ga0495609_0020466 Ga0495609_0020466_190_1062 290
802 3300046648 Ga0495611_0000003 Ga0495611_0000003_262077_262949 290
803 3300046648 Ga0495611_0000857 Ga0495611_0000857_15416_16288 290
804 3300046660 Ga0495625_0000019 Ga0495625_0000019_43707_44579 290
805 3300046665 Ga0495661_0057424 Ga0495661_0057424_352_1224 290
806 3300046692 Ga0495671_0001785 Ga0495671_0001785_913_1785 290
807 3300046794 Ga0495589_0000516 Ga0495589_0000516_284_1156 290
808 3300046810 Ga0495660_0000125 Ga0495660_0000125_34081_34953 290
809 3300046810 Ga0495660_0002931 Ga0495660_0002931_1167_2039 290
810 3300047446 Ga0495679_000017 Ga0495679_000017_285_1157 290
811 3300047469 Ga0495673_0000004 Ga0495673_0000004_696709_697581 290
812 3300047469 Ga0495673_0012171 Ga0495673_0012171_3366_4238 290
813 3300047472 Ga0495686_0000117 Ga0495686_0000117_164229_165101 290
814 3300047472 Ga0495686_0004845 Ga0495686_0004845_6983_7855 290
815 3300047472 Ga0495686_0025565 Ga0495686_0025565_2614_3486 290
816 3300048903 Ga0496100_0005052 Ga0496100_0005052_4435_5307 290
817 3300048903 Ga0496100_0083587 Ga0496100_0083587_847_1719 290
818 3300048904 Ga0496101_0296569 Ga0496101_0296569_157_1044 290
819 3300048905 Ga0496102_0032094 Ga0496102_0032094_1265_2152 290
820 3300048905 Ga0496102_0422372 Ga0496102_0422372_242_1114 290
821 3300048908 Ga0496105_0000914 Ga0496105_0000914_3411_4283 290
822 3300048909 Ga0496106_0000637 Ga0496106_0000637_21469_22356 290
823 3300048912 Ga0496109_0012039 Ga0496109_0012039_2319_3206 290
824 3300048915 Ga0496112_0003022 Ga0496112_0003022_10821_11708 290
825 3300048920 Ga0496117_0023276 Ga0496117_0023276_3670_4542 290
826 3300048920 Ga0496117_0100990 Ga0496117_0100990_536_1408 290
827 3300048921 Ga0496118_0001026 Ga0496118_0001026_27604_28476 290
828 3300048921 Ga0496118_0004246 Ga0496118_0004246_15702_16574 290
829 3300048921 Ga0496118_0008143 Ga0496118_0008143_2737_3609 290
830 3300048921 Ga0496118_0017301 Ga0496118_0017301_5175_6047 290
831 3300048922 Ga0496119_0000306 Ga0496119_0000306_64145_65017 290
832 3300048923 Ga0496120_0000145 Ga0496120_0000145_63692_64564 290
833 3300048924 Ga0496121_0000251 Ga0496121_0000251_48347_49219 290
834 3300048924 Ga0496121_0000593 Ga0496121_0000593_44253_45125 290
835 3300048924 Ga0496121_0041801 Ga0496121_0041801_2844_3716 290
836 3300048924 Ga0496121_0240081 Ga0496121_0240081_67_939 290
837 3300048925 Ga0496122_0008859 Ga0496122_0008859_2826_3698 290
838 3300048925 Ga0496122_0029664 Ga0496122_0029664_2129_3001 290
839 3300048926 Ga0496123_0009630 Ga0496123_0009630_1086_1958 290
840 3300048926 Ga0496123_0018943 Ga0496123_0018943_1626_2498 290
841 3300048927 Ga0496124_0001043 Ga0496124_0001043_42869_43741 290
842 3300048927 Ga0496124_0244663 Ga0496124_0244663_306_1226 290
843 3300048928 Ga0496125_0023701 Ga0496125_0023701_208_1080 290
844 3300048929 Ga0496126_0000712 Ga0496126_0000712_38621_39493 290
845 3300048929 Ga0496126_0115714 Ga0496126_0115714_446_1318 290
846 3300048929 Ga0496126_0256869 Ga0496126_0256869_479_1351 290
847 3300049459 Ga0495678_001135 Ga0495678_001135_228_1100 290
848 3300049460 Ga0495682_0035008 Ga0495682_0035008_51_923 290
849 3300049568 Ga0501031_0045711 Ga0501031_0045711_799_1671 290
850 3300049568 Ga0501031_0138479 Ga0501031_0138479_57_929 290
851 3300049569 Ga0501032_0045363 Ga0501032_0045363_631_1503 290
852 3300049570 Ga0501033_0001322 Ga0501033_0001322_20311_21183 290
853 3300049570 Ga0501033_0382947 Ga0501033_0382947_95_967 290
854 3300049573 Ga0501037_0075291 Ga0501037_0075291_661_1533 290
855 3300049574 Ga0501038_0122747 Ga0501038_0122747_1015_1986 290
856 3300049574 Ga0501038_0159177 Ga0501038_0159177_770_1642 290
857 3300049579 Ga0501043_0130484 Ga0501043_0130484_1059_1931 290
858 3300049581 Ga0501047_0008124 Ga0501047_0008124_95_967 290
859 3300049581 Ga0501047_0212484 Ga0501047_0212484_679_1551 290
860 3300049581 Ga0501047_0426161 Ga0501047_0426161_254_1126 290
861 3300049582 Ga0501048_0097270 Ga0501048_0097270_237_1109 290
862 3300049586 Ga0501070_0008994 Ga0501070_0008994_7246_8118 290
863 3300049591 Ga0501075_0369376 Ga0501075_0369376_51_935 290
864 3300049592 Ga0501076_0104928 Ga0501076_0104928_1277_2161 290
865 3300049823 Ga0501044_0065626 Ga0501044_0065626_181_1053 290
866 3300053087 Ga0500643_000223 Ga0500643_000223_569_1441 290
867 3300053087 Ga0500643_002293 Ga0500643_002293_90_962 290
868 3300053093 Ga0500651_0000244 Ga0500651_0000244_22730_23602 290
869 3300053093 Ga0500651_0000401 Ga0500651_0000401_7867_8739 290
870 3300053103 Ga0500555_000290 Ga0500555_000290_171_1043 290
871 3300053120 Ga0500597_077126 Ga0500597_077126_370_1242 290
872 3300053730 Ga0500645_000648 Ga0500645_000648_20851_21723 290
873 3300001904 JGI24736J21556_1000331 JGI24736J21556_10003312 291
874 3300001979 JGI24740J21852_10016362 JGI24740J21852_100163622 291
875 3300001989 JGI24739J22299_10002202 JGI24739J22299_100022027 291
876 3300001990 JGI24737J22298_10008868 JGI24737J22298_100088683 291
877 3300002067 JGI24735J21928_10012133 JGI24735J21928_100121333 291
878 3300002075 JGI24738J21930_10000044 JGI24738J21930_100000445 291
879 3300002737 JGI25162J39368_1000781 JGI25162J39368_10007812 291
880 3300002737 JGI25162J39368_1003558 JGI25162J39368_10035584 291
881 3300002772 JGI25164J39214_1000537 JGI25164J39214_100053715 291
882 3300002772 JGI25164J39214_1000599 JGI25164J39214_10005992 291
883 3300002774 JGI25150J39212_1000339 JGI25150J39212_10003395 291
884 3300003187 JGI25151J46595_10000141 JGI25151J46595_1000014142 291
885 3300003214 JGI25165J46597_1001192 JGI25165J46597_10011922 291
886 3300003215 JGI25153J46596_10000106 JGI25153J46596_1000010642 291
887 3300003578 Ga0006562J51391_1028372 Ga0006562J51391_10283722 291
888 3300003752 Ga0055539_1001886 Ga0055539_10018861 291
889 3300003759 Ga0055525_1000093 Ga0055525_10000933 291
890 3300003760 Ga0055527_1000245 Ga0055527_10002451 291
891 3300003760 Ga0055527_1001066 Ga0055527_10010666 291
892 3300003761 Ga0055535_1000732 Ga0055535_10007322 291
893 3300003761 Ga0055535_1002441 Ga0055535_10024416 291
894 3300003762 Ga0055542_1000751 Ga0055542_100075122 291
895 3300003762 Ga0055542_1002340 Ga0055542_10023406 291
896 3300003763 Ga0055529_1001551 Ga0055529_10015516 291
897 3300003781 Ga0055536_1001544 Ga0055536_10015443 291
898 3300005327 Ga0070658_10003002 Ga0070658_1000300213 291
899 3300005337 Ga0070682_100056300 Ga0070682_1000563001 291
900 3300005344 Ga0070661_100070505 Ga0070661_1000705052 291
901 3300005344 Ga0070661_100190400 Ga0070661_1001904002 291
902 3300005344 Ga0070661_100461724 Ga0070661_1004617241 291
903 3300005347 Ga0070668_100014195 Ga0070668_1000141953 291
904 3300005347 Ga0070668_100025263 Ga0070668_1000252632 291
905 3300005355 Ga0070671_100017824 Ga0070671_1000178245 291
906 3300005364 Ga0070673_100085963 Ga0070673_1000859634 291
907 3300005366 Ga0070659_100073578 Ga0070659_1000735784 291
908 3300005367 Ga0070667_100072489 Ga0070667_1000724892 291
909 3300005445 Ga0070708_100000059 Ga0070708_10000005922 291
910 3300005455 Ga0070663_100016964 Ga0070663_1000169644 291
911 3300005455 Ga0070663_100023904 Ga0070663_1000239044 291
912 3300005455 Ga0070663_100143396 Ga0070663_1001433962 291
913 3300005457 Ga0070662_100022409 Ga0070662_1000224093 291
914 3300005466 Ga0070685_10004503 Ga0070685_100045033 291
915 3300005539 Ga0068853_100038741 Ga0068853_1000387413 291
916 3300005539 Ga0068853_100051238 Ga0068853_1000512382 291
917 3300005546 Ga0070696_100138591 Ga0070696_1001385912 291
918 3300005548 Ga0070665_100002811 Ga0070665_1000028115 291
919 3300005563 Ga0068855_100062160 Ga0068855_1000621602 291
920 3300005578 Ga0068854_100000786 Ga0068854_1000007867 291
921 3300005614 Ga0068856_100005579 Ga0068856_1000055793 291
922 3300005616 Ga0068852_100014115 Ga0068852_1000141153 291
923 3300005616 Ga0068852_100082733 Ga0068852_1000827332 291
924 3300005616 Ga0068852_100118615 Ga0068852_1001186152 291
925 3300005617 Ga0068859_100000584 Ga0068859_1000005844 291
926 3300005834 Ga0068851_10006366 Ga0068851_100063665 291
927 3300005842 Ga0068858_100000235 Ga0068858_10000023521 291
928 3300005842 Ga0068858_100494183 Ga0068858_1004941832 291
929 3300005843 Ga0068860_100027269 Ga0068860_1000272693 291
930 3300005843 Ga0068860_100075407 Ga0068860_1000754074 291
931 3300005844 Ga0068862_100000715 Ga0068862_10000071524 291
932 3300006028 Ga0070717_10009369 Ga0070717_100093692 291
933 3300006237 Ga0097621_100032392 Ga0097621_1000323922 291
934 3300006358 Ga0068871_100065145 Ga0068871_1000651453 291
935 3300006931 Ga0097620_100000584 Ga0097620_10000058427 291
936 3300007265 Ga0099794_10000152 Ga0099794_1000015210 291
937 3300009093 Ga0105240_10000705 Ga0105240_1000070545 291
938 3300009093 Ga0105240_10200597 Ga0105240_102005972 291
939 3300009101 Ga0105247_10034781 Ga0105247_100347812 291
940 3300009177 Ga0105248_10395772 Ga0105248_103957721 291
941 3300009545 Ga0105237_10000084 Ga0105237_1000008411 291
942 3300009551 Ga0105238_10221147 Ga0105238_102211472 291
943 3300010375 Ga0105239_10018941 Ga0105239_100189415 291
944 3300010375 Ga0105239_10040597 Ga0105239_100405972 291
945 3300010375 Ga0105239_10043604 Ga0105239_100436043 291
946 3300010375 Ga0105239_10059993 Ga0105239_100599934 291
947 3300010375 Ga0105239_10330830 Ga0105239_103308302 291
948 3300013105 Ga0157369_10004125 Ga0157369_100041257 291
949 3300013296 Ga0157374_10143264 Ga0157374_101432642 291
950 3300013297 Ga0157378_10001829 Ga0157378_100018298 291
951 3300014969 Ga0157376_10023163 Ga0157376_100231633 291
952 3300020070 Ga0206356_11496191 Ga0206356_114961912 291
953 3300020081 Ga0206354_10278400 Ga0206354_102784001 291
954 3300022467 Ga0224712_10023723 Ga0224712_100237232 291
955 3300025225 Ga0209566_105364 Ga0209566_1053642 291
956 3300025226 Ga0209674_100453 Ga0209674_10045312 291
957 3300025226 Ga0209674_101324 Ga0209674_1013242 291
958 3300025228 Ga0209672_100005 Ga0209672_100005184 291
959 3300025228 Ga0209672_100055 Ga0209672_100055109 291
960 3300025228 Ga0209672_101177 Ga0209672_1011772 291
961 3300025230 Ga0209563_100045 Ga0209563_100045124 291
962 3300025231 Ga0207427_100134 Ga0207427_10013419 291
963 3300025231 Ga0207427_100150 Ga0207427_10015017 291
964 3300025233 Ga0209437_100005 Ga0209437_100005723 291
965 3300025233 Ga0209437_100200 Ga0209437_10020017 291
966 3300025242 Ga0209258_100006 Ga0209258_100006184 291
967 3300025242 Ga0209258_100012 Ga0209258_10001256 291
968 3300025242 Ga0209258_100255 Ga0209258_10025545 291
969 3300025245 Ga0207425_1000084 Ga0207425_100008444 291
970 3300025250 Ga0209026_1000017 Ga0209026_1000017293 291
971 3300025250 Ga0209026_1000084 Ga0209026_100008487 291
972 3300025253 Ga0209677_103582 Ga0209677_1035823 291
973 3300025254 Ga0209148_1000012 Ga0209148_1000012184 291
974 3300025254 Ga0209148_1000014 Ga0209148_1000014599 291
975 3300025254 Ga0209148_1000221 Ga0209148_100022145 291
976 3300025256 Ga0209759_1001340 Ga0209759_10013409 291
977 3300025256 Ga0209759_1012002 Ga0209759_10120022 291
978 3300025258 Ga0209129_1000057 Ga0209129_1000057174 291
979 3300025258 Ga0209129_1004398 Ga0209129_10043984 291
980 3300025261 Ga0209233_1000011 Ga0209233_1000011219 291
981 3300025261 Ga0209233_1000193 Ga0209233_100019317 291
982 3300025261 Ga0209233_1000957 Ga0209233_10009577 291
983 3300025272 Ga0209455_1000008 Ga0209455_1000008184 291
984 3300025272 Ga0209455_1000014 Ga0209455_1000014487 291
985 3300025272 Ga0209455_1000266 Ga0209455_100026639 291
986 3300025292 Ga0209676_1000027 Ga0209676_1000027275 291
987 3300025294 Ga0209025_1000013 Ga0209025_1000013241 291
988 3300025297 Ga0209758_1000014 Ga0209758_1000014241 291
989 3300025321 Ga0207656_10000936 Ga0207656_100009364 291
990 3300025900 Ga0207710_10074039 Ga0207710_100740392 291
991 3300025903 Ga0207680_10045353 Ga0207680_100453532 291
992 3300025904 Ga0207647_10000019 Ga0207647_1000001979 291
993 3300025904 Ga0207647_10040824 Ga0207647_100408242 291
994 3300025909 Ga0207705_10007619 Ga0207705_100076196 291
995 3300025911 Ga0207654_10278853 Ga0207654_102788531 291
996 3300025913 Ga0207695_10000014 Ga0207695_10000014215 291
997 3300025913 Ga0207695_10000683 Ga0207695_1000068359 291
998 3300025913 Ga0207695_10025619 Ga0207695_100256194 291
999 3300025913 Ga0207695_10065505 Ga0207695_100655053 291
1000 3300025914 Ga0207671_10000011 Ga0207671_10000011307 291
1001 3300025914 Ga0207671_10000507 Ga0207671_1000050731 291
1002 3300025914 Ga0207671_10000764 Ga0207671_100007642 291
1003 3300025914 Ga0207671_10008592 Ga0207671_100085926 291
1004 3300025914 Ga0207671_10020874 Ga0207671_100208743 291
1005 3300025914 Ga0207671_10023665 Ga0207671_100236653 291
1006 3300025914 Ga0207671_10253118 Ga0207671_102531182 291
1007 3300025920 Ga0207649_10002004 Ga0207649_100020046 291
1008 3300025920 Ga0207649_10160508 Ga0207649_101605082 291
1009 3300025924 Ga0207694_10000932 Ga0207694_100009322 291
1010 3300025924 Ga0207694_10002038 Ga0207694_1000203811 291
1011 3300025925 Ga0207650_10004303 Ga0207650_100043032 291
1012 3300025928 Ga0207700_10035503 Ga0207700_100355033 291
1013 3300025931 Ga0207644_10021077 Ga0207644_100210774 291
1014 3300025933 Ga0207706_10301089 Ga0207706_103010891 291
1015 3300025941 Ga0207711_10332390 Ga0207711_103323901 291
1016 3300025949 Ga0207667_10010895 Ga0207667_100108957 291
1017 3300025961 Ga0207712_10000601 Ga0207712_100006011 291
1018 3300025972 Ga0207668_10045026 Ga0207668_100450262 291
1019 3300025972 Ga0207668_10098713 Ga0207668_100987132 291
1020 3300025981 Ga0207640_10000091 Ga0207640_100000913 291
1021 3300025981 Ga0207640_10010209 Ga0207640_100102094 291
1022 3300025986 Ga0207658_10140485 Ga0207658_101404852 291
1023 3300026023 Ga0207677_10131583 Ga0207677_101315832 291
1024 3300026035 Ga0207703_10000250 Ga0207703_1000025012 291
1025 3300026041 Ga0207639_10000117 Ga0207639_1000011714 291
1026 3300026041 Ga0207639_10000304 Ga0207639_1000030428 291
1027 3300026041 Ga0207639_10047073 Ga0207639_100470732 291
1028 3300026067 Ga0207678_10068756 Ga0207678_100687561 291
1029 3300026078 Ga0207702_10000146 Ga0207702_1000014635 291
1030 3300026078 Ga0207702_10002805 Ga0207702_100028058 291
1031 3300026078 Ga0207702_10096169 Ga0207702_100961692 291
1032 3300026095 Ga0207676_10711659 Ga0207676_107116591 291
1033 3300026142 Ga0207698_10009637 Ga0207698_100096373 291
1034 3300026142 Ga0207698_10014742 Ga0207698_100147422 291
1035 3300026142 Ga0207698_10053204 Ga0207698_100532044 291
1036 3300026142 Ga0207698_10573335 Ga0207698_105733351 291
1037 3300027360 Ga0209969_1021540 Ga0209969_10215401 291
1038 3300027364 Ga0209967_1008434 Ga0209967_10084342 291
1039 3300027543 Ga0209999_1034164 Ga0209999_10341641 291
1040 3300027671 Ga0209588_1000048 Ga0209588_100004821 291
1041 3300027682 Ga0209971_1002342 Ga0209971_10023421 291
1042 3300027876 Ga0209974_10053523 Ga0209974_100535231 291
1043 3300028379 Ga0268266_10000007 Ga0268266_10000007488 291
1044 3300028379 Ga0268266_10037056 Ga0268266_100370562 291
1045 3300028380 Ga0268265_10006004 Ga0268265_100060043 291
1046 3300028381 Ga0268264_10016287 Ga0268264_100162873 291
1047 3300028381 Ga0268264_10067806 Ga0268264_100678062 291
1048 3300031238 Ga0265332_10043912 Ga0265332_100439122 291
1049 3300031730 Ga0307516_10081484 Ga0307516_100814842 291
1050 3300031911 Ga0307412_10000964 Ga0307412_100009649 291
1051 3300032004 Ga0307414_10243913 Ga0307414_102439131 291
1052 3300037312 Ga0395899_0000076 Ga0395899_0000076_28013_28888 291
1053 3300037312 Ga0395899_0005634 Ga0395899_0005634_8219_9094 291
1054 3300037312 Ga0395899_0045910 Ga0395899_0045910_1152_2027 291
1055 3300037418 Ga0395900_0000024 Ga0395900_0000024_247667_248542 291
1056 3300037418 Ga0395900_0004448 Ga0395900_0004448_6343_7218 291
1057 3300037418 Ga0395900_0015314 Ga0395900_0015314_4921_5796 291
1058 3300037466 Ga0395898_0000044 Ga0395898_0000044_41419_42294 291
1059 3300037466 Ga0395898_0000311 Ga0395898_0000311_57655_58530 291
1060 3300037471 Ga0395905_0004228 Ga0395905_0004228_2890_3765 291
1061 3300038443 Ga0395901_0315084 Ga0395901_0315084_409_1284 291
1062 3300038443 Ga0395901_0412867 Ga0395901_0412867_102_977 291
1063 3300038705 Ga0237819_00065 Ga0237819_00065_12099_12977 291
1064 3300039447 Ga0436361_0440406 Ga0436361_0440406_16_897 291
1065 3300041404 Ga0439436_0000039 Ga0439436_0000039_21406_22281 291
1066 3300044658 Ga0466972_0120479 Ga0466972_0120479_202_1077 291
1067 3300044663 Ga0466989_0131196 Ga0466989_0131196_479_1354 291
1068 3300044672 Ga0466982_0000012 Ga0466982_0000012_17975_18850 291
1069 3300044684 Ga0466966_0013976 Ga0466966_0013976_4069_4944 291
1070 3300044693 Ga0466961_0006799 Ga0466961_0006799_5830_6705 291
1071 3300044693 Ga0466961_0020185 Ga0466961_0020185_2512_3387 291
1072 3300044706 Ga0466964_0020282 Ga0466964_0020282_336_1211 291
1073 3300044735 Ga0466968_0000372 Ga0466968_0000372_10569_11444 291
1074 3300044735 Ga0466968_0038297 Ga0466968_0038297_955_1830 291
1075 3300044765 Ga0466970_0021689 Ga0466970_0021689_1989_2864 291
1076 3300044842 Ga0466957_0000988 Ga0466957_0000988_11844_12719 291
1077 3300045049 Ga0466959_0000112 Ga0466959_0000112_49161_50036 291
1078 3300045836 Ga0466958_0041319 Ga0466958_0041319_1699_2574 291
1079 3300045836 Ga0466958_0085656 Ga0466958_0085656_815_1690 291
1080 3300046454 Ga0495592_0068831 Ga0495592_0068831_690_1595 291
1081 3300046499 Ga0495594_0083560 Ga0495594_0083560_522_1418 291
1082 3300046511 Ga0495608_0003719 Ga0495608_0003719_7609_8514 291
1083 3300046516 Ga0495628_0035804 Ga0495628_0035804_329_1234 291
1084 3300046559 Ga0495667_0188232 Ga0495667_0188232_360_1265 291
1085 3300046691 Ga0495670_0002544 Ga0495670_0002544_363_1238 291
1086 3300046694 Ga0495649_0045773 Ga0495649_0045773_410_1288 291
1087 3300048907 Ga0496104_0467140 Ga0496104_0467140_267_1142 291
1088 3300048923 Ga0496120_0056783 Ga0496120_0056783_74_949 291
1089 3300048928 Ga0496125_0000239 Ga0496125_0000239_46227_47102 291
1090 3300049570 Ga0501033_0095900 Ga0501033_0095900_596_1471 291
1091 3300049571 Ga0501034_0001814 Ga0501034_0001814_26177_27052 291
1092 3300049580 Ga0501046_0093723 Ga0501046_0093723_61_939 291
1093 3300049586 Ga0501070_0088946 Ga0501070_0088946_731_1606 291
1094 3300049589 Ga0501073_0105507 Ga0501073_0105507_667_1545 291
1095 3300053139 Ga0500568_0005462 Ga0500568_0005462_3128_4006 291
1096 3300060353 Ga0501082_0000524 Ga0501082_0000524_27014_27892 291
1097 3300061719 Ga0466962_0011774 Ga0466962_0011774_282_1157 291
1098 3300061719 Ga0466962_0020327 Ga0466962_0020327_2144_3019 291
1099 3300061719 Ga0466962_0087573 Ga0466962_0087573_223_1098 291

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02629

CoA_binding

CoA binding domain

6

99

0.99

PF00549

Ligase_CoA

CoA-ligase

152

271

0.95

PF13607

Succ_CoA_lig

Succinyl-CoA ligase like flavodoxin domain

146

271

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
6mgg-assembly1.cif.gz_A succinyl-coa synthase from francisella tularensis, phosphorylated, in complex with coa 0.9736 2 283
6pfn-assembly2.cif.gz_C succinyl-coa synthase from francisella tularensis 0.9731 2 283
2nua-assembly1.cif.gz_A c123av mutant of e. coli succinyl-coa synthetase 0.9729 2 287
7mss-assembly1.cif.gz_A human e105qa gtp-specific succinyl-coa synthetase complexed with succinate, magnesium ion and coa 0.9724 3 290
2nu9-assembly1.cif.gz_A c123at mutant of e. coli succinyl-coa synthetase orthorhombic crystal form 0.9721 2 287
ID Description Score Start End Superfamily
af_A0A1D6EZI1_156_262_3.40.50.261 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Succinyl-CoA synthetase domains 1.001 122 207 3.40.50.261
1jllA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9735 2 124 3.40.50.720
1jllA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9658 2 124 3.40.50.720
2yv2A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9617 4 124 3.40.50.720
2yv2A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.954 4 124 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A438H262-F1-model_v4 Succinate--CoA ligase [ADP-forming] subunit alpha-1, mitochondrial 1.001 3 105 GO:0016874
AF-A0A4Q3HXK0-F1-model_v4 deleted 0.9999 1 235
AF-A0A7C5M1I3-F1-model_v4 Succinate--CoA ligase subunit alpha 0.9983 1 180 GO:0004775
GO:0004776
GO:0006099
GO:0009361
AF-A0A2D4K3L3-F1-model_v4 CoA-binding domain-containing protein 0.9978 5 107 GO:0004775
GO:0004776
GO:0005739
GO:0006099
GO:0009361
AF-A0A2N1XEF4-F1-model_v4 Succinate--CoA ligase subunit alpha (EC 6.2.1.5) 0.9977 1 181 GO:0004775
GO:0004776
GO:0006099
GO:0009361

Feature Viewer

pLDDT pTM Quality
92.75 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map