F489989
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1096 | 483 | 1039 | 235 |
Family's Representative Sequence
| Representative Sequence | 3300046506|Ga0495583_0000001|Ga0495583_0000001_517596_518423 |
| Length | 275 |
| Sequence | MVVSPQGASVAVATFGRYRHPAASMLSASVQHSEAMRRAERLFQIIQILRRSRQPVTADAMAAELETSKRSVYRDIAALIGQRAPIRGEAGVGYVLEAGYDMPPLMLTPDEIEAAVLGAQWVAGRGDPVLATAANDLIAKIAAAVPEELRPYVLRPATEAARAWKALPDGLDIAQARAWIHAGRKIRLDYRDEKGAVSQRVVWPVTVGYLETVRLLVAWCELRGDFRHFRTDRVEHAEFLDERHGQRPGALRARWERALEEERQRWLANNPGAGC |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 2 | 2510917020 | Caulobacter sp. AP07 | Isolate | Rhizosphere |
| 3 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 4 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 5 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 6 | 2582581279 | Caulobacter henricii OK261 | Isolate | Rhizosphere |
| 7 | 2582581280 | Caulobacter henricii CF287 | Isolate | Rhizosphere |
| 8 | 2582581293 | Caulobacter henricii YR570 | Isolate | Rhizosphere |
| 9 | 2582581305 | Rhizorhabdus wittichii YR128 | Isolate | Rhizosphere |
| 10 | 2585428106 | Caulobacter sp. OV484 | Isolate | Rhizosphere |
| 11 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 12 | 2643221545 | Caulobacter sp. Root1455 | Isolate | Unclassified |
| 13 | 2643221552 | Caulobacter sp. Root1472 | Isolate | Unclassified |
| 14 | 2643221583 | Caulobacter sp. Root655 | Isolate | Unclassified |
| 15 | 2643221584 | Caulobacter sp. Root656 | Isolate | Unclassified |
| 16 | 2643221598 | Phenylobacterium sp. Root700 | Isolate | Unclassified |
| 17 | 2643221614 | Phenylobacterium sp. Root77 | Isolate | Unclassified |
| 18 | 2643221622 | Sphingomonas sp. Root241 | Isolate | Unclassified |
| 19 | 2643221640 | Caulobacter sp. Root342 | Isolate | Unclassified |
| 20 | 2643221642 | Caulobacter sp. Root343 | Isolate | Unclassified |
| 21 | 2643221661 | Phenylobacterium sp. Root1277 | Isolate | Unclassified |
| 22 | 2643221666 | Phenylobacterium sp. Root1290 | Isolate | Unclassified |
| 23 | 2643221691 | Caulobacter sp. Root487D2Y | Isolate | Unclassified |
| 24 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 25 | 2791355048 | Caulobacter flavus CGMCC1 15093 | Isolate | Rhizosphere |
| 26 | 2818991435 | Caulobacter henricii 536 | Isolate | Unclassified |
| 27 | 2818991454 | Caulobacter rhizosphaerae 3260 | Isolate | Rhizosphere |
| 28 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 29 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 30 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 31 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 32 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 33 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 34 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 35 | 2843744320 | Caulobacter flavus RHGG3 | Isolate | Unclassified |
| 36 | 2849560528 | Caulobacter zeae 410 | Isolate | Unclassified |
| 37 | 2849573788 | Caulobacter endophyticus 774 | Isolate | Unclassified |
| 38 | 2851153111 | Caulobacter radicis 736 | Isolate | Unclassified |
| 39 | 2857504554 | Caulobacter sp. R-72291 | Isolate | Unclassified |
| 40 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 41 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 42 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 43 | 2884960567 | Caulobacter sp. 602-1 | Isolate | Rhizosphere |
| 44 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 45 | 2898329390 | Caulobacter sp. 602-2 | Isolate | Rhizosphere |
| 46 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 47 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 48 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 49 | 2928531327 | Caulobacter sp. 1776 | Isolate | Rhizosphere |
| 50 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 51 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 52 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 53 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 54 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 55 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 56 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 57 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 58 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 59 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 60 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 61 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 62 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 63 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 64 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 65 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 66 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 67 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 68 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 69 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 70 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 71 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 75 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 77 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 78 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 79 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 88 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 90 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 91 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 96 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 97 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 98 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 99 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 100 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 101 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 102 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 103 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 104 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 105 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 106 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 107 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 108 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 109 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 110 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 111 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 112 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 113 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 114 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 115 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 116 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 117 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 118 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 119 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 120 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 121 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 122 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 123 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 124 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 125 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 126 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 127 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 128 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 129 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 130 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 132 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 133 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 134 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 135 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 137 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 138 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 139 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 144 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 146 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 147 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 148 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 149 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 150 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 151 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 152 | 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Metagenome | Rhizosphere |
| 153 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 164 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 165 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 166 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 167 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 168 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 169 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 170 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 171 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 172 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 173 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 174 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 175 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 176 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 177 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 178 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 179 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 180 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 181 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 182 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 183 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 184 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 185 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 186 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 187 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 188 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 189 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 236 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 240 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 241 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 242 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 243 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 244 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 245 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 246 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 247 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 248 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 249 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 250 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 251 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 252 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 253 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 254 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 255 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 256 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 257 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 258 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 259 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 260 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 261 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 262 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 263 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 264 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 265 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 266 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 267 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 268 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 269 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 270 | 3300036458 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 271 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 272 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 273 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 274 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 275 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 276 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 277 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 278 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 279 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 280 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 281 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 282 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 283 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 284 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 285 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 286 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 287 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 288 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 289 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 290 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 291 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 292 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 293 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 294 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 295 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 296 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 297 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 298 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 299 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 300 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 301 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 302 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 303 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 304 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 305 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 306 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 307 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 308 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 309 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 310 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 311 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 312 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 313 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 314 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 315 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 362 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 363 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 364 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 365 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 366 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 367 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 368 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 369 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 370 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 371 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 372 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 373 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 374 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 375 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 376 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 377 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 378 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 379 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 380 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 381 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 382 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 383 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 384 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 387 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 388 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 389 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 390 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 391 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 392 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 393 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 394 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 395 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 396 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 397 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 398 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 399 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 400 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 401 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 402 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 403 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 404 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 405 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 406 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 407 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 408 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 409 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 410 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 411 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 412 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 413 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 414 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 415 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 416 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 417 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 418 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 419 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 420 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 421 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 422 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 423 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 424 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 425 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 426 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 428 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 429 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 430 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 431 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 432 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 433 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 434 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 435 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 436 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 437 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 438 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 439 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 440 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 441 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 442 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 443 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 444 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 445 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 446 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 447 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 448 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 449 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 450 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 451 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 452 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 453 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 454 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 455 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 456 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 457 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 458 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 459 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 460 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 461 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 462 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 463 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 464 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 465 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 466 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 467 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 468 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 469 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 470 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 471 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 472 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 473 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 474 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 475 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 476 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 477 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 478 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 479 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 480 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 481 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 482 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 483 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.71 |
| Metatranscriptomes | 0.09 |
| Isolates | 5.2 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 26 |
| Nodule | 1.37 |
| Rhizoplane | 2.65 |
| Rhizosphere | 58.39 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.59 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | ARCol0yngRDRAFT_1002743 | 3300000652 | Bacteria | 1313 |
| 2 | JGI24739J22299_10082974 | 3300001989 | Bacteria | 982 |
| 3 | JGI24737J22298_10001157 | 3300001990 | Bacteria | 9276 |
| 4 | JGI24737J22298_10002048 | 3300001990 | Bacteria | 7217 |
| 5 | JGI24737J22298_10006756 | 3300001990 | Bacteria | 3899 |
| 6 | JGI24735J21928_10004802 | 3300002067 | Bacteria | 4513 |
| 7 | JGI24735J21928_10011300 | 3300002067 | Bacteria | 2834 |
| 8 | JGI24735J21928_10017522 | 3300002067 | Bacteria | 2215 |
| 9 | JGI24735J21928_10031649 | 3300002067 | Bacteria | 1568 |
| 10 | JGI24744J21845_10010918 | 3300002077 | Bacteria | 1859 |
| 11 | JGI25150J39212_1001113 | 3300002774 | Bacteria | 8088 |
| 12 | JGI25406J46586_10000513 | 3300003203 | Bacteria | 18124 |
| 13 | JGI25165J46597_1000007 | 3300003214 | Bacteria | 518996 |
| 14 | JGI25165J46597_1000165 | 3300003214 | Bacteria | 104009 |
| 15 | JGI25153J46596_10000103 | 3300003215 | Bacteria | 96279 |
| 16 | JGI25153J46596_10000253 | 3300003215 | Bacteria | 43821 |
| 17 | JGI25153J46596_10000301 | 3300003215 | Bacteria | 36933 |
| 18 | rootL2_10056079 | 3300003322 | Bacteria | 6635 |
| 19 | rootL2_10085247 | 3300003322 | Bacteria | 2074 |
| 20 | rootL2_10136953 | 3300003322 | Bacteria | 1186 |
| 21 | JGI25160J50197_1002871 | 3300003354 | Bacteria | 7885 |
| 22 | Ga0055526_1002472 | 3300003771 | Bacteria | 12489 |
| 23 | Ga0055526_1023389 | 3300003771 | Bacteria | 2064 |
| 24 | Ga0055526_1030086 | 3300003771 | Bacteria | 1593 |
| 25 | Ga0055526_1046549 | 3300003771 | Bacteria | 1026 |
| 26 | Ga0055537_1000720 | 3300003773 | Bacteria | 17131 |
| 27 | Ga0055537_1001200 | 3300003773 | Bacteria | 10985 |
| 28 | Ga0055537_1005264 | 3300003773 | Bacteria | 3507 |
| 29 | Ga0055524_1000561 | 3300003775 | Bacteria | 27893 |
| 30 | Ga0055524_1010000 | 3300003775 | Bacteria | 3811 |
| 31 | Ga0055524_1051165 | 3300003775 | Bacteria | 935 |
| 32 | Ga0055536_1000883 | 3300003781 | Bacteria | 19500 |
| 33 | Ga0055536_1001272 | 3300003781 | Bacteria | 15547 |
| 34 | Ga0055528_1007152 | 3300003790 | Bacteria | 4977 |
| 35 | Ga0055530_10001417 | 3300003791 | Bacteria | 17611 |
| 36 | Ga0055530_10007674 | 3300003791 | Bacteria | 4491 |
| 37 | Ga0055530_10034337 | 3300003791 | Bacteria | 1297 |
| 38 | Ga0055540_1003607 | 3300003792 | Bacteria | 7388 |
| 39 | Ga0055531_10000274 | 3300003794 | Bacteria | 53225 |
| 40 | Ga0055531_10001047 | 3300003794 | Bacteria | 21808 |
| 41 | Ga0055531_10005338 | 3300003794 | Bacteria | 7540 |
| 42 | Ga0055531_10022251 | 3300003794 | Bacteria | 2423 |
| 43 | Ga0055531_10036703 | 3300003794 | Bacteria | 1505 |
| 44 | Ga0055543_1020464 | 3300004625 | Bacteria | 1215 |
| 45 | Ga0065165_1000256 | 3300005262 | Bacteria | 92230 |
| 46 | Ga0065165_1001164 | 3300005262 | Bacteria | 30599 |
| 47 | Ga0065165_1001167 | 3300005262 | Bacteria | 30545 |
| 48 | Ga0065165_1004950 | 3300005262 | Bacteria | 7841 |
| 49 | Ga0065165_1032813 | 3300005262 | Bacteria | 1623 |
| 50 | Ga0065165_1058454 | 3300005262 | Bacteria | 1065 |
| 51 | Ga0070658_10004018 | 3300005327 | Bacteria | 12053 |
| 52 | Ga0070658_10004565 | 3300005327 | Bacteria | 11251 |
| 53 | Ga0070658_10212129 | 3300005327 | Bacteria | 1636 |
| 54 | Ga0070676_10000416 | 3300005328 | Bacteria | 20088 |
| 55 | Ga0070670_100205126 | 3300005331 | Bacteria | 1713 |
| 56 | Ga0068869_100015254 | 3300005334 | Bacteria | 5150 |
| 57 | Ga0070666_10186306 | 3300005335 | Bacteria | 1457 |
| 58 | Ga0070680_100017794 | 3300005336 | Bacteria | 5606 |
| 59 | Ga0070682_100202918 | 3300005337 | Bacteria | 1400 |
| 60 | Ga0070682_100208451 | 3300005337 | Bacteria | 1384 |
| 61 | Ga0068868_100000013 | 3300005338 | Bacteria | 110536 |
| 62 | Ga0068868_100667725 | 3300005338 | Bacteria | 927 |
| 63 | Ga0070660_100002444 | 3300005339 | Bacteria | 12761 |
| 64 | Ga0070660_100003692 | 3300005339 | Bacteria | 10562 |
| 65 | Ga0070660_100019488 | 3300005339 | Bacteria | 4972 |
| 66 | Ga0070660_100033044 | 3300005339 | Bacteria | 3897 |
| 67 | Ga0070660_100204054 | 3300005339 | Bacteria | 1604 |
| 68 | Ga0070660_100625404 | 3300005339 | Bacteria | 901 |
| 69 | Ga0070661_100097802 | 3300005344 | Bacteria | 2180 |
| 70 | Ga0070661_100188955 | 3300005344 | Bacteria | 1570 |
| 71 | Ga0070668_100019990 | 3300005347 | Bacteria | 5049 |
| 72 | Ga0070669_100765504 | 3300005353 | Bacteria | 819 |
| 73 | Ga0070675_100134826 | 3300005354 | Bacteria | 2107 |
| 74 | Ga0070671_100067672 | 3300005355 | Bacteria | 2978 |
| 75 | Ga0070673_100000002 | 3300005364 | Bacteria | 225084 |
| 76 | Ga0070673_100334229 | 3300005364 | Bacteria | 1341 |
| 77 | Ga0070659_100003649 | 3300005366 | Bacteria | 10967 |
| 78 | Ga0070659_100036509 | 3300005366 | Bacteria | 3831 |
| 79 | Ga0070659_100077774 | 3300005366 | Bacteria | 2646 |
| 80 | Ga0070659_100148389 | 3300005366 | Bacteria | 1912 |
| 81 | Ga0070709_10003406 | 3300005434 | Bacteria | 8539 |
| 82 | Ga0070709_10020120 | 3300005434 | Bacteria | 3868 |
| 83 | Ga0070709_10045772 | 3300005434 | Bacteria | 2718 |
| 84 | Ga0070714_100226508 | 3300005435 | Bacteria | 1721 |
| 85 | Ga0070713_100010463 | 3300005436 | Bacteria | 6700 |
| 86 | Ga0070713_100071899 | 3300005436 | Bacteria | 2925 |
| 87 | Ga0070713_100222146 | 3300005436 | Bacteria | 1714 |
| 88 | Ga0070713_100287196 | 3300005436 | Bacteria | 1511 |
| 89 | Ga0070710_10025371 | 3300005437 | Bacteria | 3139 |
| 90 | Ga0070711_100001130 | 3300005439 | Bacteria | 14272 |
| 91 | Ga0070711_100002277 | 3300005439 | Bacteria | 10885 |
| 92 | Ga0070711_100452971 | 3300005439 | Bacteria | 1051 |
| 93 | Ga0070663_100572479 | 3300005455 | Bacteria | 947 |
| 94 | Ga0070678_100010460 | 3300005456 | Bacteria | 5671 |
| 95 | Ga0070662_100159029 | 3300005457 | Bacteria | 1766 |
| 96 | Ga0070681_10006411 | 3300005458 | Bacteria | 11447 |
| 97 | Ga0070681_10049606 | 3300005458 | Bacteria | 4191 |
| 98 | Ga0070681_10087304 | 3300005458 | Bacteria | 3072 |
| 99 | Ga0068867_100000012 | 3300005459 | Bacteria | 118831 |
| 100 | Ga0068867_100276620 | 3300005459 | Bacteria | 1375 |
| 101 | Ga0070706_100052063 | 3300005467 | Bacteria | 3780 |
| 102 | Ga0070707_100092451 | 3300005468 | Bacteria | 2929 |
| 103 | Ga0070679_100117260 | 3300005530 | Bacteria | 2647 |
| 104 | Ga0070684_100001671 | 3300005535 | Bacteria | 16123 |
| 105 | Ga0070697_100118434 | 3300005536 | Bacteria | 2213 |
| 106 | Ga0068853_100009612 | 3300005539 | Bacteria | 7791 |
| 107 | Ga0068853_100041194 | 3300005539 | Bacteria | 3943 |
| 108 | Ga0068853_100470288 | 3300005539 | Bacteria | 1184 |
| 109 | Ga0070693_100020120 | 3300005547 | Bacteria | 3514 |
| 110 | Ga0070665_100001299 | 3300005548 | Bacteria | 29894 |
| 111 | Ga0070665_100154706 | 3300005548 | Bacteria | 2295 |
| 112 | Ga0070665_100174582 | 3300005548 | Bacteria | 2150 |
| 113 | Ga0070665_100203709 | 3300005548 | Bacteria | 1979 |
| 114 | Ga0070665_100535622 | 3300005548 | Bacteria | 1183 |
| 115 | Ga0068855_100000095 | 3300005563 | Bacteria | 106561 |
| 116 | Ga0068855_100071449 | 3300005563 | Bacteria | 4036 |
| 117 | Ga0068855_100298678 | 3300005563 | Bacteria | 1784 |
| 118 | Ga0068855_100498496 | 3300005563 | Bacteria | 1323 |
| 119 | Ga0068857_100013087 | 3300005577 | Bacteria | 7230 |
| 120 | Ga0068857_100021147 | 3300005577 | Bacteria | 5725 |
| 121 | Ga0068857_100163281 | 3300005577 | Bacteria | 2022 |
| 122 | Ga0068856_100000137 | 3300005614 | Bacteria | 73762 |
| 123 | Ga0068856_100016744 | 3300005614 | Bacteria | 7101 |
| 124 | Ga0068856_100345247 | 3300005614 | Bacteria | 1507 |
| 125 | Ga0068852_100000586 | 3300005616 | Bacteria | 23996 |
| 126 | Ga0068852_100088449 | 3300005616 | Bacteria | 2767 |
| 127 | Ga0068859_100005156 | 3300005617 | Bacteria | 13269 |
| 128 | Ga0068864_100007001 | 3300005618 | Bacteria | 9253 |
| 129 | Ga0068866_10071782 | 3300005718 | Bacteria | 1832 |
| 130 | Ga0068861_100207079 | 3300005719 | Bacteria | 1650 |
| 131 | Ga0068851_10024349 | 3300005834 | Bacteria | 2963 |
| 132 | Ga0068863_100025840 | 3300005841 | Bacteria | 5602 |
| 133 | Ga0068863_100359835 | 3300005841 | Bacteria | 1418 |
| 134 | Ga0068858_100000771 | 3300005842 | Bacteria | 33416 |
| 135 | Ga0068858_100009417 | 3300005842 | Bacteria | 9320 |
| 136 | Ga0068858_100242087 | 3300005842 | Bacteria | 1712 |
| 137 | Ga0068860_100000313 | 3300005843 | Bacteria | 66545 |
| 138 | Ga0068860_101020018 | 3300005843 | Bacteria | 846 |
| 139 | Ga0068862_100015180 | 3300005844 | Bacteria | 6396 |
| 140 | Ga0068862_100015872 | 3300005844 | Bacteria | 6258 |
| 141 | Ga0081455_10002424 | 3300005937 | Bacteria | 22245 |
| 142 | Ga0081455_10017304 | 3300005937 | Bacteria | 6918 |
| 143 | Ga0081540_1024929 | 3300005983 | Bacteria | 3458 |
| 144 | Ga0081540_1028527 | 3300005983 | Bacteria | 3132 |
| 145 | Ga0081540_1059623 | 3300005983 | Bacteria | 1831 |
| 146 | Ga0081540_1072041 | 3300005983 | Bacteria | 1594 |
| 147 | Ga0081540_1142003 | 3300005983 | Bacteria | 962 |
| 148 | Ga0081539_10000801 | 3300005985 | Bacteria | 61178 |
| 149 | Ga0081539_10073132 | 3300005985 | Bacteria | 1830 |
| 150 | Ga0075365_10036163 | 3300006038 | Bacteria | 3199 |
| 151 | Ga0075365_10055263 | 3300006038 | Bacteria | 2634 |
| 152 | Ga0075365_10164151 | 3300006038 | Bacteria | 1549 |
| 153 | Ga0075365_10238357 | 3300006038 | Bacteria | 1277 |
| 154 | Ga0075368_10003536 | 3300006042 | Bacteria | 5233 |
| 155 | Ga0075363_100004455 | 3300006048 | Bacteria | 6132 |
| 156 | Ga0075364_10012640 | 3300006051 | Bacteria | 5171 |
| 157 | Ga0075364_10077984 | 3300006051 | Bacteria | 2187 |
| 158 | Ga0075364_10520688 | 3300006051 | Bacteria | 813 |
| 159 | Ga0070712_100009825 | 3300006175 | Bacteria | 6031 |
| 160 | Ga0075362_10021637 | 3300006177 | Bacteria | 2702 |
| 161 | Ga0075367_10020984 | 3300006178 | Bacteria | 3645 |
| 162 | Ga0075367_10037363 | 3300006178 | Bacteria | 2821 |
| 163 | Ga0075367_10039353 | 3300006178 | Bacteria | 2756 |
| 164 | Ga0075369_10004680 | 3300006186 | Bacteria | 5076 |
| 165 | Ga0075369_10005108 | 3300006186 | Bacteria | 4887 |
| 166 | Ga0075369_10009026 | 3300006186 | Bacteria | 3859 |
| 167 | Ga0075369_10106555 | 3300006186 | Bacteria | 1261 |
| 168 | Ga0075369_10120009 | 3300006186 | Bacteria | 1190 |
| 169 | Ga0075369_10238000 | 3300006186 | Bacteria | 844 |
| 170 | Ga0075366_10008146 | 3300006195 | Bacteria | 5815 |
| 171 | Ga0075366_10086221 | 3300006195 | Bacteria | 1878 |
| 172 | Ga0075366_10161131 | 3300006195 | Bacteria | 1359 |
| 173 | Ga0097621_100061585 | 3300006237 | Bacteria | 3078 |
| 174 | Ga0097621_100144761 | 3300006237 | Bacteria | 2034 |
| 175 | Ga0097621_100872561 | 3300006237 | Bacteria | 837 |
| 176 | Ga0075370_10130135 | 3300006353 | Bacteria | 1468 |
| 177 | Ga0075370_10169650 | 3300006353 | Bacteria | 1282 |
| 178 | Ga0075370_10297882 | 3300006353 | Bacteria | 959 |
| 179 | Ga0075428_100150741 | 3300006844 | Bacteria | 2526 |
| 180 | Ga0075434_100023401 | 3300006871 | Bacteria | 6020 |
| 181 | Ga0068865_100000004 | 3300006881 | Bacteria | 226236 |
| 182 | Ga0068865_100480280 | 3300006881 | Bacteria | 1033 |
| 183 | Ga0097620_100005156 | 3300006931 | Bacteria | 13269 |
| 184 | Ga0075435_100411755 | 3300007076 | Bacteria | 1164 |
| 185 | Ga0099794_10061546 | 3300007265 | Bacteria | 1824 |
| 186 | Ga0099795_10001129 | 3300007788 | Bacteria | 5569 |
| 187 | Ga0099795_10005962 | 3300007788 | Bacteria | 3288 |
| 188 | Ga0099795_10067502 | 3300007788 | Bacteria | 1342 |
| 189 | Ga0105240_10002463 | 3300009093 | Bacteria | 29749 |
| 190 | Ga0105240_10033307 | 3300009093 | Bacteria | 6659 |
| 191 | Ga0105240_10064674 | 3300009093 | Bacteria | 4544 |
| 192 | Ga0105240_10071475 | 3300009093 | Bacteria | 4291 |
| 193 | Ga0105240_10086052 | 3300009093 | Bacteria | 3850 |
| 194 | Ga0105240_10298611 | 3300009093 | Bacteria | 1843 |
| 195 | Ga0105240_10323474 | 3300009093 | Bacteria | 1757 |
| 196 | Ga0105245_10001027 | 3300009098 | Bacteria | 25355 |
| 197 | Ga0105245_10003725 | 3300009098 | Bacteria | 13583 |
| 198 | Ga0105245_11027269 | 3300009098 | Bacteria | 869 |
| 199 | Ga0105247_10043425 | 3300009101 | Bacteria | 2754 |
| 200 | Ga0105247_10503386 | 3300009101 | Bacteria | 883 |
| 201 | Ga0114129_10054829 | 3300009147 | Bacteria | 5588 |
| 202 | Ga0105243_10000146 | 3300009148 | Bacteria | 81008 |
| 203 | Ga0105242_10000497 | 3300009176 | Bacteria | 31053 |
| 204 | Ga0105248_10001758 | 3300009177 | Bacteria | 24108 |
| 205 | Ga0105248_10007949 | 3300009177 | Bacteria | 11658 |
| 206 | Ga0105248_10042051 | 3300009177 | Bacteria | 5125 |
| 207 | Ga0105248_10047211 | 3300009177 | Bacteria | 4829 |
| 208 | Ga0105248_10347630 | 3300009177 | Bacteria | 1669 |
| 209 | Ga0105237_10052574 | 3300009545 | Bacteria | 4088 |
| 210 | Ga0105237_10053748 | 3300009545 | Bacteria | 4039 |
| 211 | Ga0105237_10054084 | 3300009545 | Bacteria | 4023 |
| 212 | Ga0105237_10133176 | 3300009545 | Bacteria | 2480 |
| 213 | Ga0105238_10006268 | 3300009551 | Bacteria | 11820 |
| 214 | Ga0105238_10022426 | 3300009551 | Bacteria | 6435 |
| 215 | Ga0105238_10225558 | 3300009551 | Bacteria | 1850 |
| 216 | Ga0105249_10015630 | 3300009553 | Bacteria | 6720 |
| 217 | Ga0105249_10157228 | 3300009553 | Bacteria | 2193 |
| 218 | Ga0105249_10179246 | 3300009553 | Bacteria | 2060 |
| 219 | Ga0099796_10012567 | 3300010159 | Bacteria | 2395 |
| 220 | Ga0105239_10017503 | 3300010375 | Bacteria | 7926 |
| 221 | Ga0105239_10216274 | 3300010375 | Bacteria | 2149 |
| 222 | Ga0105239_10851949 | 3300010375 | Bacteria | 1045 |
| 223 | Ga0105246_10000138 | 3300011119 | Bacteria | 33809 |
| 224 | Ga0157327_1000745 | 3300012512 | Bacteria | 1841 |
| 225 | Ga0157373_10079649 | 3300013100 | Bacteria | 2311 |
| 226 | Ga0157370_10000096 | 3300013104 | Bacteria | 99163 |
| 227 | Ga0157370_10274931 | 3300013104 | Bacteria | 1556 |
| 228 | Ga0157369_10018692 | 3300013105 | Bacteria | 7770 |
| 229 | Ga0157369_10022918 | 3300013105 | Bacteria | 6962 |
| 230 | Ga0157369_10053822 | 3300013105 | Bacteria | 4348 |
| 231 | Ga0157374_10001104 | 3300013296 | Bacteria | 23221 |
| 232 | Ga0157378_10015726 | 3300013297 | Bacteria | 6625 |
| 233 | Ga0157378_10091415 | 3300013297 | Bacteria | 2767 |
| 234 | Ga0163162_10004509 | 3300013306 | Bacteria | 13410 |
| 235 | Ga0163162_10026231 | 3300013306 | Bacteria | 5759 |
| 236 | Ga0163162_11080978 | 3300013306 | Bacteria | 908 |
| 237 | Ga0157372_10034063 | 3300013307 | Bacteria | 5596 |
| 238 | Ga0157372_10067956 | 3300013307 | Bacteria | 4006 |
| 239 | Ga0157372_10294884 | 3300013307 | Bacteria | 1886 |
| 240 | Ga0157372_10559346 | 3300013307 | Bacteria | 1333 |
| 241 | Ga0157375_10000587 | 3300013308 | Bacteria | 32327 |
| 242 | Ga0163163_10018900 | 3300014325 | Bacteria | 6465 |
| 243 | Ga0163163_10089709 | 3300014325 | Bacteria | 3087 |
| 244 | Ga0163163_10557376 | 3300014325 | Bacteria | 1209 |
| 245 | Ga0157380_10122751 | 3300014326 | Bacteria | 2203 |
| 246 | Ga0157380_10532302 | 3300014326 | Bacteria | 1149 |
| 247 | Ga0182008_10154201 | 3300014497 | Bacteria | 1153 |
| 248 | Ga0157379_10014381 | 3300014968 | Bacteria | 6944 |
| 249 | Ga0157379_10027684 | 3300014968 | Bacteria | 5046 |
| 250 | Ga0157379_10033261 | 3300014968 | Bacteria | 4598 |
| 251 | Ga0157379_10067957 | 3300014968 | Bacteria | 3186 |
| 252 | Ga0157379_10199431 | 3300014968 | Bacteria | 1809 |
| 253 | Ga0157376_10000131 | 3300014969 | Bacteria | 51790 |
| 254 | Ga0163161_10056570 | 3300017792 | Bacteria | 2849 |
| 255 | Ga0213872_10070428 | 3300021361 | Bacteria | 1577 |
| 256 | Ga0213876_10000345 | 3300021384 | Bacteria | 40189 |
| 257 | Ga0213876_10038689 | 3300021384 | Bacteria | 2518 |
| 258 | Ga0209436_112907 | 3300025208 | Bacteria | 1395 |
| 259 | Ga0209437_106743 | 3300025233 | Bacteria | 1899 |
| 260 | Ga0207425_1000094 | 3300025245 | Bacteria | 85629 |
| 261 | Ga0207425_1001939 | 3300025245 | Bacteria | 7787 |
| 262 | Ga0209026_1001831 | 3300025250 | Bacteria | 8716 |
| 263 | Ga0209677_102422 | 3300025253 | Bacteria | 7047 |
| 264 | Ga0209148_1000074 | 3300025254 | Bacteria | 314356 |
| 265 | Ga0209148_1001194 | 3300025254 | Bacteria | 14881 |
| 266 | Ga0209129_1001201 | 3300025258 | Bacteria | 14903 |
| 267 | Ga0209233_1000026 | 3300025261 | Bacteria | 678466 |
| 268 | Ga0209233_1000098 | 3300025261 | Bacteria | 294111 |
| 269 | Ga0209233_1002344 | 3300025261 | Bacteria | 7057 |
| 270 | Ga0209565_1000007 | 3300025263 | Bacteria | 784361 |
| 271 | Ga0209565_1000618 | 3300025263 | Bacteria | 23421 |
| 272 | Ga0209565_1038534 | 3300025263 | Bacteria | 899 |
| 273 | Ga0209455_1000574 | 3300025272 | Bacteria | 24064 |
| 274 | Ga0209455_1002785 | 3300025272 | Bacteria | 6531 |
| 275 | Ga0209455_1013949 | 3300025272 | Bacteria | 1841 |
| 276 | Ga0209455_1016958 | 3300025272 | Bacteria | 1545 |
| 277 | Ga0209455_1036672 | 3300025272 | Bacteria | 778 |
| 278 | Ga0209673_1000722 | 3300025273 | Bacteria | 45860 |
| 279 | Ga0209673_1001309 | 3300025273 | Bacteria | 25209 |
| 280 | Ga0209673_1016536 | 3300025273 | Bacteria | 2753 |
| 281 | Ga0209673_1027785 | 3300025273 | Bacteria | 1834 |
| 282 | Ga0209676_1000243 | 3300025292 | Bacteria | 117113 |
| 283 | Ga0209676_1000311 | 3300025292 | Bacteria | 95478 |
| 284 | Ga0209676_1004805 | 3300025292 | Bacteria | 7338 |
| 285 | Ga0209025_1000630 | 3300025294 | Bacteria | 62487 |
| 286 | Ga0209564_1000713 | 3300025295 | Bacteria | 48301 |
| 287 | Ga0209564_1000718 | 3300025295 | Bacteria | 47576 |
| 288 | Ga0209564_1000745 | 3300025295 | Bacteria | 46163 |
| 289 | Ga0209564_1003160 | 3300025295 | Bacteria | 11595 |
| 290 | Ga0209564_1006871 | 3300025295 | Bacteria | 6001 |
| 291 | Ga0209564_1008096 | 3300025295 | Bacteria | 5260 |
| 292 | Ga0209564_1009741 | 3300025295 | Bacteria | 4522 |
| 293 | Ga0209564_1032344 | 3300025295 | Bacteria | 1578 |
| 294 | Ga0209758_1000002 | 3300025297 | Bacteria | 1400310 |
| 295 | Ga0209758_1000015 | 3300025297 | Bacteria | 851943 |
| 296 | Ga0209758_1000108 | 3300025297 | Bacteria | 216541 |
| 297 | Ga0209758_1000239 | 3300025297 | Bacteria | 114761 |
| 298 | Ga0209758_1000252 | 3300025297 | Bacteria | 108214 |
| 299 | Ga0209758_1001566 | 3300025297 | Bacteria | 26231 |
| 300 | Ga0209758_1001570 | 3300025297 | Bacteria | 26195 |
| 301 | Ga0209758_1004632 | 3300025297 | Bacteria | 11268 |
| 302 | Ga0209758_1006280 | 3300025297 | Bacteria | 8638 |
| 303 | Ga0209758_1006552 | 3300025297 | Bacteria | 8293 |
| 304 | Ga0209758_1021049 | 3300025297 | Bacteria | 3057 |
| 305 | Ga0209758_1022902 | 3300025297 | Bacteria | 2844 |
| 306 | Ga0209758_1026731 | 3300025297 | Bacteria | 2488 |
| 307 | Ga0209758_1028026 | 3300025297 | Bacteria | 2393 |
| 308 | Ga0209050_1000244 | 3300025298 | Bacteria | 117105 |
| 309 | Ga0209050_1000342 | 3300025298 | Bacteria | 92644 |
| 310 | Ga0209050_1000375 | 3300025298 | Bacteria | 84503 |
| 311 | Ga0209050_1005517 | 3300025298 | Bacteria | 7905 |
| 312 | Ga0209050_1011876 | 3300025298 | Bacteria | 4069 |
| 313 | Ga0209050_1014540 | 3300025298 | Bacteria | 3381 |
| 314 | Ga0209256_1000008 | 3300025299 | Bacteria | 975723 |
| 315 | Ga0209256_1001119 | 3300025299 | Bacteria | 30656 |
| 316 | Ga0209256_1002155 | 3300025299 | Bacteria | 16982 |
| 317 | Ga0209256_1002592 | 3300025299 | Bacteria | 14393 |
| 318 | Ga0209256_1008041 | 3300025299 | Bacteria | 4993 |
| 319 | Ga0209256_1010559 | 3300025299 | Bacteria | 3842 |
| 320 | Ga0207426_1000217 | 3300025302 | Bacteria | 136180 |
| 321 | Ga0207426_1000368 | 3300025302 | Bacteria | 79715 |
| 322 | Ga0207426_1016643 | 3300025302 | Bacteria | 2633 |
| 323 | Ga0209051_1000226 | 3300025303 | Bacteria | 94990 |
| 324 | Ga0209051_1003593 | 3300025303 | Bacteria | 10081 |
| 325 | Ga0209257_1000066 | 3300025304 | Bacteria | 344166 |
| 326 | Ga0209257_1000140 | 3300025304 | Bacteria | 201515 |
| 327 | Ga0209257_1001119 | 3300025304 | Bacteria | 34613 |
| 328 | Ga0209257_1002989 | 3300025304 | Bacteria | 15349 |
| 329 | Ga0209257_1003585 | 3300025304 | Bacteria | 13127 |
| 330 | Ga0209257_1004459 | 3300025304 | Bacteria | 10837 |
| 331 | Ga0209257_1017346 | 3300025304 | Bacteria | 2843 |
| 332 | Ga0209257_1019253 | 3300025304 | Bacteria | 2579 |
| 333 | Ga0209257_1023078 | 3300025304 | Bacteria | 2199 |
| 334 | Ga0207692_10092668 | 3300025898 | Bacteria | 1642 |
| 335 | Ga0207642_10150907 | 3300025899 | Bacteria | 1237 |
| 336 | Ga0207680_10208528 | 3300025903 | Bacteria | 1335 |
| 337 | Ga0207647_10025784 | 3300025904 | Bacteria | 3855 |
| 338 | Ga0207647_10152771 | 3300025904 | Bacteria | 1349 |
| 339 | Ga0207647_10359411 | 3300025904 | Bacteria | 824 |
| 340 | Ga0207699_10019120 | 3300025906 | Bacteria | 3646 |
| 341 | Ga0207699_10032628 | 3300025906 | Bacteria | 2935 |
| 342 | Ga0207699_10062902 | 3300025906 | Bacteria | 2239 |
| 343 | Ga0207645_10004384 | 3300025907 | Bacteria | 10452 |
| 344 | Ga0207705_10000055 | 3300025909 | Bacteria | 160436 |
| 345 | Ga0207705_10007178 | 3300025909 | Bacteria | 8207 |
| 346 | Ga0207684_10047574 | 3300025910 | Bacteria | 3637 |
| 347 | Ga0207654_10496656 | 3300025911 | Bacteria | 861 |
| 348 | Ga0207707_10000143 | 3300025912 | Bacteria | 74226 |
| 349 | Ga0207707_10014431 | 3300025912 | Bacteria | 6882 |
| 350 | Ga0207695_10004557 | 3300025913 | Bacteria | 18841 |
| 351 | Ga0207695_10005778 | 3300025913 | Bacteria | 16288 |
| 352 | Ga0207695_10029272 | 3300025913 | Bacteria | 6091 |
| 353 | Ga0207695_10525076 | 3300025913 | Bacteria | 1065 |
| 354 | Ga0207671_10029351 | 3300025914 | Bacteria | 4106 |
| 355 | Ga0207671_10061198 | 3300025914 | Bacteria | 2793 |
| 356 | Ga0207671_10144019 | 3300025914 | Bacteria | 1837 |
| 357 | Ga0207671_10178948 | 3300025914 | Bacteria | 1650 |
| 358 | Ga0207693_10054355 | 3300025915 | Bacteria | 3141 |
| 359 | Ga0207693_10166544 | 3300025915 | Bacteria | 1735 |
| 360 | Ga0207663_10052117 | 3300025916 | Bacteria | 2551 |
| 361 | Ga0207660_10007904 | 3300025917 | Bacteria | 6882 |
| 362 | Ga0207660_10274141 | 3300025917 | Bacteria | 1337 |
| 363 | Ga0207657_10004951 | 3300025919 | Bacteria | 14018 |
| 364 | Ga0207657_10005482 | 3300025919 | Bacteria | 13248 |
| 365 | Ga0207657_10013332 | 3300025919 | Bacteria | 8064 |
| 366 | Ga0207657_10139147 | 3300025919 | Bacteria | 1984 |
| 367 | Ga0207652_10024703 | 3300025921 | Bacteria | 4987 |
| 368 | Ga0207646_10065090 | 3300025922 | Bacteria | 3254 |
| 369 | Ga0207694_10029840 | 3300025924 | Bacteria | 4163 |
| 370 | Ga0207694_10049968 | 3300025924 | Bacteria | 3238 |
| 371 | Ga0207694_10050027 | 3300025924 | Bacteria | 3235 |
| 372 | Ga0207694_10067102 | 3300025924 | Bacteria | 2800 |
| 373 | Ga0207659_10015289 | 3300025926 | Bacteria | 4967 |
| 374 | Ga0207659_10232512 | 3300025926 | Bacteria | 1487 |
| 375 | Ga0207659_10510357 | 3300025926 | Bacteria | 1018 |
| 376 | Ga0207687_10000755 | 3300025927 | Bacteria | 21846 |
| 377 | Ga0207687_10089008 | 3300025927 | Bacteria | 2247 |
| 378 | Ga0207687_10201791 | 3300025927 | Bacteria | 1555 |
| 379 | Ga0207700_10034094 | 3300025928 | Bacteria | 3650 |
| 380 | Ga0207700_10110658 | 3300025928 | Bacteria | 2209 |
| 381 | Ga0207700_10197737 | 3300025928 | Bacteria | 1693 |
| 382 | Ga0207700_10227682 | 3300025928 | Bacteria | 1583 |
| 383 | Ga0207690_10004570 | 3300025932 | Bacteria | 8175 |
| 384 | Ga0207690_10036500 | 3300025932 | Bacteria | 3183 |
| 385 | Ga0207690_10401104 | 3300025932 | Bacteria | 1094 |
| 386 | Ga0207706_10010431 | 3300025933 | Bacteria | 8489 |
| 387 | Ga0207686_10067444 | 3300025934 | Bacteria | 2289 |
| 388 | Ga0207709_10000314 | 3300025935 | Bacteria | 52842 |
| 389 | Ga0207704_10000005 | 3300025938 | Bacteria | 225353 |
| 390 | Ga0207711_10000852 | 3300025941 | Bacteria | 29486 |
| 391 | Ga0207711_10004629 | 3300025941 | Bacteria | 11695 |
| 392 | Ga0207711_10176891 | 3300025941 | Bacteria | 1939 |
| 393 | Ga0207689_10001653 | 3300025942 | Bacteria | 21135 |
| 394 | Ga0207679_10256115 | 3300025945 | Bacteria | 1490 |
| 395 | Ga0207667_10000016 | 3300025949 | Bacteria | 391466 |
| 396 | Ga0207667_10020014 | 3300025949 | Bacteria | 7455 |
| 397 | Ga0207667_10079777 | 3300025949 | Bacteria | 3392 |
| 398 | Ga0207651_10000007 | 3300025960 | Bacteria | 225286 |
| 399 | Ga0207712_10007902 | 3300025961 | Bacteria | 6720 |
| 400 | Ga0207712_10088953 | 3300025961 | Bacteria | 2269 |
| 401 | Ga0207712_10234109 | 3300025961 | Bacteria | 1476 |
| 402 | Ga0207668_10436882 | 3300025972 | Bacteria | 1114 |
| 403 | Ga0207677_10000085 | 3300026023 | Bacteria | 78393 |
| 404 | Ga0207703_10001689 | 3300026035 | Bacteria | 19855 |
| 405 | Ga0207703_10006205 | 3300026035 | Bacteria | 9564 |
| 406 | Ga0207703_10224453 | 3300026035 | Bacteria | 1681 |
| 407 | Ga0207639_10038697 | 3300026041 | Bacteria | 3549 |
| 408 | Ga0207639_10255690 | 3300026041 | Bacteria | 1530 |
| 409 | Ga0207639_10286758 | 3300026041 | Bacteria | 1450 |
| 410 | Ga0207678_10049937 | 3300026067 | Bacteria | 3615 |
| 411 | Ga0207678_10746243 | 3300026067 | Bacteria | 863 |
| 412 | Ga0207702_10000063 | 3300026078 | Bacteria | 123034 |
| 413 | Ga0207702_10005342 | 3300026078 | Bacteria | 11261 |
| 414 | Ga0207702_10423659 | 3300026078 | Bacteria | 1287 |
| 415 | Ga0207641_10028640 | 3300026088 | Bacteria | 4603 |
| 416 | Ga0207641_10341334 | 3300026088 | Bacteria | 1425 |
| 417 | Ga0207641_10389758 | 3300026088 | Bacteria | 1336 |
| 418 | Ga0207641_10518373 | 3300026088 | Bacteria | 1159 |
| 419 | Ga0207648_10000005 | 3300026089 | Bacteria | 225083 |
| 420 | Ga0207676_10001553 | 3300026095 | Bacteria | 16924 |
| 421 | Ga0207676_10159444 | 3300026095 | Bacteria | 1953 |
| 422 | Ga0207676_10369365 | 3300026095 | Bacteria | 1332 |
| 423 | Ga0207674_10000989 | 3300026116 | Bacteria | 37099 |
| 424 | Ga0207674_10017443 | 3300026116 | Bacteria | 7835 |
| 425 | Ga0207674_10018135 | 3300026116 | Bacteria | 7658 |
| 426 | Ga0207674_10484544 | 3300026116 | Bacteria | 1195 |
| 427 | Ga0207675_100343902 | 3300026118 | Bacteria | 1461 |
| 428 | Ga0207675_100537927 | 3300026118 | Bacteria | 1166 |
| 429 | Ga0207683_10149323 | 3300026121 | Bacteria | 2108 |
| 430 | Ga0207698_10000294 | 3300026142 | Bacteria | 30242 |
| 431 | Ga0207698_10033871 | 3300026142 | Bacteria | 3716 |
| 432 | Ga0207698_10264407 | 3300026142 | Bacteria | 1582 |
| 433 | Ga0207428_10207164 | 3300027907 | Bacteria | 1474 |
| 434 | Ga0268266_10000003 | 3300028379 | Bacteria | 1701703 |
| 435 | Ga0268266_10126859 | 3300028379 | Bacteria | 2278 |
| 436 | Ga0268266_10154418 | 3300028379 | Bacteria | 2072 |
| 437 | Ga0268266_10166098 | 3300028379 | Bacteria | 2000 |
| 438 | Ga0268266_10235109 | 3300028379 | Bacteria | 1689 |
| 439 | Ga0268266_10545318 | 3300028379 | Bacteria | 1111 |
| 440 | Ga0268265_10023564 | 3300028380 | Bacteria | 4340 |
| 441 | Ga0268265_10036215 | 3300028380 | Bacteria | 3613 |
| 442 | Ga0268265_10453740 | 3300028380 | Bacteria | 1198 |
| 443 | Ga0268264_10000356 | 3300028381 | Bacteria | 68810 |
| 444 | Ga0307517_10176599 | 3300028786 | Bacteria | 1389 |
| 445 | Ga0307515_10033355 | 3300028794 | Bacteria | 8482 |
| 446 | Ga0307511_10034380 | 3300030521 | Bacteria | 4450 |
| 447 | Ga0307512_10191584 | 3300030522 | Bacteria | 1127 |
| 448 | Ga0265330_10010731 | 3300031235 | Bacteria | 4310 |
| 449 | Ga0265330_10063434 | 3300031235 | Bacteria | 1606 |
| 450 | Ga0265332_10151694 | 3300031238 | Bacteria | 969 |
| 451 | Ga0265320_10001345 | 3300031240 | Bacteria | 17924 |
| 452 | Ga0265340_10016299 | 3300031247 | Bacteria | 3849 |
| 453 | Ga0265340_10186514 | 3300031247 | Bacteria | 936 |
| 454 | Ga0265331_10032239 | 3300031250 | Bacteria | 2598 |
| 455 | Ga0265316_10045394 | 3300031344 | Bacteria | 3489 |
| 456 | Ga0307513_10079397 | 3300031456 | Bacteria | 3390 |
| 457 | Ga0307513_10270222 | 3300031456 | Bacteria | 1484 |
| 458 | Ga0307513_10306911 | 3300031456 | Bacteria | 1351 |
| 459 | Ga0307509_10192327 | 3300031507 | Bacteria | 1889 |
| 460 | Ga0307509_10541234 | 3300031507 | Bacteria | 843 |
| 461 | Ga0307408_100064798 | 3300031548 | Bacteria | 2678 |
| 462 | Ga0307508_10001949 | 3300031616 | Bacteria | 22585 |
| 463 | Ga0307508_10262591 | 3300031616 | Bacteria | 1321 |
| 464 | Ga0265314_10071962 | 3300031711 | Bacteria | 2311 |
| 465 | Ga0265314_10073784 | 3300031711 | Bacteria | 2274 |
| 466 | Ga0265342_10003269 | 3300031712 | Bacteria | 13437 |
| 467 | Ga0265342_10028180 | 3300031712 | Bacteria | 3502 |
| 468 | Ga0265342_10089269 | 3300031712 | Bacteria | 1769 |
| 469 | Ga0265342_10122932 | 3300031712 | Bacteria | 1460 |
| 470 | Ga0307516_10000034 | 3300031730 | Bacteria | 155251 |
| 471 | Ga0307516_10005305 | 3300031730 | Bacteria | 15512 |
| 472 | Ga0307516_10126728 | 3300031730 | Bacteria | 2337 |
| 473 | Ga0307405_10414785 | 3300031731 | Bacteria | 1058 |
| 474 | Ga0307412_10355937 | 3300031911 | Bacteria | 1177 |
| 475 | Ga0307412_10421289 | 3300031911 | Bacteria | 1092 |
| 476 | Ga0307414_10021121 | 3300032004 | Bacteria | 4076 |
| 477 | Ga0307414_10197404 | 3300032004 | Bacteria | 1633 |
| 478 | Ga0307510_10103437 | 3300033180 | Bacteria | 2625 |
| 479 | Ga0307510_10129319 | 3300033180 | Bacteria | 2204 |
| 480 | Ga0307510_10167278 | 3300033180 | Bacteria | 1784 |
| 481 | Ga0373934_0135557 | 3300035086 | Bacteria | 1005 |
| 482 | Ga0373944_0080706 | 3300035089 | Bacteria | 1074 |
| 483 | Ga0373923_0182533 | 3300035111 | Bacteria | 965 |
| 484 | Ga0373936_0086972 | 3300035113 | Bacteria | 1307 |
| 485 | Ga0373936_0187711 | 3300035113 | Bacteria | 909 |
| 486 | Ga0373955_0449417 | 3300035172 | Bacteria | 785 |
| 487 | Ga0373935_0005959 | 3300035692 | Bacteria | 7231 |
| 488 | Ga0373927_0002991 | 3300035695 | Bacteria | 12261 |
| 489 | Ga0373927_0014399 | 3300035695 | Bacteria | 5236 |
| 490 | Ga0373927_0049450 | 3300035695 | Bacteria | 2718 |
| 491 | Ga0373933_0285329 | 3300035724 | Bacteria | 1067 |
| 492 | Ga0373947_0040983 | 3300035725 | Bacteria | 2760 |
| 493 | Ga0373937_0047940 | 3300036401 | Bacteria | 3909 |
| 494 | Ga0310112_010758 | 3300036458 | Bacteria | 1307 |
| 495 | Ga0373925_0034633 | 3300037068 | Bacteria | 3722 |
| 496 | Ga0373925_0317917 | 3300037068 | Bacteria | 1259 |
| 497 | Ga0373925_0352501 | 3300037068 | Bacteria | 1195 |
| 498 | Ga0395899_0000026 | 3300037312 | Bacteria | 345291 |
| 499 | Ga0395899_0000713 | 3300037312 | Bacteria | 33291 |
| 500 | Ga0395899_0098311 | 3300037312 | Bacteria | 2114 |
| 501 | Ga0395899_0510502 | 3300037312 | Bacteria | 778 |
| 502 | Ga0395900_0025660 | 3300037418 | Bacteria | 6032 |
| 503 | Ga0395900_0200106 | 3300037418 | Bacteria | 2022 |
| 504 | Ga0395898_0058714 | 3300037466 | Bacteria | 3745 |
| 505 | Ga0395898_0204761 | 3300037466 | Bacteria | 1883 |
| 506 | Ga0395898_0289869 | 3300037466 | Bacteria | 1561 |
| 507 | Ga0395898_0443901 | 3300037466 | Bacteria | 1236 |
| 508 | Ga0395905_0012102 | 3300037471 | Bacteria | 8312 |
| 509 | Ga0395905_0034469 | 3300037471 | Bacteria | 4753 |
| 510 | Ga0395905_0050916 | 3300037471 | Bacteria | 3879 |
| 511 | Ga0395905_0061355 | 3300037471 | Bacteria | 3517 |
| 512 | Ga0395905_0070375 | 3300037471 | Bacteria | 3278 |
| 513 | Ga0395905_0078733 | 3300037471 | Bacteria | 3089 |
| 514 | Ga0395905_0410047 | 3300037471 | Bacteria | 1250 |
| 515 | Ga0395905_0876355 | 3300037471 | Bacteria | 801 |
| 516 | Ga0395901_0029430 | 3300038443 | Bacteria | 5656 |
| 517 | Ga0395901_0029978 | 3300038443 | Bacteria | 5604 |
| 518 | Ga0395901_0104792 | 3300038443 | Bacteria | 2968 |
| 519 | Ga0395901_0192446 | 3300038443 | Bacteria | 2139 |
| 520 | Ga0395901_0395262 | 3300038443 | Bacteria | 1421 |
| 521 | Ga0395901_0418805 | 3300038443 | Bacteria | 1374 |
| 522 | Ga0395901_0688279 | 3300038443 | Bacteria | 1021 |
| 523 | Ga0395901_0794163 | 3300038443 | Bacteria | 936 |
| 524 | Ga0436365_0140106 | 3300039437 | Bacteria | 2084 |
| 525 | Ga0436365_0449154 | 3300039437 | Bacteria | 1607 |
| 526 | Ga0436365_0503144 | 3300039437 | Bacteria | 3811 |
| 527 | Ga0436365_0916510 | 3300039437 | Bacteria | 28669 |
| 528 | Ga0436365_1541345 | 3300039437 | Bacteria | 20116 |
| 529 | Ga0436365_1602753 | 3300039437 | Bacteria | 4159 |
| 530 | Ga0436360_0479997 | 3300039438 | Bacteria | 1343 |
| 531 | Ga0436360_0795172 | 3300039438 | Bacteria | 791 |
| 532 | Ga0436361_0108203 | 3300039447 | Bacteria | 1212 |
| 533 | Ga0436361_0186477 | 3300039447 | Bacteria | 1340 |
| 534 | Ga0436361_0238923 | 3300039447 | Bacteria | 2966 |
| 535 | Ga0436361_0261403 | 3300039447 | Bacteria | 1358 |
| 536 | Ga0436361_0546846 | 3300039447 | Bacteria | 2777 |
| 537 | Ga0436361_0681592 | 3300039447 | Bacteria | 2168 |
| 538 | Ga0436361_0843361 | 3300039447 | Bacteria | 817 |
| 539 | Ga0436363_0168726 | 3300039450 | Bacteria | 4122 |
| 540 | Ga0436363_0599359 | 3300039450 | Bacteria | 7683 |
| 541 | Ga0436363_0885771 | 3300039450 | Bacteria | 980 |
| 542 | Ga0439436_0018407 | 3300041404 | Bacteria | 2088 |
| 543 | Ga0439461_0035617 | 3300041410 | Bacteria | 1056 |
| 544 | Ga0439465_0006377 | 3300041413 | Bacteria | 3746 |
| 545 | Ga0439431_0000187 | 3300041997 | Bacteria | 12043 |
| 546 | Ga0439431_0010651 | 3300041997 | Bacteria | 2088 |
| 547 | Ga0439442_002393 | 3300042002 | Bacteria | 3683 |
| 548 | Ga0439445_0000562 | 3300042004 | Bacteria | 7575 |
| 549 | Ga0439445_0069288 | 3300042004 | Bacteria | 974 |
| 550 | Ga0439448_0002340 | 3300042005 | Bacteria | 5139 |
| 551 | Ga0439448_0024185 | 3300042005 | Bacteria | 1898 |
| 552 | Ga0439432_003177 | 3300042006 | Bacteria | 6113 |
| 553 | Ga0439449_0053381 | 3300042007 | Bacteria | 1494 |
| 554 | Ga0439452_021467 | 3300042010 | Bacteria | 1682 |
| 555 | Ga0439455_0007335 | 3300042012 | Bacteria | 2329 |
| 556 | Ga0439455_0008361 | 3300042012 | Bacteria | 2216 |
| 557 | Ga0439455_0059366 | 3300042012 | Bacteria | 1012 |
| 558 | Ga0439455_0071768 | 3300042012 | Bacteria | 931 |
| 559 | Ga0439455_0102985 | 3300042012 | Bacteria | 790 |
| 560 | Ga0439457_001532 | 3300042014 | Bacteria | 6934 |
| 561 | Ga0450919_010306 | 3300042121 | Bacteria | 1070 |
| 562 | Ga0450923_017278 | 3300042125 | Bacteria | 1368 |
| 563 | Ga0450898_035919 | 3300042134 | Bacteria | 924 |
| 564 | Ga0450910_010396 | 3300042147 | Bacteria | 1325 |
| 565 | Ga0439446_0002031 | 3300042156 | Bacteria | 4791 |
| 566 | Ga0439458_0000986 | 3300042157 | Bacteria | 7274 |
| 567 | Ga0439458_0001013 | 3300042157 | Bacteria | 7188 |
| 568 | Ga0439458_0001992 | 3300042157 | Bacteria | 5069 |
| 569 | Ga0439434_0002604 | 3300042435 | Bacteria | 5251 |
| 570 | Ga0439435_0012758 | 3300042436 | Bacteria | 2044 |
| 571 | Ga0466972_0010990 | 3300044658 | Bacteria | 4545 |
| 572 | Ga0466965_0031586 | 3300044683 | Bacteria | 2583 |
| 573 | Ga0466966_0034352 | 3300044684 | Bacteria | 3279 |
| 574 | Ga0466966_0058072 | 3300044684 | Unclassified | 2446 |
| 575 | Ga0466966_0058718 | 3300044684 | Bacteria | 2431 |
| 576 | Ga0466966_0138559 | 3300044684 | Bacteria | 1487 |
| 577 | Ga0466961_0011581 | 3300044693 | Bacteria | 5637 |
| 578 | Ga0466963_0037193 | 3300044694 | Plasmid | 3177 |
| 579 | Ga0466963_0049597 | 3300044694 | Bacteria | 2777 |
| 580 | Ga0466963_0101375 | 3300044694 | Bacteria | 1971 |
| 581 | Ga0466964_0013581 | 3300044706 | Bacteria | 3089 |
| 582 | Ga0466964_0085777 | 3300044706 | Bacteria | 1360 |
| 583 | Ga0466971_0024553 | 3300044719 | Bacteria | 2690 |
| 584 | Ga0466971_0062460 | 3300044719 | Bacteria | 1685 |
| 585 | Ga0466968_0025710 | 3300044735 | Bacteria | 2413 |
| 586 | Ga0466968_0029848 | 3300044735 | Bacteria | 2257 |
| 587 | Ga0466970_0004968 | 3300044765 | Bacteria | 6570 |
| 588 | Ga0466970_0099144 | 3300044765 | Bacteria | 1586 |
| 589 | Ga0466957_0008884 | 3300044842 | Bacteria | 5725 |
| 590 | Ga0466957_0195426 | 3300044842 | Bacteria | 1327 |
| 591 | Ga0466957_0206052 | 3300044842 | Bacteria | 1293 |
| 592 | Ga0466960_0329898 | 3300044901 | Bacteria | 866 |
| 593 | Ga0466960_0374149 | 3300044901 | Bacteria | 816 |
| 594 | Ga0466959_0005917 | 3300045049 | Bacteria | 8424 |
| 595 | Ga0466959_0042510 | 3300045049 | Bacteria | 3352 |
| 596 | Ga0466959_0075547 | 3300045049 | Bacteria | 2434 |
| 597 | Ga0466959_0099323 | 3300045049 | Bacteria | 2084 |
| 598 | Ga0466959_0296235 | 3300045049 | Bacteria | 1108 |
| 599 | Ga0466959_0428104 | 3300045049 | Bacteria | 898 |
| 600 | Ga0466958_0000048 | 3300045836 | Bacteria | 35635 |
| 601 | Ga0466958_0021853 | 3300045836 | Bacteria | 3742 |
| 602 | Ga0466958_0057198 | 3300045836 | Bacteria | 2370 |
| 603 | Ga0466958_0093525 | 3300045836 | Unclassified | 1862 |
| 604 | Ga0466958_0359931 | 3300045836 | Bacteria | 937 |
| 605 | Ga0466967_0223964 | 3300045976 | Bacteria | 1788 |
| 606 | Ga0466967_0291750 | 3300045976 | Bacteria | 1567 |
| 607 | Ga0495627_000209 | 3300046453 | Bacteria | 63424 |
| 608 | Ga0495590_0002168 | 3300046457 | Bacteria | 8231 |
| 609 | Ga0495629_0418204 | 3300046459 | Bacteria | 910 |
| 610 | Ga0495638_0000326 | 3300046460 | Bacteria | 60360 |
| 611 | Ga0495638_0000434 | 3300046460 | Bacteria | 50529 |
| 612 | Ga0495638_0005521 | 3300046460 | Bacteria | 9392 |
| 613 | Ga0495638_0039729 | 3300046460 | Bacteria | 2985 |
| 614 | Ga0495638_0048119 | 3300046460 | Bacteria | 2670 |
| 615 | Ga0495638_0130212 | 3300046460 | Bacteria | 1478 |
| 616 | Ga0495638_0291070 | 3300046460 | Bacteria | 883 |
| 617 | Ga0495638_0293732 | 3300046460 | Bacteria | 878 |
| 618 | Ga0495641_0159147 | 3300046461 | Bacteria | 1010 |
| 619 | Ga0495651_0009405 | 3300046462 | Bacteria | 7507 |
| 620 | Ga0495651_0022220 | 3300046462 | Bacteria | 4932 |
| 621 | Ga0495650_0000069 | 3300046471 | Bacteria | 261124 |
| 622 | Ga0495650_0031088 | 3300046471 | Bacteria | 2408 |
| 623 | Ga0495650_0116783 | 3300046471 | Bacteria | 985 |
| 624 | Ga0495580_0348313 | 3300046472 | Bacteria | 1004 |
| 625 | Ga0495664_0277789 | 3300046477 | Bacteria | 1012 |
| 626 | Ga0495585_0207160 | 3300046492 | Bacteria | 996 |
| 627 | Ga0495594_0017602 | 3300046499 | Bacteria | 3778 |
| 628 | Ga0495594_0134716 | 3300046499 | Bacteria | 1400 |
| 629 | Ga0495607_0204649 | 3300046501 | Bacteria | 974 |
| 630 | Ga0495583_0000001 | 3300046506 | Bacteria | 811973 |
| 631 | Ga0495583_0094892 | 3300046506 | Bacteria | 1280 |
| 632 | Ga0495606_0016300 | 3300046507 | Bacteria | 5673 |
| 633 | Ga0495606_0349636 | 3300046507 | Bacteria | 785 |
| 634 | Ga0495610_0002007 | 3300046512 | Bacteria | 17407 |
| 635 | Ga0495610_0004447 | 3300046512 | Bacteria | 10361 |
| 636 | Ga0495610_0005291 | 3300046512 | Bacteria | 9230 |
| 637 | Ga0495610_0017507 | 3300046512 | Bacteria | 4083 |
| 638 | Ga0495616_0000115 | 3300046513 | Bacteria | 70371 |
| 639 | Ga0495631_0001223 | 3300046518 | Bacteria | 15856 |
| 640 | Ga0495631_0138305 | 3300046518 | Bacteria | 1046 |
| 641 | Ga0495631_0164379 | 3300046518 | Bacteria | 952 |
| 642 | Ga0495632_0012120 | 3300046519 | Bacteria | 4986 |
| 643 | Ga0495643_0212575 | 3300046522 | Bacteria | 922 |
| 644 | Ga0495643_0227646 | 3300046522 | Bacteria | 881 |
| 645 | Ga0495648_0000165 | 3300046524 | Bacteria | 78462 |
| 646 | Ga0495648_0053168 | 3300046524 | Bacteria | 2455 |
| 647 | Ga0495648_0112343 | 3300046524 | Bacteria | 1480 |
| 648 | Ga0495663_0025072 | 3300046525 | Bacteria | 1737 |
| 649 | Ga0495654_0000024 | 3300046530 | Bacteria | 238195 |
| 650 | Ga0495654_0012651 | 3300046530 | Bacteria | 4529 |
| 651 | Ga0495645_0177873 | 3300046543 | Bacteria | 1460 |
| 652 | Ga0495622_0005431 | 3300046557 | Bacteria | 5915 |
| 653 | Ga0495668_0000456 | 3300046616 | Bacteria | 52300 |
| 654 | Ga0495668_0015595 | 3300046616 | Bacteria | 4432 |
| 655 | Ga0495668_0018797 | 3300046616 | Bacteria | 3993 |
| 656 | Ga0495668_0023744 | 3300046616 | Bacteria | 3493 |
| 657 | Ga0495668_0035943 | 3300046616 | Bacteria | 2777 |
| 658 | Ga0495668_0074400 | 3300046616 | Bacteria | 1865 |
| 659 | Ga0495668_0081140 | 3300046616 | Bacteria | 1780 |
| 660 | Ga0495634_0326474 | 3300046642 | Bacteria | 923 |
| 661 | Ga0495611_0182921 | 3300046648 | Bacteria | 979 |
| 662 | Ga0495625_0000230 | 3300046660 | Bacteria | 88194 |
| 663 | Ga0495625_0004316 | 3300046660 | Bacteria | 13502 |
| 664 | Ga0495625_0006914 | 3300046660 | Bacteria | 10011 |
| 665 | Ga0495625_0018507 | 3300046660 | Bacteria | 5436 |
| 666 | Ga0495625_0039826 | 3300046660 | Bacteria | 3429 |
| 667 | Ga0495625_0073657 | 3300046660 | Bacteria | 2393 |
| 668 | Ga0495659_0131102 | 3300046664 | Bacteria | 994 |
| 669 | Ga0495661_0012280 | 3300046665 | Bacteria | 5785 |
| 670 | Ga0495588_0203650 | 3300046674 | Bacteria | 1045 |
| 671 | Ga0495657_0046244 | 3300046675 | Bacteria | 2949 |
| 672 | Ga0495599_0169263 | 3300046678 | Bacteria | 1348 |
| 673 | Ga0495623_0012870 | 3300046679 | Bacteria | 5419 |
| 674 | Ga0495613_0056042 | 3300046689 | Bacteria | 2895 |
| 675 | Ga0495613_0144755 | 3300046689 | Bacteria | 1697 |
| 676 | Ga0495670_0000029 | 3300046691 | Bacteria | 87662 |
| 677 | Ga0495670_0012601 | 3300046691 | Bacteria | 4158 |
| 678 | Ga0495671_0061171 | 3300046692 | Bacteria | 1858 |
| 679 | Ga0495660_0132991 | 3300046810 | Bacteria | 1246 |
| 680 | Ga0495581_0193504 | 3300047315 | Bacteria | 1190 |
| 681 | Ga0495604_0105632 | 3300047317 | Bacteria | 2061 |
| 682 | Ga0495604_0358796 | 3300047317 | Bacteria | 967 |
| 683 | Ga0495672_0019609 | 3300047320 | Bacteria | 4457 |
| 684 | Ga0495672_0145424 | 3300047320 | Bacteria | 1234 |
| 685 | Ga0495677_0008628 | 3300047445 | Bacteria | 3784 |
| 686 | Ga0495673_0000108 | 3300047469 | Bacteria | 168459 |
| 687 | Ga0495673_0000344 | 3300047469 | Bacteria | 58803 |
| 688 | Ga0495673_0003633 | 3300047469 | Bacteria | 10088 |
| 689 | Ga0495686_0004056 | 3300047472 | Bacteria | 12228 |
| 690 | Ga0495686_0011950 | 3300047472 | Bacteria | 6101 |
| 691 | Ga0495686_0013762 | 3300047472 | Bacteria | 5605 |
| 692 | Ga0495686_0036693 | 3300047472 | Bacteria | 3145 |
| 693 | Ga0495686_0074651 | 3300047472 | Bacteria | 2080 |
| 694 | Ga0495686_0132889 | 3300047472 | Bacteria | 1474 |
| 695 | Ga0495686_0156744 | 3300047472 | Bacteria | 1333 |
| 696 | Ga0495602_0194229 | 3300048088 | Bacteria | 1554 |
| 697 | Ga0495626_0061575 | 3300048091 | Bacteria | 1706 |
| 698 | Ga0496100_0306526 | 3300048903 | Bacteria | 1190 |
| 699 | Ga0496100_0327012 | 3300048903 | Bacteria | 1153 |
| 700 | Ga0496103_0174513 | 3300048906 | Bacteria | 1381 |
| 701 | Ga0496104_0001606 | 3300048907 | Bacteria | 19467 |
| 702 | Ga0496104_0001863 | 3300048907 | Bacteria | 18258 |
| 703 | Ga0496105_0008691 | 3300048908 | Bacteria | 7902 |
| 704 | Ga0496105_0443611 | 3300048908 | Bacteria | 1025 |
| 705 | Ga0496106_0001358 | 3300048909 | Bacteria | 18318 |
| 706 | Ga0496106_0044228 | 3300048909 | Bacteria | 3342 |
| 707 | Ga0496106_0052530 | 3300048909 | Bacteria | 3075 |
| 708 | Ga0496106_0736254 | 3300048909 | Bacteria | 784 |
| 709 | Ga0496107_0006558 | 3300048910 | Bacteria | 8007 |
| 710 | Ga0496107_0403907 | 3300048910 | Bacteria | 1016 |
| 711 | Ga0496108_0204804 | 3300048911 | Bacteria | 1712 |
| 712 | Ga0496108_0205223 | 3300048911 | Bacteria | 1710 |
| 713 | Ga0496110_0113009 | 3300048913 | Bacteria | 2442 |
| 714 | Ga0496110_0216548 | 3300048913 | Bacteria | 1741 |
| 715 | Ga0496111_0294153 | 3300048914 | Bacteria | 1204 |
| 716 | Ga0496111_0412806 | 3300048914 | Bacteria | 997 |
| 717 | Ga0496112_0908806 | 3300048915 | Bacteria | 802 |
| 718 | Ga0496113_0213646 | 3300048916 | Bacteria | 1536 |
| 719 | Ga0496114_0281214 | 3300048917 | Bacteria | 1467 |
| 720 | Ga0496114_0656583 | 3300048917 | Bacteria | 922 |
| 721 | Ga0496115_0000921 | 3300048918 | Bacteria | 21326 |
| 722 | Ga0496115_0001486 | 3300048918 | Bacteria | 16854 |
| 723 | Ga0496115_0004981 | 3300048918 | Bacteria | 9641 |
| 724 | Ga0496115_0020165 | 3300048918 | Bacteria | 5139 |
| 725 | Ga0496115_0101425 | 3300048918 | Bacteria | 2360 |
| 726 | Ga0496116_0000965 | 3300048919 | Bacteria | 35491 |
| 727 | Ga0496116_0143291 | 3300048919 | Bacteria | 1340 |
| 728 | Ga0496117_0013409 | 3300048920 | Bacteria | 7153 |
| 729 | Ga0496117_0034522 | 3300048920 | Bacteria | 3809 |
| 730 | Ga0496117_0105182 | 3300048920 | Bacteria | 1774 |
| 731 | Ga0496117_0106166 | 3300048920 | Bacteria | 1763 |
| 732 | Ga0496117_0144340 | 3300048920 | Bacteria | 1420 |
| 733 | Ga0496117_0148732 | 3300048920 | Bacteria | 1390 |
| 734 | Ga0496118_0003027 | 3300048921 | Bacteria | 21693 |
| 735 | Ga0496118_0010242 | 3300048921 | Bacteria | 9306 |
| 736 | Ga0496118_0020353 | 3300048921 | Bacteria | 5885 |
| 737 | Ga0496118_0028559 | 3300048921 | Bacteria | 4695 |
| 738 | Ga0496118_0039154 | 3300048921 | Bacteria | 3787 |
| 739 | Ga0496118_0070052 | 3300048921 | Bacteria | 2535 |
| 740 | Ga0496118_0084187 | 3300048921 | Bacteria | 2220 |
| 741 | Ga0496118_0120085 | 3300048921 | Bacteria | 1716 |
| 742 | Ga0496119_0024118 | 3300048922 | Bacteria | 4289 |
| 743 | Ga0496119_0035437 | 3300048922 | Bacteria | 3270 |
| 744 | Ga0496119_0051808 | 3300048922 | Bacteria | 2519 |
| 745 | Ga0496119_0064646 | 3300048922 | Bacteria | 2171 |
| 746 | Ga0496119_0119652 | 3300048922 | Bacteria | 1450 |
| 747 | Ga0496121_0001622 | 3300048924 | Bacteria | 37285 |
| 748 | Ga0496121_0007823 | 3300048924 | Bacteria | 12793 |
| 749 | Ga0496121_0023791 | 3300048924 | Bacteria | 5882 |
| 750 | Ga0496121_0028197 | 3300048924 | Bacteria | 5232 |
| 751 | Ga0496121_0036329 | 3300048924 | Bacteria | 4392 |
| 752 | Ga0496121_0126551 | 3300048924 | Bacteria | 1919 |
| 753 | Ga0496121_0161432 | 3300048924 | Bacteria | 1638 |
| 754 | Ga0496121_0208762 | 3300048924 | Bacteria | 1385 |
| 755 | Ga0496121_0244912 | 3300048924 | Bacteria | 1247 |
| 756 | Ga0496121_0289800 | 3300048924 | Bacteria | 1116 |
| 757 | Ga0496121_0366225 | 3300048924 | Bacteria | 955 |
| 758 | Ga0496122_0024545 | 3300048925 | Bacteria | 5272 |
| 759 | Ga0496122_0036640 | 3300048925 | Bacteria | 3962 |
| 760 | Ga0496122_0209236 | 3300048925 | Bacteria | 1132 |
| 761 | Ga0496123_0022020 | 3300048926 | Bacteria | 4930 |
| 762 | Ga0496123_0065829 | 3300048926 | Bacteria | 2299 |
| 763 | Ga0496124_0002957 | 3300048927 | Bacteria | 21339 |
| 764 | Ga0496124_0049091 | 3300048927 | Bacteria | 3602 |
| 765 | Ga0496124_0095992 | 3300048927 | Bacteria | 2409 |
| 766 | Ga0496124_0218398 | 3300048927 | Bacteria | 1436 |
| 767 | Ga0496124_0231950 | 3300048927 | Bacteria | 1379 |
| 768 | Ga0496124_0266812 | 3300048927 | Bacteria | 1256 |
| 769 | Ga0496124_0469553 | 3300048927 | Bacteria | 853 |
| 770 | Ga0496124_0526149 | 3300048927 | Bacteria | 786 |
| 771 | Ga0496125_0001630 | 3300048928 | Bacteria | 31638 |
| 772 | Ga0496125_0056184 | 3300048928 | Bacteria | 3199 |
| 773 | Ga0496125_0083260 | 3300048928 | Bacteria | 2434 |
| 774 | Ga0496125_0089991 | 3300048928 | Bacteria | 2306 |
| 775 | Ga0496125_0095264 | 3300048928 | Bacteria | 2215 |
| 776 | Ga0496125_0099406 | 3300048928 | Bacteria | 2149 |
| 777 | Ga0496125_0137524 | 3300048928 | Bacteria | 1706 |
| 778 | Ga0496125_0242362 | 3300048928 | Bacteria | 1144 |
| 779 | Ga0496125_0281648 | 3300048928 | Bacteria | 1029 |
| 780 | Ga0496125_0295403 | 3300048928 | Bacteria | 995 |
| 781 | Ga0496126_0003803 | 3300048929 | Bacteria | 18741 |
| 782 | Ga0496126_0028894 | 3300048929 | Bacteria | 5275 |
| 783 | Ga0496126_0033555 | 3300048929 | Bacteria | 4827 |
| 784 | Ga0496126_0070139 | 3300048929 | Bacteria | 3123 |
| 785 | Ga0496126_0081503 | 3300048929 | Bacteria | 2860 |
| 786 | Ga0496126_0104438 | 3300048929 | Bacteria | 2475 |
| 787 | Ga0496126_0312538 | 3300048929 | Bacteria | 1293 |
| 788 | Ga0496126_0373969 | 3300048929 | Bacteria | 1161 |
| 789 | Ga0496126_0486006 | 3300048929 | Bacteria | 989 |
| 790 | Ga0495678_003911 | 3300049459 | Bacteria | 8931 |
| 791 | Ga0495682_0081120 | 3300049460 | Bacteria | 1167 |
| 792 | Ga0495682_0131024 | 3300049460 | Bacteria | 897 |
| 793 | Ga0501031_0003114 | 3300049568 | Bacteria | 10626 |
| 794 | Ga0501031_0026710 | 3300049568 | Bacteria | 3763 |
| 795 | Ga0501032_0000762 | 3300049569 | Bacteria | 26183 |
| 796 | Ga0501032_0056815 | 3300049569 | Bacteria | 2630 |
| 797 | Ga0501032_0071436 | 3300049569 | Bacteria | 2313 |
| 798 | Ga0501033_0000136 | 3300049570 | Bacteria | 70952 |
| 799 | Ga0501033_0026715 | 3300049570 | Bacteria | 4342 |
| 800 | Ga0501033_0057089 | 3300049570 | Bacteria | 2886 |
| 801 | Ga0501033_0098622 | 3300049570 | Bacteria | 2133 |
| 802 | Ga0501033_0267830 | 3300049570 | Bacteria | 1208 |
| 803 | Ga0501033_0336784 | 3300049570 | Bacteria | 1058 |
| 804 | Ga0501034_0000251 | 3300049571 | Bacteria | 99406 |
| 805 | Ga0501034_0008471 | 3300049571 | Bacteria | 10862 |
| 806 | Ga0501034_0025849 | 3300049571 | Bacteria | 5980 |
| 807 | Ga0501034_0099688 | 3300049571 | Bacteria | 2900 |
| 808 | Ga0501034_0134299 | 3300049571 | Bacteria | 2456 |
| 809 | Ga0501034_0146924 | 3300049571 | Bacteria | 2335 |
| 810 | Ga0501036_0000036 | 3300049572 | Bacteria | 87244 |
| 811 | Ga0501036_0095905 | 3300049572 | Bacteria | 2507 |
| 812 | Ga0501036_0139078 | 3300049572 | Bacteria | 2049 |
| 813 | Ga0501037_0000867 | 3300049573 | Bacteria | 22596 |
| 814 | Ga0501037_0186696 | 3300049573 | Bacteria | 1469 |
| 815 | Ga0501037_0190511 | 3300049573 | Bacteria | 1452 |
| 816 | Ga0501038_0000428 | 3300049574 | Bacteria | 36623 |
| 817 | Ga0501038_0036231 | 3300049574 | Bacteria | 4330 |
| 818 | Ga0501038_0203480 | 3300049574 | Bacteria | 1588 |
| 819 | Ga0501038_0223971 | 3300049574 | Bacteria | 1499 |
| 820 | Ga0501038_0247921 | 3300049574 | Bacteria | 1412 |
| 821 | Ga0501039_0000273 | 3300049575 | Bacteria | 37431 |
| 822 | Ga0501039_0032382 | 3300049575 | Bacteria | 4030 |
| 823 | Ga0501042_0170613 | 3300049578 | Bacteria | 1570 |
| 824 | Ga0501043_0000165 | 3300049579 | Bacteria | 59980 |
| 825 | Ga0501043_0027908 | 3300049579 | Bacteria | 4431 |
| 826 | Ga0501043_0198896 | 3300049579 | Bacteria | 1556 |
| 827 | Ga0501043_0205795 | 3300049579 | Bacteria | 1526 |
| 828 | Ga0501043_0223047 | 3300049579 | Bacteria | 1457 |
| 829 | Ga0501043_0289433 | 3300049579 | Bacteria | 1254 |
| 830 | Ga0501043_0624811 | 3300049579 | Bacteria | 793 |
| 831 | Ga0501046_0000839 | 3300049580 | Bacteria | 29959 |
| 832 | Ga0501046_0516206 | 3300049580 | Bacteria | 854 |
| 833 | Ga0501047_0000340 | 3300049581 | Bacteria | 53278 |
| 834 | Ga0501047_0001905 | 3300049581 | Bacteria | 20058 |
| 835 | Ga0501047_0003425 | 3300049581 | Bacteria | 14995 |
| 836 | Ga0501047_0041364 | 3300049581 | Bacteria | 4454 |
| 837 | Ga0501047_0458913 | 3300049581 | Bacteria | 1103 |
| 838 | Ga0501048_0001309 | 3300049582 | Bacteria | 18872 |
| 839 | Ga0501048_0046616 | 3300049582 | Bacteria | 3094 |
| 840 | Ga0501067_0000457 | 3300049583 | Bacteria | 22383 |
| 841 | Ga0501067_0087210 | 3300049583 | Bacteria | 1732 |
| 842 | Ga0501067_0135039 | 3300049583 | Bacteria | 1373 |
| 843 | Ga0501068_0000839 | 3300049584 | Bacteria | 15999 |
| 844 | Ga0501068_0032662 | 3300049584 | Bacteria | 3095 |
| 845 | Ga0501069_0032150 | 3300049585 | Bacteria | 2888 |
| 846 | Ga0501069_0066434 | 3300049585 | Bacteria | 2017 |
| 847 | Ga0501070_0000971 | 3300049586 | Bacteria | 25732 |
| 848 | Ga0501070_0073648 | 3300049586 | Bacteria | 2826 |
| 849 | Ga0501070_0577973 | 3300049586 | Bacteria | 897 |
| 850 | Ga0501071_0079057 | 3300049587 | Bacteria | 2404 |
| 851 | Ga0501072_0003301 | 3300049588 | Bacteria | 12139 |
| 852 | Ga0501073_0000037 | 3300049589 | Bacteria | 87345 |
| 853 | Ga0501073_0065517 | 3300049589 | Bacteria | 2533 |
| 854 | Ga0501074_0000167 | 3300049590 | Bacteria | 35108 |
| 855 | Ga0501074_0259375 | 3300049590 | Bacteria | 1236 |
| 856 | Ga0501076_0191321 | 3300049592 | Bacteria | 1670 |
| 857 | Ga0501079_0002302 | 3300049741 | Bacteria | 13814 |
| 858 | Ga0501080_0006603 | 3300049742 | Bacteria | 10426 |
| 859 | Ga0501080_0055199 | 3300049742 | Bacteria | 3700 |
| 860 | Ga0501080_0080214 | 3300049742 | Bacteria | 3033 |
| 861 | Ga0501080_0084313 | 3300049742 | Bacteria | 2952 |
| 862 | Ga0501083_0001812 | 3300049744 | Bacteria | 14636 |
| 863 | Ga0501083_0016896 | 3300049744 | Bacteria | 5097 |
| 864 | Ga0501083_0042452 | 3300049744 | Bacteria | 3083 |
| 865 | Ga0501241_006927 | 3300049758 | Bacteria | 2082 |
| 866 | Ga0501035_0000142 | 3300049822 | Bacteria | 87561 |
| 867 | Ga0501035_0006052 | 3300049822 | Bacteria | 11395 |
| 868 | Ga0501035_0088777 | 3300049822 | Bacteria | 2723 |
| 869 | Ga0501035_0185286 | 3300049822 | Bacteria | 1792 |
| 870 | Ga0501035_0319208 | 3300049822 | Bacteria | 1305 |
| 871 | Ga0501044_0000414 | 3300049823 | Bacteria | 52784 |
| 872 | Ga0501044_0008740 | 3300049823 | Bacteria | 11085 |
| 873 | Ga0501044_0013526 | 3300049823 | Bacteria | 8821 |
| 874 | Ga0501044_0021563 | 3300049823 | Bacteria | 6869 |
| 875 | Ga0501044_0022908 | 3300049823 | Bacteria | 6650 |
| 876 | Ga0501044_0076769 | 3300049823 | Bacteria | 3389 |
| 877 | Ga0501044_0083517 | 3300049823 | Bacteria | 3230 |
| 878 | Ga0501044_0100473 | 3300049823 | Bacteria | 2911 |
| 879 | Ga0501044_0286077 | 3300049823 | Bacteria | 1581 |
| 880 | Ga0501044_0394898 | 3300049823 | Bacteria | 1296 |
| 881 | Ga0501045_0002539 | 3300049824 | Bacteria | 12434 |
| 882 | nmdc:mga03n38_180079_c1 | 3300050490 | Bacteria | 1082 |
| 883 | nmdc:mga03n38_3129_c1 | 3300050490 | Bacteria | 5263 |
| 884 | nmdc:mga00v17_26492_c1 | 3300050491 | Bacteria | 3380 |
| 885 | nmdc:mga00v17_28827_c1 | 3300050491 | Bacteria | 3254 |
| 886 | nmdc:mga00v17_51403_c1 | 3300050491 | Bacteria | 2506 |
| 887 | nmdc:mga00v17_59417_c1 | 3300050491 | Bacteria | 2346 |
| 888 | nmdc:mga00v17_69035_c1 | 3300050491 | Bacteria | 2186 |
| 889 | nmdc:mga0yw44_179253_c1 | 3300050492 | Bacteria | 1394 |
| 890 | nmdc:mga0yw44_23081_c1 | 3300050492 | Bacteria | 3501 |
| 891 | nmdc:mga0yw44_341776_c1 | 3300050492 | Bacteria | 1007 |
| 892 | nmdc:mga0yw44_4551_c1 | 3300050492 | Bacteria | 6383 |
| 893 | nmdc:mga0yw44_50500_c1 | 3300050492 | Bacteria | 2515 |
| 894 | nmdc:mga0yw44_7729_c1 | 3300050492 | Bacteria | 5309 |
| 895 | nmdc:mga0yw44_84115_c1 | 3300050492 | Bacteria | 2000 |
| 896 | nmdc:mga0k408_14464_c1 | 3300050493 | Bacteria | 4350 |
| 897 | nmdc:mga0k408_199183_c1 | 3300050493 | Bacteria | 1195 |
| 898 | nmdc:mga06z11_138892_c1 | 3300050494 | Bacteria | 1372 |
| 899 | nmdc:mga06z11_4688_c1 | 3300050494 | Bacteria | 5399 |
| 900 | nmdc:mga04h51_98496_c1 | 3300050495 | Bacteria | 1062 |
| 901 | nmdc:mga07m45_32567_c1 | 3300050496 | Bacteria | 2890 |
| 902 | nmdc:mga05p37_650235_c1 | 3300050507 | Bacteria | 1181 |
| 903 | nmdc:mga0rr50_234301_c1 | 3300050513 | Bacteria | 1520 |
| 904 | nmdc:mga08x19_86194_c1 | 3300050514 | Bacteria | 2067 |
| 905 | nmdc:mga0sz30_2586_c1 | 3300050516 | Bacteria | 6435 |
| 906 | nmdc:mga0sz30_4919_c1 | 3300050516 | Bacteria | 4868 |
| 907 | nmdc:mga0sz30_51614_c1 | 3300050516 | Bacteria | 1745 |
| 908 | nmdc:mga0sz30_75666_c1 | 3300050516 | Bacteria | 1453 |
| 909 | Ga0495595_0087546 | 3300053084 | Bacteria | 1491 |
| 910 | Ga0500578_0000056 | 3300053086 | Bacteria | 120189 |
| 911 | Ga0500578_0113492 | 3300053086 | Bacteria | 1707 |
| 912 | Ga0500578_0190611 | 3300053086 | Bacteria | 1259 |
| 913 | Ga0500578_0193464 | 3300053086 | Bacteria | 1248 |
| 914 | Ga0500578_0230005 | 3300053086 | Bacteria | 1124 |
| 915 | Ga0500643_000048 | 3300053087 | Bacteria | 147879 |
| 916 | Ga0500643_000548 | 3300053087 | Bacteria | 26252 |
| 917 | Ga0500643_005672 | 3300053087 | Bacteria | 5335 |
| 918 | Ga0500643_010845 | 3300053087 | Bacteria | 3365 |
| 919 | Ga0500643_012763 | 3300053087 | Bacteria | 2996 |
| 920 | Ga0500643_070398 | 3300053087 | Bacteria | 971 |
| 921 | Ga0500644_0000089 | 3300053088 | Bacteria | 56897 |
| 922 | Ga0500644_0028932 | 3300053088 | Bacteria | 1737 |
| 923 | Ga0500644_0044232 | 3300053088 | Bacteria | 1494 |
| 924 | Ga0500647_0093291 | 3300053091 | Bacteria | 1440 |
| 925 | Ga0500647_0178970 | 3300053091 | Bacteria | 974 |
| 926 | Ga0500583_0010766 | 3300053092 | Bacteria | 3412 |
| 927 | Ga0500583_0060762 | 3300053092 | Bacteria | 1783 |
| 928 | Ga0500651_0002004 | 3300053093 | Bacteria | 10570 |
| 929 | Ga0500651_0002704 | 3300053093 | Bacteria | 9450 |
| 930 | Ga0500651_0014869 | 3300053093 | Bacteria | 4768 |
| 931 | Ga0500651_0215834 | 3300053093 | Bacteria | 1127 |
| 932 | Ga0500566_0002605 | 3300053094 | Bacteria | 10733 |
| 933 | Ga0500566_0003780 | 3300053094 | Bacteria | 9033 |
| 934 | Ga0500566_0006460 | 3300053094 | Bacteria | 6955 |
| 935 | Ga0500566_0075920 | 3300053094 | Bacteria | 1879 |
| 936 | Ga0500641_0018004 | 3300053096 | Bacteria | 2652 |
| 937 | Ga0500641_0023374 | 3300053096 | Bacteria | 2377 |
| 938 | Ga0500641_0025472 | 3300053096 | Bacteria | 2289 |
| 939 | Ga0500641_0032761 | 3300053096 | Bacteria | 2058 |
| 940 | Ga0500641_0054141 | 3300053096 | Bacteria | 1658 |
| 941 | Ga0500650_0025917 | 3300053098 | Bacteria | 2625 |
| 942 | Ga0500554_041214 | 3300053102 | Bacteria | 1418 |
| 943 | Ga0500555_027405 | 3300053103 | Bacteria | 1625 |
| 944 | Ga0500556_0000003 | 3300053104 | Bacteria | 679379 |
| 945 | Ga0500556_0001687 | 3300053104 | Bacteria | 8514 |
| 946 | Ga0500562_000489 | 3300053108 | Bacteria | 9608 |
| 947 | Ga0500562_006991 | 3300053108 | Bacteria | 2846 |
| 948 | Ga0500562_016473 | 3300053108 | Bacteria | 1901 |
| 949 | Ga0500562_027131 | 3300053108 | Bacteria | 1502 |
| 950 | Ga0500594_0000724 | 3300053118 | Bacteria | 7016 |
| 951 | Ga0500594_0086696 | 3300053118 | Bacteria | 944 |
| 952 | Ga0500595_000333 | 3300053119 | Bacteria | 30925 |
| 953 | Ga0500595_000497 | 3300053119 | Bacteria | 23997 |
| 954 | Ga0500595_000553 | 3300053119 | Bacteria | 22382 |
| 955 | Ga0500595_002282 | 3300053119 | Bacteria | 9644 |
| 956 | Ga0500608_000207 | 3300053122 | Bacteria | 23415 |
| 957 | Ga0500608_063928 | 3300053122 | Bacteria | 1756 |
| 958 | Ga0500608_141759 | 3300053122 | Bacteria | 1064 |
| 959 | Ga0500614_015345 | 3300053123 | Bacteria | 1707 |
| 960 | Ga0500614_040520 | 3300053123 | Bacteria | 1182 |
| 961 | Ga0500618_000034 | 3300053125 | Bacteria | 120560 |
| 962 | Ga0500618_006607 | 3300053125 | Bacteria | 3387 |
| 963 | Ga0500628_081385 | 3300053129 | Bacteria | 830 |
| 964 | Ga0500642_0000015 | 3300053130 | Bacteria | 181424 |
| 965 | Ga0500642_0001744 | 3300053130 | Bacteria | 6273 |
| 966 | Ga0500642_0015152 | 3300053130 | Bacteria | 2890 |
| 967 | Ga0500642_0133221 | 3300053130 | Bacteria | 1165 |
| 968 | Ga0500642_0197676 | 3300053130 | Bacteria | 936 |
| 969 | Ga0500652_010728 | 3300053131 | Bacteria | 3151 |
| 970 | Ga0500652_011638 | 3300053131 | Bacteria | 3057 |
| 971 | Ga0500652_083744 | 3300053131 | Bacteria | 1329 |
| 972 | Ga0500655_000460 | 3300053133 | Bacteria | 8332 |
| 973 | Ga0500658_0000793 | 3300053134 | Bacteria | 13099 |
| 974 | Ga0500658_0001085 | 3300053134 | Bacteria | 11126 |
| 975 | Ga0500658_0010451 | 3300053134 | Bacteria | 3424 |
| 976 | Ga0500658_0031805 | 3300053134 | Bacteria | 2066 |
| 977 | Ga0500658_0055776 | 3300053134 | Bacteria | 1628 |
| 978 | Ga0500658_0165245 | 3300053134 | Bacteria | 1003 |
| 979 | Ga0500559_0000112 | 3300053136 | Bacteria | 63817 |
| 980 | Ga0500559_0001714 | 3300053136 | Bacteria | 12043 |
| 981 | Ga0500559_0033232 | 3300053136 | Bacteria | 2220 |
| 982 | Ga0500559_0081897 | 3300053136 | Bacteria | 1468 |
| 983 | Ga0500559_0089806 | 3300053136 | Bacteria | 1405 |
| 984 | Ga0500559_0147656 | 3300053136 | Bacteria | 1103 |
| 985 | Ga0500564_000057 | 3300053138 | Bacteria | 29651 |
| 986 | Ga0500564_150650 | 3300053138 | Bacteria | 992 |
| 987 | Ga0500568_0000536 | 3300053139 | Bacteria | 27978 |
| 988 | Ga0500568_0005756 | 3300053139 | Bacteria | 6345 |
| 989 | Ga0500568_0016371 | 3300053139 | Bacteria | 3298 |
| 990 | Ga0500568_0049176 | 3300053139 | Bacteria | 1665 |
| 991 | Ga0500568_0077254 | 3300053139 | Bacteria | 1267 |
| 992 | Ga0500568_0084110 | 3300053139 | Bacteria | 1205 |
| 993 | Ga0500568_0084443 | 3300053139 | Bacteria | 1202 |
| 994 | Ga0500568_0092354 | 3300053139 | Bacteria | 1141 |
| 995 | Ga0500573_0067724 | 3300053140 | Bacteria | 2040 |
| 996 | Ga0500586_000330 | 3300053145 | Bacteria | 9419 |
| 997 | Ga0500588_0059114 | 3300053146 | Bacteria | 1222 |
| 998 | Ga0500590_000163 | 3300053148 | Bacteria | 19391 |
| 999 | Ga0500590_007211 | 3300053148 | Bacteria | 5474 |
| 1000 | Ga0500590_031070 | 3300053148 | Bacteria | 2769 |
| 1001 | Ga0500590_046959 | 3300053148 | Bacteria | 2206 |
| 1002 | Ga0500603_014424 | 3300053150 | Bacteria | 1846 |
| 1003 | Ga0500603_087833 | 3300053150 | Bacteria | 909 |
| 1004 | Ga0500604_0053896 | 3300053151 | Bacteria | 1247 |
| 1005 | Ga0500616_0000033 | 3300053153 | Bacteria | 398830 |
| 1006 | Ga0500616_0001587 | 3300053153 | Bacteria | 21239 |
| 1007 | Ga0500616_0030013 | 3300053153 | Bacteria | 2988 |
| 1008 | Ga0500616_0118939 | 3300053153 | Bacteria | 1265 |
| 1009 | Ga0500622_0001006 | 3300053156 | Bacteria | 23789 |
| 1010 | Ga0500622_0001762 | 3300053156 | Bacteria | 16622 |
| 1011 | Ga0500622_0006755 | 3300053156 | Bacteria | 6605 |
| 1012 | Ga0500622_0017921 | 3300053156 | Bacteria | 3767 |
| 1013 | Ga0500622_0023088 | 3300053156 | Bacteria | 3296 |
| 1014 | Ga0500622_0026896 | 3300053156 | Bacteria | 3033 |
| 1015 | Ga0500622_0141881 | 3300053156 | Bacteria | 1145 |
| 1016 | Ga0500627_0043782 | 3300053158 | Bacteria | 1931 |
| 1017 | Ga0500627_0081653 | 3300053158 | Bacteria | 1441 |
| 1018 | Ga0500638_016198 | 3300053162 | Bacteria | 3434 |
| 1019 | Ga0500639_060191 | 3300053163 | Bacteria | 1958 |
| 1020 | Ga0500636_0015308 | 3300053177 | Bacteria | 4519 |
| 1021 | Ga0500636_0040450 | 3300053177 | Bacteria | 2757 |
| 1022 | Ga0500637_0000060 | 3300053178 | Bacteria | 38881 |
| 1023 | Ga0500570_004099 | 3300053724 | Bacteria | 7619 |
| 1024 | Ga0500570_077593 | 3300053724 | Bacteria | 1515 |
| 1025 | Ga0500611_021920 | 3300053727 | Bacteria | 1225 |
| 1026 | Ga0500611_027584 | 3300053727 | Bacteria | 1145 |
| 1027 | Ga0500645_000883 | 3300053730 | Bacteria | 17431 |
| 1028 | Ga0500645_029154 | 3300053730 | Bacteria | 1667 |
| 1029 | Ga0500645_064013 | 3300053730 | Bacteria | 1061 |
| 1030 | Ga0500609_000027 | 3300053731 | Bacteria | 21239 |
| 1031 | Ga0500609_002135 | 3300053731 | Bacteria | 2832 |
| 1032 | Ga0500596_001647 | 3300053735 | Bacteria | 4511 |
| 1033 | Ga0500599_002351 | 3300053736 | Bacteria | 2264 |
| 1034 | Ga0501084_0005116 | 3300054114 | Bacteria | 10737 |
| 1035 | Ga0501084_0254685 | 3300054114 | Bacteria | 1482 |
| 1036 | Ga0500661_001013 | 3300055283 | Bacteria | 5278 |
| 1037 | Ga0501082_0004333 | 3300060353 | Bacteria | 12407 |
| 1038 | Ga0501082_0098486 | 3300060353 | Bacteria | 2528 |
| 1039 | Ga0466962_0001247 | 3300061719 | Bacteria | 11734 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300038443 | Ga0395901_0418805 | Ga0395901_0418805_768_1361 | 186 |
| 2 | 3300049570 | Ga0501033_0336784 | Ga0501033_0336784_454_1041 | 186 |
| 3 | 3300005618 | Ga0068864_100007001 | Ga0068864_1000070014 | 207 |
| 4 | 3300005842 | Ga0068858_100000771 | Ga0068858_10000077129 | 207 |
| 5 | 3300009177 | Ga0105248_10047211 | Ga0105248_100472115 | 207 |
| 6 | 3300009553 | Ga0105249_10157228 | Ga0105249_101572282 | 207 |
| 7 | 3300013306 | Ga0163162_10004509 | Ga0163162_100045099 | 207 |
| 8 | 3300025941 | Ga0207711_10176891 | Ga0207711_101768912 | 207 |
| 9 | 3300025961 | Ga0207712_10088953 | Ga0207712_100889532 | 207 |
| 10 | 3300026035 | Ga0207703_10001689 | Ga0207703_1000168911 | 207 |
| 11 | 3300026095 | Ga0207676_10001553 | Ga0207676_100015539 | 207 |
| 12 | 3300053139 | Ga0500568_0077254 | Ga0500568_0077254_31_702 | 210 |
| 13 | 3300005337 | Ga0070682_100202918 | Ga0070682_1002029182 | 213 |
| 14 | 3300005434 | Ga0070709_10045772 | Ga0070709_100457724 | 213 |
| 15 | 3300005458 | Ga0070681_10006411 | Ga0070681_100064114 | 213 |
| 16 | 3300005530 | Ga0070679_100117260 | Ga0070679_1001172602 | 213 |
| 17 | 3300006237 | Ga0097621_100061585 | Ga0097621_1000615854 | 213 |
| 18 | 3300009093 | Ga0105240_10033307 | Ga0105240_100333075 | 213 |
| 19 | 3300013307 | Ga0157372_10067956 | Ga0157372_100679565 | 213 |
| 20 | 3300025906 | Ga0207699_10019120 | Ga0207699_100191204 | 213 |
| 21 | 3300025912 | Ga0207707_10000143 | Ga0207707_1000014336 | 213 |
| 22 | 3300025917 | Ga0207660_10274141 | Ga0207660_102741413 | 213 |
| 23 | 3300048924 | Ga0496121_0289800 | Ga0496121_0289800_398_1096 | 213 |
| 24 | 3300005434 | Ga0070709_10003406 | Ga0070709_100034066 | 215 |
| 25 | 3300005436 | Ga0070713_100010463 | Ga0070713_1000104633 | 215 |
| 26 | 3300005439 | Ga0070711_100002277 | Ga0070711_10000227710 | 215 |
| 27 | 3300005439 | Ga0070711_100452971 | Ga0070711_1004529712 | 215 |
| 28 | 3300005458 | Ga0070681_10049606 | Ga0070681_100496066 | 215 |
| 29 | 3300005577 | Ga0068857_100163281 | Ga0068857_1001632814 | 215 |
| 30 | 3300025906 | Ga0207699_10062902 | Ga0207699_100629023 | 215 |
| 31 | 3300025928 | Ga0207700_10034094 | Ga0207700_100340943 | 215 |
| 32 | 3300026116 | Ga0207674_10484544 | Ga0207674_104845442 | 215 |
| 33 | 3300026142 | Ga0207698_10264407 | Ga0207698_102644073 | 215 |
| 34 | 3300044694 | Ga0466963_0049597 | Ga0466963_0049597_345_1043 | 215 |
| 35 | 3300045976 | Ga0466967_0223964 | Ga0466967_0223964_139_837 | 215 |
| 36 | 3300048929 | Ga0496126_0104438 | Ga0496126_0104438_336_1034 | 215 |
| 37 | 3300009177 | Ga0105248_10347630 | Ga0105248_103476302 | 220 |
| 38 | 3300037471 | Ga0395905_0876355 | Ga0395905_0876355_17_715 | 220 |
| 39 | 3300042012 | Ga0439455_0102985 | Ga0439455_0102985_51_731 | 220 |
| 40 | 3300049569 | Ga0501032_0071436 | Ga0501032_0071436_83_760 | 221 |
| 41 | 3300049570 | Ga0501033_0098622 | Ga0501033_0098622_213_890 | 221 |
| 42 | 3300049571 | Ga0501034_0025849 | Ga0501034_0025849_5091_5768 | 221 |
| 43 | 3300049572 | Ga0501036_0095905 | Ga0501036_0095905_551_1228 | 221 |
| 44 | 3300049574 | Ga0501038_0036231 | Ga0501038_0036231_1154_1831 | 221 |
| 45 | 3300049575 | Ga0501039_0032382 | Ga0501039_0032382_2387_3064 | 221 |
| 46 | 3300049579 | Ga0501043_0223047 | Ga0501043_0223047_758_1435 | 221 |
| 47 | 3300049582 | Ga0501048_0046616 | Ga0501048_0046616_1489_2166 | 221 |
| 48 | 3300049822 | Ga0501035_0006052 | Ga0501035_0006052_3031_3708 | 221 |
| 49 | 3300049823 | Ga0501044_0013526 | Ga0501044_0013526_5784_6461 | 221 |
| 50 | iso_pu_bacteria | 2508501128 | 2509151565 | 221 |
| 51 | iso_pu_bacteria | 2513237141 | 2513891646 | 221 |
| 52 | iso_pu_bacteria | 2517093001 | 2517105700 | 221 |
| 53 | iso_pu_bacteria | 2524023205 | 2524435444 | 221 |
| 54 | iso_pu_bacteria | 2602042107 | 2603860096 | 221 |
| 55 | iso_pu_bacteria | 2744054633 | 2745081392 | 221 |
| 56 | iso_pu_bacteria | 2824704595 | 2824706075 | 221 |
| 57 | iso_pu_bacteria | 2824753945 | 2824760292 | 221 |
| 58 | iso_pu_bacteria | 2824763712 | 2824771531 | 221 |
| 59 | iso_pu_bacteria | 2824773399 | 2824775749 | 221 |
| 60 | iso_pu_bacteria | 2841957949 | 2841965297 | 221 |
| 61 | iso_pu_bacteria | 2842038055 | 2842044359 | 221 |
| 62 | iso_pu_bacteria | 2842045827 | 2842051652 | 221 |
| 63 | iso_pu_bacteria | 2857524615 | 2857525079 | 221 |
| 64 | iso_pu_bacteria | 2874620515 | 2874622434 | 221 |
| 65 | iso_pu_bacteria | 2876761206 | 2876761700 | 221 |
| 66 | iso_pu_bacteria | 2893066018 | 2893069665 | 221 |
| 67 | iso_pu_bacteria | 2904666416 | 2904671559 | 221 |
| 68 | iso_pu_bacteria | 2904711408 | 2904718102 | 221 |
| 69 | iso_pu_bacteria | 2919073203 | 2919078967 | 221 |
| 70 | iso_pu_bacteria | 8006926726 | 8006928840 | 221 |
| 71 | iso_pu_bacteria | 8016522445 | 8016526936 | 221 |
| 72 | iso_pu_bacteria | 8016530956 | 8016532020 | 221 |
| 73 | iso_pu_bacteria | 8016548790 | 8016556858 | 221 |
| 74 | iso_pu_bacteria | 8016557553 | 8016565211 | 221 |
| 75 | iso_pu_bacteria | 8016575299 | 8016582856 | 221 |
| 76 | iso_pu_bacteria | 8016595262 | 8016602854 | 221 |
| 77 | iso_pu_bacteria | 8019530166 | 8019531837 | 221 |
| 78 | 3300005335 | Ga0070666_10186306 | Ga0070666_101863061 | 222 |
| 79 | 3300005841 | Ga0068863_100025840 | Ga0068863_1000258403 | 222 |
| 80 | 3300009093 | Ga0105240_10002463 | Ga0105240_1000246315 | 222 |
| 81 | 3300025903 | Ga0207680_10208528 | Ga0207680_102085282 | 222 |
| 82 | 3300025913 | Ga0207695_10004557 | Ga0207695_1000455714 | 222 |
| 83 | 3300026088 | Ga0207641_10028640 | Ga0207641_100286407 | 222 |
| 84 | 3300037312 | Ga0395899_0000026 | Ga0395899_0000026_35378_36100 | 222 |
| 85 | 3300053148 | Ga0500590_000163 | Ga0500590_000163_15709_16425 | 222 |
| 86 | iso_pu_bacteria | 2582581305 | 2585259718 | 222 |
| 87 | iso_pu_bacteria | 2643221614 | 2644087375 | 222 |
| 88 | iso_pu_bacteria | 2643221661 | 2644344581 | 222 |
| 89 | iso_pu_bacteria | 2643221666 | 2644366735 | 222 |
| 90 | 3300039437 | Ga0436365_0140106 | Ga0436365_0140106_24_725 | 223 |
| 91 | iso_pu_bacteria | 2791355048 | 2792458916 | 223 |
| 92 | iso_pu_bacteria | 2843744320 | 2843749072 | 223 |
| 93 | iso_pu_bacteria | 2849560528 | 2849564398 | 223 |
| 94 | iso_pu_bacteria | 2849573788 | 2849575270 | 223 |
| 95 | iso_pu_bacteria | 2851153111 | 2851155526 | 223 |
| 96 | iso_pu_bacteria | 2898329390 | 2898330873 | 223 |
| 97 | 3300003203 | JGI25406J46586_10000513 | JGI25406J46586_100005132 | 224 |
| 98 | 3300005548 | Ga0070665_100001299 | Ga0070665_1000012996 | 224 |
| 99 | 3300005841 | Ga0068863_100359835 | Ga0068863_1003598352 | 224 |
| 100 | 3300005985 | Ga0081539_10000801 | Ga0081539_1000080132 | 224 |
| 101 | 3300009093 | Ga0105240_10086052 | Ga0105240_100860526 | 224 |
| 102 | 3300009551 | Ga0105238_10225558 | Ga0105238_102255581 | 224 |
| 103 | 3300014325 | Ga0163163_10018900 | Ga0163163_100189006 | 224 |
| 104 | 3300014325 | Ga0163163_10557376 | Ga0163163_105573761 | 224 |
| 105 | 3300025913 | Ga0207695_10029272 | Ga0207695_100292722 | 224 |
| 106 | 3300025924 | Ga0207694_10067102 | Ga0207694_100671022 | 224 |
| 107 | 3300026088 | Ga0207641_10518373 | Ga0207641_105183731 | 224 |
| 108 | 3300026095 | Ga0207676_10369365 | Ga0207676_103693652 | 224 |
| 109 | 3300028379 | Ga0268266_10000003 | Ga0268266_100000031048 | 224 |
| 110 | 3300048918 | Ga0496115_0000921 | Ga0496115_0000921_14826_15593 | 224 |
| 111 | iso_pu_bacteria | 2510917020 | 2511124191 | 224 |
| 112 | iso_pu_bacteria | 2582581280 | 2585150853 | 224 |
| 113 | iso_pu_bacteria | 2582581293 | 2585195825 | 224 |
| 114 | iso_pu_bacteria | 2643221583 | 2643923880 | 224 |
| 115 | iso_pu_bacteria | 2818991435 | 2819538598 | 224 |
| 116 | iso_pu_bacteria | 2818991454 | 2819646868 | 224 |
| 117 | 3300002067 | JGI24735J21928_10031649 | JGI24735J21928_100316493 | 225 |
| 118 | 3300003215 | JGI25153J46596_10000301 | JGI25153J46596_100003014 | 225 |
| 119 | 3300003354 | JGI25160J50197_1002871 | JGI25160J50197_10028713 | 225 |
| 120 | 3300003771 | Ga0055526_1046549 | Ga0055526_10465491 | 225 |
| 121 | 3300003775 | Ga0055524_1051165 | Ga0055524_10511651 | 225 |
| 122 | 3300005262 | Ga0065165_1001167 | Ga0065165_100116718 | 225 |
| 123 | 3300005262 | Ga0065165_1032813 | Ga0065165_10328132 | 225 |
| 124 | 3300005336 | Ga0070680_100017794 | Ga0070680_1000177946 | 225 |
| 125 | 3300005337 | Ga0070682_100208451 | Ga0070682_1002084512 | 225 |
| 126 | 3300005338 | Ga0068868_100667725 | Ga0068868_1006677251 | 225 |
| 127 | 3300005339 | Ga0070660_100003692 | Ga0070660_10000369211 | 225 |
| 128 | 3300005344 | Ga0070661_100097802 | Ga0070661_1000978022 | 225 |
| 129 | 3300005344 | Ga0070661_100188955 | Ga0070661_1001889551 | 225 |
| 130 | 3300005366 | Ga0070659_100077774 | Ga0070659_1000777741 | 225 |
| 131 | 3300005434 | Ga0070709_10020120 | Ga0070709_100201202 | 225 |
| 132 | 3300005435 | Ga0070714_100226508 | Ga0070714_1002265082 | 225 |
| 133 | 3300005436 | Ga0070713_100071899 | Ga0070713_1000718993 | 225 |
| 134 | 3300005436 | Ga0070713_100287196 | Ga0070713_1002871961 | 225 |
| 135 | 3300005437 | Ga0070710_10025371 | Ga0070710_100253712 | 225 |
| 136 | 3300005439 | Ga0070711_100001130 | Ga0070711_10000113012 | 225 |
| 137 | 3300005455 | Ga0070663_100572479 | Ga0070663_1005724791 | 225 |
| 138 | 3300005458 | Ga0070681_10087304 | Ga0070681_100873044 | 225 |
| 139 | 3300005467 | Ga0070706_100052063 | Ga0070706_1000520634 | 225 |
| 140 | 3300005468 | Ga0070707_100092451 | Ga0070707_1000924514 | 225 |
| 141 | 3300005535 | Ga0070684_100001671 | Ga0070684_10000167117 | 225 |
| 142 | 3300005536 | Ga0070697_100118434 | Ga0070697_1001184342 | 225 |
| 143 | 3300005539 | Ga0068853_100009612 | Ga0068853_1000096127 | 225 |
| 144 | 3300005577 | Ga0068857_100013087 | Ga0068857_1000130877 | 225 |
| 145 | 3300005614 | Ga0068856_100000137 | Ga0068856_10000013716 | 225 |
| 146 | 3300005614 | Ga0068856_100345247 | Ga0068856_1003452473 | 225 |
| 147 | 3300005616 | Ga0068852_100088449 | Ga0068852_1000884494 | 225 |
| 148 | 3300005834 | Ga0068851_10024349 | Ga0068851_100243493 | 225 |
| 149 | 3300005842 | Ga0068858_100242087 | Ga0068858_1002420873 | 225 |
| 150 | 3300005843 | Ga0068860_100000313 | Ga0068860_10000031349 | 225 |
| 151 | 3300005844 | Ga0068862_100015872 | Ga0068862_1000158722 | 225 |
| 152 | 3300005937 | Ga0081455_10017304 | Ga0081455_100173043 | 225 |
| 153 | 3300005983 | Ga0081540_1024929 | Ga0081540_10249295 | 225 |
| 154 | 3300005983 | Ga0081540_1028527 | Ga0081540_10285274 | 225 |
| 155 | 3300005983 | Ga0081540_1059623 | Ga0081540_10596233 | 225 |
| 156 | 3300005983 | Ga0081540_1072041 | Ga0081540_10720411 | 225 |
| 157 | 3300005983 | Ga0081540_1142003 | Ga0081540_11420031 | 225 |
| 158 | 3300006038 | Ga0075365_10055263 | Ga0075365_100552633 | 225 |
| 159 | 3300006038 | Ga0075365_10238357 | Ga0075365_102383572 | 225 |
| 160 | 3300006051 | Ga0075364_10012640 | Ga0075364_100126406 | 225 |
| 161 | 3300006051 | Ga0075364_10520688 | Ga0075364_105206881 | 225 |
| 162 | 3300006175 | Ga0070712_100009825 | Ga0070712_1000098255 | 225 |
| 163 | 3300006178 | Ga0075367_10039353 | Ga0075367_100393533 | 225 |
| 164 | 3300006186 | Ga0075369_10009026 | Ga0075369_100090266 | 225 |
| 165 | 3300006186 | Ga0075369_10120009 | Ga0075369_101200092 | 225 |
| 166 | 3300006195 | Ga0075366_10161131 | Ga0075366_101611312 | 225 |
| 167 | 3300006237 | Ga0097621_100144761 | Ga0097621_1001447614 | 225 |
| 168 | 3300006353 | Ga0075370_10169650 | Ga0075370_101696501 | 225 |
| 169 | 3300006871 | Ga0075434_100023401 | Ga0075434_1000234018 | 225 |
| 170 | 3300007076 | Ga0075435_100411755 | Ga0075435_1004117552 | 225 |
| 171 | 3300007265 | Ga0099794_10061546 | Ga0099794_100615461 | 225 |
| 172 | 3300007788 | Ga0099795_10001129 | Ga0099795_100011297 | 225 |
| 173 | 3300007788 | Ga0099795_10005962 | Ga0099795_100059624 | 225 |
| 174 | 3300007788 | Ga0099795_10067502 | Ga0099795_100675022 | 225 |
| 175 | 3300009093 | Ga0105240_10071475 | Ga0105240_100714754 | 225 |
| 176 | 3300009098 | Ga0105245_11027269 | Ga0105245_110272691 | 225 |
| 177 | 3300009101 | Ga0105247_10043425 | Ga0105247_100434253 | 225 |
| 178 | 3300009177 | Ga0105248_10042051 | Ga0105248_100420515 | 225 |
| 179 | 3300009545 | Ga0105237_10053748 | Ga0105237_100537485 | 225 |
| 180 | 3300009545 | Ga0105237_10054084 | Ga0105237_100540844 | 225 |
| 181 | 3300009551 | Ga0105238_10006268 | Ga0105238_100062685 | 225 |
| 182 | 3300009551 | Ga0105238_10022426 | Ga0105238_100224265 | 225 |
| 183 | 3300010375 | Ga0105239_10017503 | Ga0105239_100175037 | 225 |
| 184 | 3300010375 | Ga0105239_10216274 | Ga0105239_102162743 | 225 |
| 185 | 3300013105 | Ga0157369_10018692 | Ga0157369_100186926 | 225 |
| 186 | 3300013105 | Ga0157369_10053822 | Ga0157369_100538223 | 225 |
| 187 | 3300014968 | Ga0157379_10033261 | Ga0157379_100332615 | 225 |
| 188 | 3300014968 | Ga0157379_10199431 | Ga0157379_101994311 | 225 |
| 189 | 3300025253 | Ga0209677_102422 | Ga0209677_1024226 | 225 |
| 190 | 3300025261 | Ga0209233_1002344 | Ga0209233_10023447 | 225 |
| 191 | 3300025272 | Ga0209455_1002785 | Ga0209455_10027854 | 225 |
| 192 | 3300025272 | Ga0209455_1013949 | Ga0209455_10139492 | 225 |
| 193 | 3300025272 | Ga0209455_1016958 | Ga0209455_10169582 | 225 |
| 194 | 3300025273 | Ga0209673_1016536 | Ga0209673_10165364 | 225 |
| 195 | 3300025295 | Ga0209564_1000718 | Ga0209564_100071825 | 225 |
| 196 | 3300025295 | Ga0209564_1003160 | Ga0209564_10031603 | 225 |
| 197 | 3300025295 | Ga0209564_1006871 | Ga0209564_10068717 | 225 |
| 198 | 3300025297 | Ga0209758_1000015 | Ga0209758_1000015792 | 225 |
| 199 | 3300025297 | Ga0209758_1004632 | Ga0209758_100463212 | 225 |
| 200 | 3300025297 | Ga0209758_1006280 | Ga0209758_10062808 | 225 |
| 201 | 3300025297 | Ga0209758_1022902 | Ga0209758_10229024 | 225 |
| 202 | 3300025299 | Ga0209256_1002592 | Ga0209256_100259212 | 225 |
| 203 | 3300025302 | Ga0207426_1000217 | Ga0207426_10002174 | 225 |
| 204 | 3300025302 | Ga0207426_1000368 | Ga0207426_10003689 | 225 |
| 205 | 3300025302 | Ga0207426_1016643 | Ga0207426_10166434 | 225 |
| 206 | 3300025304 | Ga0209257_1002989 | Ga0209257_100298915 | 225 |
| 207 | 3300025898 | Ga0207692_10092668 | Ga0207692_100926682 | 225 |
| 208 | 3300025906 | Ga0207699_10032628 | Ga0207699_100326283 | 225 |
| 209 | 3300025910 | Ga0207684_10047574 | Ga0207684_100475744 | 225 |
| 210 | 3300025912 | Ga0207707_10014431 | Ga0207707_100144314 | 225 |
| 211 | 3300025914 | Ga0207671_10029351 | Ga0207671_100293514 | 225 |
| 212 | 3300025914 | Ga0207671_10178948 | Ga0207671_101789483 | 225 |
| 213 | 3300025915 | Ga0207693_10054355 | Ga0207693_100543554 | 225 |
| 214 | 3300025916 | Ga0207663_10052117 | Ga0207663_100521174 | 225 |
| 215 | 3300025917 | Ga0207660_10007904 | Ga0207660_100079047 | 225 |
| 216 | 3300025919 | Ga0207657_10005482 | Ga0207657_1000548212 | 225 |
| 217 | 3300025921 | Ga0207652_10024703 | Ga0207652_100247035 | 225 |
| 218 | 3300025922 | Ga0207646_10065090 | Ga0207646_100650903 | 225 |
| 219 | 3300025924 | Ga0207694_10029840 | Ga0207694_100298406 | 225 |
| 220 | 3300025924 | Ga0207694_10050027 | Ga0207694_100500274 | 225 |
| 221 | 3300025926 | Ga0207659_10510357 | Ga0207659_105103572 | 225 |
| 222 | 3300025928 | Ga0207700_10110658 | Ga0207700_101106582 | 225 |
| 223 | 3300025928 | Ga0207700_10227682 | Ga0207700_102276822 | 225 |
| 224 | 3300025932 | Ga0207690_10401104 | Ga0207690_104011042 | 225 |
| 225 | 3300025945 | Ga0207679_10256115 | Ga0207679_102561152 | 225 |
| 226 | 3300025949 | Ga0207667_10020014 | Ga0207667_100200147 | 225 |
| 227 | 3300026035 | Ga0207703_10224453 | Ga0207703_102244532 | 225 |
| 228 | 3300026067 | Ga0207678_10049937 | Ga0207678_100499372 | 225 |
| 229 | 3300026078 | Ga0207702_10000063 | Ga0207702_1000006313 | 225 |
| 230 | 3300026078 | Ga0207702_10423659 | Ga0207702_104236592 | 225 |
| 231 | 3300026088 | Ga0207641_10389758 | Ga0207641_103897582 | 225 |
| 232 | 3300026095 | Ga0207676_10159444 | Ga0207676_101594442 | 225 |
| 233 | 3300026116 | Ga0207674_10018135 | Ga0207674_100181356 | 225 |
| 234 | 3300026142 | Ga0207698_10033871 | Ga0207698_100338711 | 225 |
| 235 | 3300028379 | Ga0268266_10126859 | Ga0268266_101268593 | 225 |
| 236 | 3300028379 | Ga0268266_10154418 | Ga0268266_101544182 | 225 |
| 237 | 3300028380 | Ga0268265_10036215 | Ga0268265_100362155 | 225 |
| 238 | 3300028380 | Ga0268265_10453740 | Ga0268265_104537402 | 225 |
| 239 | 3300028381 | Ga0268264_10000356 | Ga0268264_1000035620 | 225 |
| 240 | 3300030521 | Ga0307511_10034380 | Ga0307511_100343802 | 225 |
| 241 | 3300031235 | Ga0265330_10010731 | Ga0265330_100107314 | 225 |
| 242 | 3300031235 | Ga0265330_10063434 | Ga0265330_100634342 | 225 |
| 243 | 3300031238 | Ga0265332_10151694 | Ga0265332_101516941 | 225 |
| 244 | 3300031247 | Ga0265340_10016299 | Ga0265340_100162994 | 225 |
| 245 | 3300031247 | Ga0265340_10186514 | Ga0265340_101865142 | 225 |
| 246 | 3300031250 | Ga0265331_10032239 | Ga0265331_100322394 | 225 |
| 247 | 3300031344 | Ga0265316_10045394 | Ga0265316_100453944 | 225 |
| 248 | 3300031456 | Ga0307513_10306911 | Ga0307513_103069112 | 225 |
| 249 | 3300031507 | Ga0307509_10192327 | Ga0307509_101923273 | 225 |
| 250 | 3300031548 | Ga0307408_100064798 | Ga0307408_1000647983 | 225 |
| 251 | 3300031711 | Ga0265314_10071962 | Ga0265314_100719624 | 225 |
| 252 | 3300031711 | Ga0265314_10073784 | Ga0265314_100737844 | 225 |
| 253 | 3300031712 | Ga0265342_10003269 | Ga0265342_100032692 | 225 |
| 254 | 3300031712 | Ga0265342_10028180 | Ga0265342_100281802 | 225 |
| 255 | 3300031712 | Ga0265342_10089269 | Ga0265342_100892693 | 225 |
| 256 | 3300031712 | Ga0265342_10122932 | Ga0265342_101229323 | 225 |
| 257 | 3300031730 | Ga0307516_10005305 | Ga0307516_100053055 | 225 |
| 258 | 3300031731 | Ga0307405_10414785 | Ga0307405_104147851 | 225 |
| 259 | 3300031911 | Ga0307412_10355937 | Ga0307412_103559371 | 225 |
| 260 | 3300031911 | Ga0307412_10421289 | Ga0307412_104212892 | 225 |
| 261 | 3300033180 | Ga0307510_10103437 | Ga0307510_101034373 | 225 |
| 262 | 3300033180 | Ga0307510_10167278 | Ga0307510_101672782 | 225 |
| 263 | 3300035086 | Ga0373934_0135557 | Ga0373934_0135557_65_763 | 225 |
| 264 | 3300035089 | Ga0373944_0080706 | Ga0373944_0080706_22_720 | 225 |
| 265 | 3300035111 | Ga0373923_0182533 | Ga0373923_0182533_143_841 | 225 |
| 266 | 3300035113 | Ga0373936_0086972 | Ga0373936_0086972_159_857 | 225 |
| 267 | 3300035113 | Ga0373936_0187711 | Ga0373936_0187711_153_851 | 225 |
| 268 | 3300035172 | Ga0373955_0449417 | Ga0373955_0449417_58_756 | 225 |
| 269 | 3300035692 | Ga0373935_0005959 | Ga0373935_0005959_5268_5966 | 225 |
| 270 | 3300035695 | Ga0373927_0002991 | Ga0373927_0002991_8989_9687 | 225 |
| 271 | 3300035695 | Ga0373927_0014399 | Ga0373927_0014399_2727_3425 | 225 |
| 272 | 3300035695 | Ga0373927_0049450 | Ga0373927_0049450_333_1031 | 225 |
| 273 | 3300035724 | Ga0373933_0285329 | Ga0373933_0285329_179_877 | 225 |
| 274 | 3300035725 | Ga0373947_0040983 | Ga0373947_0040983_476_1174 | 225 |
| 275 | 3300036401 | Ga0373937_0047940 | Ga0373937_0047940_1930_2628 | 225 |
| 276 | 3300036458 | Ga0310112_010758 | Ga0310112_010758_69_767 | 225 |
| 277 | 3300037068 | Ga0373925_0034633 | Ga0373925_0034633_2946_3644 | 225 |
| 278 | 3300037068 | Ga0373925_0317917 | Ga0373925_0317917_191_889 | 225 |
| 279 | 3300037068 | Ga0373925_0352501 | Ga0373925_0352501_439_1137 | 225 |
| 280 | 3300037312 | Ga0395899_0098311 | Ga0395899_0098311_1128_1862 | 225 |
| 281 | 3300037312 | Ga0395899_0510502 | Ga0395899_0510502_25_723 | 225 |
| 282 | 3300037418 | Ga0395900_0025660 | Ga0395900_0025660_4392_5120 | 225 |
| 283 | 3300037418 | Ga0395900_0200106 | Ga0395900_0200106_809_1507 | 225 |
| 284 | 3300037466 | Ga0395898_0058714 | Ga0395898_0058714_478_1176 | 225 |
| 285 | 3300037466 | Ga0395898_0289869 | Ga0395898_0289869_688_1416 | 225 |
| 286 | 3300037471 | Ga0395905_0012102 | Ga0395905_0012102_3223_3966 | 225 |
| 287 | 3300037471 | Ga0395905_0061355 | Ga0395905_0061355_2202_2930 | 225 |
| 288 | 3300038443 | Ga0395901_0029430 | Ga0395901_0029430_3401_4099 | 225 |
| 289 | 3300038443 | Ga0395901_0104792 | Ga0395901_0104792_1021_1749 | 225 |
| 290 | 3300038443 | Ga0395901_0395262 | Ga0395901_0395262_356_1054 | 225 |
| 291 | 3300038443 | Ga0395901_0688279 | Ga0395901_0688279_30_764 | 225 |
| 292 | 3300038443 | Ga0395901_0794163 | Ga0395901_0794163_157_855 | 225 |
| 293 | 3300039437 | Ga0436365_0503144 | Ga0436365_0503144_1633_2331 | 225 |
| 294 | 3300039437 | Ga0436365_1602753 | Ga0436365_1602753_227_925 | 225 |
| 295 | 3300039438 | Ga0436360_0479997 | Ga0436360_0479997_382_1080 | 225 |
| 296 | 3300039438 | Ga0436360_0795172 | Ga0436360_0795172_46_744 | 225 |
| 297 | 3300039447 | Ga0436361_0238923 | Ga0436361_0238923_1627_2325 | 225 |
| 298 | 3300039447 | Ga0436361_0261403 | Ga0436361_0261403_413_1090 | 225 |
| 299 | 3300039447 | Ga0436361_0681592 | Ga0436361_0681592_1070_1768 | 225 |
| 300 | 3300039447 | Ga0436361_0843361 | Ga0436361_0843361_77_775 | 225 |
| 301 | 3300039450 | Ga0436363_0599359 | Ga0436363_0599359_4826_5524 | 225 |
| 302 | 3300039450 | Ga0436363_0885771 | Ga0436363_0885771_204_902 | 225 |
| 303 | 3300044684 | Ga0466966_0034352 | Ga0466966_0034352_1584_2282 | 225 |
| 304 | 3300044706 | Ga0466964_0085777 | Ga0466964_0085777_394_1092 | 225 |
| 305 | 3300044719 | Ga0466971_0062460 | Ga0466971_0062460_564_1253 | 225 |
| 306 | 3300044735 | Ga0466968_0025710 | Ga0466968_0025710_958_1656 | 225 |
| 307 | 3300044842 | Ga0466957_0195426 | Ga0466957_0195426_348_1046 | 225 |
| 308 | 3300044842 | Ga0466957_0206052 | Ga0466957_0206052_343_1032 | 225 |
| 309 | 3300044901 | Ga0466960_0329898 | Ga0466960_0329898_67_765 | 225 |
| 310 | 3300045049 | Ga0466959_0075547 | Ga0466959_0075547_1031_1729 | 225 |
| 311 | 3300045049 | Ga0466959_0428104 | Ga0466959_0428104_172_861 | 225 |
| 312 | 3300045836 | Ga0466958_0021853 | Ga0466958_0021853_306_995 | 225 |
| 313 | 3300045976 | Ga0466967_0291750 | Ga0466967_0291750_757_1455 | 225 |
| 314 | 3300046459 | Ga0495629_0418204 | Ga0495629_0418204_170_868 | 225 |
| 315 | 3300046460 | Ga0495638_0039729 | Ga0495638_0039729_889_1587 | 225 |
| 316 | 3300046460 | Ga0495638_0048119 | Ga0495638_0048119_384_1082 | 225 |
| 317 | 3300046460 | Ga0495638_0130212 | Ga0495638_0130212_39_737 | 225 |
| 318 | 3300046460 | Ga0495638_0291070 | Ga0495638_0291070_40_738 | 225 |
| 319 | 3300046461 | Ga0495641_0159147 | Ga0495641_0159147_261_959 | 225 |
| 320 | 3300046462 | Ga0495651_0009405 | Ga0495651_0009405_1020_1769 | 225 |
| 321 | 3300046462 | Ga0495651_0022220 | Ga0495651_0022220_1576_2274 | 225 |
| 322 | 3300046471 | Ga0495650_0031088 | Ga0495650_0031088_1228_1926 | 225 |
| 323 | 3300046477 | Ga0495664_0277789 | Ga0495664_0277789_299_997 | 225 |
| 324 | 3300046492 | Ga0495585_0207160 | Ga0495585_0207160_20_817 | 225 |
| 325 | 3300046499 | Ga0495594_0017602 | Ga0495594_0017602_909_1607 | 225 |
| 326 | 3300046499 | Ga0495594_0134716 | Ga0495594_0134716_113_811 | 225 |
| 327 | 3300046501 | Ga0495607_0204649 | Ga0495607_0204649_43_741 | 225 |
| 328 | 3300046506 | Ga0495583_0094892 | Ga0495583_0094892_55_753 | 225 |
| 329 | 3300046507 | Ga0495606_0349636 | Ga0495606_0349636_37_735 | 225 |
| 330 | 3300046512 | Ga0495610_0017507 | Ga0495610_0017507_3258_3956 | 225 |
| 331 | 3300046518 | Ga0495631_0164379 | Ga0495631_0164379_174_872 | 225 |
| 332 | 3300046522 | Ga0495643_0212575 | Ga0495643_0212575_70_768 | 225 |
| 333 | 3300046522 | Ga0495643_0227646 | Ga0495643_0227646_170_868 | 225 |
| 334 | 3300046524 | Ga0495648_0053168 | Ga0495648_0053168_693_1391 | 225 |
| 335 | 3300046530 | Ga0495654_0012651 | Ga0495654_0012651_252_950 | 225 |
| 336 | 3300046543 | Ga0495645_0177873 | Ga0495645_0177873_640_1389 | 225 |
| 337 | 3300046557 | Ga0495622_0005431 | Ga0495622_0005431_2381_3079 | 225 |
| 338 | 3300046616 | Ga0495668_0035943 | Ga0495668_0035943_1278_1976 | 225 |
| 339 | 3300046642 | Ga0495634_0326474 | Ga0495634_0326474_193_891 | 225 |
| 340 | 3300046648 | Ga0495611_0182921 | Ga0495611_0182921_210_908 | 225 |
| 341 | 3300046660 | Ga0495625_0073657 | Ga0495625_0073657_1111_1809 | 225 |
| 342 | 3300046665 | Ga0495661_0012280 | Ga0495661_0012280_2757_3455 | 225 |
| 343 | 3300046674 | Ga0495588_0203650 | Ga0495588_0203650_251_949 | 225 |
| 344 | 3300046675 | Ga0495657_0046244 | Ga0495657_0046244_541_1290 | 225 |
| 345 | 3300046678 | Ga0495599_0169263 | Ga0495599_0169263_627_1325 | 225 |
| 346 | 3300046679 | Ga0495623_0012870 | Ga0495623_0012870_245_979 | 225 |
| 347 | 3300046689 | Ga0495613_0056042 | Ga0495613_0056042_1882_2580 | 225 |
| 348 | 3300046689 | Ga0495613_0144755 | Ga0495613_0144755_225_923 | 225 |
| 349 | 3300046691 | Ga0495670_0012601 | Ga0495670_0012601_1542_2240 | 225 |
| 350 | 3300046810 | Ga0495660_0132991 | Ga0495660_0132991_270_968 | 225 |
| 351 | 3300047315 | Ga0495581_0193504 | Ga0495581_0193504_450_1148 | 225 |
| 352 | 3300047317 | Ga0495604_0105632 | Ga0495604_0105632_841_1539 | 225 |
| 353 | 3300047317 | Ga0495604_0358796 | Ga0495604_0358796_164_913 | 225 |
| 354 | 3300047320 | Ga0495672_0145424 | Ga0495672_0145424_416_1114 | 225 |
| 355 | 3300047472 | Ga0495686_0013762 | Ga0495686_0013762_687_1385 | 225 |
| 356 | 3300047472 | Ga0495686_0036693 | Ga0495686_0036693_2303_3001 | 225 |
| 357 | 3300047472 | Ga0495686_0074651 | Ga0495686_0074651_793_1491 | 225 |
| 358 | 3300048088 | Ga0495602_0194229 | Ga0495602_0194229_829_1527 | 225 |
| 359 | 3300048091 | Ga0495626_0061575 | Ga0495626_0061575_278_976 | 225 |
| 360 | 3300048903 | Ga0496100_0306526 | Ga0496100_0306526_224_922 | 225 |
| 361 | 3300048906 | Ga0496103_0174513 | Ga0496103_0174513_350_1048 | 225 |
| 362 | 3300048908 | Ga0496105_0443611 | Ga0496105_0443611_251_949 | 225 |
| 363 | 3300048909 | Ga0496106_0001358 | Ga0496106_0001358_16258_16956 | 225 |
| 364 | 3300048909 | Ga0496106_0052530 | Ga0496106_0052530_2015_2713 | 225 |
| 365 | 3300048909 | Ga0496106_0736254 | Ga0496106_0736254_74_772 | 225 |
| 366 | 3300048910 | Ga0496107_0403907 | Ga0496107_0403907_58_756 | 225 |
| 367 | 3300048911 | Ga0496108_0204804 | Ga0496108_0204804_991_1689 | 225 |
| 368 | 3300048913 | Ga0496110_0113009 | Ga0496110_0113009_521_1219 | 225 |
| 369 | 3300048913 | Ga0496110_0216548 | Ga0496110_0216548_880_1578 | 225 |
| 370 | 3300048914 | Ga0496111_0294153 | Ga0496111_0294153_31_729 | 225 |
| 371 | 3300048914 | Ga0496111_0412806 | Ga0496111_0412806_108_806 | 225 |
| 372 | 3300048917 | Ga0496114_0281214 | Ga0496114_0281214_231_929 | 225 |
| 373 | 3300048918 | Ga0496115_0020165 | Ga0496115_0020165_4381_5079 | 225 |
| 374 | 3300048918 | Ga0496115_0101425 | Ga0496115_0101425_1233_1931 | 225 |
| 375 | 3300048919 | Ga0496116_0000965 | Ga0496116_0000965_2701_3399 | 225 |
| 376 | 3300048919 | Ga0496116_0143291 | Ga0496116_0143291_390_1088 | 225 |
| 377 | 3300048920 | Ga0496117_0034522 | Ga0496117_0034522_1810_2508 | 225 |
| 378 | 3300048920 | Ga0496117_0105182 | Ga0496117_0105182_972_1670 | 225 |
| 379 | 3300048920 | Ga0496117_0106166 | Ga0496117_0106166_379_1077 | 225 |
| 380 | 3300048920 | Ga0496117_0144340 | Ga0496117_0144340_85_783 | 225 |
| 381 | 3300048920 | Ga0496117_0148732 | Ga0496117_0148732_111_809 | 225 |
| 382 | 3300048921 | Ga0496118_0003027 | Ga0496118_0003027_4740_5438 | 225 |
| 383 | 3300048921 | Ga0496118_0010242 | Ga0496118_0010242_8507_9205 | 225 |
| 384 | 3300048921 | Ga0496118_0020353 | Ga0496118_0020353_3435_4133 | 225 |
| 385 | 3300048921 | Ga0496118_0028559 | Ga0496118_0028559_2532_3230 | 225 |
| 386 | 3300048921 | Ga0496118_0039154 | Ga0496118_0039154_1427_2125 | 225 |
| 387 | 3300048921 | Ga0496118_0084187 | Ga0496118_0084187_426_1124 | 225 |
| 388 | 3300048921 | Ga0496118_0120085 | Ga0496118_0120085_764_1462 | 225 |
| 389 | 3300048922 | Ga0496119_0024118 | Ga0496119_0024118_3248_3946 | 225 |
| 390 | 3300048922 | Ga0496119_0035437 | Ga0496119_0035437_1513_2217 | 225 |
| 391 | 3300048922 | Ga0496119_0051808 | Ga0496119_0051808_492_1190 | 225 |
| 392 | 3300048922 | Ga0496119_0064646 | Ga0496119_0064646_405_1103 | 225 |
| 393 | 3300048922 | Ga0496119_0119652 | Ga0496119_0119652_397_1095 | 225 |
| 394 | 3300048924 | Ga0496121_0001622 | Ga0496121_0001622_20289_20987 | 225 |
| 395 | 3300048924 | Ga0496121_0023791 | Ga0496121_0023791_2582_3286 | 225 |
| 396 | 3300048924 | Ga0496121_0028197 | Ga0496121_0028197_1310_2008 | 225 |
| 397 | 3300048924 | Ga0496121_0036329 | Ga0496121_0036329_382_1080 | 225 |
| 398 | 3300048924 | Ga0496121_0126551 | Ga0496121_0126551_1169_1867 | 225 |
| 399 | 3300048924 | Ga0496121_0161432 | Ga0496121_0161432_635_1333 | 225 |
| 400 | 3300048924 | Ga0496121_0208762 | Ga0496121_0208762_644_1342 | 225 |
| 401 | 3300048925 | Ga0496122_0024545 | Ga0496122_0024545_586_1284 | 225 |
| 402 | 3300048925 | Ga0496122_0209236 | Ga0496122_0209236_352_1050 | 225 |
| 403 | 3300048926 | Ga0496123_0065829 | Ga0496123_0065829_525_1223 | 225 |
| 404 | 3300048927 | Ga0496124_0002957 | Ga0496124_0002957_10340_11038 | 225 |
| 405 | 3300048927 | Ga0496124_0095992 | Ga0496124_0095992_168_866 | 225 |
| 406 | 3300048927 | Ga0496124_0218398 | Ga0496124_0218398_699_1397 | 225 |
| 407 | 3300048927 | Ga0496124_0231950 | Ga0496124_0231950_644_1342 | 225 |
| 408 | 3300048927 | Ga0496124_0266812 | Ga0496124_0266812_411_1109 | 225 |
| 409 | 3300048927 | Ga0496124_0469553 | Ga0496124_0469553_89_793 | 225 |
| 410 | 3300048927 | Ga0496124_0526149 | Ga0496124_0526149_50_748 | 225 |
| 411 | 3300048928 | Ga0496125_0001630 | Ga0496125_0001630_23404_24102 | 225 |
| 412 | 3300048928 | Ga0496125_0056184 | Ga0496125_0056184_813_1511 | 225 |
| 413 | 3300048928 | Ga0496125_0083260 | Ga0496125_0083260_976_1674 | 225 |
| 414 | 3300048928 | Ga0496125_0089991 | Ga0496125_0089991_1041_1739 | 225 |
| 415 | 3300048928 | Ga0496125_0099406 | Ga0496125_0099406_1289_1987 | 225 |
| 416 | 3300048928 | Ga0496125_0137524 | Ga0496125_0137524_348_1046 | 225 |
| 417 | 3300048928 | Ga0496125_0281648 | Ga0496125_0281648_202_900 | 225 |
| 418 | 3300048929 | Ga0496126_0003803 | Ga0496126_0003803_8226_8924 | 225 |
| 419 | 3300048929 | Ga0496126_0033555 | Ga0496126_0033555_559_1257 | 225 |
| 420 | 3300048929 | Ga0496126_0070139 | Ga0496126_0070139_2288_2986 | 225 |
| 421 | 3300048929 | Ga0496126_0081503 | Ga0496126_0081503_1267_1965 | 225 |
| 422 | 3300048929 | Ga0496126_0312538 | Ga0496126_0312538_285_983 | 225 |
| 423 | 3300048929 | Ga0496126_0373969 | Ga0496126_0373969_177_875 | 225 |
| 424 | 3300048929 | Ga0496126_0486006 | Ga0496126_0486006_213_941 | 225 |
| 425 | 3300049460 | Ga0495682_0081120 | Ga0495682_0081120_441_1139 | 225 |
| 426 | 3300049460 | Ga0495682_0131024 | Ga0495682_0131024_170_868 | 225 |
| 427 | 3300049568 | Ga0501031_0003114 | Ga0501031_0003114_3983_4681 | 225 |
| 428 | 3300049569 | Ga0501032_0000762 | Ga0501032_0000762_9882_10580 | 225 |
| 429 | 3300049570 | Ga0501033_0000136 | Ga0501033_0000136_63086_63784 | 225 |
| 430 | 3300049570 | Ga0501033_0026715 | Ga0501033_0026715_1367_2083 | 225 |
| 431 | 3300049570 | Ga0501033_0267830 | Ga0501033_0267830_353_1060 | 225 |
| 432 | 3300049571 | Ga0501034_0000251 | Ga0501034_0000251_81637_82335 | 225 |
| 433 | 3300049571 | Ga0501034_0134299 | Ga0501034_0134299_700_1416 | 225 |
| 434 | 3300049572 | Ga0501036_0000036 | Ga0501036_0000036_7179_7877 | 225 |
| 435 | 3300049572 | Ga0501036_0139078 | Ga0501036_0139078_352_1068 | 225 |
| 436 | 3300049573 | Ga0501037_0000867 | Ga0501037_0000867_9902_10600 | 225 |
| 437 | 3300049574 | Ga0501038_0000428 | Ga0501038_0000428_28419_29117 | 225 |
| 438 | 3300049574 | Ga0501038_0203480 | Ga0501038_0203480_591_1310 | 225 |
| 439 | 3300049574 | Ga0501038_0223971 | Ga0501038_0223971_443_1159 | 225 |
| 440 | 3300049575 | Ga0501039_0000273 | Ga0501039_0000273_2502_3200 | 225 |
| 441 | 3300049578 | Ga0501042_0170613 | Ga0501042_0170613_345_1061 | 225 |
| 442 | 3300049579 | Ga0501043_0000165 | Ga0501043_0000165_21408_22106 | 225 |
| 443 | 3300049579 | Ga0501043_0205795 | Ga0501043_0205795_648_1367 | 225 |
| 444 | 3300049579 | Ga0501043_0289433 | Ga0501043_0289433_235_954 | 225 |
| 445 | 3300049579 | Ga0501043_0624811 | Ga0501043_0624811_37_753 | 225 |
| 446 | 3300049580 | Ga0501046_0000839 | Ga0501046_0000839_17109_17807 | 225 |
| 447 | 3300049581 | Ga0501047_0000340 | Ga0501047_0000340_45408_46106 | 225 |
| 448 | 3300049581 | Ga0501047_0041364 | Ga0501047_0041364_1724_2443 | 225 |
| 449 | 3300049582 | Ga0501048_0001309 | Ga0501048_0001309_15486_16184 | 225 |
| 450 | 3300049583 | Ga0501067_0000457 | Ga0501067_0000457_13147_13845 | 225 |
| 451 | 3300049583 | Ga0501067_0087210 | Ga0501067_0087210_512_1228 | 225 |
| 452 | 3300049584 | Ga0501068_0000839 | Ga0501068_0000839_6029_6727 | 225 |
| 453 | 3300049585 | Ga0501069_0066434 | Ga0501069_0066434_56_772 | 225 |
| 454 | 3300049586 | Ga0501070_0000971 | Ga0501070_0000971_8004_8702 | 225 |
| 455 | 3300049586 | Ga0501070_0577973 | Ga0501070_0577973_122_820 | 225 |
| 456 | 3300049587 | Ga0501071_0079057 | Ga0501071_0079057_146_844 | 225 |
| 457 | 3300049588 | Ga0501072_0003301 | Ga0501072_0003301_5147_5845 | 225 |
| 458 | 3300049589 | Ga0501073_0000037 | Ga0501073_0000037_79396_80094 | 225 |
| 459 | 3300049590 | Ga0501074_0000167 | Ga0501074_0000167_15523_16221 | 225 |
| 460 | 3300049741 | Ga0501079_0002302 | Ga0501079_0002302_6850_7548 | 225 |
| 461 | 3300049742 | Ga0501080_0006603 | Ga0501080_0006603_2548_3246 | 225 |
| 462 | 3300049744 | Ga0501083_0001812 | Ga0501083_0001812_2308_3006 | 225 |
| 463 | 3300049822 | Ga0501035_0000142 | Ga0501035_0000142_5227_5925 | 225 |
| 464 | 3300049822 | Ga0501035_0088777 | Ga0501035_0088777_1099_1815 | 225 |
| 465 | 3300049822 | Ga0501035_0185286 | Ga0501035_0185286_571_1278 | 225 |
| 466 | 3300049823 | Ga0501044_0000414 | Ga0501044_0000414_5405_6103 | 225 |
| 467 | 3300049823 | Ga0501044_0021563 | Ga0501044_0021563_564_1283 | 225 |
| 468 | 3300049823 | Ga0501044_0022908 | Ga0501044_0022908_1344_2051 | 225 |
| 469 | 3300049823 | Ga0501044_0076769 | Ga0501044_0076769_1239_1955 | 225 |
| 470 | 3300049823 | Ga0501044_0394898 | Ga0501044_0394898_250_966 | 225 |
| 471 | 3300049824 | Ga0501045_0002539 | Ga0501045_0002539_5483_6181 | 225 |
| 472 | 3300050490 | nmdc:mga03n38_180079_c1 | nmdc:mga03n38_180079_c1_163_861 | 225 |
| 473 | 3300050491 | nmdc:mga00v17_28827_c1 | nmdc:mga00v17_28827_c1_992_1690 | 225 |
| 474 | 3300050492 | nmdc:mga0yw44_179253_c1 | nmdc:mga0yw44_179253_c1_116_814 | 225 |
| 475 | 3300050492 | nmdc:mga0yw44_4551_c1 | nmdc:mga0yw44_4551_c1_2861_3559 | 225 |
| 476 | 3300050492 | nmdc:mga0yw44_7729_c1 | nmdc:mga0yw44_7729_c1_3410_4108 | 225 |
| 477 | 3300050513 | nmdc:mga0rr50_234301_c1 | nmdc:mga0rr50_234301_c1_456_1154 | 225 |
| 478 | 3300050514 | nmdc:mga08x19_86194_c1 | nmdc:mga08x19_86194_c1_552_1250 | 225 |
| 479 | 3300050516 | nmdc:mga0sz30_51614_c1 | nmdc:mga0sz30_51614_c1_424_1122 | 225 |
| 480 | 3300050516 | nmdc:mga0sz30_75666_c1 | nmdc:mga0sz30_75666_c1_379_1077 | 225 |
| 481 | 3300053084 | Ga0495595_0087546 | Ga0495595_0087546_16_765 | 225 |
| 482 | 3300053086 | Ga0500578_0230005 | Ga0500578_0230005_305_1003 | 225 |
| 483 | 3300053087 | Ga0500643_000048 | Ga0500643_000048_96721_97419 | 225 |
| 484 | 3300053088 | Ga0500644_0044232 | Ga0500644_0044232_70_768 | 225 |
| 485 | 3300053091 | Ga0500647_0093291 | Ga0500647_0093291_416_1114 | 225 |
| 486 | 3300053092 | Ga0500583_0010766 | Ga0500583_0010766_1905_2603 | 225 |
| 487 | 3300053092 | Ga0500583_0060762 | Ga0500583_0060762_970_1668 | 225 |
| 488 | 3300053093 | Ga0500651_0002004 | Ga0500651_0002004_4457_5155 | 225 |
| 489 | 3300053094 | Ga0500566_0002605 | Ga0500566_0002605_1452_2150 | 225 |
| 490 | 3300053094 | Ga0500566_0006460 | Ga0500566_0006460_5587_6285 | 225 |
| 491 | 3300053094 | Ga0500566_0075920 | Ga0500566_0075920_617_1315 | 225 |
| 492 | 3300053096 | Ga0500641_0032761 | Ga0500641_0032761_690_1388 | 225 |
| 493 | 3300053098 | Ga0500650_0025917 | Ga0500650_0025917_880_1578 | 225 |
| 494 | 3300053102 | Ga0500554_041214 | Ga0500554_041214_171_869 | 225 |
| 495 | 3300053103 | Ga0500555_027405 | Ga0500555_027405_393_1091 | 225 |
| 496 | 3300053104 | Ga0500556_0000003 | Ga0500556_0000003_363807_364505 | 225 |
| 497 | 3300053108 | Ga0500562_027131 | Ga0500562_027131_30_728 | 225 |
| 498 | 3300053118 | Ga0500594_0086696 | Ga0500594_0086696_234_932 | 225 |
| 499 | 3300053119 | Ga0500595_000333 | Ga0500595_000333_16892_17590 | 225 |
| 500 | 3300053119 | Ga0500595_000497 | Ga0500595_000497_6290_6988 | 225 |
| 501 | 3300053119 | Ga0500595_002282 | Ga0500595_002282_1954_2652 | 225 |
| 502 | 3300053122 | Ga0500608_063928 | Ga0500608_063928_619_1317 | 225 |
| 503 | 3300053122 | Ga0500608_141759 | Ga0500608_141759_228_926 | 225 |
| 504 | 3300053123 | Ga0500614_040520 | Ga0500614_040520_418_1116 | 225 |
| 505 | 3300053125 | Ga0500618_006607 | Ga0500618_006607_710_1408 | 225 |
| 506 | 3300053129 | Ga0500628_081385 | Ga0500628_081385_55_753 | 225 |
| 507 | 3300053130 | Ga0500642_0000015 | Ga0500642_0000015_150089_150787 | 225 |
| 508 | 3300053130 | Ga0500642_0001744 | Ga0500642_0001744_624_1322 | 225 |
| 509 | 3300053130 | Ga0500642_0197676 | Ga0500642_0197676_133_831 | 225 |
| 510 | 3300053131 | Ga0500652_010728 | Ga0500652_010728_518_1216 | 225 |
| 511 | 3300053134 | Ga0500658_0031805 | Ga0500658_0031805_823_1521 | 225 |
| 512 | 3300053136 | Ga0500559_0001714 | Ga0500559_0001714_9922_10620 | 225 |
| 513 | 3300053136 | Ga0500559_0081897 | Ga0500559_0081897_336_1034 | 225 |
| 514 | 3300053138 | Ga0500564_150650 | Ga0500564_150650_187_885 | 225 |
| 515 | 3300053139 | Ga0500568_0000536 | Ga0500568_0000536_23111_23809 | 225 |
| 516 | 3300053139 | Ga0500568_0092354 | Ga0500568_0092354_309_1007 | 225 |
| 517 | 3300053140 | Ga0500573_0067724 | Ga0500573_0067724_453_1208 | 225 |
| 518 | 3300053145 | Ga0500586_000330 | Ga0500586_000330_8403_9101 | 225 |
| 519 | 3300053148 | Ga0500590_031070 | Ga0500590_031070_883_1581 | 225 |
| 520 | 3300053148 | Ga0500590_046959 | Ga0500590_046959_414_1112 | 225 |
| 521 | 3300053150 | Ga0500603_014424 | Ga0500603_014424_863_1561 | 225 |
| 522 | 3300053150 | Ga0500603_087833 | Ga0500603_087833_170_868 | 225 |
| 523 | 3300053151 | Ga0500604_0053896 | Ga0500604_0053896_40_738 | 225 |
| 524 | 3300053153 | Ga0500616_0000033 | Ga0500616_0000033_101821_102519 | 225 |
| 525 | 3300053153 | Ga0500616_0030013 | Ga0500616_0030013_1199_1897 | 225 |
| 526 | 3300053156 | Ga0500622_0017921 | Ga0500622_0017921_276_974 | 225 |
| 527 | 3300053156 | Ga0500622_0026896 | Ga0500622_0026896_1247_1945 | 225 |
| 528 | 3300053158 | Ga0500627_0043782 | Ga0500627_0043782_493_1191 | 225 |
| 529 | 3300053158 | Ga0500627_0081653 | Ga0500627_0081653_249_947 | 225 |
| 530 | 3300053162 | Ga0500638_016198 | Ga0500638_016198_368_1066 | 225 |
| 531 | 3300053163 | Ga0500639_060191 | Ga0500639_060191_1217_1915 | 225 |
| 532 | 3300053177 | Ga0500636_0015308 | Ga0500636_0015308_1653_2351 | 225 |
| 533 | 3300053178 | Ga0500637_0000060 | Ga0500637_0000060_24568_25266 | 225 |
| 534 | 3300053724 | Ga0500570_077593 | Ga0500570_077593_132_830 | 225 |
| 535 | 3300053727 | Ga0500611_021920 | Ga0500611_021920_265_963 | 225 |
| 536 | 3300053735 | Ga0500596_001647 | Ga0500596_001647_949_1647 | 225 |
| 537 | 3300053736 | Ga0500599_002351 | Ga0500599_002351_434_1132 | 225 |
| 538 | 3300054114 | Ga0501084_0005116 | Ga0501084_0005116_1510_2208 | 225 |
| 539 | 3300055283 | Ga0500661_001013 | Ga0500661_001013_2736_3434 | 225 |
| 540 | 3300060353 | Ga0501082_0004333 | Ga0501082_0004333_2666_3364 | 225 |
| 541 | 3300061719 | Ga0466962_0001247 | Ga0466962_0001247_6480_7169 | 225 |
| 542 | iso_pu_bacteria | 2582581279 | 2585147145 | 225 |
| 543 | iso_pu_bacteria | 2585428106 | 2587918018 | 225 |
| 544 | iso_pu_bacteria | 2643221545 | 2643748399 | 225 |
| 545 | iso_pu_bacteria | 2643221552 | 2643780674 | 225 |
| 546 | iso_pu_bacteria | 2643221584 | 2643929447 | 225 |
| 547 | iso_pu_bacteria | 2643221640 | 2644224552 | 225 |
| 548 | iso_pu_bacteria | 2643221642 | 2644234513 | 225 |
| 549 | iso_pu_bacteria | 2643221691 | 2644508212 | 225 |
| 550 | iso_pu_bacteria | 2857504554 | 2857504811 | 225 |
| 551 | iso_pu_bacteria | 2884960567 | 2884965359 | 225 |
| 552 | iso_pu_bacteria | 2928531327 | 2928532858 | 225 |
| 553 | 3300001990 | JGI24737J22298_10006756 | JGI24737J22298_100067565 | 226 |
| 554 | 3300002067 | JGI24735J21928_10004802 | JGI24735J21928_100048026 | 226 |
| 555 | 3300002067 | JGI24735J21928_10017522 | JGI24735J21928_100175221 | 226 |
| 556 | 3300003214 | JGI25165J46597_1000165 | JGI25165J46597_100016565 | 226 |
| 557 | 3300005327 | Ga0070658_10004018 | Ga0070658_100040189 | 226 |
| 558 | 3300005327 | Ga0070658_10004565 | Ga0070658_1000456512 | 226 |
| 559 | 3300005327 | Ga0070658_10212129 | Ga0070658_102121292 | 226 |
| 560 | 3300005328 | Ga0070676_10000416 | Ga0070676_1000041616 | 226 |
| 561 | 3300005334 | Ga0068869_100015254 | Ga0068869_1000152546 | 226 |
| 562 | 3300005338 | Ga0068868_100000013 | Ga0068868_1000000132 | 226 |
| 563 | 3300005339 | Ga0070660_100002444 | Ga0070660_1000024446 | 226 |
| 564 | 3300005339 | Ga0070660_100033044 | Ga0070660_1000330442 | 226 |
| 565 | 3300005364 | Ga0070673_100000002 | Ga0070673_100000002196 | 226 |
| 566 | 3300005366 | Ga0070659_100148389 | Ga0070659_1001483894 | 226 |
| 567 | 3300005459 | Ga0068867_100000012 | Ga0068867_10000001218 | 226 |
| 568 | 3300005539 | Ga0068853_100041194 | Ga0068853_1000411944 | 226 |
| 569 | 3300005547 | Ga0070693_100020120 | Ga0070693_1000201205 | 226 |
| 570 | 3300005548 | Ga0070665_100535622 | Ga0070665_1005356222 | 226 |
| 571 | 3300005563 | Ga0068855_100000095 | Ga0068855_10000009548 | 226 |
| 572 | 3300005563 | Ga0068855_100071449 | Ga0068855_1000714492 | 226 |
| 573 | 3300005563 | Ga0068855_100498496 | Ga0068855_1004984962 | 226 |
| 574 | 3300005614 | Ga0068856_100016744 | Ga0068856_1000167444 | 226 |
| 575 | 3300005718 | Ga0068866_10071782 | Ga0068866_100717823 | 226 |
| 576 | 3300006881 | Ga0068865_100000004 | Ga0068865_100000004195 | 226 |
| 577 | 3300009093 | Ga0105240_10064674 | Ga0105240_100646742 | 226 |
| 578 | 3300009093 | Ga0105240_10323474 | Ga0105240_103234742 | 226 |
| 579 | 3300009098 | Ga0105245_10001027 | Ga0105245_100010277 | 226 |
| 580 | 3300009148 | Ga0105243_10000146 | Ga0105243_1000014617 | 226 |
| 581 | 3300009176 | Ga0105242_10000497 | Ga0105242_1000049728 | 226 |
| 582 | 3300009545 | Ga0105237_10133176 | Ga0105237_101331764 | 226 |
| 583 | 3300009553 | Ga0105249_10015630 | Ga0105249_100156305 | 226 |
| 584 | 3300011119 | Ga0105246_10000138 | Ga0105246_1000013819 | 226 |
| 585 | 3300013104 | Ga0157370_10000096 | Ga0157370_1000009645 | 226 |
| 586 | 3300013104 | Ga0157370_10274931 | Ga0157370_102749312 | 226 |
| 587 | 3300013105 | Ga0157369_10022918 | Ga0157369_100229186 | 226 |
| 588 | 3300013296 | Ga0157374_10001104 | Ga0157374_100011049 | 226 |
| 589 | 3300013297 | Ga0157378_10015726 | Ga0157378_100157269 | 226 |
| 590 | 3300013306 | Ga0163162_11080978 | Ga0163162_110809782 | 226 |
| 591 | 3300013307 | Ga0157372_10034063 | Ga0157372_100340638 | 226 |
| 592 | 3300013308 | Ga0157375_10000587 | Ga0157375_1000058713 | 226 |
| 593 | 3300014497 | Ga0182008_10154201 | Ga0182008_101542012 | 226 |
| 594 | 3300014969 | Ga0157376_10000131 | Ga0157376_1000013140 | 226 |
| 595 | 3300021384 | Ga0213876_10000345 | Ga0213876_1000034511 | 226 |
| 596 | 3300021384 | Ga0213876_10038689 | Ga0213876_100386893 | 226 |
| 597 | 3300025250 | Ga0209026_1001831 | Ga0209026_10018311 | 226 |
| 598 | 3300025254 | Ga0209148_1000074 | Ga0209148_1000074225 | 226 |
| 599 | 3300025254 | Ga0209148_1001194 | Ga0209148_100119418 | 226 |
| 600 | 3300025261 | Ga0209233_1000098 | Ga0209233_1000098224 | 226 |
| 601 | 3300025272 | Ga0209455_1000574 | Ga0209455_100057422 | 226 |
| 602 | 3300025272 | Ga0209455_1036672 | Ga0209455_10366721 | 226 |
| 603 | 3300025899 | Ga0207642_10150907 | Ga0207642_101509072 | 226 |
| 604 | 3300025907 | Ga0207645_10004384 | Ga0207645_100043847 | 226 |
| 605 | 3300025909 | Ga0207705_10000055 | Ga0207705_10000055140 | 226 |
| 606 | 3300025909 | Ga0207705_10007178 | Ga0207705_100071786 | 226 |
| 607 | 3300025911 | Ga0207654_10496656 | Ga0207654_104966561 | 226 |
| 608 | 3300025913 | Ga0207695_10005778 | Ga0207695_100057787 | 226 |
| 609 | 3300025913 | Ga0207695_10525076 | Ga0207695_105250762 | 226 |
| 610 | 3300025914 | Ga0207671_10061198 | Ga0207671_100611982 | 226 |
| 611 | 3300025919 | Ga0207657_10004951 | Ga0207657_1000495111 | 226 |
| 612 | 3300025919 | Ga0207657_10139147 | Ga0207657_101391473 | 226 |
| 613 | 3300025927 | Ga0207687_10089008 | Ga0207687_100890083 | 226 |
| 614 | 3300025934 | Ga0207686_10067444 | Ga0207686_100674442 | 226 |
| 615 | 3300025935 | Ga0207709_10000314 | Ga0207709_1000031462 | 226 |
| 616 | 3300025938 | Ga0207704_10000005 | Ga0207704_1000000518 | 226 |
| 617 | 3300025942 | Ga0207689_10001653 | Ga0207689_1000165318 | 226 |
| 618 | 3300025949 | Ga0207667_10000016 | Ga0207667_10000016282 | 226 |
| 619 | 3300025949 | Ga0207667_10079777 | Ga0207667_100797774 | 226 |
| 620 | 3300025960 | Ga0207651_10000007 | Ga0207651_1000000718 | 226 |
| 621 | 3300025961 | Ga0207712_10007902 | Ga0207712_100079026 | 226 |
| 622 | 3300026023 | Ga0207677_10000085 | Ga0207677_100000857 | 226 |
| 623 | 3300026041 | Ga0207639_10038697 | Ga0207639_100386973 | 226 |
| 624 | 3300026078 | Ga0207702_10005342 | Ga0207702_100053428 | 226 |
| 625 | 3300026089 | Ga0207648_10000005 | Ga0207648_1000000519 | 226 |
| 626 | 3300031730 | Ga0307516_10000034 | Ga0307516_1000003477 | 226 |
| 627 | 3300032004 | Ga0307414_10197404 | Ga0307414_101974042 | 226 |
| 628 | 3300037312 | Ga0395899_0000713 | Ga0395899_0000713_232_918 | 226 |
| 629 | 3300039437 | Ga0436365_0916510 | Ga0436365_0916510_16258_16944 | 226 |
| 630 | 3300039437 | Ga0436365_1541345 | Ga0436365_1541345_9705_10445 | 226 |
| 631 | 3300039450 | Ga0436363_0168726 | Ga0436363_0168726_3295_4035 | 226 |
| 632 | 3300048916 | Ga0496113_0213646 | Ga0496113_0213646_239_919 | 226 |
| 633 | 3300048920 | Ga0496117_0013409 | Ga0496117_0013409_719_1426 | 226 |
| 634 | 3300048921 | Ga0496118_0070052 | Ga0496118_0070052_157_864 | 226 |
| 635 | 3300048925 | Ga0496122_0036640 | Ga0496122_0036640_647_1354 | 226 |
| 636 | 3300048926 | Ga0496123_0022020 | Ga0496123_0022020_2527_3234 | 226 |
| 637 | 3300048928 | Ga0496125_0295403 | Ga0496125_0295403_42_785 | 226 |
| 638 | 3300048929 | Ga0496126_0028894 | Ga0496126_0028894_1284_1970 | 226 |
| 639 | 3300053091 | Ga0500647_0178970 | Ga0500647_0178970_40_753 | 226 |
| 640 | 3300053093 | Ga0500651_0002704 | Ga0500651_0002704_174_887 | 226 |
| 641 | 3300053130 | Ga0500642_0015152 | Ga0500642_0015152_2000_2713 | 226 |
| 642 | 3300053133 | Ga0500655_000460 | Ga0500655_000460_6512_7225 | 226 |
| 643 | 3300053148 | Ga0500590_007211 | Ga0500590_007211_966_1679 | 226 |
| 644 | 3300053724 | Ga0500570_004099 | Ga0500570_004099_5816_6529 | 226 |
| 645 | 3300053730 | Ga0500645_029154 | Ga0500645_029154_167_883 | 226 |
| 646 | iso_pu_bacteria | 2643221598 | 2643998673 | 226 |
| 647 | iso_pu_bacteria | 2643221622 | 2644125726 | 226 |
| 648 | 3300009177 | Ga0105248_10007949 | Ga0105248_1000794913 | 227 |
| 649 | 3300021361 | Ga0213872_10070428 | Ga0213872_100704282 | 227 |
| 650 | 3300025299 | Ga0209256_1010559 | Ga0209256_10105592 | 227 |
| 651 | 3300025941 | Ga0207711_10004629 | Ga0207711_1000462913 | 227 |
| 652 | 3300037466 | Ga0395898_0204761 | Ga0395898_0204761_498_1184 | 227 |
| 653 | 3300037471 | Ga0395905_0034469 | Ga0395905_0034469_2532_3218 | 227 |
| 654 | 3300037471 | Ga0395905_0410047 | Ga0395905_0410047_361_1047 | 227 |
| 655 | 3300038443 | Ga0395901_0029978 | Ga0395901_0029978_1291_1977 | 227 |
| 656 | 3300039447 | Ga0436361_0546846 | Ga0436361_0546846_871_1566 | 227 |
| 657 | 3300042012 | Ga0439455_0059366 | Ga0439455_0059366_110_796 | 227 |
| 658 | 3300049568 | Ga0501031_0026710 | Ga0501031_0026710_3028_3723 | 227 |
| 659 | 3300049571 | Ga0501034_0008471 | Ga0501034_0008471_9756_10454 | 227 |
| 660 | 3300049744 | Ga0501083_0016896 | Ga0501083_0016896_3947_4633 | 227 |
| 661 | 3300053134 | Ga0500658_0055776 | Ga0500658_0055776_286_984 | 227 |
| 662 | 3300053139 | Ga0500568_0084443 | Ga0500568_0084443_136_834 | 227 |
| 663 | 3300002067 | JGI24735J21928_10011300 | JGI24735J21928_100113003 | 228 |
| 664 | 3300003322 | rootL2_10085247 | rootL2_100852472 | 228 |
| 665 | 3300003322 | rootL2_10136953 | rootL2_101369532 | 228 |
| 666 | 3300003794 | Ga0055531_10001047 | Ga0055531_1000104714 | 228 |
| 667 | 3300005262 | Ga0065165_1004950 | Ga0065165_10049503 | 228 |
| 668 | 3300005457 | Ga0070662_100159029 | Ga0070662_1001590292 | 228 |
| 669 | 3300006186 | Ga0075369_10004680 | Ga0075369_100046801 | 228 |
| 670 | 3300006195 | Ga0075366_10086221 | Ga0075366_100862212 | 228 |
| 671 | 3300006237 | Ga0097621_100872561 | Ga0097621_1008725611 | 228 |
| 672 | 3300009093 | Ga0105240_10298611 | Ga0105240_102986112 | 228 |
| 673 | 3300013306 | Ga0163162_10026231 | Ga0163162_100262312 | 228 |
| 674 | 3300014968 | Ga0157379_10014381 | Ga0157379_100143813 | 228 |
| 675 | 3300014968 | Ga0157379_10027684 | Ga0157379_100276842 | 228 |
| 676 | 3300025297 | Ga0209758_1001570 | Ga0209758_100157012 | 228 |
| 677 | 3300025297 | Ga0209758_1026731 | Ga0209758_10267314 | 228 |
| 678 | 3300025304 | Ga0209257_1000066 | Ga0209257_100006653 | 228 |
| 679 | 3300025904 | Ga0207647_10152771 | Ga0207647_101527711 | 228 |
| 680 | 3300025904 | Ga0207647_10359411 | Ga0207647_103594111 | 228 |
| 681 | 3300025915 | Ga0207693_10166544 | Ga0207693_101665442 | 228 |
| 682 | 3300025927 | Ga0207687_10201791 | Ga0207687_102017912 | 228 |
| 683 | 3300025933 | Ga0207706_10010431 | Ga0207706_1001043110 | 228 |
| 684 | 3300025972 | Ga0207668_10436882 | Ga0207668_104368822 | 228 |
| 685 | 3300026067 | Ga0207678_10746243 | Ga0207678_107462431 | 228 |
| 686 | 3300031240 | Ga0265320_10001345 | Ga0265320_1000134520 | 228 |
| 687 | 3300039447 | Ga0436361_0108203 | Ga0436361_0108203_381_1151 | 228 |
| 688 | 3300039447 | Ga0436361_0186477 | Ga0436361_0186477_585_1325 | 228 |
| 689 | 3300041410 | Ga0439461_0035617 | Ga0439461_0035617_56_808 | 228 |
| 690 | 3300042005 | Ga0439448_0002340 | Ga0439448_0002340_4384_5082 | 228 |
| 691 | 3300042005 | Ga0439448_0024185 | Ga0439448_0024185_843_1541 | 228 |
| 692 | 3300042012 | Ga0439455_0007335 | Ga0439455_0007335_1246_1944 | 228 |
| 693 | 3300042012 | Ga0439455_0008361 | Ga0439455_0008361_766_1464 | 228 |
| 694 | 3300042157 | Ga0439458_0000986 | Ga0439458_0000986_6013_6705 | 228 |
| 695 | 3300042157 | Ga0439458_0001013 | Ga0439458_0001013_1392_2090 | 228 |
| 696 | 3300042157 | Ga0439458_0001992 | Ga0439458_0001992_1209_1907 | 228 |
| 697 | 3300044684 | Ga0466966_0058718 | Ga0466966_0058718_1542_2240 | 228 |
| 698 | 3300045049 | Ga0466959_0042510 | Ga0466959_0042510_2555_3313 | 228 |
| 699 | 3300045049 | Ga0466959_0296235 | Ga0466959_0296235_59_745 | 228 |
| 700 | 3300045836 | Ga0466958_0359931 | Ga0466958_0359931_195_893 | 228 |
| 701 | 3300046453 | Ga0495627_000209 | Ga0495627_000209_54444_55193 | 228 |
| 702 | 3300046460 | Ga0495638_0000434 | Ga0495638_0000434_30887_31600 | 228 |
| 703 | 3300046472 | Ga0495580_0348313 | Ga0495580_0348313_190_960 | 228 |
| 704 | 3300046512 | Ga0495610_0005291 | Ga0495610_0005291_8189_8905 | 228 |
| 705 | 3300046660 | Ga0495625_0039826 | Ga0495625_0039826_2154_2876 | 228 |
| 706 | 3300047469 | Ga0495673_0000108 | Ga0495673_0000108_124628_125344 | 228 |
| 707 | 3300048903 | Ga0496100_0327012 | Ga0496100_0327012_171_857 | 228 |
| 708 | 3300048918 | Ga0496115_0004981 | Ga0496115_0004981_6924_7610 | 228 |
| 709 | 3300049571 | Ga0501034_0146924 | Ga0501034_0146924_732_1427 | 228 |
| 710 | 3300050491 | nmdc:mga00v17_26492_c1 | nmdc:mga00v17_26492_c1_2418_3116 | 228 |
| 711 | 3300050492 | nmdc:mga0yw44_341776_c1 | nmdc:mga0yw44_341776_c1_107_805 | 228 |
| 712 | 3300050492 | nmdc:mga0yw44_50500_c1 | nmdc:mga0yw44_50500_c1_1611_2309 | 228 |
| 713 | 3300050492 | nmdc:mga0yw44_84115_c1 | nmdc:mga0yw44_84115_c1_916_1614 | 228 |
| 714 | 3300053087 | Ga0500643_005672 | Ga0500643_005672_573_1259 | 228 |
| 715 | 3300053096 | Ga0500641_0023374 | Ga0500641_0023374_11_709 | 228 |
| 716 | 3300053123 | Ga0500614_015345 | Ga0500614_015345_804_1550 | 228 |
| 717 | 3300053136 | Ga0500559_0000112 | Ga0500559_0000112_4279_5028 | 228 |
| 718 | 3300053156 | Ga0500622_0023088 | Ga0500622_0023088_2428_3174 | 228 |
| 719 | 3300053177 | Ga0500636_0040450 | Ga0500636_0040450_374_1096 | 228 |
| 720 | 3300001990 | JGI24737J22298_10001157 | JGI24737J22298_100011577 | 229 |
| 721 | 3300001990 | JGI24737J22298_10002048 | JGI24737J22298_100020486 | 229 |
| 722 | 3300003215 | JGI25153J46596_10000103 | JGI25153J46596_1000010366 | 229 |
| 723 | 3300003322 | rootL2_10056079 | rootL2_100560793 | 229 |
| 724 | 3300003771 | Ga0055526_1023389 | Ga0055526_10233892 | 229 |
| 725 | 3300003771 | Ga0055526_1030086 | Ga0055526_10300862 | 229 |
| 726 | 3300003773 | Ga0055537_1001200 | Ga0055537_10012008 | 229 |
| 727 | 3300003775 | Ga0055524_1010000 | Ga0055524_10100002 | 229 |
| 728 | 3300003781 | Ga0055536_1000883 | Ga0055536_10008836 | 229 |
| 729 | 3300003781 | Ga0055536_1001272 | Ga0055536_10012726 | 229 |
| 730 | 3300003790 | Ga0055528_1007152 | Ga0055528_10071525 | 229 |
| 731 | 3300003791 | Ga0055530_10001417 | Ga0055530_1000141711 | 229 |
| 732 | 3300003791 | Ga0055530_10034337 | Ga0055530_100343372 | 229 |
| 733 | 3300003794 | Ga0055531_10000274 | Ga0055531_1000027449 | 229 |
| 734 | 3300003794 | Ga0055531_10022251 | Ga0055531_100222511 | 229 |
| 735 | 3300005262 | Ga0065165_1000256 | Ga0065165_100025652 | 229 |
| 736 | 3300005331 | Ga0070670_100205126 | Ga0070670_1002051262 | 229 |
| 737 | 3300005339 | Ga0070660_100204054 | Ga0070660_1002040541 | 229 |
| 738 | 3300005339 | Ga0070660_100625404 | Ga0070660_1006254041 | 229 |
| 739 | 3300005347 | Ga0070668_100019990 | Ga0070668_1000199905 | 229 |
| 740 | 3300005366 | Ga0070659_100003649 | Ga0070659_1000036497 | 229 |
| 741 | 3300005539 | Ga0068853_100470288 | Ga0068853_1004702881 | 229 |
| 742 | 3300005548 | Ga0070665_100154706 | Ga0070665_1001547063 | 229 |
| 743 | 3300005548 | Ga0070665_100174582 | Ga0070665_1001745822 | 229 |
| 744 | 3300005548 | Ga0070665_100203709 | Ga0070665_1002037092 | 229 |
| 745 | 3300005577 | Ga0068857_100021147 | Ga0068857_1000211472 | 229 |
| 746 | 3300005719 | Ga0068861_100207079 | Ga0068861_1002070792 | 229 |
| 747 | 3300005843 | Ga0068860_101020018 | Ga0068860_1010200181 | 229 |
| 748 | 3300005937 | Ga0081455_10002424 | Ga0081455_1000242414 | 229 |
| 749 | 3300006038 | Ga0075365_10164151 | Ga0075365_101641512 | 229 |
| 750 | 3300006186 | Ga0075369_10106555 | Ga0075369_101065552 | 229 |
| 751 | 3300006195 | Ga0075366_10008146 | Ga0075366_100081466 | 229 |
| 752 | 3300006353 | Ga0075370_10297882 | Ga0075370_102978822 | 229 |
| 753 | 3300009098 | Ga0105245_10003725 | Ga0105245_100037255 | 229 |
| 754 | 3300013297 | Ga0157378_10091415 | Ga0157378_100914153 | 229 |
| 755 | 3300013307 | Ga0157372_10294884 | Ga0157372_102948842 | 229 |
| 756 | 3300014325 | Ga0163163_10089709 | Ga0163163_100897093 | 229 |
| 757 | 3300025263 | Ga0209565_1000618 | Ga0209565_10006186 | 229 |
| 758 | 3300025273 | Ga0209673_1000722 | Ga0209673_10007226 | 229 |
| 759 | 3300025273 | Ga0209673_1027785 | Ga0209673_10277852 | 229 |
| 760 | 3300025292 | Ga0209676_1000243 | Ga0209676_100024374 | 229 |
| 761 | 3300025292 | Ga0209676_1000311 | Ga0209676_100031125 | 229 |
| 762 | 3300025295 | Ga0209564_1000713 | Ga0209564_100071335 | 229 |
| 763 | 3300025295 | Ga0209564_1009741 | Ga0209564_10097412 | 229 |
| 764 | 3300025295 | Ga0209564_1032344 | Ga0209564_10323441 | 229 |
| 765 | 3300025297 | Ga0209758_1000239 | Ga0209758_100023988 | 229 |
| 766 | 3300025297 | Ga0209758_1001566 | Ga0209758_100156618 | 229 |
| 767 | 3300025298 | Ga0209050_1000244 | Ga0209050_100024474 | 229 |
| 768 | 3300025298 | Ga0209050_1000375 | Ga0209050_100037525 | 229 |
| 769 | 3300025298 | Ga0209050_1011876 | Ga0209050_10118762 | 229 |
| 770 | 3300025298 | Ga0209050_1014540 | Ga0209050_10145402 | 229 |
| 771 | 3300025299 | Ga0209256_1001119 | Ga0209256_100111927 | 229 |
| 772 | 3300025299 | Ga0209256_1002155 | Ga0209256_100215510 | 229 |
| 773 | 3300025299 | Ga0209256_1008041 | Ga0209256_10080412 | 229 |
| 774 | 3300025303 | Ga0209051_1003593 | Ga0209051_10035939 | 229 |
| 775 | 3300025304 | Ga0209257_1000140 | Ga0209257_100014050 | 229 |
| 776 | 3300025304 | Ga0209257_1001119 | Ga0209257_100111930 | 229 |
| 777 | 3300025304 | Ga0209257_1004459 | Ga0209257_10044593 | 229 |
| 778 | 3300025304 | Ga0209257_1023078 | Ga0209257_10230783 | 229 |
| 779 | 3300025904 | Ga0207647_10025784 | Ga0207647_100257845 | 229 |
| 780 | 3300025927 | Ga0207687_10000755 | Ga0207687_100007557 | 229 |
| 781 | 3300025932 | Ga0207690_10004570 | Ga0207690_100045707 | 229 |
| 782 | 3300025932 | Ga0207690_10036500 | Ga0207690_100365003 | 229 |
| 783 | 3300026041 | Ga0207639_10255690 | Ga0207639_102556902 | 229 |
| 784 | 3300026088 | Ga0207641_10341334 | Ga0207641_103413342 | 229 |
| 785 | 3300026116 | Ga0207674_10000989 | Ga0207674_1000098931 | 229 |
| 786 | 3300026118 | Ga0207675_100343902 | Ga0207675_1003439022 | 229 |
| 787 | 3300028379 | Ga0268266_10166098 | Ga0268266_101660983 | 229 |
| 788 | 3300028379 | Ga0268266_10235109 | Ga0268266_102351091 | 229 |
| 789 | 3300028379 | Ga0268266_10545318 | Ga0268266_105453182 | 229 |
| 790 | 3300028794 | Ga0307515_10033355 | Ga0307515_100333557 | 229 |
| 791 | 3300030522 | Ga0307512_10191584 | Ga0307512_101915842 | 229 |
| 792 | 3300031456 | Ga0307513_10079397 | Ga0307513_100793973 | 229 |
| 793 | 3300031456 | Ga0307513_10270222 | Ga0307513_102702222 | 229 |
| 794 | 3300033180 | Ga0307510_10129319 | Ga0307510_101293191 | 229 |
| 795 | 3300042012 | Ga0439455_0071768 | Ga0439455_0071768_58_747 | 229 |
| 796 | 3300044684 | Ga0466966_0058072 | Ga0466966_0058072_1503_2204 | 229 |
| 797 | 3300044694 | Ga0466963_0037193 | Ga0466963_0037193_1338_2039 | 229 |
| 798 | 3300044719 | Ga0466971_0024553 | Ga0466971_0024553_136_837 | 229 |
| 799 | 3300044842 | Ga0466957_0008884 | Ga0466957_0008884_2150_2851 | 229 |
| 800 | 3300045049 | Ga0466959_0005917 | Ga0466959_0005917_3309_4010 | 229 |
| 801 | 3300045836 | Ga0466958_0093525 | Ga0466958_0093525_216_917 | 229 |
| 802 | 3300046457 | Ga0495590_0002168 | Ga0495590_0002168_972_1706 | 229 |
| 803 | 3300046460 | Ga0495638_0000326 | Ga0495638_0000326_50472_51206 | 229 |
| 804 | 3300046460 | Ga0495638_0005521 | Ga0495638_0005521_7090_7800 | 229 |
| 805 | 3300046471 | Ga0495650_0000069 | Ga0495650_0000069_3369_4085 | 229 |
| 806 | 3300046471 | Ga0495650_0116783 | Ga0495650_0116783_231_965 | 229 |
| 807 | 3300046506 | Ga0495583_0000001 | Ga0495583_0000001_517596_518423 | 229 |
| 808 | 3300046507 | Ga0495606_0016300 | Ga0495606_0016300_3832_4584 | 229 |
| 809 | 3300046512 | Ga0495610_0002007 | Ga0495610_0002007_3606_4361 | 229 |
| 810 | 3300046512 | Ga0495610_0004447 | Ga0495610_0004447_5500_6234 | 229 |
| 811 | 3300046513 | Ga0495616_0000115 | Ga0495616_0000115_169_924 | 229 |
| 812 | 3300046518 | Ga0495631_0001223 | Ga0495631_0001223_12681_13415 | 229 |
| 813 | 3300046518 | Ga0495631_0138305 | Ga0495631_0138305_84_839 | 229 |
| 814 | 3300046519 | Ga0495632_0012120 | Ga0495632_0012120_3761_4510 | 229 |
| 815 | 3300046524 | Ga0495648_0000165 | Ga0495648_0000165_23444_24154 | 229 |
| 816 | 3300046524 | Ga0495648_0112343 | Ga0495648_0112343_542_1291 | 229 |
| 817 | 3300046525 | Ga0495663_0025072 | Ga0495663_0025072_48_803 | 229 |
| 818 | 3300046530 | Ga0495654_0000024 | Ga0495654_0000024_117922_118671 | 229 |
| 819 | 3300046616 | Ga0495668_0000456 | Ga0495668_0000456_35907_36626 | 229 |
| 820 | 3300046616 | Ga0495668_0015595 | Ga0495668_0015595_1570_2325 | 229 |
| 821 | 3300046616 | Ga0495668_0018797 | Ga0495668_0018797_1397_2107 | 229 |
| 822 | 3300046616 | Ga0495668_0023744 | Ga0495668_0023744_1527_2282 | 229 |
| 823 | 3300046616 | Ga0495668_0074400 | Ga0495668_0074400_327_1052 | 229 |
| 824 | 3300046616 | Ga0495668_0081140 | Ga0495668_0081140_973_1677 | 229 |
| 825 | 3300046660 | Ga0495625_0000230 | Ga0495625_0000230_19966_20715 | 229 |
| 826 | 3300046660 | Ga0495625_0004316 | Ga0495625_0004316_7526_8242 | 229 |
| 827 | 3300046660 | Ga0495625_0006914 | Ga0495625_0006914_5530_6285 | 229 |
| 828 | 3300046660 | Ga0495625_0018507 | Ga0495625_0018507_149_853 | 229 |
| 829 | 3300046664 | Ga0495659_0131102 | Ga0495659_0131102_26_781 | 229 |
| 830 | 3300046692 | Ga0495671_0061171 | Ga0495671_0061171_316_1050 | 229 |
| 831 | 3300047320 | Ga0495672_0019609 | Ga0495672_0019609_2662_3417 | 229 |
| 832 | 3300047445 | Ga0495677_0008628 | Ga0495677_0008628_2327_3031 | 229 |
| 833 | 3300047469 | Ga0495673_0000344 | Ga0495673_0000344_21573_22283 | 229 |
| 834 | 3300047469 | Ga0495673_0003633 | Ga0495673_0003633_6750_7499 | 229 |
| 835 | 3300047472 | Ga0495686_0004056 | Ga0495686_0004056_3378_4127 | 229 |
| 836 | 3300047472 | Ga0495686_0011950 | Ga0495686_0011950_5304_6038 | 229 |
| 837 | 3300047472 | Ga0495686_0132889 | Ga0495686_0132889_522_1241 | 229 |
| 838 | 3300048909 | Ga0496106_0044228 | Ga0496106_0044228_947_1663 | 229 |
| 839 | 3300048910 | Ga0496107_0006558 | Ga0496107_0006558_1203_1919 | 229 |
| 840 | 3300048918 | Ga0496115_0001486 | Ga0496115_0001486_15129_15884 | 229 |
| 841 | 3300048924 | Ga0496121_0007823 | Ga0496121_0007823_11157_11873 | 229 |
| 842 | 3300048924 | Ga0496121_0244912 | Ga0496121_0244912_317_1027 | 229 |
| 843 | 3300048924 | Ga0496121_0366225 | Ga0496121_0366225_62_772 | 229 |
| 844 | 3300048927 | Ga0496124_0049091 | Ga0496124_0049091_2857_3576 | 229 |
| 845 | 3300048928 | Ga0496125_0095264 | Ga0496125_0095264_1439_2158 | 229 |
| 846 | 3300049459 | Ga0495678_003911 | Ga0495678_003911_4389_5123 | 229 |
| 847 | 3300049569 | Ga0501032_0056815 | Ga0501032_0056815_1121_1825 | 229 |
| 848 | 3300049570 | Ga0501033_0057089 | Ga0501033_0057089_1777_2481 | 229 |
| 849 | 3300049573 | Ga0501037_0186696 | Ga0501037_0186696_33_737 | 229 |
| 850 | 3300049579 | Ga0501043_0027908 | Ga0501043_0027908_2580_3281 | 229 |
| 851 | 3300049579 | Ga0501043_0198896 | Ga0501043_0198896_581_1285 | 229 |
| 852 | 3300049580 | Ga0501046_0516206 | Ga0501046_0516206_130_834 | 229 |
| 853 | 3300049581 | Ga0501047_0001905 | Ga0501047_0001905_394_1095 | 229 |
| 854 | 3300049581 | Ga0501047_0003425 | Ga0501047_0003425_1066_1770 | 229 |
| 855 | 3300049583 | Ga0501067_0135039 | Ga0501067_0135039_131_835 | 229 |
| 856 | 3300049584 | Ga0501068_0032662 | Ga0501068_0032662_933_1637 | 229 |
| 857 | 3300049585 | Ga0501069_0032150 | Ga0501069_0032150_1919_2671 | 229 |
| 858 | 3300049592 | Ga0501076_0191321 | Ga0501076_0191321_57_761 | 229 |
| 859 | 3300049742 | Ga0501080_0080214 | Ga0501080_0080214_25_729 | 229 |
| 860 | 3300049744 | Ga0501083_0042452 | Ga0501083_0042452_1872_2576 | 229 |
| 861 | 3300049822 | Ga0501035_0319208 | Ga0501035_0319208_131_832 | 229 |
| 862 | 3300049823 | Ga0501044_0008740 | Ga0501044_0008740_4649_5353 | 229 |
| 863 | 3300049823 | Ga0501044_0083517 | Ga0501044_0083517_922_1623 | 229 |
| 864 | 3300050493 | nmdc:mga0k408_199183_c1 | nmdc:mga0k408_199183_c1_402_1151 | 229 |
| 865 | 3300050516 | nmdc:mga0sz30_4919_c1 | nmdc:mga0sz30_4919_c1_1255_1974 | 229 |
| 866 | 3300053086 | Ga0500578_0000056 | Ga0500578_0000056_82876_83610 | 229 |
| 867 | 3300053086 | Ga0500578_0113492 | Ga0500578_0113492_445_1197 | 229 |
| 868 | 3300053086 | Ga0500578_0190611 | Ga0500578_0190611_333_1034 | 229 |
| 869 | 3300053087 | Ga0500643_000548 | Ga0500643_000548_23794_24495 | 229 |
| 870 | 3300053087 | Ga0500643_012763 | Ga0500643_012763_512_1222 | 229 |
| 871 | 3300053087 | Ga0500643_070398 | Ga0500643_070398_231_947 | 229 |
| 872 | 3300053088 | Ga0500644_0000089 | Ga0500644_0000089_36485_37195 | 229 |
| 873 | 3300053088 | Ga0500644_0028932 | Ga0500644_0028932_181_915 | 229 |
| 874 | 3300053093 | Ga0500651_0215834 | Ga0500651_0215834_190_942 | 229 |
| 875 | 3300053096 | Ga0500641_0018004 | Ga0500641_0018004_812_1546 | 229 |
| 876 | 3300053096 | Ga0500641_0025472 | Ga0500641_0025472_1308_2018 | 229 |
| 877 | 3300053104 | Ga0500556_0001687 | Ga0500556_0001687_4290_5045 | 229 |
| 878 | 3300053108 | Ga0500562_000489 | Ga0500562_000489_6083_6817 | 229 |
| 879 | 3300053108 | Ga0500562_006991 | Ga0500562_006991_1173_1907 | 229 |
| 880 | 3300053118 | Ga0500594_0000724 | Ga0500594_0000724_2199_2933 | 229 |
| 881 | 3300053122 | Ga0500608_000207 | Ga0500608_000207_4271_4990 | 229 |
| 882 | 3300053125 | Ga0500618_000034 | Ga0500618_000034_4638_5393 | 229 |
| 883 | 3300053134 | Ga0500658_0010451 | Ga0500658_0010451_2234_2989 | 229 |
| 884 | 3300053136 | Ga0500559_0033232 | Ga0500559_0033232_325_1044 | 229 |
| 885 | 3300053136 | Ga0500559_0089806 | Ga0500559_0089806_377_1081 | 229 |
| 886 | 3300053136 | Ga0500559_0147656 | Ga0500559_0147656_263_955 | 229 |
| 887 | 3300053138 | Ga0500564_000057 | Ga0500564_000057_15755_16465 | 229 |
| 888 | 3300053153 | Ga0500616_0001587 | Ga0500616_0001587_3249_4016 | 229 |
| 889 | 3300053153 | Ga0500616_0118939 | Ga0500616_0118939_145_861 | 229 |
| 890 | 3300053156 | Ga0500622_0001762 | Ga0500622_0001762_9327_10061 | 229 |
| 891 | 3300053156 | Ga0500622_0006755 | Ga0500622_0006755_973_1692 | 229 |
| 892 | 3300053156 | Ga0500622_0141881 | Ga0500622_0141881_59_787 | 229 |
| 893 | 3300053727 | Ga0500611_027584 | Ga0500611_027584_180_890 | 229 |
| 894 | 3300053730 | Ga0500645_000883 | Ga0500645_000883_2894_3649 | 229 |
| 895 | 3300053730 | Ga0500645_064013 | Ga0500645_064013_28_729 | 229 |
| 896 | 3300053731 | Ga0500609_000027 | Ga0500609_000027_10808_11563 | 229 |
| 897 | 3300053731 | Ga0500609_002135 | Ga0500609_002135_1952_2656 | 229 |
| 898 | 3300060353 | Ga0501082_0098486 | Ga0501082_0098486_354_1058 | 229 |
| 899 | 3300000652 | ARCol0yngRDRAFT_1002743 | ARCol0yngRDRAFT_10027433 | 230 |
| 900 | 3300001989 | JGI24739J22299_10082974 | JGI24739J22299_100829741 | 230 |
| 901 | 3300002077 | JGI24744J21845_10010918 | JGI24744J21845_100109182 | 230 |
| 902 | 3300002774 | JGI25150J39212_1001113 | JGI25150J39212_10011131 | 230 |
| 903 | 3300003214 | JGI25165J46597_1000007 | JGI25165J46597_1000007312 | 230 |
| 904 | 3300003215 | JGI25153J46596_10000253 | JGI25153J46596_1000025335 | 230 |
| 905 | 3300003771 | Ga0055526_1002472 | Ga0055526_10024726 | 230 |
| 906 | 3300003773 | Ga0055537_1000720 | Ga0055537_10007207 | 230 |
| 907 | 3300003773 | Ga0055537_1005264 | Ga0055537_10052643 | 230 |
| 908 | 3300003775 | Ga0055524_1000561 | Ga0055524_100056125 | 230 |
| 909 | 3300003791 | Ga0055530_10007674 | Ga0055530_100076743 | 230 |
| 910 | 3300003792 | Ga0055540_1003607 | Ga0055540_10036076 | 230 |
| 911 | 3300003794 | Ga0055531_10005338 | Ga0055531_100053383 | 230 |
| 912 | 3300003794 | Ga0055531_10036703 | Ga0055531_100367032 | 230 |
| 913 | 3300004625 | Ga0055543_1020464 | Ga0055543_10204641 | 230 |
| 914 | 3300005262 | Ga0065165_1001164 | Ga0065165_100116427 | 230 |
| 915 | 3300005262 | Ga0065165_1058454 | Ga0065165_10584541 | 230 |
| 916 | 3300005339 | Ga0070660_100019488 | Ga0070660_1000194882 | 230 |
| 917 | 3300005353 | Ga0070669_100765504 | Ga0070669_1007655041 | 230 |
| 918 | 3300005354 | Ga0070675_100134826 | Ga0070675_1001348263 | 230 |
| 919 | 3300005355 | Ga0070671_100067672 | Ga0070671_1000676722 | 230 |
| 920 | 3300005364 | Ga0070673_100334229 | Ga0070673_1003342292 | 230 |
| 921 | 3300005366 | Ga0070659_100036509 | Ga0070659_1000365094 | 230 |
| 922 | 3300005436 | Ga0070713_100222146 | Ga0070713_1002221462 | 230 |
| 923 | 3300005456 | Ga0070678_100010460 | Ga0070678_1000104606 | 230 |
| 924 | 3300005459 | Ga0068867_100276620 | Ga0068867_1002766201 | 230 |
| 925 | 3300005563 | Ga0068855_100298678 | Ga0068855_1002986782 | 230 |
| 926 | 3300005616 | Ga0068852_100000586 | Ga0068852_10000058610 | 230 |
| 927 | 3300005617 | Ga0068859_100005156 | Ga0068859_1000051567 | 230 |
| 928 | 3300005842 | Ga0068858_100009417 | Ga0068858_1000094172 | 230 |
| 929 | 3300005844 | Ga0068862_100015180 | Ga0068862_1000151803 | 230 |
| 930 | 3300005985 | Ga0081539_10073132 | Ga0081539_100731322 | 230 |
| 931 | 3300006038 | Ga0075365_10036163 | Ga0075365_100361634 | 230 |
| 932 | 3300006042 | Ga0075368_10003536 | Ga0075368_100035367 | 230 |
| 933 | 3300006048 | Ga0075363_100004455 | Ga0075363_1000044558 | 230 |
| 934 | 3300006051 | Ga0075364_10077984 | Ga0075364_100779842 | 230 |
| 935 | 3300006177 | Ga0075362_10021637 | Ga0075362_100216372 | 230 |
| 936 | 3300006178 | Ga0075367_10020984 | Ga0075367_100209843 | 230 |
| 937 | 3300006178 | Ga0075367_10037363 | Ga0075367_100373633 | 230 |
| 938 | 3300006186 | Ga0075369_10005108 | Ga0075369_100051084 | 230 |
| 939 | 3300006186 | Ga0075369_10238000 | Ga0075369_102380002 | 230 |
| 940 | 3300006353 | Ga0075370_10130135 | Ga0075370_101301352 | 230 |
| 941 | 3300006844 | Ga0075428_100150741 | Ga0075428_1001507413 | 230 |
| 942 | 3300006881 | Ga0068865_100480280 | Ga0068865_1004802802 | 230 |
| 943 | 3300006931 | Ga0097620_100005156 | Ga0097620_1000051567 | 230 |
| 944 | 3300009101 | Ga0105247_10503386 | Ga0105247_105033861 | 230 |
| 945 | 3300009147 | Ga0114129_10054829 | Ga0114129_100548293 | 230 |
| 946 | 3300009177 | Ga0105248_10001758 | Ga0105248_100017585 | 230 |
| 947 | 3300009545 | Ga0105237_10052574 | Ga0105237_100525745 | 230 |
| 948 | 3300009553 | Ga0105249_10179246 | Ga0105249_101792462 | 230 |
| 949 | 3300010159 | Ga0099796_10012567 | Ga0099796_100125672 | 230 |
| 950 | 3300010375 | Ga0105239_10851949 | Ga0105239_108519492 | 230 |
| 951 | 3300012512 | Ga0157327_1000745 | Ga0157327_10007452 | 230 |
| 952 | 3300013100 | Ga0157373_10079649 | Ga0157373_100796492 | 230 |
| 953 | 3300013307 | Ga0157372_10559346 | Ga0157372_105593462 | 230 |
| 954 | 3300014326 | Ga0157380_10122751 | Ga0157380_101227513 | 230 |
| 955 | 3300014326 | Ga0157380_10532302 | Ga0157380_105323021 | 230 |
| 956 | 3300014968 | Ga0157379_10067957 | Ga0157379_100679573 | 230 |
| 957 | 3300017792 | Ga0163161_10056570 | Ga0163161_100565702 | 230 |
| 958 | 3300025208 | Ga0209436_112907 | Ga0209436_1129072 | 230 |
| 959 | 3300025233 | Ga0209437_106743 | Ga0209437_1067431 | 230 |
| 960 | 3300025245 | Ga0207425_1000094 | Ga0207425_100009478 | 230 |
| 961 | 3300025245 | Ga0207425_1001939 | Ga0207425_10019393 | 230 |
| 962 | 3300025258 | Ga0209129_1001201 | Ga0209129_10012019 | 230 |
| 963 | 3300025261 | Ga0209233_1000026 | Ga0209233_1000026313 | 230 |
| 964 | 3300025263 | Ga0209565_1000007 | Ga0209565_1000007206 | 230 |
| 965 | 3300025263 | Ga0209565_1038534 | Ga0209565_10385341 | 230 |
| 966 | 3300025273 | Ga0209673_1001309 | Ga0209673_10013092 | 230 |
| 967 | 3300025292 | Ga0209676_1004805 | Ga0209676_10048057 | 230 |
| 968 | 3300025294 | Ga0209025_1000630 | Ga0209025_100063019 | 230 |
| 969 | 3300025295 | Ga0209564_1000745 | Ga0209564_10007454 | 230 |
| 970 | 3300025295 | Ga0209564_1008096 | Ga0209564_10080961 | 230 |
| 971 | 3300025297 | Ga0209758_1000002 | Ga0209758_100000278 | 230 |
| 972 | 3300025297 | Ga0209758_1000108 | Ga0209758_1000108139 | 230 |
| 973 | 3300025297 | Ga0209758_1000252 | Ga0209758_10002525 | 230 |
| 974 | 3300025297 | Ga0209758_1006552 | Ga0209758_10065522 | 230 |
| 975 | 3300025297 | Ga0209758_1021049 | Ga0209758_10210495 | 230 |
| 976 | 3300025297 | Ga0209758_1028026 | Ga0209758_10280263 | 230 |
| 977 | 3300025298 | Ga0209050_1000342 | Ga0209050_100034281 | 230 |
| 978 | 3300025298 | Ga0209050_1005517 | Ga0209050_10055175 | 230 |
| 979 | 3300025299 | Ga0209256_1000008 | Ga0209256_100000848 | 230 |
| 980 | 3300025303 | Ga0209051_1000226 | Ga0209051_100022678 | 230 |
| 981 | 3300025304 | Ga0209257_1003585 | Ga0209257_10035857 | 230 |
| 982 | 3300025304 | Ga0209257_1017346 | Ga0209257_10173464 | 230 |
| 983 | 3300025304 | Ga0209257_1019253 | Ga0209257_10192533 | 230 |
| 984 | 3300025914 | Ga0207671_10144019 | Ga0207671_101440192 | 230 |
| 985 | 3300025919 | Ga0207657_10013332 | Ga0207657_100133323 | 230 |
| 986 | 3300025924 | Ga0207694_10049968 | Ga0207694_100499682 | 230 |
| 987 | 3300025926 | Ga0207659_10015289 | Ga0207659_100152896 | 230 |
| 988 | 3300025926 | Ga0207659_10232512 | Ga0207659_102325122 | 230 |
| 989 | 3300025928 | Ga0207700_10197737 | Ga0207700_101977372 | 230 |
| 990 | 3300025941 | Ga0207711_10000852 | Ga0207711_100008525 | 230 |
| 991 | 3300025961 | Ga0207712_10234109 | Ga0207712_102341092 | 230 |
| 992 | 3300026035 | Ga0207703_10006205 | Ga0207703_100062058 | 230 |
| 993 | 3300026041 | Ga0207639_10286758 | Ga0207639_102867582 | 230 |
| 994 | 3300026116 | Ga0207674_10017443 | Ga0207674_100174433 | 230 |
| 995 | 3300026118 | Ga0207675_100537927 | Ga0207675_1005379271 | 230 |
| 996 | 3300026121 | Ga0207683_10149323 | Ga0207683_101493231 | 230 |
| 997 | 3300026142 | Ga0207698_10000294 | Ga0207698_1000029430 | 230 |
| 998 | 3300027907 | Ga0207428_10207164 | Ga0207428_102071642 | 230 |
| 999 | 3300028380 | Ga0268265_10023564 | Ga0268265_100235644 | 230 |
| 1000 | 3300028786 | Ga0307517_10176599 | Ga0307517_101765991 | 230 |
| 1001 | 3300031507 | Ga0307509_10541234 | Ga0307509_105412341 | 230 |
| 1002 | 3300031616 | Ga0307508_10001949 | Ga0307508_1000194912 | 230 |
| 1003 | 3300031616 | Ga0307508_10262591 | Ga0307508_102625912 | 230 |
| 1004 | 3300031730 | Ga0307516_10126728 | Ga0307516_101267283 | 230 |
| 1005 | 3300032004 | Ga0307414_10021121 | Ga0307414_100211215 | 230 |
| 1006 | 3300037466 | Ga0395898_0443901 | Ga0395898_0443901_390_1088 | 230 |
| 1007 | 3300037471 | Ga0395905_0050916 | Ga0395905_0050916_1247_1945 | 230 |
| 1008 | 3300037471 | Ga0395905_0070375 | Ga0395905_0070375_1333_2052 | 230 |
| 1009 | 3300037471 | Ga0395905_0078733 | Ga0395905_0078733_568_1266 | 230 |
| 1010 | 3300038443 | Ga0395901_0192446 | Ga0395901_0192446_195_887 | 230 |
| 1011 | 3300039437 | Ga0436365_0449154 | Ga0436365_0449154_612_1370 | 230 |
| 1012 | 3300041404 | Ga0439436_0018407 | Ga0439436_0018407_1163_1855 | 230 |
| 1013 | 3300041413 | Ga0439465_0006377 | Ga0439465_0006377_2237_2929 | 230 |
| 1014 | 3300041997 | Ga0439431_0000187 | Ga0439431_0000187_4097_4837 | 230 |
| 1015 | 3300041997 | Ga0439431_0010651 | Ga0439431_0010651_1075_1767 | 230 |
| 1016 | 3300042002 | Ga0439442_002393 | Ga0439442_002393_211_951 | 230 |
| 1017 | 3300042004 | Ga0439445_0000562 | Ga0439445_0000562_2423_3163 | 230 |
| 1018 | 3300042004 | Ga0439445_0069288 | Ga0439445_0069288_92_784 | 230 |
| 1019 | 3300042006 | Ga0439432_003177 | Ga0439432_003177_14_754 | 230 |
| 1020 | 3300042007 | Ga0439449_0053381 | Ga0439449_0053381_133_825 | 230 |
| 1021 | 3300042010 | Ga0439452_021467 | Ga0439452_021467_105_797 | 230 |
| 1022 | 3300042014 | Ga0439457_001532 | Ga0439457_001532_844_1536 | 230 |
| 1023 | 3300042121 | Ga0450919_010306 | Ga0450919_010306_22_714 | 230 |
| 1024 | 3300042125 | Ga0450923_017278 | Ga0450923_017278_383_1075 | 230 |
| 1025 | 3300042134 | Ga0450898_035919 | Ga0450898_035919_104_796 | 230 |
| 1026 | 3300042147 | Ga0450910_010396 | Ga0450910_010396_375_1067 | 230 |
| 1027 | 3300042156 | Ga0439446_0002031 | Ga0439446_0002031_3865_4605 | 230 |
| 1028 | 3300042435 | Ga0439434_0002604 | Ga0439434_0002604_954_1646 | 230 |
| 1029 | 3300042436 | Ga0439435_0012758 | Ga0439435_0012758_1310_2020 | 230 |
| 1030 | 3300044658 | Ga0466972_0010990 | Ga0466972_0010990_2896_3615 | 230 |
| 1031 | 3300044683 | Ga0466965_0031586 | Ga0466965_0031586_346_1065 | 230 |
| 1032 | 3300044684 | Ga0466966_0138559 | Ga0466966_0138559_223_942 | 230 |
| 1033 | 3300044693 | Ga0466961_0011581 | Ga0466961_0011581_155_874 | 230 |
| 1034 | 3300044694 | Ga0466963_0101375 | Ga0466963_0101375_765_1484 | 230 |
| 1035 | 3300044706 | Ga0466964_0013581 | Ga0466964_0013581_1814_2533 | 230 |
| 1036 | 3300044735 | Ga0466968_0029848 | Ga0466968_0029848_1189_1908 | 230 |
| 1037 | 3300044765 | Ga0466970_0004968 | Ga0466970_0004968_1984_2703 | 230 |
| 1038 | 3300044765 | Ga0466970_0099144 | Ga0466970_0099144_116_835 | 230 |
| 1039 | 3300044901 | Ga0466960_0374149 | Ga0466960_0374149_72_791 | 230 |
| 1040 | 3300045049 | Ga0466959_0099323 | Ga0466959_0099323_1314_2033 | 230 |
| 1041 | 3300045836 | Ga0466958_0000048 | Ga0466958_0000048_24898_25599 | 230 |
| 1042 | 3300045836 | Ga0466958_0057198 | Ga0466958_0057198_1398_2117 | 230 |
| 1043 | 3300046460 | Ga0495638_0293732 | Ga0495638_0293732_168_866 | 230 |
| 1044 | 3300046691 | Ga0495670_0000029 | Ga0495670_0000029_63037_63756 | 230 |
| 1045 | 3300047472 | Ga0495686_0156744 | Ga0495686_0156744_216_935 | 230 |
| 1046 | 3300048907 | Ga0496104_0001606 | Ga0496104_0001606_4502_5245 | 230 |
| 1047 | 3300048907 | Ga0496104_0001863 | Ga0496104_0001863_12115_12843 | 230 |
| 1048 | 3300048908 | Ga0496105_0008691 | Ga0496105_0008691_1685_2428 | 230 |
| 1049 | 3300048911 | Ga0496108_0205223 | Ga0496108_0205223_258_986 | 230 |
| 1050 | 3300048915 | Ga0496112_0908806 | Ga0496112_0908806_15_743 | 230 |
| 1051 | 3300048917 | Ga0496114_0656583 | Ga0496114_0656583_63_806 | 230 |
| 1052 | 3300048928 | Ga0496125_0242362 | Ga0496125_0242362_156_875 | 230 |
| 1053 | 3300049571 | Ga0501034_0099688 | Ga0501034_0099688_2111_2827 | 230 |
| 1054 | 3300049573 | Ga0501037_0190511 | Ga0501037_0190511_392_1111 | 230 |
| 1055 | 3300049574 | Ga0501038_0247921 | Ga0501038_0247921_650_1369 | 230 |
| 1056 | 3300049581 | Ga0501047_0458913 | Ga0501047_0458913_198_920 | 230 |
| 1057 | 3300049586 | Ga0501070_0073648 | Ga0501070_0073648_1105_1827 | 230 |
| 1058 | 3300049589 | Ga0501073_0065517 | Ga0501073_0065517_1126_1848 | 230 |
| 1059 | 3300049590 | Ga0501074_0259375 | Ga0501074_0259375_66_830 | 230 |
| 1060 | 3300049742 | Ga0501080_0055199 | Ga0501080_0055199_830_1546 | 230 |
| 1061 | 3300049742 | Ga0501080_0084313 | Ga0501080_0084313_1275_1997 | 230 |
| 1062 | 3300049758 | Ga0501241_006927 | Ga0501241_006927_70_774 | 230 |
| 1063 | 3300049823 | Ga0501044_0100473 | Ga0501044_0100473_1470_2186 | 230 |
| 1064 | 3300049823 | Ga0501044_0286077 | Ga0501044_0286077_176_898 | 230 |
| 1065 | 3300050490 | nmdc:mga03n38_3129_c1 | nmdc:mga03n38_3129_c1_4365_5102 | 230 |
| 1066 | 3300050491 | nmdc:mga00v17_51403_c1 | nmdc:mga00v17_51403_c1_709_1446 | 230 |
| 1067 | 3300050491 | nmdc:mga00v17_59417_c1 | nmdc:mga00v17_59417_c1_1228_1929 | 230 |
| 1068 | 3300050491 | nmdc:mga00v17_69035_c1 | nmdc:mga00v17_69035_c1_385_1083 | 230 |
| 1069 | 3300050492 | nmdc:mga0yw44_23081_c1 | nmdc:mga0yw44_23081_c1_239_940 | 230 |
| 1070 | 3300050493 | nmdc:mga0k408_14464_c1 | nmdc:mga0k408_14464_c1_1714_2451 | 230 |
| 1071 | 3300050494 | nmdc:mga06z11_138892_c1 | nmdc:mga06z11_138892_c1_617_1315 | 230 |
| 1072 | 3300050494 | nmdc:mga06z11_4688_c1 | nmdc:mga06z11_4688_c1_2217_2918 | 230 |
| 1073 | 3300050495 | nmdc:mga04h51_98496_c1 | nmdc:mga04h51_98496_c1_39_734 | 230 |
| 1074 | 3300050496 | nmdc:mga07m45_32567_c1 | nmdc:mga07m45_32567_c1_1531_2268 | 230 |
| 1075 | 3300050507 | nmdc:mga05p37_650235_c1 | nmdc:mga05p37_650235_c1_324_1064 | 230 |
| 1076 | 3300050516 | nmdc:mga0sz30_2586_c1 | nmdc:mga0sz30_2586_c1_3827_4528 | 230 |
| 1077 | 3300053086 | Ga0500578_0193464 | Ga0500578_0193464_479_1228 | 230 |
| 1078 | 3300053087 | Ga0500643_010845 | Ga0500643_010845_2656_3348 | 230 |
| 1079 | 3300053093 | Ga0500651_0014869 | Ga0500651_0014869_3521_4270 | 230 |
| 1080 | 3300053094 | Ga0500566_0003780 | Ga0500566_0003780_3692_4384 | 230 |
| 1081 | 3300053096 | Ga0500641_0054141 | Ga0500641_0054141_138_830 | 230 |
| 1082 | 3300053108 | Ga0500562_016473 | Ga0500562_016473_1061_1762 | 230 |
| 1083 | 3300053119 | Ga0500595_000553 | Ga0500595_000553_17642_18367 | 230 |
| 1084 | 3300053130 | Ga0500642_0133221 | Ga0500642_0133221_21_722 | 230 |
| 1085 | 3300053131 | Ga0500652_011638 | Ga0500652_011638_867_1583 | 230 |
| 1086 | 3300053131 | Ga0500652_083744 | Ga0500652_083744_55_756 | 230 |
| 1087 | 3300053134 | Ga0500658_0000793 | Ga0500658_0000793_8516_9208 | 230 |
| 1088 | 3300053134 | Ga0500658_0001085 | Ga0500658_0001085_9069_9761 | 230 |
| 1089 | 3300053134 | Ga0500658_0165245 | Ga0500658_0165245_140_904 | 230 |
| 1090 | 3300053139 | Ga0500568_0005756 | Ga0500568_0005756_4645_5337 | 230 |
| 1091 | 3300053139 | Ga0500568_0016371 | Ga0500568_0016371_1921_2685 | 230 |
| 1092 | 3300053139 | Ga0500568_0049176 | Ga0500568_0049176_784_1548 | 230 |
| 1093 | 3300053139 | Ga0500568_0084110 | Ga0500568_0084110_71_787 | 230 |
| 1094 | 3300053146 | Ga0500588_0059114 | Ga0500588_0059114_133_897 | 230 |
| 1095 | 3300053156 | Ga0500622_0001006 | Ga0500622_0001006_14767_15465 | 230 |
| 1096 | 3300054114 | Ga0501084_0254685 | Ga0501084_0254685_338_1060 | 230 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4hob-assembly2.cif.gz_C | the crystal structure of the zalpha domain from cyprinid herpes virus 3 | 0.9176 | 4 | 48 |
| 4hob-assembly1.cif.gz_A | the crystal structure of the zalpha domain from cyprinid herpes virus 3 | 0.9095 | 4 | 48 |
| 5way-assembly1.cif.gz_B | mgaspn protein, mga regulator from streptococcus pneumoniae | 0.8969 | 2 | 52 |
| 3f72-assembly3.cif.gz_E | crystal structure of the staphylococcus aureus pi258 cadc metal binding site 2 mutant | 0.8852 | 6 | 61 |
| 8fi3-assembly1.cif.gz_B | bifunctional ligase/repressor bira from klebsiella pneumoniae complexed with biotin (domain swapped dimer) | 0.885 | 6 | 61 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4a0yA01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9473 | 1 | 45 | 1.10.10.10 |
| 3v7sA01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9456 | 5 | 62 | 1.10.10.10 |
| af_Q2G258_1_64_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9359 | 7 | 62 | 1.10.10.10 |
| 4a12C01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9277 | 1 | 45 | 1.10.10.10 |
| 1j5yA01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9275 | 3 | 64 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7X3MD42-F1-model_v4 | WYL domain-containing protein | 0.942 | 136 | 212 |
|
| AF-A0A3D2X3X3-F1-model_v4 | YafY family transcriptional regulator | 0.9318 | 138 | 201 |
|
| AF-Q1WLE7-F1-model_v4 | WYL domain-containing protein | 0.9241 | 137 | 223 |
|
| AF-A0A1F6PI14-F1-model_v4 | WYL domain-containing protein | 0.9214 | 138 | 212 |
|
| AF-A0A2N2DEY2-F1-model_v4 | WYL domain-containing protein | 0.9205 | 138 | 212 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar