F489989

General Info

Members Datasets Scaffolds Average Seq Length
1096 483 1039 235

Family's Representative Sequence

Representative Sequence 3300046506|Ga0495583_0000001|Ga0495583_0000001_517596_518423
Length 275
Sequence MVVSPQGASVAVATFGRYRHPAASMLSASVQHSEAMRRAERLFQIIQILRRSRQPVTADAMAAELETSKRSVYRDIAALIGQRAPIRGEAGVGYVLEAGYDMPPLMLTPDEIEAAVLGAQWVAGRGDPVLATAANDLIAKIAAAVPEELRPYVLRPATEAARAWKALPDGLDIAQARAWIHAGRKIRLDYRDEKGAVSQRVVWPVTVGYLETVRLLVAWCELRGDFRHFRTDRVEHAEFLDERHGQRPGALRARWERALEEERQRWLANNPGAGC

Samples

Sample ID Description Type Environment
1 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
2 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
3 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
4 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
5 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
6 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
7 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
8 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
9 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
10 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
11 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
12 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
13 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
14 2643221583 Caulobacter sp. Root655 Isolate Unclassified
15 2643221584 Caulobacter sp. Root656 Isolate Unclassified
16 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
17 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
18 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
19 2643221640 Caulobacter sp. Root342 Isolate Unclassified
20 2643221642 Caulobacter sp. Root343 Isolate Unclassified
21 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
22 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
23 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
24 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
25 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
26 2818991435 Caulobacter henricii 536 Isolate Unclassified
27 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
28 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
29 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
30 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
31 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
32 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
33 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
34 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
35 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
36 2849560528 Caulobacter zeae 410 Isolate Unclassified
37 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
38 2851153111 Caulobacter radicis 736 Isolate Unclassified
39 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
40 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
41 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
42 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
43 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
44 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
45 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
46 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
47 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
48 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
49 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
50 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
51 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
52 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
53 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
54 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
55 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
56 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
57 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
58 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
59 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
60 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
61 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
62 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
63 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
64 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
65 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
66 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
67 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
68 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
69 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
70 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
71 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
72 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
73 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
74 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
75 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
76 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
77 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
78 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
79 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
80 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
81 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
82 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
83 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
84 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
85 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
86 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
87 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
88 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
89 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
90 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
91 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
92 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
93 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
94 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
95 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
96 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
97 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
98 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
99 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
100 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
101 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
102 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
103 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
104 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
105 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
106 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
107 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
108 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
109 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
110 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
111 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
112 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
113 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
114 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
115 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
116 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
117 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
118 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
119 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
120 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
121 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
122 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
123 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
124 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
125 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
126 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
127 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
128 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
129 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
130 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
131 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
132 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
133 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
134 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
135 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
136 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
137 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
138 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
139 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
140 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
141 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
142 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
143 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
144 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
145 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
146 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
147 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
148 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
149 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
150 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
151 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
152 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
153 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
154 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
155 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
156 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
157 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
158 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
159 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
160 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
161 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
162 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
163 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
164 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
165 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
166 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
167 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
168 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
169 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
170 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
171 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
172 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
173 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
174 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
175 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
176 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
177 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
178 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
179 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
180 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
181 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
182 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
183 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
184 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
185 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
186 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
187 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
188 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
189 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
236 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
240 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
241 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
242 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
243 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
244 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
245 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
246 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
247 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
248 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
249 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
250 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
251 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
252 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
253 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
254 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
255 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
256 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
257 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
258 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
259 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
260 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
261 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
262 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
263 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
264 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
265 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
266 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
267 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
268 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
269 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
270 3300036458 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
271 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
272 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
273 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
274 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
275 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
276 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
277 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
278 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
279 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
280 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
281 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
282 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
283 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
284 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
285 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
286 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
287 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
288 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
289 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
290 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
291 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
292 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
293 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
294 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
295 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
296 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
297 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
298 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
299 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
300 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
301 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
302 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
303 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
304 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
305 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
306 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
307 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
308 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
309 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
310 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
311 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
312 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
313 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
314 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
315 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
316 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
317 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
318 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
319 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
320 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
321 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
322 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
323 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
324 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
325 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
326 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
327 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
328 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
329 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
330 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
331 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
332 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
333 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
334 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
335 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
336 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
337 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
338 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
339 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
340 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
341 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
342 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
343 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
344 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
345 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
346 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
347 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
348 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
349 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
350 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
351 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
352 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
353 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
354 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
355 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
356 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
357 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
358 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
359 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
360 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
361 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
362 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
363 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
364 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
365 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
366 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
367 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
368 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
369 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
370 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
371 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
372 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
373 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
374 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
375 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
376 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
377 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
378 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
379 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
380 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
381 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
382 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
383 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
384 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
385 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
386 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
387 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
388 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
389 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
390 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
391 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
392 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
393 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
394 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
395 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
396 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
397 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
398 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
399 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
400 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
401 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
402 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
403 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
404 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
405 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
406 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
407 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
408 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
409 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
410 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
411 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
412 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
413 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
414 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
415 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
416 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
417 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
418 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
419 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
420 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
421 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
422 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
423 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
424 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
425 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
426 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
427 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
428 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
429 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
430 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
431 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
432 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
433 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
434 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
435 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
436 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
437 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
438 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
439 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
440 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
441 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
442 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
443 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
444 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
445 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
446 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
447 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
448 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
449 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
450 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
451 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
452 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
453 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
454 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
455 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
456 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
457 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
458 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
459 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
460 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
461 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
462 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
463 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
464 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
465 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
466 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
467 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
468 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
469 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
470 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
471 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
472 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
473 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
474 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
475 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
476 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
477 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
478 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
479 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
480 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
481 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
482 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
483 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 94.71
Metatranscriptomes 0.09
Isolates 5.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 26
Nodule 1.37
Rhizoplane 2.65
Rhizosphere 58.39
Stem 0
Stem Tuber 0
Unclassified 11.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 ARCol0yngRDRAFT_1002743 3300000652 Bacteria 1313
2 JGI24739J22299_10082974 3300001989 Bacteria 982
3 JGI24737J22298_10001157 3300001990 Bacteria 9276
4 JGI24737J22298_10002048 3300001990 Bacteria 7217
5 JGI24737J22298_10006756 3300001990 Bacteria 3899
6 JGI24735J21928_10004802 3300002067 Bacteria 4513
7 JGI24735J21928_10011300 3300002067 Bacteria 2834
8 JGI24735J21928_10017522 3300002067 Bacteria 2215
9 JGI24735J21928_10031649 3300002067 Bacteria 1568
10 JGI24744J21845_10010918 3300002077 Bacteria 1859
11 JGI25150J39212_1001113 3300002774 Bacteria 8088
12 JGI25406J46586_10000513 3300003203 Bacteria 18124
13 JGI25165J46597_1000007 3300003214 Bacteria 518996
14 JGI25165J46597_1000165 3300003214 Bacteria 104009
15 JGI25153J46596_10000103 3300003215 Bacteria 96279
16 JGI25153J46596_10000253 3300003215 Bacteria 43821
17 JGI25153J46596_10000301 3300003215 Bacteria 36933
18 rootL2_10056079 3300003322 Bacteria 6635
19 rootL2_10085247 3300003322 Bacteria 2074
20 rootL2_10136953 3300003322 Bacteria 1186
21 JGI25160J50197_1002871 3300003354 Bacteria 7885
22 Ga0055526_1002472 3300003771 Bacteria 12489
23 Ga0055526_1023389 3300003771 Bacteria 2064
24 Ga0055526_1030086 3300003771 Bacteria 1593
25 Ga0055526_1046549 3300003771 Bacteria 1026
26 Ga0055537_1000720 3300003773 Bacteria 17131
27 Ga0055537_1001200 3300003773 Bacteria 10985
28 Ga0055537_1005264 3300003773 Bacteria 3507
29 Ga0055524_1000561 3300003775 Bacteria 27893
30 Ga0055524_1010000 3300003775 Bacteria 3811
31 Ga0055524_1051165 3300003775 Bacteria 935
32 Ga0055536_1000883 3300003781 Bacteria 19500
33 Ga0055536_1001272 3300003781 Bacteria 15547
34 Ga0055528_1007152 3300003790 Bacteria 4977
35 Ga0055530_10001417 3300003791 Bacteria 17611
36 Ga0055530_10007674 3300003791 Bacteria 4491
37 Ga0055530_10034337 3300003791 Bacteria 1297
38 Ga0055540_1003607 3300003792 Bacteria 7388
39 Ga0055531_10000274 3300003794 Bacteria 53225
40 Ga0055531_10001047 3300003794 Bacteria 21808
41 Ga0055531_10005338 3300003794 Bacteria 7540
42 Ga0055531_10022251 3300003794 Bacteria 2423
43 Ga0055531_10036703 3300003794 Bacteria 1505
44 Ga0055543_1020464 3300004625 Bacteria 1215
45 Ga0065165_1000256 3300005262 Bacteria 92230
46 Ga0065165_1001164 3300005262 Bacteria 30599
47 Ga0065165_1001167 3300005262 Bacteria 30545
48 Ga0065165_1004950 3300005262 Bacteria 7841
49 Ga0065165_1032813 3300005262 Bacteria 1623
50 Ga0065165_1058454 3300005262 Bacteria 1065
51 Ga0070658_10004018 3300005327 Bacteria 12053
52 Ga0070658_10004565 3300005327 Bacteria 11251
53 Ga0070658_10212129 3300005327 Bacteria 1636
54 Ga0070676_10000416 3300005328 Bacteria 20088
55 Ga0070670_100205126 3300005331 Bacteria 1713
56 Ga0068869_100015254 3300005334 Bacteria 5150
57 Ga0070666_10186306 3300005335 Bacteria 1457
58 Ga0070680_100017794 3300005336 Bacteria 5606
59 Ga0070682_100202918 3300005337 Bacteria 1400
60 Ga0070682_100208451 3300005337 Bacteria 1384
61 Ga0068868_100000013 3300005338 Bacteria 110536
62 Ga0068868_100667725 3300005338 Bacteria 927
63 Ga0070660_100002444 3300005339 Bacteria 12761
64 Ga0070660_100003692 3300005339 Bacteria 10562
65 Ga0070660_100019488 3300005339 Bacteria 4972
66 Ga0070660_100033044 3300005339 Bacteria 3897
67 Ga0070660_100204054 3300005339 Bacteria 1604
68 Ga0070660_100625404 3300005339 Bacteria 901
69 Ga0070661_100097802 3300005344 Bacteria 2180
70 Ga0070661_100188955 3300005344 Bacteria 1570
71 Ga0070668_100019990 3300005347 Bacteria 5049
72 Ga0070669_100765504 3300005353 Bacteria 819
73 Ga0070675_100134826 3300005354 Bacteria 2107
74 Ga0070671_100067672 3300005355 Bacteria 2978
75 Ga0070673_100000002 3300005364 Bacteria 225084
76 Ga0070673_100334229 3300005364 Bacteria 1341
77 Ga0070659_100003649 3300005366 Bacteria 10967
78 Ga0070659_100036509 3300005366 Bacteria 3831
79 Ga0070659_100077774 3300005366 Bacteria 2646
80 Ga0070659_100148389 3300005366 Bacteria 1912
81 Ga0070709_10003406 3300005434 Bacteria 8539
82 Ga0070709_10020120 3300005434 Bacteria 3868
83 Ga0070709_10045772 3300005434 Bacteria 2718
84 Ga0070714_100226508 3300005435 Bacteria 1721
85 Ga0070713_100010463 3300005436 Bacteria 6700
86 Ga0070713_100071899 3300005436 Bacteria 2925
87 Ga0070713_100222146 3300005436 Bacteria 1714
88 Ga0070713_100287196 3300005436 Bacteria 1511
89 Ga0070710_10025371 3300005437 Bacteria 3139
90 Ga0070711_100001130 3300005439 Bacteria 14272
91 Ga0070711_100002277 3300005439 Bacteria 10885
92 Ga0070711_100452971 3300005439 Bacteria 1051
93 Ga0070663_100572479 3300005455 Bacteria 947
94 Ga0070678_100010460 3300005456 Bacteria 5671
95 Ga0070662_100159029 3300005457 Bacteria 1766
96 Ga0070681_10006411 3300005458 Bacteria 11447
97 Ga0070681_10049606 3300005458 Bacteria 4191
98 Ga0070681_10087304 3300005458 Bacteria 3072
99 Ga0068867_100000012 3300005459 Bacteria 118831
100 Ga0068867_100276620 3300005459 Bacteria 1375
101 Ga0070706_100052063 3300005467 Bacteria 3780
102 Ga0070707_100092451 3300005468 Bacteria 2929
103 Ga0070679_100117260 3300005530 Bacteria 2647
104 Ga0070684_100001671 3300005535 Bacteria 16123
105 Ga0070697_100118434 3300005536 Bacteria 2213
106 Ga0068853_100009612 3300005539 Bacteria 7791
107 Ga0068853_100041194 3300005539 Bacteria 3943
108 Ga0068853_100470288 3300005539 Bacteria 1184
109 Ga0070693_100020120 3300005547 Bacteria 3514
110 Ga0070665_100001299 3300005548 Bacteria 29894
111 Ga0070665_100154706 3300005548 Bacteria 2295
112 Ga0070665_100174582 3300005548 Bacteria 2150
113 Ga0070665_100203709 3300005548 Bacteria 1979
114 Ga0070665_100535622 3300005548 Bacteria 1183
115 Ga0068855_100000095 3300005563 Bacteria 106561
116 Ga0068855_100071449 3300005563 Bacteria 4036
117 Ga0068855_100298678 3300005563 Bacteria 1784
118 Ga0068855_100498496 3300005563 Bacteria 1323
119 Ga0068857_100013087 3300005577 Bacteria 7230
120 Ga0068857_100021147 3300005577 Bacteria 5725
121 Ga0068857_100163281 3300005577 Bacteria 2022
122 Ga0068856_100000137 3300005614 Bacteria 73762
123 Ga0068856_100016744 3300005614 Bacteria 7101
124 Ga0068856_100345247 3300005614 Bacteria 1507
125 Ga0068852_100000586 3300005616 Bacteria 23996
126 Ga0068852_100088449 3300005616 Bacteria 2767
127 Ga0068859_100005156 3300005617 Bacteria 13269
128 Ga0068864_100007001 3300005618 Bacteria 9253
129 Ga0068866_10071782 3300005718 Bacteria 1832
130 Ga0068861_100207079 3300005719 Bacteria 1650
131 Ga0068851_10024349 3300005834 Bacteria 2963
132 Ga0068863_100025840 3300005841 Bacteria 5602
133 Ga0068863_100359835 3300005841 Bacteria 1418
134 Ga0068858_100000771 3300005842 Bacteria 33416
135 Ga0068858_100009417 3300005842 Bacteria 9320
136 Ga0068858_100242087 3300005842 Bacteria 1712
137 Ga0068860_100000313 3300005843 Bacteria 66545
138 Ga0068860_101020018 3300005843 Bacteria 846
139 Ga0068862_100015180 3300005844 Bacteria 6396
140 Ga0068862_100015872 3300005844 Bacteria 6258
141 Ga0081455_10002424 3300005937 Bacteria 22245
142 Ga0081455_10017304 3300005937 Bacteria 6918
143 Ga0081540_1024929 3300005983 Bacteria 3458
144 Ga0081540_1028527 3300005983 Bacteria 3132
145 Ga0081540_1059623 3300005983 Bacteria 1831
146 Ga0081540_1072041 3300005983 Bacteria 1594
147 Ga0081540_1142003 3300005983 Bacteria 962
148 Ga0081539_10000801 3300005985 Bacteria 61178
149 Ga0081539_10073132 3300005985 Bacteria 1830
150 Ga0075365_10036163 3300006038 Bacteria 3199
151 Ga0075365_10055263 3300006038 Bacteria 2634
152 Ga0075365_10164151 3300006038 Bacteria 1549
153 Ga0075365_10238357 3300006038 Bacteria 1277
154 Ga0075368_10003536 3300006042 Bacteria 5233
155 Ga0075363_100004455 3300006048 Bacteria 6132
156 Ga0075364_10012640 3300006051 Bacteria 5171
157 Ga0075364_10077984 3300006051 Bacteria 2187
158 Ga0075364_10520688 3300006051 Bacteria 813
159 Ga0070712_100009825 3300006175 Bacteria 6031
160 Ga0075362_10021637 3300006177 Bacteria 2702
161 Ga0075367_10020984 3300006178 Bacteria 3645
162 Ga0075367_10037363 3300006178 Bacteria 2821
163 Ga0075367_10039353 3300006178 Bacteria 2756
164 Ga0075369_10004680 3300006186 Bacteria 5076
165 Ga0075369_10005108 3300006186 Bacteria 4887
166 Ga0075369_10009026 3300006186 Bacteria 3859
167 Ga0075369_10106555 3300006186 Bacteria 1261
168 Ga0075369_10120009 3300006186 Bacteria 1190
169 Ga0075369_10238000 3300006186 Bacteria 844
170 Ga0075366_10008146 3300006195 Bacteria 5815
171 Ga0075366_10086221 3300006195 Bacteria 1878
172 Ga0075366_10161131 3300006195 Bacteria 1359
173 Ga0097621_100061585 3300006237 Bacteria 3078
174 Ga0097621_100144761 3300006237 Bacteria 2034
175 Ga0097621_100872561 3300006237 Bacteria 837
176 Ga0075370_10130135 3300006353 Bacteria 1468
177 Ga0075370_10169650 3300006353 Bacteria 1282
178 Ga0075370_10297882 3300006353 Bacteria 959
179 Ga0075428_100150741 3300006844 Bacteria 2526
180 Ga0075434_100023401 3300006871 Bacteria 6020
181 Ga0068865_100000004 3300006881 Bacteria 226236
182 Ga0068865_100480280 3300006881 Bacteria 1033
183 Ga0097620_100005156 3300006931 Bacteria 13269
184 Ga0075435_100411755 3300007076 Bacteria 1164
185 Ga0099794_10061546 3300007265 Bacteria 1824
186 Ga0099795_10001129 3300007788 Bacteria 5569
187 Ga0099795_10005962 3300007788 Bacteria 3288
188 Ga0099795_10067502 3300007788 Bacteria 1342
189 Ga0105240_10002463 3300009093 Bacteria 29749
190 Ga0105240_10033307 3300009093 Bacteria 6659
191 Ga0105240_10064674 3300009093 Bacteria 4544
192 Ga0105240_10071475 3300009093 Bacteria 4291
193 Ga0105240_10086052 3300009093 Bacteria 3850
194 Ga0105240_10298611 3300009093 Bacteria 1843
195 Ga0105240_10323474 3300009093 Bacteria 1757
196 Ga0105245_10001027 3300009098 Bacteria 25355
197 Ga0105245_10003725 3300009098 Bacteria 13583
198 Ga0105245_11027269 3300009098 Bacteria 869
199 Ga0105247_10043425 3300009101 Bacteria 2754
200 Ga0105247_10503386 3300009101 Bacteria 883
201 Ga0114129_10054829 3300009147 Bacteria 5588
202 Ga0105243_10000146 3300009148 Bacteria 81008
203 Ga0105242_10000497 3300009176 Bacteria 31053
204 Ga0105248_10001758 3300009177 Bacteria 24108
205 Ga0105248_10007949 3300009177 Bacteria 11658
206 Ga0105248_10042051 3300009177 Bacteria 5125
207 Ga0105248_10047211 3300009177 Bacteria 4829
208 Ga0105248_10347630 3300009177 Bacteria 1669
209 Ga0105237_10052574 3300009545 Bacteria 4088
210 Ga0105237_10053748 3300009545 Bacteria 4039
211 Ga0105237_10054084 3300009545 Bacteria 4023
212 Ga0105237_10133176 3300009545 Bacteria 2480
213 Ga0105238_10006268 3300009551 Bacteria 11820
214 Ga0105238_10022426 3300009551 Bacteria 6435
215 Ga0105238_10225558 3300009551 Bacteria 1850
216 Ga0105249_10015630 3300009553 Bacteria 6720
217 Ga0105249_10157228 3300009553 Bacteria 2193
218 Ga0105249_10179246 3300009553 Bacteria 2060
219 Ga0099796_10012567 3300010159 Bacteria 2395
220 Ga0105239_10017503 3300010375 Bacteria 7926
221 Ga0105239_10216274 3300010375 Bacteria 2149
222 Ga0105239_10851949 3300010375 Bacteria 1045
223 Ga0105246_10000138 3300011119 Bacteria 33809
224 Ga0157327_1000745 3300012512 Bacteria 1841
225 Ga0157373_10079649 3300013100 Bacteria 2311
226 Ga0157370_10000096 3300013104 Bacteria 99163
227 Ga0157370_10274931 3300013104 Bacteria 1556
228 Ga0157369_10018692 3300013105 Bacteria 7770
229 Ga0157369_10022918 3300013105 Bacteria 6962
230 Ga0157369_10053822 3300013105 Bacteria 4348
231 Ga0157374_10001104 3300013296 Bacteria 23221
232 Ga0157378_10015726 3300013297 Bacteria 6625
233 Ga0157378_10091415 3300013297 Bacteria 2767
234 Ga0163162_10004509 3300013306 Bacteria 13410
235 Ga0163162_10026231 3300013306 Bacteria 5759
236 Ga0163162_11080978 3300013306 Bacteria 908
237 Ga0157372_10034063 3300013307 Bacteria 5596
238 Ga0157372_10067956 3300013307 Bacteria 4006
239 Ga0157372_10294884 3300013307 Bacteria 1886
240 Ga0157372_10559346 3300013307 Bacteria 1333
241 Ga0157375_10000587 3300013308 Bacteria 32327
242 Ga0163163_10018900 3300014325 Bacteria 6465
243 Ga0163163_10089709 3300014325 Bacteria 3087
244 Ga0163163_10557376 3300014325 Bacteria 1209
245 Ga0157380_10122751 3300014326 Bacteria 2203
246 Ga0157380_10532302 3300014326 Bacteria 1149
247 Ga0182008_10154201 3300014497 Bacteria 1153
248 Ga0157379_10014381 3300014968 Bacteria 6944
249 Ga0157379_10027684 3300014968 Bacteria 5046
250 Ga0157379_10033261 3300014968 Bacteria 4598
251 Ga0157379_10067957 3300014968 Bacteria 3186
252 Ga0157379_10199431 3300014968 Bacteria 1809
253 Ga0157376_10000131 3300014969 Bacteria 51790
254 Ga0163161_10056570 3300017792 Bacteria 2849
255 Ga0213872_10070428 3300021361 Bacteria 1577
256 Ga0213876_10000345 3300021384 Bacteria 40189
257 Ga0213876_10038689 3300021384 Bacteria 2518
258 Ga0209436_112907 3300025208 Bacteria 1395
259 Ga0209437_106743 3300025233 Bacteria 1899
260 Ga0207425_1000094 3300025245 Bacteria 85629
261 Ga0207425_1001939 3300025245 Bacteria 7787
262 Ga0209026_1001831 3300025250 Bacteria 8716
263 Ga0209677_102422 3300025253 Bacteria 7047
264 Ga0209148_1000074 3300025254 Bacteria 314356
265 Ga0209148_1001194 3300025254 Bacteria 14881
266 Ga0209129_1001201 3300025258 Bacteria 14903
267 Ga0209233_1000026 3300025261 Bacteria 678466
268 Ga0209233_1000098 3300025261 Bacteria 294111
269 Ga0209233_1002344 3300025261 Bacteria 7057
270 Ga0209565_1000007 3300025263 Bacteria 784361
271 Ga0209565_1000618 3300025263 Bacteria 23421
272 Ga0209565_1038534 3300025263 Bacteria 899
273 Ga0209455_1000574 3300025272 Bacteria 24064
274 Ga0209455_1002785 3300025272 Bacteria 6531
275 Ga0209455_1013949 3300025272 Bacteria 1841
276 Ga0209455_1016958 3300025272 Bacteria 1545
277 Ga0209455_1036672 3300025272 Bacteria 778
278 Ga0209673_1000722 3300025273 Bacteria 45860
279 Ga0209673_1001309 3300025273 Bacteria 25209
280 Ga0209673_1016536 3300025273 Bacteria 2753
281 Ga0209673_1027785 3300025273 Bacteria 1834
282 Ga0209676_1000243 3300025292 Bacteria 117113
283 Ga0209676_1000311 3300025292 Bacteria 95478
284 Ga0209676_1004805 3300025292 Bacteria 7338
285 Ga0209025_1000630 3300025294 Bacteria 62487
286 Ga0209564_1000713 3300025295 Bacteria 48301
287 Ga0209564_1000718 3300025295 Bacteria 47576
288 Ga0209564_1000745 3300025295 Bacteria 46163
289 Ga0209564_1003160 3300025295 Bacteria 11595
290 Ga0209564_1006871 3300025295 Bacteria 6001
291 Ga0209564_1008096 3300025295 Bacteria 5260
292 Ga0209564_1009741 3300025295 Bacteria 4522
293 Ga0209564_1032344 3300025295 Bacteria 1578
294 Ga0209758_1000002 3300025297 Bacteria 1400310
295 Ga0209758_1000015 3300025297 Bacteria 851943
296 Ga0209758_1000108 3300025297 Bacteria 216541
297 Ga0209758_1000239 3300025297 Bacteria 114761
298 Ga0209758_1000252 3300025297 Bacteria 108214
299 Ga0209758_1001566 3300025297 Bacteria 26231
300 Ga0209758_1001570 3300025297 Bacteria 26195
301 Ga0209758_1004632 3300025297 Bacteria 11268
302 Ga0209758_1006280 3300025297 Bacteria 8638
303 Ga0209758_1006552 3300025297 Bacteria 8293
304 Ga0209758_1021049 3300025297 Bacteria 3057
305 Ga0209758_1022902 3300025297 Bacteria 2844
306 Ga0209758_1026731 3300025297 Bacteria 2488
307 Ga0209758_1028026 3300025297 Bacteria 2393
308 Ga0209050_1000244 3300025298 Bacteria 117105
309 Ga0209050_1000342 3300025298 Bacteria 92644
310 Ga0209050_1000375 3300025298 Bacteria 84503
311 Ga0209050_1005517 3300025298 Bacteria 7905
312 Ga0209050_1011876 3300025298 Bacteria 4069
313 Ga0209050_1014540 3300025298 Bacteria 3381
314 Ga0209256_1000008 3300025299 Bacteria 975723
315 Ga0209256_1001119 3300025299 Bacteria 30656
316 Ga0209256_1002155 3300025299 Bacteria 16982
317 Ga0209256_1002592 3300025299 Bacteria 14393
318 Ga0209256_1008041 3300025299 Bacteria 4993
319 Ga0209256_1010559 3300025299 Bacteria 3842
320 Ga0207426_1000217 3300025302 Bacteria 136180
321 Ga0207426_1000368 3300025302 Bacteria 79715
322 Ga0207426_1016643 3300025302 Bacteria 2633
323 Ga0209051_1000226 3300025303 Bacteria 94990
324 Ga0209051_1003593 3300025303 Bacteria 10081
325 Ga0209257_1000066 3300025304 Bacteria 344166
326 Ga0209257_1000140 3300025304 Bacteria 201515
327 Ga0209257_1001119 3300025304 Bacteria 34613
328 Ga0209257_1002989 3300025304 Bacteria 15349
329 Ga0209257_1003585 3300025304 Bacteria 13127
330 Ga0209257_1004459 3300025304 Bacteria 10837
331 Ga0209257_1017346 3300025304 Bacteria 2843
332 Ga0209257_1019253 3300025304 Bacteria 2579
333 Ga0209257_1023078 3300025304 Bacteria 2199
334 Ga0207692_10092668 3300025898 Bacteria 1642
335 Ga0207642_10150907 3300025899 Bacteria 1237
336 Ga0207680_10208528 3300025903 Bacteria 1335
337 Ga0207647_10025784 3300025904 Bacteria 3855
338 Ga0207647_10152771 3300025904 Bacteria 1349
339 Ga0207647_10359411 3300025904 Bacteria 824
340 Ga0207699_10019120 3300025906 Bacteria 3646
341 Ga0207699_10032628 3300025906 Bacteria 2935
342 Ga0207699_10062902 3300025906 Bacteria 2239
343 Ga0207645_10004384 3300025907 Bacteria 10452
344 Ga0207705_10000055 3300025909 Bacteria 160436
345 Ga0207705_10007178 3300025909 Bacteria 8207
346 Ga0207684_10047574 3300025910 Bacteria 3637
347 Ga0207654_10496656 3300025911 Bacteria 861
348 Ga0207707_10000143 3300025912 Bacteria 74226
349 Ga0207707_10014431 3300025912 Bacteria 6882
350 Ga0207695_10004557 3300025913 Bacteria 18841
351 Ga0207695_10005778 3300025913 Bacteria 16288
352 Ga0207695_10029272 3300025913 Bacteria 6091
353 Ga0207695_10525076 3300025913 Bacteria 1065
354 Ga0207671_10029351 3300025914 Bacteria 4106
355 Ga0207671_10061198 3300025914 Bacteria 2793
356 Ga0207671_10144019 3300025914 Bacteria 1837
357 Ga0207671_10178948 3300025914 Bacteria 1650
358 Ga0207693_10054355 3300025915 Bacteria 3141
359 Ga0207693_10166544 3300025915 Bacteria 1735
360 Ga0207663_10052117 3300025916 Bacteria 2551
361 Ga0207660_10007904 3300025917 Bacteria 6882
362 Ga0207660_10274141 3300025917 Bacteria 1337
363 Ga0207657_10004951 3300025919 Bacteria 14018
364 Ga0207657_10005482 3300025919 Bacteria 13248
365 Ga0207657_10013332 3300025919 Bacteria 8064
366 Ga0207657_10139147 3300025919 Bacteria 1984
367 Ga0207652_10024703 3300025921 Bacteria 4987
368 Ga0207646_10065090 3300025922 Bacteria 3254
369 Ga0207694_10029840 3300025924 Bacteria 4163
370 Ga0207694_10049968 3300025924 Bacteria 3238
371 Ga0207694_10050027 3300025924 Bacteria 3235
372 Ga0207694_10067102 3300025924 Bacteria 2800
373 Ga0207659_10015289 3300025926 Bacteria 4967
374 Ga0207659_10232512 3300025926 Bacteria 1487
375 Ga0207659_10510357 3300025926 Bacteria 1018
376 Ga0207687_10000755 3300025927 Bacteria 21846
377 Ga0207687_10089008 3300025927 Bacteria 2247
378 Ga0207687_10201791 3300025927 Bacteria 1555
379 Ga0207700_10034094 3300025928 Bacteria 3650
380 Ga0207700_10110658 3300025928 Bacteria 2209
381 Ga0207700_10197737 3300025928 Bacteria 1693
382 Ga0207700_10227682 3300025928 Bacteria 1583
383 Ga0207690_10004570 3300025932 Bacteria 8175
384 Ga0207690_10036500 3300025932 Bacteria 3183
385 Ga0207690_10401104 3300025932 Bacteria 1094
386 Ga0207706_10010431 3300025933 Bacteria 8489
387 Ga0207686_10067444 3300025934 Bacteria 2289
388 Ga0207709_10000314 3300025935 Bacteria 52842
389 Ga0207704_10000005 3300025938 Bacteria 225353
390 Ga0207711_10000852 3300025941 Bacteria 29486
391 Ga0207711_10004629 3300025941 Bacteria 11695
392 Ga0207711_10176891 3300025941 Bacteria 1939
393 Ga0207689_10001653 3300025942 Bacteria 21135
394 Ga0207679_10256115 3300025945 Bacteria 1490
395 Ga0207667_10000016 3300025949 Bacteria 391466
396 Ga0207667_10020014 3300025949 Bacteria 7455
397 Ga0207667_10079777 3300025949 Bacteria 3392
398 Ga0207651_10000007 3300025960 Bacteria 225286
399 Ga0207712_10007902 3300025961 Bacteria 6720
400 Ga0207712_10088953 3300025961 Bacteria 2269
401 Ga0207712_10234109 3300025961 Bacteria 1476
402 Ga0207668_10436882 3300025972 Bacteria 1114
403 Ga0207677_10000085 3300026023 Bacteria 78393
404 Ga0207703_10001689 3300026035 Bacteria 19855
405 Ga0207703_10006205 3300026035 Bacteria 9564
406 Ga0207703_10224453 3300026035 Bacteria 1681
407 Ga0207639_10038697 3300026041 Bacteria 3549
408 Ga0207639_10255690 3300026041 Bacteria 1530
409 Ga0207639_10286758 3300026041 Bacteria 1450
410 Ga0207678_10049937 3300026067 Bacteria 3615
411 Ga0207678_10746243 3300026067 Bacteria 863
412 Ga0207702_10000063 3300026078 Bacteria 123034
413 Ga0207702_10005342 3300026078 Bacteria 11261
414 Ga0207702_10423659 3300026078 Bacteria 1287
415 Ga0207641_10028640 3300026088 Bacteria 4603
416 Ga0207641_10341334 3300026088 Bacteria 1425
417 Ga0207641_10389758 3300026088 Bacteria 1336
418 Ga0207641_10518373 3300026088 Bacteria 1159
419 Ga0207648_10000005 3300026089 Bacteria 225083
420 Ga0207676_10001553 3300026095 Bacteria 16924
421 Ga0207676_10159444 3300026095 Bacteria 1953
422 Ga0207676_10369365 3300026095 Bacteria 1332
423 Ga0207674_10000989 3300026116 Bacteria 37099
424 Ga0207674_10017443 3300026116 Bacteria 7835
425 Ga0207674_10018135 3300026116 Bacteria 7658
426 Ga0207674_10484544 3300026116 Bacteria 1195
427 Ga0207675_100343902 3300026118 Bacteria 1461
428 Ga0207675_100537927 3300026118 Bacteria 1166
429 Ga0207683_10149323 3300026121 Bacteria 2108
430 Ga0207698_10000294 3300026142 Bacteria 30242
431 Ga0207698_10033871 3300026142 Bacteria 3716
432 Ga0207698_10264407 3300026142 Bacteria 1582
433 Ga0207428_10207164 3300027907 Bacteria 1474
434 Ga0268266_10000003 3300028379 Bacteria 1701703
435 Ga0268266_10126859 3300028379 Bacteria 2278
436 Ga0268266_10154418 3300028379 Bacteria 2072
437 Ga0268266_10166098 3300028379 Bacteria 2000
438 Ga0268266_10235109 3300028379 Bacteria 1689
439 Ga0268266_10545318 3300028379 Bacteria 1111
440 Ga0268265_10023564 3300028380 Bacteria 4340
441 Ga0268265_10036215 3300028380 Bacteria 3613
442 Ga0268265_10453740 3300028380 Bacteria 1198
443 Ga0268264_10000356 3300028381 Bacteria 68810
444 Ga0307517_10176599 3300028786 Bacteria 1389
445 Ga0307515_10033355 3300028794 Bacteria 8482
446 Ga0307511_10034380 3300030521 Bacteria 4450
447 Ga0307512_10191584 3300030522 Bacteria 1127
448 Ga0265330_10010731 3300031235 Bacteria 4310
449 Ga0265330_10063434 3300031235 Bacteria 1606
450 Ga0265332_10151694 3300031238 Bacteria 969
451 Ga0265320_10001345 3300031240 Bacteria 17924
452 Ga0265340_10016299 3300031247 Bacteria 3849
453 Ga0265340_10186514 3300031247 Bacteria 936
454 Ga0265331_10032239 3300031250 Bacteria 2598
455 Ga0265316_10045394 3300031344 Bacteria 3489
456 Ga0307513_10079397 3300031456 Bacteria 3390
457 Ga0307513_10270222 3300031456 Bacteria 1484
458 Ga0307513_10306911 3300031456 Bacteria 1351
459 Ga0307509_10192327 3300031507 Bacteria 1889
460 Ga0307509_10541234 3300031507 Bacteria 843
461 Ga0307408_100064798 3300031548 Bacteria 2678
462 Ga0307508_10001949 3300031616 Bacteria 22585
463 Ga0307508_10262591 3300031616 Bacteria 1321
464 Ga0265314_10071962 3300031711 Bacteria 2311
465 Ga0265314_10073784 3300031711 Bacteria 2274
466 Ga0265342_10003269 3300031712 Bacteria 13437
467 Ga0265342_10028180 3300031712 Bacteria 3502
468 Ga0265342_10089269 3300031712 Bacteria 1769
469 Ga0265342_10122932 3300031712 Bacteria 1460
470 Ga0307516_10000034 3300031730 Bacteria 155251
471 Ga0307516_10005305 3300031730 Bacteria 15512
472 Ga0307516_10126728 3300031730 Bacteria 2337
473 Ga0307405_10414785 3300031731 Bacteria 1058
474 Ga0307412_10355937 3300031911 Bacteria 1177
475 Ga0307412_10421289 3300031911 Bacteria 1092
476 Ga0307414_10021121 3300032004 Bacteria 4076
477 Ga0307414_10197404 3300032004 Bacteria 1633
478 Ga0307510_10103437 3300033180 Bacteria 2625
479 Ga0307510_10129319 3300033180 Bacteria 2204
480 Ga0307510_10167278 3300033180 Bacteria 1784
481 Ga0373934_0135557 3300035086 Bacteria 1005
482 Ga0373944_0080706 3300035089 Bacteria 1074
483 Ga0373923_0182533 3300035111 Bacteria 965
484 Ga0373936_0086972 3300035113 Bacteria 1307
485 Ga0373936_0187711 3300035113 Bacteria 909
486 Ga0373955_0449417 3300035172 Bacteria 785
487 Ga0373935_0005959 3300035692 Bacteria 7231
488 Ga0373927_0002991 3300035695 Bacteria 12261
489 Ga0373927_0014399 3300035695 Bacteria 5236
490 Ga0373927_0049450 3300035695 Bacteria 2718
491 Ga0373933_0285329 3300035724 Bacteria 1067
492 Ga0373947_0040983 3300035725 Bacteria 2760
493 Ga0373937_0047940 3300036401 Bacteria 3909
494 Ga0310112_010758 3300036458 Bacteria 1307
495 Ga0373925_0034633 3300037068 Bacteria 3722
496 Ga0373925_0317917 3300037068 Bacteria 1259
497 Ga0373925_0352501 3300037068 Bacteria 1195
498 Ga0395899_0000026 3300037312 Bacteria 345291
499 Ga0395899_0000713 3300037312 Bacteria 33291
500 Ga0395899_0098311 3300037312 Bacteria 2114
501 Ga0395899_0510502 3300037312 Bacteria 778
502 Ga0395900_0025660 3300037418 Bacteria 6032
503 Ga0395900_0200106 3300037418 Bacteria 2022
504 Ga0395898_0058714 3300037466 Bacteria 3745
505 Ga0395898_0204761 3300037466 Bacteria 1883
506 Ga0395898_0289869 3300037466 Bacteria 1561
507 Ga0395898_0443901 3300037466 Bacteria 1236
508 Ga0395905_0012102 3300037471 Bacteria 8312
509 Ga0395905_0034469 3300037471 Bacteria 4753
510 Ga0395905_0050916 3300037471 Bacteria 3879
511 Ga0395905_0061355 3300037471 Bacteria 3517
512 Ga0395905_0070375 3300037471 Bacteria 3278
513 Ga0395905_0078733 3300037471 Bacteria 3089
514 Ga0395905_0410047 3300037471 Bacteria 1250
515 Ga0395905_0876355 3300037471 Bacteria 801
516 Ga0395901_0029430 3300038443 Bacteria 5656
517 Ga0395901_0029978 3300038443 Bacteria 5604
518 Ga0395901_0104792 3300038443 Bacteria 2968
519 Ga0395901_0192446 3300038443 Bacteria 2139
520 Ga0395901_0395262 3300038443 Bacteria 1421
521 Ga0395901_0418805 3300038443 Bacteria 1374
522 Ga0395901_0688279 3300038443 Bacteria 1021
523 Ga0395901_0794163 3300038443 Bacteria 936
524 Ga0436365_0140106 3300039437 Bacteria 2084
525 Ga0436365_0449154 3300039437 Bacteria 1607
526 Ga0436365_0503144 3300039437 Bacteria 3811
527 Ga0436365_0916510 3300039437 Bacteria 28669
528 Ga0436365_1541345 3300039437 Bacteria 20116
529 Ga0436365_1602753 3300039437 Bacteria 4159
530 Ga0436360_0479997 3300039438 Bacteria 1343
531 Ga0436360_0795172 3300039438 Bacteria 791
532 Ga0436361_0108203 3300039447 Bacteria 1212
533 Ga0436361_0186477 3300039447 Bacteria 1340
534 Ga0436361_0238923 3300039447 Bacteria 2966
535 Ga0436361_0261403 3300039447 Bacteria 1358
536 Ga0436361_0546846 3300039447 Bacteria 2777
537 Ga0436361_0681592 3300039447 Bacteria 2168
538 Ga0436361_0843361 3300039447 Bacteria 817
539 Ga0436363_0168726 3300039450 Bacteria 4122
540 Ga0436363_0599359 3300039450 Bacteria 7683
541 Ga0436363_0885771 3300039450 Bacteria 980
542 Ga0439436_0018407 3300041404 Bacteria 2088
543 Ga0439461_0035617 3300041410 Bacteria 1056
544 Ga0439465_0006377 3300041413 Bacteria 3746
545 Ga0439431_0000187 3300041997 Bacteria 12043
546 Ga0439431_0010651 3300041997 Bacteria 2088
547 Ga0439442_002393 3300042002 Bacteria 3683
548 Ga0439445_0000562 3300042004 Bacteria 7575
549 Ga0439445_0069288 3300042004 Bacteria 974
550 Ga0439448_0002340 3300042005 Bacteria 5139
551 Ga0439448_0024185 3300042005 Bacteria 1898
552 Ga0439432_003177 3300042006 Bacteria 6113
553 Ga0439449_0053381 3300042007 Bacteria 1494
554 Ga0439452_021467 3300042010 Bacteria 1682
555 Ga0439455_0007335 3300042012 Bacteria 2329
556 Ga0439455_0008361 3300042012 Bacteria 2216
557 Ga0439455_0059366 3300042012 Bacteria 1012
558 Ga0439455_0071768 3300042012 Bacteria 931
559 Ga0439455_0102985 3300042012 Bacteria 790
560 Ga0439457_001532 3300042014 Bacteria 6934
561 Ga0450919_010306 3300042121 Bacteria 1070
562 Ga0450923_017278 3300042125 Bacteria 1368
563 Ga0450898_035919 3300042134 Bacteria 924
564 Ga0450910_010396 3300042147 Bacteria 1325
565 Ga0439446_0002031 3300042156 Bacteria 4791
566 Ga0439458_0000986 3300042157 Bacteria 7274
567 Ga0439458_0001013 3300042157 Bacteria 7188
568 Ga0439458_0001992 3300042157 Bacteria 5069
569 Ga0439434_0002604 3300042435 Bacteria 5251
570 Ga0439435_0012758 3300042436 Bacteria 2044
571 Ga0466972_0010990 3300044658 Bacteria 4545
572 Ga0466965_0031586 3300044683 Bacteria 2583
573 Ga0466966_0034352 3300044684 Bacteria 3279
574 Ga0466966_0058072 3300044684 Unclassified 2446
575 Ga0466966_0058718 3300044684 Bacteria 2431
576 Ga0466966_0138559 3300044684 Bacteria 1487
577 Ga0466961_0011581 3300044693 Bacteria 5637
578 Ga0466963_0037193 3300044694 Plasmid 3177
579 Ga0466963_0049597 3300044694 Bacteria 2777
580 Ga0466963_0101375 3300044694 Bacteria 1971
581 Ga0466964_0013581 3300044706 Bacteria 3089
582 Ga0466964_0085777 3300044706 Bacteria 1360
583 Ga0466971_0024553 3300044719 Bacteria 2690
584 Ga0466971_0062460 3300044719 Bacteria 1685
585 Ga0466968_0025710 3300044735 Bacteria 2413
586 Ga0466968_0029848 3300044735 Bacteria 2257
587 Ga0466970_0004968 3300044765 Bacteria 6570
588 Ga0466970_0099144 3300044765 Bacteria 1586
589 Ga0466957_0008884 3300044842 Bacteria 5725
590 Ga0466957_0195426 3300044842 Bacteria 1327
591 Ga0466957_0206052 3300044842 Bacteria 1293
592 Ga0466960_0329898 3300044901 Bacteria 866
593 Ga0466960_0374149 3300044901 Bacteria 816
594 Ga0466959_0005917 3300045049 Bacteria 8424
595 Ga0466959_0042510 3300045049 Bacteria 3352
596 Ga0466959_0075547 3300045049 Bacteria 2434
597 Ga0466959_0099323 3300045049 Bacteria 2084
598 Ga0466959_0296235 3300045049 Bacteria 1108
599 Ga0466959_0428104 3300045049 Bacteria 898
600 Ga0466958_0000048 3300045836 Bacteria 35635
601 Ga0466958_0021853 3300045836 Bacteria 3742
602 Ga0466958_0057198 3300045836 Bacteria 2370
603 Ga0466958_0093525 3300045836 Unclassified 1862
604 Ga0466958_0359931 3300045836 Bacteria 937
605 Ga0466967_0223964 3300045976 Bacteria 1788
606 Ga0466967_0291750 3300045976 Bacteria 1567
607 Ga0495627_000209 3300046453 Bacteria 63424
608 Ga0495590_0002168 3300046457 Bacteria 8231
609 Ga0495629_0418204 3300046459 Bacteria 910
610 Ga0495638_0000326 3300046460 Bacteria 60360
611 Ga0495638_0000434 3300046460 Bacteria 50529
612 Ga0495638_0005521 3300046460 Bacteria 9392
613 Ga0495638_0039729 3300046460 Bacteria 2985
614 Ga0495638_0048119 3300046460 Bacteria 2670
615 Ga0495638_0130212 3300046460 Bacteria 1478
616 Ga0495638_0291070 3300046460 Bacteria 883
617 Ga0495638_0293732 3300046460 Bacteria 878
618 Ga0495641_0159147 3300046461 Bacteria 1010
619 Ga0495651_0009405 3300046462 Bacteria 7507
620 Ga0495651_0022220 3300046462 Bacteria 4932
621 Ga0495650_0000069 3300046471 Bacteria 261124
622 Ga0495650_0031088 3300046471 Bacteria 2408
623 Ga0495650_0116783 3300046471 Bacteria 985
624 Ga0495580_0348313 3300046472 Bacteria 1004
625 Ga0495664_0277789 3300046477 Bacteria 1012
626 Ga0495585_0207160 3300046492 Bacteria 996
627 Ga0495594_0017602 3300046499 Bacteria 3778
628 Ga0495594_0134716 3300046499 Bacteria 1400
629 Ga0495607_0204649 3300046501 Bacteria 974
630 Ga0495583_0000001 3300046506 Bacteria 811973
631 Ga0495583_0094892 3300046506 Bacteria 1280
632 Ga0495606_0016300 3300046507 Bacteria 5673
633 Ga0495606_0349636 3300046507 Bacteria 785
634 Ga0495610_0002007 3300046512 Bacteria 17407
635 Ga0495610_0004447 3300046512 Bacteria 10361
636 Ga0495610_0005291 3300046512 Bacteria 9230
637 Ga0495610_0017507 3300046512 Bacteria 4083
638 Ga0495616_0000115 3300046513 Bacteria 70371
639 Ga0495631_0001223 3300046518 Bacteria 15856
640 Ga0495631_0138305 3300046518 Bacteria 1046
641 Ga0495631_0164379 3300046518 Bacteria 952
642 Ga0495632_0012120 3300046519 Bacteria 4986
643 Ga0495643_0212575 3300046522 Bacteria 922
644 Ga0495643_0227646 3300046522 Bacteria 881
645 Ga0495648_0000165 3300046524 Bacteria 78462
646 Ga0495648_0053168 3300046524 Bacteria 2455
647 Ga0495648_0112343 3300046524 Bacteria 1480
648 Ga0495663_0025072 3300046525 Bacteria 1737
649 Ga0495654_0000024 3300046530 Bacteria 238195
650 Ga0495654_0012651 3300046530 Bacteria 4529
651 Ga0495645_0177873 3300046543 Bacteria 1460
652 Ga0495622_0005431 3300046557 Bacteria 5915
653 Ga0495668_0000456 3300046616 Bacteria 52300
654 Ga0495668_0015595 3300046616 Bacteria 4432
655 Ga0495668_0018797 3300046616 Bacteria 3993
656 Ga0495668_0023744 3300046616 Bacteria 3493
657 Ga0495668_0035943 3300046616 Bacteria 2777
658 Ga0495668_0074400 3300046616 Bacteria 1865
659 Ga0495668_0081140 3300046616 Bacteria 1780
660 Ga0495634_0326474 3300046642 Bacteria 923
661 Ga0495611_0182921 3300046648 Bacteria 979
662 Ga0495625_0000230 3300046660 Bacteria 88194
663 Ga0495625_0004316 3300046660 Bacteria 13502
664 Ga0495625_0006914 3300046660 Bacteria 10011
665 Ga0495625_0018507 3300046660 Bacteria 5436
666 Ga0495625_0039826 3300046660 Bacteria 3429
667 Ga0495625_0073657 3300046660 Bacteria 2393
668 Ga0495659_0131102 3300046664 Bacteria 994
669 Ga0495661_0012280 3300046665 Bacteria 5785
670 Ga0495588_0203650 3300046674 Bacteria 1045
671 Ga0495657_0046244 3300046675 Bacteria 2949
672 Ga0495599_0169263 3300046678 Bacteria 1348
673 Ga0495623_0012870 3300046679 Bacteria 5419
674 Ga0495613_0056042 3300046689 Bacteria 2895
675 Ga0495613_0144755 3300046689 Bacteria 1697
676 Ga0495670_0000029 3300046691 Bacteria 87662
677 Ga0495670_0012601 3300046691 Bacteria 4158
678 Ga0495671_0061171 3300046692 Bacteria 1858
679 Ga0495660_0132991 3300046810 Bacteria 1246
680 Ga0495581_0193504 3300047315 Bacteria 1190
681 Ga0495604_0105632 3300047317 Bacteria 2061
682 Ga0495604_0358796 3300047317 Bacteria 967
683 Ga0495672_0019609 3300047320 Bacteria 4457
684 Ga0495672_0145424 3300047320 Bacteria 1234
685 Ga0495677_0008628 3300047445 Bacteria 3784
686 Ga0495673_0000108 3300047469 Bacteria 168459
687 Ga0495673_0000344 3300047469 Bacteria 58803
688 Ga0495673_0003633 3300047469 Bacteria 10088
689 Ga0495686_0004056 3300047472 Bacteria 12228
690 Ga0495686_0011950 3300047472 Bacteria 6101
691 Ga0495686_0013762 3300047472 Bacteria 5605
692 Ga0495686_0036693 3300047472 Bacteria 3145
693 Ga0495686_0074651 3300047472 Bacteria 2080
694 Ga0495686_0132889 3300047472 Bacteria 1474
695 Ga0495686_0156744 3300047472 Bacteria 1333
696 Ga0495602_0194229 3300048088 Bacteria 1554
697 Ga0495626_0061575 3300048091 Bacteria 1706
698 Ga0496100_0306526 3300048903 Bacteria 1190
699 Ga0496100_0327012 3300048903 Bacteria 1153
700 Ga0496103_0174513 3300048906 Bacteria 1381
701 Ga0496104_0001606 3300048907 Bacteria 19467
702 Ga0496104_0001863 3300048907 Bacteria 18258
703 Ga0496105_0008691 3300048908 Bacteria 7902
704 Ga0496105_0443611 3300048908 Bacteria 1025
705 Ga0496106_0001358 3300048909 Bacteria 18318
706 Ga0496106_0044228 3300048909 Bacteria 3342
707 Ga0496106_0052530 3300048909 Bacteria 3075
708 Ga0496106_0736254 3300048909 Bacteria 784
709 Ga0496107_0006558 3300048910 Bacteria 8007
710 Ga0496107_0403907 3300048910 Bacteria 1016
711 Ga0496108_0204804 3300048911 Bacteria 1712
712 Ga0496108_0205223 3300048911 Bacteria 1710
713 Ga0496110_0113009 3300048913 Bacteria 2442
714 Ga0496110_0216548 3300048913 Bacteria 1741
715 Ga0496111_0294153 3300048914 Bacteria 1204
716 Ga0496111_0412806 3300048914 Bacteria 997
717 Ga0496112_0908806 3300048915 Bacteria 802
718 Ga0496113_0213646 3300048916 Bacteria 1536
719 Ga0496114_0281214 3300048917 Bacteria 1467
720 Ga0496114_0656583 3300048917 Bacteria 922
721 Ga0496115_0000921 3300048918 Bacteria 21326
722 Ga0496115_0001486 3300048918 Bacteria 16854
723 Ga0496115_0004981 3300048918 Bacteria 9641
724 Ga0496115_0020165 3300048918 Bacteria 5139
725 Ga0496115_0101425 3300048918 Bacteria 2360
726 Ga0496116_0000965 3300048919 Bacteria 35491
727 Ga0496116_0143291 3300048919 Bacteria 1340
728 Ga0496117_0013409 3300048920 Bacteria 7153
729 Ga0496117_0034522 3300048920 Bacteria 3809
730 Ga0496117_0105182 3300048920 Bacteria 1774
731 Ga0496117_0106166 3300048920 Bacteria 1763
732 Ga0496117_0144340 3300048920 Bacteria 1420
733 Ga0496117_0148732 3300048920 Bacteria 1390
734 Ga0496118_0003027 3300048921 Bacteria 21693
735 Ga0496118_0010242 3300048921 Bacteria 9306
736 Ga0496118_0020353 3300048921 Bacteria 5885
737 Ga0496118_0028559 3300048921 Bacteria 4695
738 Ga0496118_0039154 3300048921 Bacteria 3787
739 Ga0496118_0070052 3300048921 Bacteria 2535
740 Ga0496118_0084187 3300048921 Bacteria 2220
741 Ga0496118_0120085 3300048921 Bacteria 1716
742 Ga0496119_0024118 3300048922 Bacteria 4289
743 Ga0496119_0035437 3300048922 Bacteria 3270
744 Ga0496119_0051808 3300048922 Bacteria 2519
745 Ga0496119_0064646 3300048922 Bacteria 2171
746 Ga0496119_0119652 3300048922 Bacteria 1450
747 Ga0496121_0001622 3300048924 Bacteria 37285
748 Ga0496121_0007823 3300048924 Bacteria 12793
749 Ga0496121_0023791 3300048924 Bacteria 5882
750 Ga0496121_0028197 3300048924 Bacteria 5232
751 Ga0496121_0036329 3300048924 Bacteria 4392
752 Ga0496121_0126551 3300048924 Bacteria 1919
753 Ga0496121_0161432 3300048924 Bacteria 1638
754 Ga0496121_0208762 3300048924 Bacteria 1385
755 Ga0496121_0244912 3300048924 Bacteria 1247
756 Ga0496121_0289800 3300048924 Bacteria 1116
757 Ga0496121_0366225 3300048924 Bacteria 955
758 Ga0496122_0024545 3300048925 Bacteria 5272
759 Ga0496122_0036640 3300048925 Bacteria 3962
760 Ga0496122_0209236 3300048925 Bacteria 1132
761 Ga0496123_0022020 3300048926 Bacteria 4930
762 Ga0496123_0065829 3300048926 Bacteria 2299
763 Ga0496124_0002957 3300048927 Bacteria 21339
764 Ga0496124_0049091 3300048927 Bacteria 3602
765 Ga0496124_0095992 3300048927 Bacteria 2409
766 Ga0496124_0218398 3300048927 Bacteria 1436
767 Ga0496124_0231950 3300048927 Bacteria 1379
768 Ga0496124_0266812 3300048927 Bacteria 1256
769 Ga0496124_0469553 3300048927 Bacteria 853
770 Ga0496124_0526149 3300048927 Bacteria 786
771 Ga0496125_0001630 3300048928 Bacteria 31638
772 Ga0496125_0056184 3300048928 Bacteria 3199
773 Ga0496125_0083260 3300048928 Bacteria 2434
774 Ga0496125_0089991 3300048928 Bacteria 2306
775 Ga0496125_0095264 3300048928 Bacteria 2215
776 Ga0496125_0099406 3300048928 Bacteria 2149
777 Ga0496125_0137524 3300048928 Bacteria 1706
778 Ga0496125_0242362 3300048928 Bacteria 1144
779 Ga0496125_0281648 3300048928 Bacteria 1029
780 Ga0496125_0295403 3300048928 Bacteria 995
781 Ga0496126_0003803 3300048929 Bacteria 18741
782 Ga0496126_0028894 3300048929 Bacteria 5275
783 Ga0496126_0033555 3300048929 Bacteria 4827
784 Ga0496126_0070139 3300048929 Bacteria 3123
785 Ga0496126_0081503 3300048929 Bacteria 2860
786 Ga0496126_0104438 3300048929 Bacteria 2475
787 Ga0496126_0312538 3300048929 Bacteria 1293
788 Ga0496126_0373969 3300048929 Bacteria 1161
789 Ga0496126_0486006 3300048929 Bacteria 989
790 Ga0495678_003911 3300049459 Bacteria 8931
791 Ga0495682_0081120 3300049460 Bacteria 1167
792 Ga0495682_0131024 3300049460 Bacteria 897
793 Ga0501031_0003114 3300049568 Bacteria 10626
794 Ga0501031_0026710 3300049568 Bacteria 3763
795 Ga0501032_0000762 3300049569 Bacteria 26183
796 Ga0501032_0056815 3300049569 Bacteria 2630
797 Ga0501032_0071436 3300049569 Bacteria 2313
798 Ga0501033_0000136 3300049570 Bacteria 70952
799 Ga0501033_0026715 3300049570 Bacteria 4342
800 Ga0501033_0057089 3300049570 Bacteria 2886
801 Ga0501033_0098622 3300049570 Bacteria 2133
802 Ga0501033_0267830 3300049570 Bacteria 1208
803 Ga0501033_0336784 3300049570 Bacteria 1058
804 Ga0501034_0000251 3300049571 Bacteria 99406
805 Ga0501034_0008471 3300049571 Bacteria 10862
806 Ga0501034_0025849 3300049571 Bacteria 5980
807 Ga0501034_0099688 3300049571 Bacteria 2900
808 Ga0501034_0134299 3300049571 Bacteria 2456
809 Ga0501034_0146924 3300049571 Bacteria 2335
810 Ga0501036_0000036 3300049572 Bacteria 87244
811 Ga0501036_0095905 3300049572 Bacteria 2507
812 Ga0501036_0139078 3300049572 Bacteria 2049
813 Ga0501037_0000867 3300049573 Bacteria 22596
814 Ga0501037_0186696 3300049573 Bacteria 1469
815 Ga0501037_0190511 3300049573 Bacteria 1452
816 Ga0501038_0000428 3300049574 Bacteria 36623
817 Ga0501038_0036231 3300049574 Bacteria 4330
818 Ga0501038_0203480 3300049574 Bacteria 1588
819 Ga0501038_0223971 3300049574 Bacteria 1499
820 Ga0501038_0247921 3300049574 Bacteria 1412
821 Ga0501039_0000273 3300049575 Bacteria 37431
822 Ga0501039_0032382 3300049575 Bacteria 4030
823 Ga0501042_0170613 3300049578 Bacteria 1570
824 Ga0501043_0000165 3300049579 Bacteria 59980
825 Ga0501043_0027908 3300049579 Bacteria 4431
826 Ga0501043_0198896 3300049579 Bacteria 1556
827 Ga0501043_0205795 3300049579 Bacteria 1526
828 Ga0501043_0223047 3300049579 Bacteria 1457
829 Ga0501043_0289433 3300049579 Bacteria 1254
830 Ga0501043_0624811 3300049579 Bacteria 793
831 Ga0501046_0000839 3300049580 Bacteria 29959
832 Ga0501046_0516206 3300049580 Bacteria 854
833 Ga0501047_0000340 3300049581 Bacteria 53278
834 Ga0501047_0001905 3300049581 Bacteria 20058
835 Ga0501047_0003425 3300049581 Bacteria 14995
836 Ga0501047_0041364 3300049581 Bacteria 4454
837 Ga0501047_0458913 3300049581 Bacteria 1103
838 Ga0501048_0001309 3300049582 Bacteria 18872
839 Ga0501048_0046616 3300049582 Bacteria 3094
840 Ga0501067_0000457 3300049583 Bacteria 22383
841 Ga0501067_0087210 3300049583 Bacteria 1732
842 Ga0501067_0135039 3300049583 Bacteria 1373
843 Ga0501068_0000839 3300049584 Bacteria 15999
844 Ga0501068_0032662 3300049584 Bacteria 3095
845 Ga0501069_0032150 3300049585 Bacteria 2888
846 Ga0501069_0066434 3300049585 Bacteria 2017
847 Ga0501070_0000971 3300049586 Bacteria 25732
848 Ga0501070_0073648 3300049586 Bacteria 2826
849 Ga0501070_0577973 3300049586 Bacteria 897
850 Ga0501071_0079057 3300049587 Bacteria 2404
851 Ga0501072_0003301 3300049588 Bacteria 12139
852 Ga0501073_0000037 3300049589 Bacteria 87345
853 Ga0501073_0065517 3300049589 Bacteria 2533
854 Ga0501074_0000167 3300049590 Bacteria 35108
855 Ga0501074_0259375 3300049590 Bacteria 1236
856 Ga0501076_0191321 3300049592 Bacteria 1670
857 Ga0501079_0002302 3300049741 Bacteria 13814
858 Ga0501080_0006603 3300049742 Bacteria 10426
859 Ga0501080_0055199 3300049742 Bacteria 3700
860 Ga0501080_0080214 3300049742 Bacteria 3033
861 Ga0501080_0084313 3300049742 Bacteria 2952
862 Ga0501083_0001812 3300049744 Bacteria 14636
863 Ga0501083_0016896 3300049744 Bacteria 5097
864 Ga0501083_0042452 3300049744 Bacteria 3083
865 Ga0501241_006927 3300049758 Bacteria 2082
866 Ga0501035_0000142 3300049822 Bacteria 87561
867 Ga0501035_0006052 3300049822 Bacteria 11395
868 Ga0501035_0088777 3300049822 Bacteria 2723
869 Ga0501035_0185286 3300049822 Bacteria 1792
870 Ga0501035_0319208 3300049822 Bacteria 1305
871 Ga0501044_0000414 3300049823 Bacteria 52784
872 Ga0501044_0008740 3300049823 Bacteria 11085
873 Ga0501044_0013526 3300049823 Bacteria 8821
874 Ga0501044_0021563 3300049823 Bacteria 6869
875 Ga0501044_0022908 3300049823 Bacteria 6650
876 Ga0501044_0076769 3300049823 Bacteria 3389
877 Ga0501044_0083517 3300049823 Bacteria 3230
878 Ga0501044_0100473 3300049823 Bacteria 2911
879 Ga0501044_0286077 3300049823 Bacteria 1581
880 Ga0501044_0394898 3300049823 Bacteria 1296
881 Ga0501045_0002539 3300049824 Bacteria 12434
882 nmdc:mga03n38_180079_c1 3300050490 Bacteria 1082
883 nmdc:mga03n38_3129_c1 3300050490 Bacteria 5263
884 nmdc:mga00v17_26492_c1 3300050491 Bacteria 3380
885 nmdc:mga00v17_28827_c1 3300050491 Bacteria 3254
886 nmdc:mga00v17_51403_c1 3300050491 Bacteria 2506
887 nmdc:mga00v17_59417_c1 3300050491 Bacteria 2346
888 nmdc:mga00v17_69035_c1 3300050491 Bacteria 2186
889 nmdc:mga0yw44_179253_c1 3300050492 Bacteria 1394
890 nmdc:mga0yw44_23081_c1 3300050492 Bacteria 3501
891 nmdc:mga0yw44_341776_c1 3300050492 Bacteria 1007
892 nmdc:mga0yw44_4551_c1 3300050492 Bacteria 6383
893 nmdc:mga0yw44_50500_c1 3300050492 Bacteria 2515
894 nmdc:mga0yw44_7729_c1 3300050492 Bacteria 5309
895 nmdc:mga0yw44_84115_c1 3300050492 Bacteria 2000
896 nmdc:mga0k408_14464_c1 3300050493 Bacteria 4350
897 nmdc:mga0k408_199183_c1 3300050493 Bacteria 1195
898 nmdc:mga06z11_138892_c1 3300050494 Bacteria 1372
899 nmdc:mga06z11_4688_c1 3300050494 Bacteria 5399
900 nmdc:mga04h51_98496_c1 3300050495 Bacteria 1062
901 nmdc:mga07m45_32567_c1 3300050496 Bacteria 2890
902 nmdc:mga05p37_650235_c1 3300050507 Bacteria 1181
903 nmdc:mga0rr50_234301_c1 3300050513 Bacteria 1520
904 nmdc:mga08x19_86194_c1 3300050514 Bacteria 2067
905 nmdc:mga0sz30_2586_c1 3300050516 Bacteria 6435
906 nmdc:mga0sz30_4919_c1 3300050516 Bacteria 4868
907 nmdc:mga0sz30_51614_c1 3300050516 Bacteria 1745
908 nmdc:mga0sz30_75666_c1 3300050516 Bacteria 1453
909 Ga0495595_0087546 3300053084 Bacteria 1491
910 Ga0500578_0000056 3300053086 Bacteria 120189
911 Ga0500578_0113492 3300053086 Bacteria 1707
912 Ga0500578_0190611 3300053086 Bacteria 1259
913 Ga0500578_0193464 3300053086 Bacteria 1248
914 Ga0500578_0230005 3300053086 Bacteria 1124
915 Ga0500643_000048 3300053087 Bacteria 147879
916 Ga0500643_000548 3300053087 Bacteria 26252
917 Ga0500643_005672 3300053087 Bacteria 5335
918 Ga0500643_010845 3300053087 Bacteria 3365
919 Ga0500643_012763 3300053087 Bacteria 2996
920 Ga0500643_070398 3300053087 Bacteria 971
921 Ga0500644_0000089 3300053088 Bacteria 56897
922 Ga0500644_0028932 3300053088 Bacteria 1737
923 Ga0500644_0044232 3300053088 Bacteria 1494
924 Ga0500647_0093291 3300053091 Bacteria 1440
925 Ga0500647_0178970 3300053091 Bacteria 974
926 Ga0500583_0010766 3300053092 Bacteria 3412
927 Ga0500583_0060762 3300053092 Bacteria 1783
928 Ga0500651_0002004 3300053093 Bacteria 10570
929 Ga0500651_0002704 3300053093 Bacteria 9450
930 Ga0500651_0014869 3300053093 Bacteria 4768
931 Ga0500651_0215834 3300053093 Bacteria 1127
932 Ga0500566_0002605 3300053094 Bacteria 10733
933 Ga0500566_0003780 3300053094 Bacteria 9033
934 Ga0500566_0006460 3300053094 Bacteria 6955
935 Ga0500566_0075920 3300053094 Bacteria 1879
936 Ga0500641_0018004 3300053096 Bacteria 2652
937 Ga0500641_0023374 3300053096 Bacteria 2377
938 Ga0500641_0025472 3300053096 Bacteria 2289
939 Ga0500641_0032761 3300053096 Bacteria 2058
940 Ga0500641_0054141 3300053096 Bacteria 1658
941 Ga0500650_0025917 3300053098 Bacteria 2625
942 Ga0500554_041214 3300053102 Bacteria 1418
943 Ga0500555_027405 3300053103 Bacteria 1625
944 Ga0500556_0000003 3300053104 Bacteria 679379
945 Ga0500556_0001687 3300053104 Bacteria 8514
946 Ga0500562_000489 3300053108 Bacteria 9608
947 Ga0500562_006991 3300053108 Bacteria 2846
948 Ga0500562_016473 3300053108 Bacteria 1901
949 Ga0500562_027131 3300053108 Bacteria 1502
950 Ga0500594_0000724 3300053118 Bacteria 7016
951 Ga0500594_0086696 3300053118 Bacteria 944
952 Ga0500595_000333 3300053119 Bacteria 30925
953 Ga0500595_000497 3300053119 Bacteria 23997
954 Ga0500595_000553 3300053119 Bacteria 22382
955 Ga0500595_002282 3300053119 Bacteria 9644
956 Ga0500608_000207 3300053122 Bacteria 23415
957 Ga0500608_063928 3300053122 Bacteria 1756
958 Ga0500608_141759 3300053122 Bacteria 1064
959 Ga0500614_015345 3300053123 Bacteria 1707
960 Ga0500614_040520 3300053123 Bacteria 1182
961 Ga0500618_000034 3300053125 Bacteria 120560
962 Ga0500618_006607 3300053125 Bacteria 3387
963 Ga0500628_081385 3300053129 Bacteria 830
964 Ga0500642_0000015 3300053130 Bacteria 181424
965 Ga0500642_0001744 3300053130 Bacteria 6273
966 Ga0500642_0015152 3300053130 Bacteria 2890
967 Ga0500642_0133221 3300053130 Bacteria 1165
968 Ga0500642_0197676 3300053130 Bacteria 936
969 Ga0500652_010728 3300053131 Bacteria 3151
970 Ga0500652_011638 3300053131 Bacteria 3057
971 Ga0500652_083744 3300053131 Bacteria 1329
972 Ga0500655_000460 3300053133 Bacteria 8332
973 Ga0500658_0000793 3300053134 Bacteria 13099
974 Ga0500658_0001085 3300053134 Bacteria 11126
975 Ga0500658_0010451 3300053134 Bacteria 3424
976 Ga0500658_0031805 3300053134 Bacteria 2066
977 Ga0500658_0055776 3300053134 Bacteria 1628
978 Ga0500658_0165245 3300053134 Bacteria 1003
979 Ga0500559_0000112 3300053136 Bacteria 63817
980 Ga0500559_0001714 3300053136 Bacteria 12043
981 Ga0500559_0033232 3300053136 Bacteria 2220
982 Ga0500559_0081897 3300053136 Bacteria 1468
983 Ga0500559_0089806 3300053136 Bacteria 1405
984 Ga0500559_0147656 3300053136 Bacteria 1103
985 Ga0500564_000057 3300053138 Bacteria 29651
986 Ga0500564_150650 3300053138 Bacteria 992
987 Ga0500568_0000536 3300053139 Bacteria 27978
988 Ga0500568_0005756 3300053139 Bacteria 6345
989 Ga0500568_0016371 3300053139 Bacteria 3298
990 Ga0500568_0049176 3300053139 Bacteria 1665
991 Ga0500568_0077254 3300053139 Bacteria 1267
992 Ga0500568_0084110 3300053139 Bacteria 1205
993 Ga0500568_0084443 3300053139 Bacteria 1202
994 Ga0500568_0092354 3300053139 Bacteria 1141
995 Ga0500573_0067724 3300053140 Bacteria 2040
996 Ga0500586_000330 3300053145 Bacteria 9419
997 Ga0500588_0059114 3300053146 Bacteria 1222
998 Ga0500590_000163 3300053148 Bacteria 19391
999 Ga0500590_007211 3300053148 Bacteria 5474
1000 Ga0500590_031070 3300053148 Bacteria 2769
1001 Ga0500590_046959 3300053148 Bacteria 2206
1002 Ga0500603_014424 3300053150 Bacteria 1846
1003 Ga0500603_087833 3300053150 Bacteria 909
1004 Ga0500604_0053896 3300053151 Bacteria 1247
1005 Ga0500616_0000033 3300053153 Bacteria 398830
1006 Ga0500616_0001587 3300053153 Bacteria 21239
1007 Ga0500616_0030013 3300053153 Bacteria 2988
1008 Ga0500616_0118939 3300053153 Bacteria 1265
1009 Ga0500622_0001006 3300053156 Bacteria 23789
1010 Ga0500622_0001762 3300053156 Bacteria 16622
1011 Ga0500622_0006755 3300053156 Bacteria 6605
1012 Ga0500622_0017921 3300053156 Bacteria 3767
1013 Ga0500622_0023088 3300053156 Bacteria 3296
1014 Ga0500622_0026896 3300053156 Bacteria 3033
1015 Ga0500622_0141881 3300053156 Bacteria 1145
1016 Ga0500627_0043782 3300053158 Bacteria 1931
1017 Ga0500627_0081653 3300053158 Bacteria 1441
1018 Ga0500638_016198 3300053162 Bacteria 3434
1019 Ga0500639_060191 3300053163 Bacteria 1958
1020 Ga0500636_0015308 3300053177 Bacteria 4519
1021 Ga0500636_0040450 3300053177 Bacteria 2757
1022 Ga0500637_0000060 3300053178 Bacteria 38881
1023 Ga0500570_004099 3300053724 Bacteria 7619
1024 Ga0500570_077593 3300053724 Bacteria 1515
1025 Ga0500611_021920 3300053727 Bacteria 1225
1026 Ga0500611_027584 3300053727 Bacteria 1145
1027 Ga0500645_000883 3300053730 Bacteria 17431
1028 Ga0500645_029154 3300053730 Bacteria 1667
1029 Ga0500645_064013 3300053730 Bacteria 1061
1030 Ga0500609_000027 3300053731 Bacteria 21239
1031 Ga0500609_002135 3300053731 Bacteria 2832
1032 Ga0500596_001647 3300053735 Bacteria 4511
1033 Ga0500599_002351 3300053736 Bacteria 2264
1034 Ga0501084_0005116 3300054114 Bacteria 10737
1035 Ga0501084_0254685 3300054114 Bacteria 1482
1036 Ga0500661_001013 3300055283 Bacteria 5278
1037 Ga0501082_0004333 3300060353 Bacteria 12407
1038 Ga0501082_0098486 3300060353 Bacteria 2528
1039 Ga0466962_0001247 3300061719 Bacteria 11734

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300038443 Ga0395901_0418805 Ga0395901_0418805_768_1361 186
2 3300049570 Ga0501033_0336784 Ga0501033_0336784_454_1041 186
3 3300005618 Ga0068864_100007001 Ga0068864_1000070014 207
4 3300005842 Ga0068858_100000771 Ga0068858_10000077129 207
5 3300009177 Ga0105248_10047211 Ga0105248_100472115 207
6 3300009553 Ga0105249_10157228 Ga0105249_101572282 207
7 3300013306 Ga0163162_10004509 Ga0163162_100045099 207
8 3300025941 Ga0207711_10176891 Ga0207711_101768912 207
9 3300025961 Ga0207712_10088953 Ga0207712_100889532 207
10 3300026035 Ga0207703_10001689 Ga0207703_1000168911 207
11 3300026095 Ga0207676_10001553 Ga0207676_100015539 207
12 3300053139 Ga0500568_0077254 Ga0500568_0077254_31_702 210
13 3300005337 Ga0070682_100202918 Ga0070682_1002029182 213
14 3300005434 Ga0070709_10045772 Ga0070709_100457724 213
15 3300005458 Ga0070681_10006411 Ga0070681_100064114 213
16 3300005530 Ga0070679_100117260 Ga0070679_1001172602 213
17 3300006237 Ga0097621_100061585 Ga0097621_1000615854 213
18 3300009093 Ga0105240_10033307 Ga0105240_100333075 213
19 3300013307 Ga0157372_10067956 Ga0157372_100679565 213
20 3300025906 Ga0207699_10019120 Ga0207699_100191204 213
21 3300025912 Ga0207707_10000143 Ga0207707_1000014336 213
22 3300025917 Ga0207660_10274141 Ga0207660_102741413 213
23 3300048924 Ga0496121_0289800 Ga0496121_0289800_398_1096 213
24 3300005434 Ga0070709_10003406 Ga0070709_100034066 215
25 3300005436 Ga0070713_100010463 Ga0070713_1000104633 215
26 3300005439 Ga0070711_100002277 Ga0070711_10000227710 215
27 3300005439 Ga0070711_100452971 Ga0070711_1004529712 215
28 3300005458 Ga0070681_10049606 Ga0070681_100496066 215
29 3300005577 Ga0068857_100163281 Ga0068857_1001632814 215
30 3300025906 Ga0207699_10062902 Ga0207699_100629023 215
31 3300025928 Ga0207700_10034094 Ga0207700_100340943 215
32 3300026116 Ga0207674_10484544 Ga0207674_104845442 215
33 3300026142 Ga0207698_10264407 Ga0207698_102644073 215
34 3300044694 Ga0466963_0049597 Ga0466963_0049597_345_1043 215
35 3300045976 Ga0466967_0223964 Ga0466967_0223964_139_837 215
36 3300048929 Ga0496126_0104438 Ga0496126_0104438_336_1034 215
37 3300009177 Ga0105248_10347630 Ga0105248_103476302 220
38 3300037471 Ga0395905_0876355 Ga0395905_0876355_17_715 220
39 3300042012 Ga0439455_0102985 Ga0439455_0102985_51_731 220
40 3300049569 Ga0501032_0071436 Ga0501032_0071436_83_760 221
41 3300049570 Ga0501033_0098622 Ga0501033_0098622_213_890 221
42 3300049571 Ga0501034_0025849 Ga0501034_0025849_5091_5768 221
43 3300049572 Ga0501036_0095905 Ga0501036_0095905_551_1228 221
44 3300049574 Ga0501038_0036231 Ga0501038_0036231_1154_1831 221
45 3300049575 Ga0501039_0032382 Ga0501039_0032382_2387_3064 221
46 3300049579 Ga0501043_0223047 Ga0501043_0223047_758_1435 221
47 3300049582 Ga0501048_0046616 Ga0501048_0046616_1489_2166 221
48 3300049822 Ga0501035_0006052 Ga0501035_0006052_3031_3708 221
49 3300049823 Ga0501044_0013526 Ga0501044_0013526_5784_6461 221
50 iso_pu_bacteria 2508501128 2509151565 221
51 iso_pu_bacteria 2513237141 2513891646 221
52 iso_pu_bacteria 2517093001 2517105700 221
53 iso_pu_bacteria 2524023205 2524435444 221
54 iso_pu_bacteria 2602042107 2603860096 221
55 iso_pu_bacteria 2744054633 2745081392 221
56 iso_pu_bacteria 2824704595 2824706075 221
57 iso_pu_bacteria 2824753945 2824760292 221
58 iso_pu_bacteria 2824763712 2824771531 221
59 iso_pu_bacteria 2824773399 2824775749 221
60 iso_pu_bacteria 2841957949 2841965297 221
61 iso_pu_bacteria 2842038055 2842044359 221
62 iso_pu_bacteria 2842045827 2842051652 221
63 iso_pu_bacteria 2857524615 2857525079 221
64 iso_pu_bacteria 2874620515 2874622434 221
65 iso_pu_bacteria 2876761206 2876761700 221
66 iso_pu_bacteria 2893066018 2893069665 221
67 iso_pu_bacteria 2904666416 2904671559 221
68 iso_pu_bacteria 2904711408 2904718102 221
69 iso_pu_bacteria 2919073203 2919078967 221
70 iso_pu_bacteria 8006926726 8006928840 221
71 iso_pu_bacteria 8016522445 8016526936 221
72 iso_pu_bacteria 8016530956 8016532020 221
73 iso_pu_bacteria 8016548790 8016556858 221
74 iso_pu_bacteria 8016557553 8016565211 221
75 iso_pu_bacteria 8016575299 8016582856 221
76 iso_pu_bacteria 8016595262 8016602854 221
77 iso_pu_bacteria 8019530166 8019531837 221
78 3300005335 Ga0070666_10186306 Ga0070666_101863061 222
79 3300005841 Ga0068863_100025840 Ga0068863_1000258403 222
80 3300009093 Ga0105240_10002463 Ga0105240_1000246315 222
81 3300025903 Ga0207680_10208528 Ga0207680_102085282 222
82 3300025913 Ga0207695_10004557 Ga0207695_1000455714 222
83 3300026088 Ga0207641_10028640 Ga0207641_100286407 222
84 3300037312 Ga0395899_0000026 Ga0395899_0000026_35378_36100 222
85 3300053148 Ga0500590_000163 Ga0500590_000163_15709_16425 222
86 iso_pu_bacteria 2582581305 2585259718 222
87 iso_pu_bacteria 2643221614 2644087375 222
88 iso_pu_bacteria 2643221661 2644344581 222
89 iso_pu_bacteria 2643221666 2644366735 222
90 3300039437 Ga0436365_0140106 Ga0436365_0140106_24_725 223
91 iso_pu_bacteria 2791355048 2792458916 223
92 iso_pu_bacteria 2843744320 2843749072 223
93 iso_pu_bacteria 2849560528 2849564398 223
94 iso_pu_bacteria 2849573788 2849575270 223
95 iso_pu_bacteria 2851153111 2851155526 223
96 iso_pu_bacteria 2898329390 2898330873 223
97 3300003203 JGI25406J46586_10000513 JGI25406J46586_100005132 224
98 3300005548 Ga0070665_100001299 Ga0070665_1000012996 224
99 3300005841 Ga0068863_100359835 Ga0068863_1003598352 224
100 3300005985 Ga0081539_10000801 Ga0081539_1000080132 224
101 3300009093 Ga0105240_10086052 Ga0105240_100860526 224
102 3300009551 Ga0105238_10225558 Ga0105238_102255581 224
103 3300014325 Ga0163163_10018900 Ga0163163_100189006 224
104 3300014325 Ga0163163_10557376 Ga0163163_105573761 224
105 3300025913 Ga0207695_10029272 Ga0207695_100292722 224
106 3300025924 Ga0207694_10067102 Ga0207694_100671022 224
107 3300026088 Ga0207641_10518373 Ga0207641_105183731 224
108 3300026095 Ga0207676_10369365 Ga0207676_103693652 224
109 3300028379 Ga0268266_10000003 Ga0268266_100000031048 224
110 3300048918 Ga0496115_0000921 Ga0496115_0000921_14826_15593 224
111 iso_pu_bacteria 2510917020 2511124191 224
112 iso_pu_bacteria 2582581280 2585150853 224
113 iso_pu_bacteria 2582581293 2585195825 224
114 iso_pu_bacteria 2643221583 2643923880 224
115 iso_pu_bacteria 2818991435 2819538598 224
116 iso_pu_bacteria 2818991454 2819646868 224
117 3300002067 JGI24735J21928_10031649 JGI24735J21928_100316493 225
118 3300003215 JGI25153J46596_10000301 JGI25153J46596_100003014 225
119 3300003354 JGI25160J50197_1002871 JGI25160J50197_10028713 225
120 3300003771 Ga0055526_1046549 Ga0055526_10465491 225
121 3300003775 Ga0055524_1051165 Ga0055524_10511651 225
122 3300005262 Ga0065165_1001167 Ga0065165_100116718 225
123 3300005262 Ga0065165_1032813 Ga0065165_10328132 225
124 3300005336 Ga0070680_100017794 Ga0070680_1000177946 225
125 3300005337 Ga0070682_100208451 Ga0070682_1002084512 225
126 3300005338 Ga0068868_100667725 Ga0068868_1006677251 225
127 3300005339 Ga0070660_100003692 Ga0070660_10000369211 225
128 3300005344 Ga0070661_100097802 Ga0070661_1000978022 225
129 3300005344 Ga0070661_100188955 Ga0070661_1001889551 225
130 3300005366 Ga0070659_100077774 Ga0070659_1000777741 225
131 3300005434 Ga0070709_10020120 Ga0070709_100201202 225
132 3300005435 Ga0070714_100226508 Ga0070714_1002265082 225
133 3300005436 Ga0070713_100071899 Ga0070713_1000718993 225
134 3300005436 Ga0070713_100287196 Ga0070713_1002871961 225
135 3300005437 Ga0070710_10025371 Ga0070710_100253712 225
136 3300005439 Ga0070711_100001130 Ga0070711_10000113012 225
137 3300005455 Ga0070663_100572479 Ga0070663_1005724791 225
138 3300005458 Ga0070681_10087304 Ga0070681_100873044 225
139 3300005467 Ga0070706_100052063 Ga0070706_1000520634 225
140 3300005468 Ga0070707_100092451 Ga0070707_1000924514 225
141 3300005535 Ga0070684_100001671 Ga0070684_10000167117 225
142 3300005536 Ga0070697_100118434 Ga0070697_1001184342 225
143 3300005539 Ga0068853_100009612 Ga0068853_1000096127 225
144 3300005577 Ga0068857_100013087 Ga0068857_1000130877 225
145 3300005614 Ga0068856_100000137 Ga0068856_10000013716 225
146 3300005614 Ga0068856_100345247 Ga0068856_1003452473 225
147 3300005616 Ga0068852_100088449 Ga0068852_1000884494 225
148 3300005834 Ga0068851_10024349 Ga0068851_100243493 225
149 3300005842 Ga0068858_100242087 Ga0068858_1002420873 225
150 3300005843 Ga0068860_100000313 Ga0068860_10000031349 225
151 3300005844 Ga0068862_100015872 Ga0068862_1000158722 225
152 3300005937 Ga0081455_10017304 Ga0081455_100173043 225
153 3300005983 Ga0081540_1024929 Ga0081540_10249295 225
154 3300005983 Ga0081540_1028527 Ga0081540_10285274 225
155 3300005983 Ga0081540_1059623 Ga0081540_10596233 225
156 3300005983 Ga0081540_1072041 Ga0081540_10720411 225
157 3300005983 Ga0081540_1142003 Ga0081540_11420031 225
158 3300006038 Ga0075365_10055263 Ga0075365_100552633 225
159 3300006038 Ga0075365_10238357 Ga0075365_102383572 225
160 3300006051 Ga0075364_10012640 Ga0075364_100126406 225
161 3300006051 Ga0075364_10520688 Ga0075364_105206881 225
162 3300006175 Ga0070712_100009825 Ga0070712_1000098255 225
163 3300006178 Ga0075367_10039353 Ga0075367_100393533 225
164 3300006186 Ga0075369_10009026 Ga0075369_100090266 225
165 3300006186 Ga0075369_10120009 Ga0075369_101200092 225
166 3300006195 Ga0075366_10161131 Ga0075366_101611312 225
167 3300006237 Ga0097621_100144761 Ga0097621_1001447614 225
168 3300006353 Ga0075370_10169650 Ga0075370_101696501 225
169 3300006871 Ga0075434_100023401 Ga0075434_1000234018 225
170 3300007076 Ga0075435_100411755 Ga0075435_1004117552 225
171 3300007265 Ga0099794_10061546 Ga0099794_100615461 225
172 3300007788 Ga0099795_10001129 Ga0099795_100011297 225
173 3300007788 Ga0099795_10005962 Ga0099795_100059624 225
174 3300007788 Ga0099795_10067502 Ga0099795_100675022 225
175 3300009093 Ga0105240_10071475 Ga0105240_100714754 225
176 3300009098 Ga0105245_11027269 Ga0105245_110272691 225
177 3300009101 Ga0105247_10043425 Ga0105247_100434253 225
178 3300009177 Ga0105248_10042051 Ga0105248_100420515 225
179 3300009545 Ga0105237_10053748 Ga0105237_100537485 225
180 3300009545 Ga0105237_10054084 Ga0105237_100540844 225
181 3300009551 Ga0105238_10006268 Ga0105238_100062685 225
182 3300009551 Ga0105238_10022426 Ga0105238_100224265 225
183 3300010375 Ga0105239_10017503 Ga0105239_100175037 225
184 3300010375 Ga0105239_10216274 Ga0105239_102162743 225
185 3300013105 Ga0157369_10018692 Ga0157369_100186926 225
186 3300013105 Ga0157369_10053822 Ga0157369_100538223 225
187 3300014968 Ga0157379_10033261 Ga0157379_100332615 225
188 3300014968 Ga0157379_10199431 Ga0157379_101994311 225
189 3300025253 Ga0209677_102422 Ga0209677_1024226 225
190 3300025261 Ga0209233_1002344 Ga0209233_10023447 225
191 3300025272 Ga0209455_1002785 Ga0209455_10027854 225
192 3300025272 Ga0209455_1013949 Ga0209455_10139492 225
193 3300025272 Ga0209455_1016958 Ga0209455_10169582 225
194 3300025273 Ga0209673_1016536 Ga0209673_10165364 225
195 3300025295 Ga0209564_1000718 Ga0209564_100071825 225
196 3300025295 Ga0209564_1003160 Ga0209564_10031603 225
197 3300025295 Ga0209564_1006871 Ga0209564_10068717 225
198 3300025297 Ga0209758_1000015 Ga0209758_1000015792 225
199 3300025297 Ga0209758_1004632 Ga0209758_100463212 225
200 3300025297 Ga0209758_1006280 Ga0209758_10062808 225
201 3300025297 Ga0209758_1022902 Ga0209758_10229024 225
202 3300025299 Ga0209256_1002592 Ga0209256_100259212 225
203 3300025302 Ga0207426_1000217 Ga0207426_10002174 225
204 3300025302 Ga0207426_1000368 Ga0207426_10003689 225
205 3300025302 Ga0207426_1016643 Ga0207426_10166434 225
206 3300025304 Ga0209257_1002989 Ga0209257_100298915 225
207 3300025898 Ga0207692_10092668 Ga0207692_100926682 225
208 3300025906 Ga0207699_10032628 Ga0207699_100326283 225
209 3300025910 Ga0207684_10047574 Ga0207684_100475744 225
210 3300025912 Ga0207707_10014431 Ga0207707_100144314 225
211 3300025914 Ga0207671_10029351 Ga0207671_100293514 225
212 3300025914 Ga0207671_10178948 Ga0207671_101789483 225
213 3300025915 Ga0207693_10054355 Ga0207693_100543554 225
214 3300025916 Ga0207663_10052117 Ga0207663_100521174 225
215 3300025917 Ga0207660_10007904 Ga0207660_100079047 225
216 3300025919 Ga0207657_10005482 Ga0207657_1000548212 225
217 3300025921 Ga0207652_10024703 Ga0207652_100247035 225
218 3300025922 Ga0207646_10065090 Ga0207646_100650903 225
219 3300025924 Ga0207694_10029840 Ga0207694_100298406 225
220 3300025924 Ga0207694_10050027 Ga0207694_100500274 225
221 3300025926 Ga0207659_10510357 Ga0207659_105103572 225
222 3300025928 Ga0207700_10110658 Ga0207700_101106582 225
223 3300025928 Ga0207700_10227682 Ga0207700_102276822 225
224 3300025932 Ga0207690_10401104 Ga0207690_104011042 225
225 3300025945 Ga0207679_10256115 Ga0207679_102561152 225
226 3300025949 Ga0207667_10020014 Ga0207667_100200147 225
227 3300026035 Ga0207703_10224453 Ga0207703_102244532 225
228 3300026067 Ga0207678_10049937 Ga0207678_100499372 225
229 3300026078 Ga0207702_10000063 Ga0207702_1000006313 225
230 3300026078 Ga0207702_10423659 Ga0207702_104236592 225
231 3300026088 Ga0207641_10389758 Ga0207641_103897582 225
232 3300026095 Ga0207676_10159444 Ga0207676_101594442 225
233 3300026116 Ga0207674_10018135 Ga0207674_100181356 225
234 3300026142 Ga0207698_10033871 Ga0207698_100338711 225
235 3300028379 Ga0268266_10126859 Ga0268266_101268593 225
236 3300028379 Ga0268266_10154418 Ga0268266_101544182 225
237 3300028380 Ga0268265_10036215 Ga0268265_100362155 225
238 3300028380 Ga0268265_10453740 Ga0268265_104537402 225
239 3300028381 Ga0268264_10000356 Ga0268264_1000035620 225
240 3300030521 Ga0307511_10034380 Ga0307511_100343802 225
241 3300031235 Ga0265330_10010731 Ga0265330_100107314 225
242 3300031235 Ga0265330_10063434 Ga0265330_100634342 225
243 3300031238 Ga0265332_10151694 Ga0265332_101516941 225
244 3300031247 Ga0265340_10016299 Ga0265340_100162994 225
245 3300031247 Ga0265340_10186514 Ga0265340_101865142 225
246 3300031250 Ga0265331_10032239 Ga0265331_100322394 225
247 3300031344 Ga0265316_10045394 Ga0265316_100453944 225
248 3300031456 Ga0307513_10306911 Ga0307513_103069112 225
249 3300031507 Ga0307509_10192327 Ga0307509_101923273 225
250 3300031548 Ga0307408_100064798 Ga0307408_1000647983 225
251 3300031711 Ga0265314_10071962 Ga0265314_100719624 225
252 3300031711 Ga0265314_10073784 Ga0265314_100737844 225
253 3300031712 Ga0265342_10003269 Ga0265342_100032692 225
254 3300031712 Ga0265342_10028180 Ga0265342_100281802 225
255 3300031712 Ga0265342_10089269 Ga0265342_100892693 225
256 3300031712 Ga0265342_10122932 Ga0265342_101229323 225
257 3300031730 Ga0307516_10005305 Ga0307516_100053055 225
258 3300031731 Ga0307405_10414785 Ga0307405_104147851 225
259 3300031911 Ga0307412_10355937 Ga0307412_103559371 225
260 3300031911 Ga0307412_10421289 Ga0307412_104212892 225
261 3300033180 Ga0307510_10103437 Ga0307510_101034373 225
262 3300033180 Ga0307510_10167278 Ga0307510_101672782 225
263 3300035086 Ga0373934_0135557 Ga0373934_0135557_65_763 225
264 3300035089 Ga0373944_0080706 Ga0373944_0080706_22_720 225
265 3300035111 Ga0373923_0182533 Ga0373923_0182533_143_841 225
266 3300035113 Ga0373936_0086972 Ga0373936_0086972_159_857 225
267 3300035113 Ga0373936_0187711 Ga0373936_0187711_153_851 225
268 3300035172 Ga0373955_0449417 Ga0373955_0449417_58_756 225
269 3300035692 Ga0373935_0005959 Ga0373935_0005959_5268_5966 225
270 3300035695 Ga0373927_0002991 Ga0373927_0002991_8989_9687 225
271 3300035695 Ga0373927_0014399 Ga0373927_0014399_2727_3425 225
272 3300035695 Ga0373927_0049450 Ga0373927_0049450_333_1031 225
273 3300035724 Ga0373933_0285329 Ga0373933_0285329_179_877 225
274 3300035725 Ga0373947_0040983 Ga0373947_0040983_476_1174 225
275 3300036401 Ga0373937_0047940 Ga0373937_0047940_1930_2628 225
276 3300036458 Ga0310112_010758 Ga0310112_010758_69_767 225
277 3300037068 Ga0373925_0034633 Ga0373925_0034633_2946_3644 225
278 3300037068 Ga0373925_0317917 Ga0373925_0317917_191_889 225
279 3300037068 Ga0373925_0352501 Ga0373925_0352501_439_1137 225
280 3300037312 Ga0395899_0098311 Ga0395899_0098311_1128_1862 225
281 3300037312 Ga0395899_0510502 Ga0395899_0510502_25_723 225
282 3300037418 Ga0395900_0025660 Ga0395900_0025660_4392_5120 225
283 3300037418 Ga0395900_0200106 Ga0395900_0200106_809_1507 225
284 3300037466 Ga0395898_0058714 Ga0395898_0058714_478_1176 225
285 3300037466 Ga0395898_0289869 Ga0395898_0289869_688_1416 225
286 3300037471 Ga0395905_0012102 Ga0395905_0012102_3223_3966 225
287 3300037471 Ga0395905_0061355 Ga0395905_0061355_2202_2930 225
288 3300038443 Ga0395901_0029430 Ga0395901_0029430_3401_4099 225
289 3300038443 Ga0395901_0104792 Ga0395901_0104792_1021_1749 225
290 3300038443 Ga0395901_0395262 Ga0395901_0395262_356_1054 225
291 3300038443 Ga0395901_0688279 Ga0395901_0688279_30_764 225
292 3300038443 Ga0395901_0794163 Ga0395901_0794163_157_855 225
293 3300039437 Ga0436365_0503144 Ga0436365_0503144_1633_2331 225
294 3300039437 Ga0436365_1602753 Ga0436365_1602753_227_925 225
295 3300039438 Ga0436360_0479997 Ga0436360_0479997_382_1080 225
296 3300039438 Ga0436360_0795172 Ga0436360_0795172_46_744 225
297 3300039447 Ga0436361_0238923 Ga0436361_0238923_1627_2325 225
298 3300039447 Ga0436361_0261403 Ga0436361_0261403_413_1090 225
299 3300039447 Ga0436361_0681592 Ga0436361_0681592_1070_1768 225
300 3300039447 Ga0436361_0843361 Ga0436361_0843361_77_775 225
301 3300039450 Ga0436363_0599359 Ga0436363_0599359_4826_5524 225
302 3300039450 Ga0436363_0885771 Ga0436363_0885771_204_902 225
303 3300044684 Ga0466966_0034352 Ga0466966_0034352_1584_2282 225
304 3300044706 Ga0466964_0085777 Ga0466964_0085777_394_1092 225
305 3300044719 Ga0466971_0062460 Ga0466971_0062460_564_1253 225
306 3300044735 Ga0466968_0025710 Ga0466968_0025710_958_1656 225
307 3300044842 Ga0466957_0195426 Ga0466957_0195426_348_1046 225
308 3300044842 Ga0466957_0206052 Ga0466957_0206052_343_1032 225
309 3300044901 Ga0466960_0329898 Ga0466960_0329898_67_765 225
310 3300045049 Ga0466959_0075547 Ga0466959_0075547_1031_1729 225
311 3300045049 Ga0466959_0428104 Ga0466959_0428104_172_861 225
312 3300045836 Ga0466958_0021853 Ga0466958_0021853_306_995 225
313 3300045976 Ga0466967_0291750 Ga0466967_0291750_757_1455 225
314 3300046459 Ga0495629_0418204 Ga0495629_0418204_170_868 225
315 3300046460 Ga0495638_0039729 Ga0495638_0039729_889_1587 225
316 3300046460 Ga0495638_0048119 Ga0495638_0048119_384_1082 225
317 3300046460 Ga0495638_0130212 Ga0495638_0130212_39_737 225
318 3300046460 Ga0495638_0291070 Ga0495638_0291070_40_738 225
319 3300046461 Ga0495641_0159147 Ga0495641_0159147_261_959 225
320 3300046462 Ga0495651_0009405 Ga0495651_0009405_1020_1769 225
321 3300046462 Ga0495651_0022220 Ga0495651_0022220_1576_2274 225
322 3300046471 Ga0495650_0031088 Ga0495650_0031088_1228_1926 225
323 3300046477 Ga0495664_0277789 Ga0495664_0277789_299_997 225
324 3300046492 Ga0495585_0207160 Ga0495585_0207160_20_817 225
325 3300046499 Ga0495594_0017602 Ga0495594_0017602_909_1607 225
326 3300046499 Ga0495594_0134716 Ga0495594_0134716_113_811 225
327 3300046501 Ga0495607_0204649 Ga0495607_0204649_43_741 225
328 3300046506 Ga0495583_0094892 Ga0495583_0094892_55_753 225
329 3300046507 Ga0495606_0349636 Ga0495606_0349636_37_735 225
330 3300046512 Ga0495610_0017507 Ga0495610_0017507_3258_3956 225
331 3300046518 Ga0495631_0164379 Ga0495631_0164379_174_872 225
332 3300046522 Ga0495643_0212575 Ga0495643_0212575_70_768 225
333 3300046522 Ga0495643_0227646 Ga0495643_0227646_170_868 225
334 3300046524 Ga0495648_0053168 Ga0495648_0053168_693_1391 225
335 3300046530 Ga0495654_0012651 Ga0495654_0012651_252_950 225
336 3300046543 Ga0495645_0177873 Ga0495645_0177873_640_1389 225
337 3300046557 Ga0495622_0005431 Ga0495622_0005431_2381_3079 225
338 3300046616 Ga0495668_0035943 Ga0495668_0035943_1278_1976 225
339 3300046642 Ga0495634_0326474 Ga0495634_0326474_193_891 225
340 3300046648 Ga0495611_0182921 Ga0495611_0182921_210_908 225
341 3300046660 Ga0495625_0073657 Ga0495625_0073657_1111_1809 225
342 3300046665 Ga0495661_0012280 Ga0495661_0012280_2757_3455 225
343 3300046674 Ga0495588_0203650 Ga0495588_0203650_251_949 225
344 3300046675 Ga0495657_0046244 Ga0495657_0046244_541_1290 225
345 3300046678 Ga0495599_0169263 Ga0495599_0169263_627_1325 225
346 3300046679 Ga0495623_0012870 Ga0495623_0012870_245_979 225
347 3300046689 Ga0495613_0056042 Ga0495613_0056042_1882_2580 225
348 3300046689 Ga0495613_0144755 Ga0495613_0144755_225_923 225
349 3300046691 Ga0495670_0012601 Ga0495670_0012601_1542_2240 225
350 3300046810 Ga0495660_0132991 Ga0495660_0132991_270_968 225
351 3300047315 Ga0495581_0193504 Ga0495581_0193504_450_1148 225
352 3300047317 Ga0495604_0105632 Ga0495604_0105632_841_1539 225
353 3300047317 Ga0495604_0358796 Ga0495604_0358796_164_913 225
354 3300047320 Ga0495672_0145424 Ga0495672_0145424_416_1114 225
355 3300047472 Ga0495686_0013762 Ga0495686_0013762_687_1385 225
356 3300047472 Ga0495686_0036693 Ga0495686_0036693_2303_3001 225
357 3300047472 Ga0495686_0074651 Ga0495686_0074651_793_1491 225
358 3300048088 Ga0495602_0194229 Ga0495602_0194229_829_1527 225
359 3300048091 Ga0495626_0061575 Ga0495626_0061575_278_976 225
360 3300048903 Ga0496100_0306526 Ga0496100_0306526_224_922 225
361 3300048906 Ga0496103_0174513 Ga0496103_0174513_350_1048 225
362 3300048908 Ga0496105_0443611 Ga0496105_0443611_251_949 225
363 3300048909 Ga0496106_0001358 Ga0496106_0001358_16258_16956 225
364 3300048909 Ga0496106_0052530 Ga0496106_0052530_2015_2713 225
365 3300048909 Ga0496106_0736254 Ga0496106_0736254_74_772 225
366 3300048910 Ga0496107_0403907 Ga0496107_0403907_58_756 225
367 3300048911 Ga0496108_0204804 Ga0496108_0204804_991_1689 225
368 3300048913 Ga0496110_0113009 Ga0496110_0113009_521_1219 225
369 3300048913 Ga0496110_0216548 Ga0496110_0216548_880_1578 225
370 3300048914 Ga0496111_0294153 Ga0496111_0294153_31_729 225
371 3300048914 Ga0496111_0412806 Ga0496111_0412806_108_806 225
372 3300048917 Ga0496114_0281214 Ga0496114_0281214_231_929 225
373 3300048918 Ga0496115_0020165 Ga0496115_0020165_4381_5079 225
374 3300048918 Ga0496115_0101425 Ga0496115_0101425_1233_1931 225
375 3300048919 Ga0496116_0000965 Ga0496116_0000965_2701_3399 225
376 3300048919 Ga0496116_0143291 Ga0496116_0143291_390_1088 225
377 3300048920 Ga0496117_0034522 Ga0496117_0034522_1810_2508 225
378 3300048920 Ga0496117_0105182 Ga0496117_0105182_972_1670 225
379 3300048920 Ga0496117_0106166 Ga0496117_0106166_379_1077 225
380 3300048920 Ga0496117_0144340 Ga0496117_0144340_85_783 225
381 3300048920 Ga0496117_0148732 Ga0496117_0148732_111_809 225
382 3300048921 Ga0496118_0003027 Ga0496118_0003027_4740_5438 225
383 3300048921 Ga0496118_0010242 Ga0496118_0010242_8507_9205 225
384 3300048921 Ga0496118_0020353 Ga0496118_0020353_3435_4133 225
385 3300048921 Ga0496118_0028559 Ga0496118_0028559_2532_3230 225
386 3300048921 Ga0496118_0039154 Ga0496118_0039154_1427_2125 225
387 3300048921 Ga0496118_0084187 Ga0496118_0084187_426_1124 225
388 3300048921 Ga0496118_0120085 Ga0496118_0120085_764_1462 225
389 3300048922 Ga0496119_0024118 Ga0496119_0024118_3248_3946 225
390 3300048922 Ga0496119_0035437 Ga0496119_0035437_1513_2217 225
391 3300048922 Ga0496119_0051808 Ga0496119_0051808_492_1190 225
392 3300048922 Ga0496119_0064646 Ga0496119_0064646_405_1103 225
393 3300048922 Ga0496119_0119652 Ga0496119_0119652_397_1095 225
394 3300048924 Ga0496121_0001622 Ga0496121_0001622_20289_20987 225
395 3300048924 Ga0496121_0023791 Ga0496121_0023791_2582_3286 225
396 3300048924 Ga0496121_0028197 Ga0496121_0028197_1310_2008 225
397 3300048924 Ga0496121_0036329 Ga0496121_0036329_382_1080 225
398 3300048924 Ga0496121_0126551 Ga0496121_0126551_1169_1867 225
399 3300048924 Ga0496121_0161432 Ga0496121_0161432_635_1333 225
400 3300048924 Ga0496121_0208762 Ga0496121_0208762_644_1342 225
401 3300048925 Ga0496122_0024545 Ga0496122_0024545_586_1284 225
402 3300048925 Ga0496122_0209236 Ga0496122_0209236_352_1050 225
403 3300048926 Ga0496123_0065829 Ga0496123_0065829_525_1223 225
404 3300048927 Ga0496124_0002957 Ga0496124_0002957_10340_11038 225
405 3300048927 Ga0496124_0095992 Ga0496124_0095992_168_866 225
406 3300048927 Ga0496124_0218398 Ga0496124_0218398_699_1397 225
407 3300048927 Ga0496124_0231950 Ga0496124_0231950_644_1342 225
408 3300048927 Ga0496124_0266812 Ga0496124_0266812_411_1109 225
409 3300048927 Ga0496124_0469553 Ga0496124_0469553_89_793 225
410 3300048927 Ga0496124_0526149 Ga0496124_0526149_50_748 225
411 3300048928 Ga0496125_0001630 Ga0496125_0001630_23404_24102 225
412 3300048928 Ga0496125_0056184 Ga0496125_0056184_813_1511 225
413 3300048928 Ga0496125_0083260 Ga0496125_0083260_976_1674 225
414 3300048928 Ga0496125_0089991 Ga0496125_0089991_1041_1739 225
415 3300048928 Ga0496125_0099406 Ga0496125_0099406_1289_1987 225
416 3300048928 Ga0496125_0137524 Ga0496125_0137524_348_1046 225
417 3300048928 Ga0496125_0281648 Ga0496125_0281648_202_900 225
418 3300048929 Ga0496126_0003803 Ga0496126_0003803_8226_8924 225
419 3300048929 Ga0496126_0033555 Ga0496126_0033555_559_1257 225
420 3300048929 Ga0496126_0070139 Ga0496126_0070139_2288_2986 225
421 3300048929 Ga0496126_0081503 Ga0496126_0081503_1267_1965 225
422 3300048929 Ga0496126_0312538 Ga0496126_0312538_285_983 225
423 3300048929 Ga0496126_0373969 Ga0496126_0373969_177_875 225
424 3300048929 Ga0496126_0486006 Ga0496126_0486006_213_941 225
425 3300049460 Ga0495682_0081120 Ga0495682_0081120_441_1139 225
426 3300049460 Ga0495682_0131024 Ga0495682_0131024_170_868 225
427 3300049568 Ga0501031_0003114 Ga0501031_0003114_3983_4681 225
428 3300049569 Ga0501032_0000762 Ga0501032_0000762_9882_10580 225
429 3300049570 Ga0501033_0000136 Ga0501033_0000136_63086_63784 225
430 3300049570 Ga0501033_0026715 Ga0501033_0026715_1367_2083 225
431 3300049570 Ga0501033_0267830 Ga0501033_0267830_353_1060 225
432 3300049571 Ga0501034_0000251 Ga0501034_0000251_81637_82335 225
433 3300049571 Ga0501034_0134299 Ga0501034_0134299_700_1416 225
434 3300049572 Ga0501036_0000036 Ga0501036_0000036_7179_7877 225
435 3300049572 Ga0501036_0139078 Ga0501036_0139078_352_1068 225
436 3300049573 Ga0501037_0000867 Ga0501037_0000867_9902_10600 225
437 3300049574 Ga0501038_0000428 Ga0501038_0000428_28419_29117 225
438 3300049574 Ga0501038_0203480 Ga0501038_0203480_591_1310 225
439 3300049574 Ga0501038_0223971 Ga0501038_0223971_443_1159 225
440 3300049575 Ga0501039_0000273 Ga0501039_0000273_2502_3200 225
441 3300049578 Ga0501042_0170613 Ga0501042_0170613_345_1061 225
442 3300049579 Ga0501043_0000165 Ga0501043_0000165_21408_22106 225
443 3300049579 Ga0501043_0205795 Ga0501043_0205795_648_1367 225
444 3300049579 Ga0501043_0289433 Ga0501043_0289433_235_954 225
445 3300049579 Ga0501043_0624811 Ga0501043_0624811_37_753 225
446 3300049580 Ga0501046_0000839 Ga0501046_0000839_17109_17807 225
447 3300049581 Ga0501047_0000340 Ga0501047_0000340_45408_46106 225
448 3300049581 Ga0501047_0041364 Ga0501047_0041364_1724_2443 225
449 3300049582 Ga0501048_0001309 Ga0501048_0001309_15486_16184 225
450 3300049583 Ga0501067_0000457 Ga0501067_0000457_13147_13845 225
451 3300049583 Ga0501067_0087210 Ga0501067_0087210_512_1228 225
452 3300049584 Ga0501068_0000839 Ga0501068_0000839_6029_6727 225
453 3300049585 Ga0501069_0066434 Ga0501069_0066434_56_772 225
454 3300049586 Ga0501070_0000971 Ga0501070_0000971_8004_8702 225
455 3300049586 Ga0501070_0577973 Ga0501070_0577973_122_820 225
456 3300049587 Ga0501071_0079057 Ga0501071_0079057_146_844 225
457 3300049588 Ga0501072_0003301 Ga0501072_0003301_5147_5845 225
458 3300049589 Ga0501073_0000037 Ga0501073_0000037_79396_80094 225
459 3300049590 Ga0501074_0000167 Ga0501074_0000167_15523_16221 225
460 3300049741 Ga0501079_0002302 Ga0501079_0002302_6850_7548 225
461 3300049742 Ga0501080_0006603 Ga0501080_0006603_2548_3246 225
462 3300049744 Ga0501083_0001812 Ga0501083_0001812_2308_3006 225
463 3300049822 Ga0501035_0000142 Ga0501035_0000142_5227_5925 225
464 3300049822 Ga0501035_0088777 Ga0501035_0088777_1099_1815 225
465 3300049822 Ga0501035_0185286 Ga0501035_0185286_571_1278 225
466 3300049823 Ga0501044_0000414 Ga0501044_0000414_5405_6103 225
467 3300049823 Ga0501044_0021563 Ga0501044_0021563_564_1283 225
468 3300049823 Ga0501044_0022908 Ga0501044_0022908_1344_2051 225
469 3300049823 Ga0501044_0076769 Ga0501044_0076769_1239_1955 225
470 3300049823 Ga0501044_0394898 Ga0501044_0394898_250_966 225
471 3300049824 Ga0501045_0002539 Ga0501045_0002539_5483_6181 225
472 3300050490 nmdc:mga03n38_180079_c1 nmdc:mga03n38_180079_c1_163_861 225
473 3300050491 nmdc:mga00v17_28827_c1 nmdc:mga00v17_28827_c1_992_1690 225
474 3300050492 nmdc:mga0yw44_179253_c1 nmdc:mga0yw44_179253_c1_116_814 225
475 3300050492 nmdc:mga0yw44_4551_c1 nmdc:mga0yw44_4551_c1_2861_3559 225
476 3300050492 nmdc:mga0yw44_7729_c1 nmdc:mga0yw44_7729_c1_3410_4108 225
477 3300050513 nmdc:mga0rr50_234301_c1 nmdc:mga0rr50_234301_c1_456_1154 225
478 3300050514 nmdc:mga08x19_86194_c1 nmdc:mga08x19_86194_c1_552_1250 225
479 3300050516 nmdc:mga0sz30_51614_c1 nmdc:mga0sz30_51614_c1_424_1122 225
480 3300050516 nmdc:mga0sz30_75666_c1 nmdc:mga0sz30_75666_c1_379_1077 225
481 3300053084 Ga0495595_0087546 Ga0495595_0087546_16_765 225
482 3300053086 Ga0500578_0230005 Ga0500578_0230005_305_1003 225
483 3300053087 Ga0500643_000048 Ga0500643_000048_96721_97419 225
484 3300053088 Ga0500644_0044232 Ga0500644_0044232_70_768 225
485 3300053091 Ga0500647_0093291 Ga0500647_0093291_416_1114 225
486 3300053092 Ga0500583_0010766 Ga0500583_0010766_1905_2603 225
487 3300053092 Ga0500583_0060762 Ga0500583_0060762_970_1668 225
488 3300053093 Ga0500651_0002004 Ga0500651_0002004_4457_5155 225
489 3300053094 Ga0500566_0002605 Ga0500566_0002605_1452_2150 225
490 3300053094 Ga0500566_0006460 Ga0500566_0006460_5587_6285 225
491 3300053094 Ga0500566_0075920 Ga0500566_0075920_617_1315 225
492 3300053096 Ga0500641_0032761 Ga0500641_0032761_690_1388 225
493 3300053098 Ga0500650_0025917 Ga0500650_0025917_880_1578 225
494 3300053102 Ga0500554_041214 Ga0500554_041214_171_869 225
495 3300053103 Ga0500555_027405 Ga0500555_027405_393_1091 225
496 3300053104 Ga0500556_0000003 Ga0500556_0000003_363807_364505 225
497 3300053108 Ga0500562_027131 Ga0500562_027131_30_728 225
498 3300053118 Ga0500594_0086696 Ga0500594_0086696_234_932 225
499 3300053119 Ga0500595_000333 Ga0500595_000333_16892_17590 225
500 3300053119 Ga0500595_000497 Ga0500595_000497_6290_6988 225
501 3300053119 Ga0500595_002282 Ga0500595_002282_1954_2652 225
502 3300053122 Ga0500608_063928 Ga0500608_063928_619_1317 225
503 3300053122 Ga0500608_141759 Ga0500608_141759_228_926 225
504 3300053123 Ga0500614_040520 Ga0500614_040520_418_1116 225
505 3300053125 Ga0500618_006607 Ga0500618_006607_710_1408 225
506 3300053129 Ga0500628_081385 Ga0500628_081385_55_753 225
507 3300053130 Ga0500642_0000015 Ga0500642_0000015_150089_150787 225
508 3300053130 Ga0500642_0001744 Ga0500642_0001744_624_1322 225
509 3300053130 Ga0500642_0197676 Ga0500642_0197676_133_831 225
510 3300053131 Ga0500652_010728 Ga0500652_010728_518_1216 225
511 3300053134 Ga0500658_0031805 Ga0500658_0031805_823_1521 225
512 3300053136 Ga0500559_0001714 Ga0500559_0001714_9922_10620 225
513 3300053136 Ga0500559_0081897 Ga0500559_0081897_336_1034 225
514 3300053138 Ga0500564_150650 Ga0500564_150650_187_885 225
515 3300053139 Ga0500568_0000536 Ga0500568_0000536_23111_23809 225
516 3300053139 Ga0500568_0092354 Ga0500568_0092354_309_1007 225
517 3300053140 Ga0500573_0067724 Ga0500573_0067724_453_1208 225
518 3300053145 Ga0500586_000330 Ga0500586_000330_8403_9101 225
519 3300053148 Ga0500590_031070 Ga0500590_031070_883_1581 225
520 3300053148 Ga0500590_046959 Ga0500590_046959_414_1112 225
521 3300053150 Ga0500603_014424 Ga0500603_014424_863_1561 225
522 3300053150 Ga0500603_087833 Ga0500603_087833_170_868 225
523 3300053151 Ga0500604_0053896 Ga0500604_0053896_40_738 225
524 3300053153 Ga0500616_0000033 Ga0500616_0000033_101821_102519 225
525 3300053153 Ga0500616_0030013 Ga0500616_0030013_1199_1897 225
526 3300053156 Ga0500622_0017921 Ga0500622_0017921_276_974 225
527 3300053156 Ga0500622_0026896 Ga0500622_0026896_1247_1945 225
528 3300053158 Ga0500627_0043782 Ga0500627_0043782_493_1191 225
529 3300053158 Ga0500627_0081653 Ga0500627_0081653_249_947 225
530 3300053162 Ga0500638_016198 Ga0500638_016198_368_1066 225
531 3300053163 Ga0500639_060191 Ga0500639_060191_1217_1915 225
532 3300053177 Ga0500636_0015308 Ga0500636_0015308_1653_2351 225
533 3300053178 Ga0500637_0000060 Ga0500637_0000060_24568_25266 225
534 3300053724 Ga0500570_077593 Ga0500570_077593_132_830 225
535 3300053727 Ga0500611_021920 Ga0500611_021920_265_963 225
536 3300053735 Ga0500596_001647 Ga0500596_001647_949_1647 225
537 3300053736 Ga0500599_002351 Ga0500599_002351_434_1132 225
538 3300054114 Ga0501084_0005116 Ga0501084_0005116_1510_2208 225
539 3300055283 Ga0500661_001013 Ga0500661_001013_2736_3434 225
540 3300060353 Ga0501082_0004333 Ga0501082_0004333_2666_3364 225
541 3300061719 Ga0466962_0001247 Ga0466962_0001247_6480_7169 225
542 iso_pu_bacteria 2582581279 2585147145 225
543 iso_pu_bacteria 2585428106 2587918018 225
544 iso_pu_bacteria 2643221545 2643748399 225
545 iso_pu_bacteria 2643221552 2643780674 225
546 iso_pu_bacteria 2643221584 2643929447 225
547 iso_pu_bacteria 2643221640 2644224552 225
548 iso_pu_bacteria 2643221642 2644234513 225
549 iso_pu_bacteria 2643221691 2644508212 225
550 iso_pu_bacteria 2857504554 2857504811 225
551 iso_pu_bacteria 2884960567 2884965359 225
552 iso_pu_bacteria 2928531327 2928532858 225
553 3300001990 JGI24737J22298_10006756 JGI24737J22298_100067565 226
554 3300002067 JGI24735J21928_10004802 JGI24735J21928_100048026 226
555 3300002067 JGI24735J21928_10017522 JGI24735J21928_100175221 226
556 3300003214 JGI25165J46597_1000165 JGI25165J46597_100016565 226
557 3300005327 Ga0070658_10004018 Ga0070658_100040189 226
558 3300005327 Ga0070658_10004565 Ga0070658_1000456512 226
559 3300005327 Ga0070658_10212129 Ga0070658_102121292 226
560 3300005328 Ga0070676_10000416 Ga0070676_1000041616 226
561 3300005334 Ga0068869_100015254 Ga0068869_1000152546 226
562 3300005338 Ga0068868_100000013 Ga0068868_1000000132 226
563 3300005339 Ga0070660_100002444 Ga0070660_1000024446 226
564 3300005339 Ga0070660_100033044 Ga0070660_1000330442 226
565 3300005364 Ga0070673_100000002 Ga0070673_100000002196 226
566 3300005366 Ga0070659_100148389 Ga0070659_1001483894 226
567 3300005459 Ga0068867_100000012 Ga0068867_10000001218 226
568 3300005539 Ga0068853_100041194 Ga0068853_1000411944 226
569 3300005547 Ga0070693_100020120 Ga0070693_1000201205 226
570 3300005548 Ga0070665_100535622 Ga0070665_1005356222 226
571 3300005563 Ga0068855_100000095 Ga0068855_10000009548 226
572 3300005563 Ga0068855_100071449 Ga0068855_1000714492 226
573 3300005563 Ga0068855_100498496 Ga0068855_1004984962 226
574 3300005614 Ga0068856_100016744 Ga0068856_1000167444 226
575 3300005718 Ga0068866_10071782 Ga0068866_100717823 226
576 3300006881 Ga0068865_100000004 Ga0068865_100000004195 226
577 3300009093 Ga0105240_10064674 Ga0105240_100646742 226
578 3300009093 Ga0105240_10323474 Ga0105240_103234742 226
579 3300009098 Ga0105245_10001027 Ga0105245_100010277 226
580 3300009148 Ga0105243_10000146 Ga0105243_1000014617 226
581 3300009176 Ga0105242_10000497 Ga0105242_1000049728 226
582 3300009545 Ga0105237_10133176 Ga0105237_101331764 226
583 3300009553 Ga0105249_10015630 Ga0105249_100156305 226
584 3300011119 Ga0105246_10000138 Ga0105246_1000013819 226
585 3300013104 Ga0157370_10000096 Ga0157370_1000009645 226
586 3300013104 Ga0157370_10274931 Ga0157370_102749312 226
587 3300013105 Ga0157369_10022918 Ga0157369_100229186 226
588 3300013296 Ga0157374_10001104 Ga0157374_100011049 226
589 3300013297 Ga0157378_10015726 Ga0157378_100157269 226
590 3300013306 Ga0163162_11080978 Ga0163162_110809782 226
591 3300013307 Ga0157372_10034063 Ga0157372_100340638 226
592 3300013308 Ga0157375_10000587 Ga0157375_1000058713 226
593 3300014497 Ga0182008_10154201 Ga0182008_101542012 226
594 3300014969 Ga0157376_10000131 Ga0157376_1000013140 226
595 3300021384 Ga0213876_10000345 Ga0213876_1000034511 226
596 3300021384 Ga0213876_10038689 Ga0213876_100386893 226
597 3300025250 Ga0209026_1001831 Ga0209026_10018311 226
598 3300025254 Ga0209148_1000074 Ga0209148_1000074225 226
599 3300025254 Ga0209148_1001194 Ga0209148_100119418 226
600 3300025261 Ga0209233_1000098 Ga0209233_1000098224 226
601 3300025272 Ga0209455_1000574 Ga0209455_100057422 226
602 3300025272 Ga0209455_1036672 Ga0209455_10366721 226
603 3300025899 Ga0207642_10150907 Ga0207642_101509072 226
604 3300025907 Ga0207645_10004384 Ga0207645_100043847 226
605 3300025909 Ga0207705_10000055 Ga0207705_10000055140 226
606 3300025909 Ga0207705_10007178 Ga0207705_100071786 226
607 3300025911 Ga0207654_10496656 Ga0207654_104966561 226
608 3300025913 Ga0207695_10005778 Ga0207695_100057787 226
609 3300025913 Ga0207695_10525076 Ga0207695_105250762 226
610 3300025914 Ga0207671_10061198 Ga0207671_100611982 226
611 3300025919 Ga0207657_10004951 Ga0207657_1000495111 226
612 3300025919 Ga0207657_10139147 Ga0207657_101391473 226
613 3300025927 Ga0207687_10089008 Ga0207687_100890083 226
614 3300025934 Ga0207686_10067444 Ga0207686_100674442 226
615 3300025935 Ga0207709_10000314 Ga0207709_1000031462 226
616 3300025938 Ga0207704_10000005 Ga0207704_1000000518 226
617 3300025942 Ga0207689_10001653 Ga0207689_1000165318 226
618 3300025949 Ga0207667_10000016 Ga0207667_10000016282 226
619 3300025949 Ga0207667_10079777 Ga0207667_100797774 226
620 3300025960 Ga0207651_10000007 Ga0207651_1000000718 226
621 3300025961 Ga0207712_10007902 Ga0207712_100079026 226
622 3300026023 Ga0207677_10000085 Ga0207677_100000857 226
623 3300026041 Ga0207639_10038697 Ga0207639_100386973 226
624 3300026078 Ga0207702_10005342 Ga0207702_100053428 226
625 3300026089 Ga0207648_10000005 Ga0207648_1000000519 226
626 3300031730 Ga0307516_10000034 Ga0307516_1000003477 226
627 3300032004 Ga0307414_10197404 Ga0307414_101974042 226
628 3300037312 Ga0395899_0000713 Ga0395899_0000713_232_918 226
629 3300039437 Ga0436365_0916510 Ga0436365_0916510_16258_16944 226
630 3300039437 Ga0436365_1541345 Ga0436365_1541345_9705_10445 226
631 3300039450 Ga0436363_0168726 Ga0436363_0168726_3295_4035 226
632 3300048916 Ga0496113_0213646 Ga0496113_0213646_239_919 226
633 3300048920 Ga0496117_0013409 Ga0496117_0013409_719_1426 226
634 3300048921 Ga0496118_0070052 Ga0496118_0070052_157_864 226
635 3300048925 Ga0496122_0036640 Ga0496122_0036640_647_1354 226
636 3300048926 Ga0496123_0022020 Ga0496123_0022020_2527_3234 226
637 3300048928 Ga0496125_0295403 Ga0496125_0295403_42_785 226
638 3300048929 Ga0496126_0028894 Ga0496126_0028894_1284_1970 226
639 3300053091 Ga0500647_0178970 Ga0500647_0178970_40_753 226
640 3300053093 Ga0500651_0002704 Ga0500651_0002704_174_887 226
641 3300053130 Ga0500642_0015152 Ga0500642_0015152_2000_2713 226
642 3300053133 Ga0500655_000460 Ga0500655_000460_6512_7225 226
643 3300053148 Ga0500590_007211 Ga0500590_007211_966_1679 226
644 3300053724 Ga0500570_004099 Ga0500570_004099_5816_6529 226
645 3300053730 Ga0500645_029154 Ga0500645_029154_167_883 226
646 iso_pu_bacteria 2643221598 2643998673 226
647 iso_pu_bacteria 2643221622 2644125726 226
648 3300009177 Ga0105248_10007949 Ga0105248_1000794913 227
649 3300021361 Ga0213872_10070428 Ga0213872_100704282 227
650 3300025299 Ga0209256_1010559 Ga0209256_10105592 227
651 3300025941 Ga0207711_10004629 Ga0207711_1000462913 227
652 3300037466 Ga0395898_0204761 Ga0395898_0204761_498_1184 227
653 3300037471 Ga0395905_0034469 Ga0395905_0034469_2532_3218 227
654 3300037471 Ga0395905_0410047 Ga0395905_0410047_361_1047 227
655 3300038443 Ga0395901_0029978 Ga0395901_0029978_1291_1977 227
656 3300039447 Ga0436361_0546846 Ga0436361_0546846_871_1566 227
657 3300042012 Ga0439455_0059366 Ga0439455_0059366_110_796 227
658 3300049568 Ga0501031_0026710 Ga0501031_0026710_3028_3723 227
659 3300049571 Ga0501034_0008471 Ga0501034_0008471_9756_10454 227
660 3300049744 Ga0501083_0016896 Ga0501083_0016896_3947_4633 227
661 3300053134 Ga0500658_0055776 Ga0500658_0055776_286_984 227
662 3300053139 Ga0500568_0084443 Ga0500568_0084443_136_834 227
663 3300002067 JGI24735J21928_10011300 JGI24735J21928_100113003 228
664 3300003322 rootL2_10085247 rootL2_100852472 228
665 3300003322 rootL2_10136953 rootL2_101369532 228
666 3300003794 Ga0055531_10001047 Ga0055531_1000104714 228
667 3300005262 Ga0065165_1004950 Ga0065165_10049503 228
668 3300005457 Ga0070662_100159029 Ga0070662_1001590292 228
669 3300006186 Ga0075369_10004680 Ga0075369_100046801 228
670 3300006195 Ga0075366_10086221 Ga0075366_100862212 228
671 3300006237 Ga0097621_100872561 Ga0097621_1008725611 228
672 3300009093 Ga0105240_10298611 Ga0105240_102986112 228
673 3300013306 Ga0163162_10026231 Ga0163162_100262312 228
674 3300014968 Ga0157379_10014381 Ga0157379_100143813 228
675 3300014968 Ga0157379_10027684 Ga0157379_100276842 228
676 3300025297 Ga0209758_1001570 Ga0209758_100157012 228
677 3300025297 Ga0209758_1026731 Ga0209758_10267314 228
678 3300025304 Ga0209257_1000066 Ga0209257_100006653 228
679 3300025904 Ga0207647_10152771 Ga0207647_101527711 228
680 3300025904 Ga0207647_10359411 Ga0207647_103594111 228
681 3300025915 Ga0207693_10166544 Ga0207693_101665442 228
682 3300025927 Ga0207687_10201791 Ga0207687_102017912 228
683 3300025933 Ga0207706_10010431 Ga0207706_1001043110 228
684 3300025972 Ga0207668_10436882 Ga0207668_104368822 228
685 3300026067 Ga0207678_10746243 Ga0207678_107462431 228
686 3300031240 Ga0265320_10001345 Ga0265320_1000134520 228
687 3300039447 Ga0436361_0108203 Ga0436361_0108203_381_1151 228
688 3300039447 Ga0436361_0186477 Ga0436361_0186477_585_1325 228
689 3300041410 Ga0439461_0035617 Ga0439461_0035617_56_808 228
690 3300042005 Ga0439448_0002340 Ga0439448_0002340_4384_5082 228
691 3300042005 Ga0439448_0024185 Ga0439448_0024185_843_1541 228
692 3300042012 Ga0439455_0007335 Ga0439455_0007335_1246_1944 228
693 3300042012 Ga0439455_0008361 Ga0439455_0008361_766_1464 228
694 3300042157 Ga0439458_0000986 Ga0439458_0000986_6013_6705 228
695 3300042157 Ga0439458_0001013 Ga0439458_0001013_1392_2090 228
696 3300042157 Ga0439458_0001992 Ga0439458_0001992_1209_1907 228
697 3300044684 Ga0466966_0058718 Ga0466966_0058718_1542_2240 228
698 3300045049 Ga0466959_0042510 Ga0466959_0042510_2555_3313 228
699 3300045049 Ga0466959_0296235 Ga0466959_0296235_59_745 228
700 3300045836 Ga0466958_0359931 Ga0466958_0359931_195_893 228
701 3300046453 Ga0495627_000209 Ga0495627_000209_54444_55193 228
702 3300046460 Ga0495638_0000434 Ga0495638_0000434_30887_31600 228
703 3300046472 Ga0495580_0348313 Ga0495580_0348313_190_960 228
704 3300046512 Ga0495610_0005291 Ga0495610_0005291_8189_8905 228
705 3300046660 Ga0495625_0039826 Ga0495625_0039826_2154_2876 228
706 3300047469 Ga0495673_0000108 Ga0495673_0000108_124628_125344 228
707 3300048903 Ga0496100_0327012 Ga0496100_0327012_171_857 228
708 3300048918 Ga0496115_0004981 Ga0496115_0004981_6924_7610 228
709 3300049571 Ga0501034_0146924 Ga0501034_0146924_732_1427 228
710 3300050491 nmdc:mga00v17_26492_c1 nmdc:mga00v17_26492_c1_2418_3116 228
711 3300050492 nmdc:mga0yw44_341776_c1 nmdc:mga0yw44_341776_c1_107_805 228
712 3300050492 nmdc:mga0yw44_50500_c1 nmdc:mga0yw44_50500_c1_1611_2309 228
713 3300050492 nmdc:mga0yw44_84115_c1 nmdc:mga0yw44_84115_c1_916_1614 228
714 3300053087 Ga0500643_005672 Ga0500643_005672_573_1259 228
715 3300053096 Ga0500641_0023374 Ga0500641_0023374_11_709 228
716 3300053123 Ga0500614_015345 Ga0500614_015345_804_1550 228
717 3300053136 Ga0500559_0000112 Ga0500559_0000112_4279_5028 228
718 3300053156 Ga0500622_0023088 Ga0500622_0023088_2428_3174 228
719 3300053177 Ga0500636_0040450 Ga0500636_0040450_374_1096 228
720 3300001990 JGI24737J22298_10001157 JGI24737J22298_100011577 229
721 3300001990 JGI24737J22298_10002048 JGI24737J22298_100020486 229
722 3300003215 JGI25153J46596_10000103 JGI25153J46596_1000010366 229
723 3300003322 rootL2_10056079 rootL2_100560793 229
724 3300003771 Ga0055526_1023389 Ga0055526_10233892 229
725 3300003771 Ga0055526_1030086 Ga0055526_10300862 229
726 3300003773 Ga0055537_1001200 Ga0055537_10012008 229
727 3300003775 Ga0055524_1010000 Ga0055524_10100002 229
728 3300003781 Ga0055536_1000883 Ga0055536_10008836 229
729 3300003781 Ga0055536_1001272 Ga0055536_10012726 229
730 3300003790 Ga0055528_1007152 Ga0055528_10071525 229
731 3300003791 Ga0055530_10001417 Ga0055530_1000141711 229
732 3300003791 Ga0055530_10034337 Ga0055530_100343372 229
733 3300003794 Ga0055531_10000274 Ga0055531_1000027449 229
734 3300003794 Ga0055531_10022251 Ga0055531_100222511 229
735 3300005262 Ga0065165_1000256 Ga0065165_100025652 229
736 3300005331 Ga0070670_100205126 Ga0070670_1002051262 229
737 3300005339 Ga0070660_100204054 Ga0070660_1002040541 229
738 3300005339 Ga0070660_100625404 Ga0070660_1006254041 229
739 3300005347 Ga0070668_100019990 Ga0070668_1000199905 229
740 3300005366 Ga0070659_100003649 Ga0070659_1000036497 229
741 3300005539 Ga0068853_100470288 Ga0068853_1004702881 229
742 3300005548 Ga0070665_100154706 Ga0070665_1001547063 229
743 3300005548 Ga0070665_100174582 Ga0070665_1001745822 229
744 3300005548 Ga0070665_100203709 Ga0070665_1002037092 229
745 3300005577 Ga0068857_100021147 Ga0068857_1000211472 229
746 3300005719 Ga0068861_100207079 Ga0068861_1002070792 229
747 3300005843 Ga0068860_101020018 Ga0068860_1010200181 229
748 3300005937 Ga0081455_10002424 Ga0081455_1000242414 229
749 3300006038 Ga0075365_10164151 Ga0075365_101641512 229
750 3300006186 Ga0075369_10106555 Ga0075369_101065552 229
751 3300006195 Ga0075366_10008146 Ga0075366_100081466 229
752 3300006353 Ga0075370_10297882 Ga0075370_102978822 229
753 3300009098 Ga0105245_10003725 Ga0105245_100037255 229
754 3300013297 Ga0157378_10091415 Ga0157378_100914153 229
755 3300013307 Ga0157372_10294884 Ga0157372_102948842 229
756 3300014325 Ga0163163_10089709 Ga0163163_100897093 229
757 3300025263 Ga0209565_1000618 Ga0209565_10006186 229
758 3300025273 Ga0209673_1000722 Ga0209673_10007226 229
759 3300025273 Ga0209673_1027785 Ga0209673_10277852 229
760 3300025292 Ga0209676_1000243 Ga0209676_100024374 229
761 3300025292 Ga0209676_1000311 Ga0209676_100031125 229
762 3300025295 Ga0209564_1000713 Ga0209564_100071335 229
763 3300025295 Ga0209564_1009741 Ga0209564_10097412 229
764 3300025295 Ga0209564_1032344 Ga0209564_10323441 229
765 3300025297 Ga0209758_1000239 Ga0209758_100023988 229
766 3300025297 Ga0209758_1001566 Ga0209758_100156618 229
767 3300025298 Ga0209050_1000244 Ga0209050_100024474 229
768 3300025298 Ga0209050_1000375 Ga0209050_100037525 229
769 3300025298 Ga0209050_1011876 Ga0209050_10118762 229
770 3300025298 Ga0209050_1014540 Ga0209050_10145402 229
771 3300025299 Ga0209256_1001119 Ga0209256_100111927 229
772 3300025299 Ga0209256_1002155 Ga0209256_100215510 229
773 3300025299 Ga0209256_1008041 Ga0209256_10080412 229
774 3300025303 Ga0209051_1003593 Ga0209051_10035939 229
775 3300025304 Ga0209257_1000140 Ga0209257_100014050 229
776 3300025304 Ga0209257_1001119 Ga0209257_100111930 229
777 3300025304 Ga0209257_1004459 Ga0209257_10044593 229
778 3300025304 Ga0209257_1023078 Ga0209257_10230783 229
779 3300025904 Ga0207647_10025784 Ga0207647_100257845 229
780 3300025927 Ga0207687_10000755 Ga0207687_100007557 229
781 3300025932 Ga0207690_10004570 Ga0207690_100045707 229
782 3300025932 Ga0207690_10036500 Ga0207690_100365003 229
783 3300026041 Ga0207639_10255690 Ga0207639_102556902 229
784 3300026088 Ga0207641_10341334 Ga0207641_103413342 229
785 3300026116 Ga0207674_10000989 Ga0207674_1000098931 229
786 3300026118 Ga0207675_100343902 Ga0207675_1003439022 229
787 3300028379 Ga0268266_10166098 Ga0268266_101660983 229
788 3300028379 Ga0268266_10235109 Ga0268266_102351091 229
789 3300028379 Ga0268266_10545318 Ga0268266_105453182 229
790 3300028794 Ga0307515_10033355 Ga0307515_100333557 229
791 3300030522 Ga0307512_10191584 Ga0307512_101915842 229
792 3300031456 Ga0307513_10079397 Ga0307513_100793973 229
793 3300031456 Ga0307513_10270222 Ga0307513_102702222 229
794 3300033180 Ga0307510_10129319 Ga0307510_101293191 229
795 3300042012 Ga0439455_0071768 Ga0439455_0071768_58_747 229
796 3300044684 Ga0466966_0058072 Ga0466966_0058072_1503_2204 229
797 3300044694 Ga0466963_0037193 Ga0466963_0037193_1338_2039 229
798 3300044719 Ga0466971_0024553 Ga0466971_0024553_136_837 229
799 3300044842 Ga0466957_0008884 Ga0466957_0008884_2150_2851 229
800 3300045049 Ga0466959_0005917 Ga0466959_0005917_3309_4010 229
801 3300045836 Ga0466958_0093525 Ga0466958_0093525_216_917 229
802 3300046457 Ga0495590_0002168 Ga0495590_0002168_972_1706 229
803 3300046460 Ga0495638_0000326 Ga0495638_0000326_50472_51206 229
804 3300046460 Ga0495638_0005521 Ga0495638_0005521_7090_7800 229
805 3300046471 Ga0495650_0000069 Ga0495650_0000069_3369_4085 229
806 3300046471 Ga0495650_0116783 Ga0495650_0116783_231_965 229
807 3300046506 Ga0495583_0000001 Ga0495583_0000001_517596_518423 229
808 3300046507 Ga0495606_0016300 Ga0495606_0016300_3832_4584 229
809 3300046512 Ga0495610_0002007 Ga0495610_0002007_3606_4361 229
810 3300046512 Ga0495610_0004447 Ga0495610_0004447_5500_6234 229
811 3300046513 Ga0495616_0000115 Ga0495616_0000115_169_924 229
812 3300046518 Ga0495631_0001223 Ga0495631_0001223_12681_13415 229
813 3300046518 Ga0495631_0138305 Ga0495631_0138305_84_839 229
814 3300046519 Ga0495632_0012120 Ga0495632_0012120_3761_4510 229
815 3300046524 Ga0495648_0000165 Ga0495648_0000165_23444_24154 229
816 3300046524 Ga0495648_0112343 Ga0495648_0112343_542_1291 229
817 3300046525 Ga0495663_0025072 Ga0495663_0025072_48_803 229
818 3300046530 Ga0495654_0000024 Ga0495654_0000024_117922_118671 229
819 3300046616 Ga0495668_0000456 Ga0495668_0000456_35907_36626 229
820 3300046616 Ga0495668_0015595 Ga0495668_0015595_1570_2325 229
821 3300046616 Ga0495668_0018797 Ga0495668_0018797_1397_2107 229
822 3300046616 Ga0495668_0023744 Ga0495668_0023744_1527_2282 229
823 3300046616 Ga0495668_0074400 Ga0495668_0074400_327_1052 229
824 3300046616 Ga0495668_0081140 Ga0495668_0081140_973_1677 229
825 3300046660 Ga0495625_0000230 Ga0495625_0000230_19966_20715 229
826 3300046660 Ga0495625_0004316 Ga0495625_0004316_7526_8242 229
827 3300046660 Ga0495625_0006914 Ga0495625_0006914_5530_6285 229
828 3300046660 Ga0495625_0018507 Ga0495625_0018507_149_853 229
829 3300046664 Ga0495659_0131102 Ga0495659_0131102_26_781 229
830 3300046692 Ga0495671_0061171 Ga0495671_0061171_316_1050 229
831 3300047320 Ga0495672_0019609 Ga0495672_0019609_2662_3417 229
832 3300047445 Ga0495677_0008628 Ga0495677_0008628_2327_3031 229
833 3300047469 Ga0495673_0000344 Ga0495673_0000344_21573_22283 229
834 3300047469 Ga0495673_0003633 Ga0495673_0003633_6750_7499 229
835 3300047472 Ga0495686_0004056 Ga0495686_0004056_3378_4127 229
836 3300047472 Ga0495686_0011950 Ga0495686_0011950_5304_6038 229
837 3300047472 Ga0495686_0132889 Ga0495686_0132889_522_1241 229
838 3300048909 Ga0496106_0044228 Ga0496106_0044228_947_1663 229
839 3300048910 Ga0496107_0006558 Ga0496107_0006558_1203_1919 229
840 3300048918 Ga0496115_0001486 Ga0496115_0001486_15129_15884 229
841 3300048924 Ga0496121_0007823 Ga0496121_0007823_11157_11873 229
842 3300048924 Ga0496121_0244912 Ga0496121_0244912_317_1027 229
843 3300048924 Ga0496121_0366225 Ga0496121_0366225_62_772 229
844 3300048927 Ga0496124_0049091 Ga0496124_0049091_2857_3576 229
845 3300048928 Ga0496125_0095264 Ga0496125_0095264_1439_2158 229
846 3300049459 Ga0495678_003911 Ga0495678_003911_4389_5123 229
847 3300049569 Ga0501032_0056815 Ga0501032_0056815_1121_1825 229
848 3300049570 Ga0501033_0057089 Ga0501033_0057089_1777_2481 229
849 3300049573 Ga0501037_0186696 Ga0501037_0186696_33_737 229
850 3300049579 Ga0501043_0027908 Ga0501043_0027908_2580_3281 229
851 3300049579 Ga0501043_0198896 Ga0501043_0198896_581_1285 229
852 3300049580 Ga0501046_0516206 Ga0501046_0516206_130_834 229
853 3300049581 Ga0501047_0001905 Ga0501047_0001905_394_1095 229
854 3300049581 Ga0501047_0003425 Ga0501047_0003425_1066_1770 229
855 3300049583 Ga0501067_0135039 Ga0501067_0135039_131_835 229
856 3300049584 Ga0501068_0032662 Ga0501068_0032662_933_1637 229
857 3300049585 Ga0501069_0032150 Ga0501069_0032150_1919_2671 229
858 3300049592 Ga0501076_0191321 Ga0501076_0191321_57_761 229
859 3300049742 Ga0501080_0080214 Ga0501080_0080214_25_729 229
860 3300049744 Ga0501083_0042452 Ga0501083_0042452_1872_2576 229
861 3300049822 Ga0501035_0319208 Ga0501035_0319208_131_832 229
862 3300049823 Ga0501044_0008740 Ga0501044_0008740_4649_5353 229
863 3300049823 Ga0501044_0083517 Ga0501044_0083517_922_1623 229
864 3300050493 nmdc:mga0k408_199183_c1 nmdc:mga0k408_199183_c1_402_1151 229
865 3300050516 nmdc:mga0sz30_4919_c1 nmdc:mga0sz30_4919_c1_1255_1974 229
866 3300053086 Ga0500578_0000056 Ga0500578_0000056_82876_83610 229
867 3300053086 Ga0500578_0113492 Ga0500578_0113492_445_1197 229
868 3300053086 Ga0500578_0190611 Ga0500578_0190611_333_1034 229
869 3300053087 Ga0500643_000548 Ga0500643_000548_23794_24495 229
870 3300053087 Ga0500643_012763 Ga0500643_012763_512_1222 229
871 3300053087 Ga0500643_070398 Ga0500643_070398_231_947 229
872 3300053088 Ga0500644_0000089 Ga0500644_0000089_36485_37195 229
873 3300053088 Ga0500644_0028932 Ga0500644_0028932_181_915 229
874 3300053093 Ga0500651_0215834 Ga0500651_0215834_190_942 229
875 3300053096 Ga0500641_0018004 Ga0500641_0018004_812_1546 229
876 3300053096 Ga0500641_0025472 Ga0500641_0025472_1308_2018 229
877 3300053104 Ga0500556_0001687 Ga0500556_0001687_4290_5045 229
878 3300053108 Ga0500562_000489 Ga0500562_000489_6083_6817 229
879 3300053108 Ga0500562_006991 Ga0500562_006991_1173_1907 229
880 3300053118 Ga0500594_0000724 Ga0500594_0000724_2199_2933 229
881 3300053122 Ga0500608_000207 Ga0500608_000207_4271_4990 229
882 3300053125 Ga0500618_000034 Ga0500618_000034_4638_5393 229
883 3300053134 Ga0500658_0010451 Ga0500658_0010451_2234_2989 229
884 3300053136 Ga0500559_0033232 Ga0500559_0033232_325_1044 229
885 3300053136 Ga0500559_0089806 Ga0500559_0089806_377_1081 229
886 3300053136 Ga0500559_0147656 Ga0500559_0147656_263_955 229
887 3300053138 Ga0500564_000057 Ga0500564_000057_15755_16465 229
888 3300053153 Ga0500616_0001587 Ga0500616_0001587_3249_4016 229
889 3300053153 Ga0500616_0118939 Ga0500616_0118939_145_861 229
890 3300053156 Ga0500622_0001762 Ga0500622_0001762_9327_10061 229
891 3300053156 Ga0500622_0006755 Ga0500622_0006755_973_1692 229
892 3300053156 Ga0500622_0141881 Ga0500622_0141881_59_787 229
893 3300053727 Ga0500611_027584 Ga0500611_027584_180_890 229
894 3300053730 Ga0500645_000883 Ga0500645_000883_2894_3649 229
895 3300053730 Ga0500645_064013 Ga0500645_064013_28_729 229
896 3300053731 Ga0500609_000027 Ga0500609_000027_10808_11563 229
897 3300053731 Ga0500609_002135 Ga0500609_002135_1952_2656 229
898 3300060353 Ga0501082_0098486 Ga0501082_0098486_354_1058 229
899 3300000652 ARCol0yngRDRAFT_1002743 ARCol0yngRDRAFT_10027433 230
900 3300001989 JGI24739J22299_10082974 JGI24739J22299_100829741 230
901 3300002077 JGI24744J21845_10010918 JGI24744J21845_100109182 230
902 3300002774 JGI25150J39212_1001113 JGI25150J39212_10011131 230
903 3300003214 JGI25165J46597_1000007 JGI25165J46597_1000007312 230
904 3300003215 JGI25153J46596_10000253 JGI25153J46596_1000025335 230
905 3300003771 Ga0055526_1002472 Ga0055526_10024726 230
906 3300003773 Ga0055537_1000720 Ga0055537_10007207 230
907 3300003773 Ga0055537_1005264 Ga0055537_10052643 230
908 3300003775 Ga0055524_1000561 Ga0055524_100056125 230
909 3300003791 Ga0055530_10007674 Ga0055530_100076743 230
910 3300003792 Ga0055540_1003607 Ga0055540_10036076 230
911 3300003794 Ga0055531_10005338 Ga0055531_100053383 230
912 3300003794 Ga0055531_10036703 Ga0055531_100367032 230
913 3300004625 Ga0055543_1020464 Ga0055543_10204641 230
914 3300005262 Ga0065165_1001164 Ga0065165_100116427 230
915 3300005262 Ga0065165_1058454 Ga0065165_10584541 230
916 3300005339 Ga0070660_100019488 Ga0070660_1000194882 230
917 3300005353 Ga0070669_100765504 Ga0070669_1007655041 230
918 3300005354 Ga0070675_100134826 Ga0070675_1001348263 230
919 3300005355 Ga0070671_100067672 Ga0070671_1000676722 230
920 3300005364 Ga0070673_100334229 Ga0070673_1003342292 230
921 3300005366 Ga0070659_100036509 Ga0070659_1000365094 230
922 3300005436 Ga0070713_100222146 Ga0070713_1002221462 230
923 3300005456 Ga0070678_100010460 Ga0070678_1000104606 230
924 3300005459 Ga0068867_100276620 Ga0068867_1002766201 230
925 3300005563 Ga0068855_100298678 Ga0068855_1002986782 230
926 3300005616 Ga0068852_100000586 Ga0068852_10000058610 230
927 3300005617 Ga0068859_100005156 Ga0068859_1000051567 230
928 3300005842 Ga0068858_100009417 Ga0068858_1000094172 230
929 3300005844 Ga0068862_100015180 Ga0068862_1000151803 230
930 3300005985 Ga0081539_10073132 Ga0081539_100731322 230
931 3300006038 Ga0075365_10036163 Ga0075365_100361634 230
932 3300006042 Ga0075368_10003536 Ga0075368_100035367 230
933 3300006048 Ga0075363_100004455 Ga0075363_1000044558 230
934 3300006051 Ga0075364_10077984 Ga0075364_100779842 230
935 3300006177 Ga0075362_10021637 Ga0075362_100216372 230
936 3300006178 Ga0075367_10020984 Ga0075367_100209843 230
937 3300006178 Ga0075367_10037363 Ga0075367_100373633 230
938 3300006186 Ga0075369_10005108 Ga0075369_100051084 230
939 3300006186 Ga0075369_10238000 Ga0075369_102380002 230
940 3300006353 Ga0075370_10130135 Ga0075370_101301352 230
941 3300006844 Ga0075428_100150741 Ga0075428_1001507413 230
942 3300006881 Ga0068865_100480280 Ga0068865_1004802802 230
943 3300006931 Ga0097620_100005156 Ga0097620_1000051567 230
944 3300009101 Ga0105247_10503386 Ga0105247_105033861 230
945 3300009147 Ga0114129_10054829 Ga0114129_100548293 230
946 3300009177 Ga0105248_10001758 Ga0105248_100017585 230
947 3300009545 Ga0105237_10052574 Ga0105237_100525745 230
948 3300009553 Ga0105249_10179246 Ga0105249_101792462 230
949 3300010159 Ga0099796_10012567 Ga0099796_100125672 230
950 3300010375 Ga0105239_10851949 Ga0105239_108519492 230
951 3300012512 Ga0157327_1000745 Ga0157327_10007452 230
952 3300013100 Ga0157373_10079649 Ga0157373_100796492 230
953 3300013307 Ga0157372_10559346 Ga0157372_105593462 230
954 3300014326 Ga0157380_10122751 Ga0157380_101227513 230
955 3300014326 Ga0157380_10532302 Ga0157380_105323021 230
956 3300014968 Ga0157379_10067957 Ga0157379_100679573 230
957 3300017792 Ga0163161_10056570 Ga0163161_100565702 230
958 3300025208 Ga0209436_112907 Ga0209436_1129072 230
959 3300025233 Ga0209437_106743 Ga0209437_1067431 230
960 3300025245 Ga0207425_1000094 Ga0207425_100009478 230
961 3300025245 Ga0207425_1001939 Ga0207425_10019393 230
962 3300025258 Ga0209129_1001201 Ga0209129_10012019 230
963 3300025261 Ga0209233_1000026 Ga0209233_1000026313 230
964 3300025263 Ga0209565_1000007 Ga0209565_1000007206 230
965 3300025263 Ga0209565_1038534 Ga0209565_10385341 230
966 3300025273 Ga0209673_1001309 Ga0209673_10013092 230
967 3300025292 Ga0209676_1004805 Ga0209676_10048057 230
968 3300025294 Ga0209025_1000630 Ga0209025_100063019 230
969 3300025295 Ga0209564_1000745 Ga0209564_10007454 230
970 3300025295 Ga0209564_1008096 Ga0209564_10080961 230
971 3300025297 Ga0209758_1000002 Ga0209758_100000278 230
972 3300025297 Ga0209758_1000108 Ga0209758_1000108139 230
973 3300025297 Ga0209758_1000252 Ga0209758_10002525 230
974 3300025297 Ga0209758_1006552 Ga0209758_10065522 230
975 3300025297 Ga0209758_1021049 Ga0209758_10210495 230
976 3300025297 Ga0209758_1028026 Ga0209758_10280263 230
977 3300025298 Ga0209050_1000342 Ga0209050_100034281 230
978 3300025298 Ga0209050_1005517 Ga0209050_10055175 230
979 3300025299 Ga0209256_1000008 Ga0209256_100000848 230
980 3300025303 Ga0209051_1000226 Ga0209051_100022678 230
981 3300025304 Ga0209257_1003585 Ga0209257_10035857 230
982 3300025304 Ga0209257_1017346 Ga0209257_10173464 230
983 3300025304 Ga0209257_1019253 Ga0209257_10192533 230
984 3300025914 Ga0207671_10144019 Ga0207671_101440192 230
985 3300025919 Ga0207657_10013332 Ga0207657_100133323 230
986 3300025924 Ga0207694_10049968 Ga0207694_100499682 230
987 3300025926 Ga0207659_10015289 Ga0207659_100152896 230
988 3300025926 Ga0207659_10232512 Ga0207659_102325122 230
989 3300025928 Ga0207700_10197737 Ga0207700_101977372 230
990 3300025941 Ga0207711_10000852 Ga0207711_100008525 230
991 3300025961 Ga0207712_10234109 Ga0207712_102341092 230
992 3300026035 Ga0207703_10006205 Ga0207703_100062058 230
993 3300026041 Ga0207639_10286758 Ga0207639_102867582 230
994 3300026116 Ga0207674_10017443 Ga0207674_100174433 230
995 3300026118 Ga0207675_100537927 Ga0207675_1005379271 230
996 3300026121 Ga0207683_10149323 Ga0207683_101493231 230
997 3300026142 Ga0207698_10000294 Ga0207698_1000029430 230
998 3300027907 Ga0207428_10207164 Ga0207428_102071642 230
999 3300028380 Ga0268265_10023564 Ga0268265_100235644 230
1000 3300028786 Ga0307517_10176599 Ga0307517_101765991 230
1001 3300031507 Ga0307509_10541234 Ga0307509_105412341 230
1002 3300031616 Ga0307508_10001949 Ga0307508_1000194912 230
1003 3300031616 Ga0307508_10262591 Ga0307508_102625912 230
1004 3300031730 Ga0307516_10126728 Ga0307516_101267283 230
1005 3300032004 Ga0307414_10021121 Ga0307414_100211215 230
1006 3300037466 Ga0395898_0443901 Ga0395898_0443901_390_1088 230
1007 3300037471 Ga0395905_0050916 Ga0395905_0050916_1247_1945 230
1008 3300037471 Ga0395905_0070375 Ga0395905_0070375_1333_2052 230
1009 3300037471 Ga0395905_0078733 Ga0395905_0078733_568_1266 230
1010 3300038443 Ga0395901_0192446 Ga0395901_0192446_195_887 230
1011 3300039437 Ga0436365_0449154 Ga0436365_0449154_612_1370 230
1012 3300041404 Ga0439436_0018407 Ga0439436_0018407_1163_1855 230
1013 3300041413 Ga0439465_0006377 Ga0439465_0006377_2237_2929 230
1014 3300041997 Ga0439431_0000187 Ga0439431_0000187_4097_4837 230
1015 3300041997 Ga0439431_0010651 Ga0439431_0010651_1075_1767 230
1016 3300042002 Ga0439442_002393 Ga0439442_002393_211_951 230
1017 3300042004 Ga0439445_0000562 Ga0439445_0000562_2423_3163 230
1018 3300042004 Ga0439445_0069288 Ga0439445_0069288_92_784 230
1019 3300042006 Ga0439432_003177 Ga0439432_003177_14_754 230
1020 3300042007 Ga0439449_0053381 Ga0439449_0053381_133_825 230
1021 3300042010 Ga0439452_021467 Ga0439452_021467_105_797 230
1022 3300042014 Ga0439457_001532 Ga0439457_001532_844_1536 230
1023 3300042121 Ga0450919_010306 Ga0450919_010306_22_714 230
1024 3300042125 Ga0450923_017278 Ga0450923_017278_383_1075 230
1025 3300042134 Ga0450898_035919 Ga0450898_035919_104_796 230
1026 3300042147 Ga0450910_010396 Ga0450910_010396_375_1067 230
1027 3300042156 Ga0439446_0002031 Ga0439446_0002031_3865_4605 230
1028 3300042435 Ga0439434_0002604 Ga0439434_0002604_954_1646 230
1029 3300042436 Ga0439435_0012758 Ga0439435_0012758_1310_2020 230
1030 3300044658 Ga0466972_0010990 Ga0466972_0010990_2896_3615 230
1031 3300044683 Ga0466965_0031586 Ga0466965_0031586_346_1065 230
1032 3300044684 Ga0466966_0138559 Ga0466966_0138559_223_942 230
1033 3300044693 Ga0466961_0011581 Ga0466961_0011581_155_874 230
1034 3300044694 Ga0466963_0101375 Ga0466963_0101375_765_1484 230
1035 3300044706 Ga0466964_0013581 Ga0466964_0013581_1814_2533 230
1036 3300044735 Ga0466968_0029848 Ga0466968_0029848_1189_1908 230
1037 3300044765 Ga0466970_0004968 Ga0466970_0004968_1984_2703 230
1038 3300044765 Ga0466970_0099144 Ga0466970_0099144_116_835 230
1039 3300044901 Ga0466960_0374149 Ga0466960_0374149_72_791 230
1040 3300045049 Ga0466959_0099323 Ga0466959_0099323_1314_2033 230
1041 3300045836 Ga0466958_0000048 Ga0466958_0000048_24898_25599 230
1042 3300045836 Ga0466958_0057198 Ga0466958_0057198_1398_2117 230
1043 3300046460 Ga0495638_0293732 Ga0495638_0293732_168_866 230
1044 3300046691 Ga0495670_0000029 Ga0495670_0000029_63037_63756 230
1045 3300047472 Ga0495686_0156744 Ga0495686_0156744_216_935 230
1046 3300048907 Ga0496104_0001606 Ga0496104_0001606_4502_5245 230
1047 3300048907 Ga0496104_0001863 Ga0496104_0001863_12115_12843 230
1048 3300048908 Ga0496105_0008691 Ga0496105_0008691_1685_2428 230
1049 3300048911 Ga0496108_0205223 Ga0496108_0205223_258_986 230
1050 3300048915 Ga0496112_0908806 Ga0496112_0908806_15_743 230
1051 3300048917 Ga0496114_0656583 Ga0496114_0656583_63_806 230
1052 3300048928 Ga0496125_0242362 Ga0496125_0242362_156_875 230
1053 3300049571 Ga0501034_0099688 Ga0501034_0099688_2111_2827 230
1054 3300049573 Ga0501037_0190511 Ga0501037_0190511_392_1111 230
1055 3300049574 Ga0501038_0247921 Ga0501038_0247921_650_1369 230
1056 3300049581 Ga0501047_0458913 Ga0501047_0458913_198_920 230
1057 3300049586 Ga0501070_0073648 Ga0501070_0073648_1105_1827 230
1058 3300049589 Ga0501073_0065517 Ga0501073_0065517_1126_1848 230
1059 3300049590 Ga0501074_0259375 Ga0501074_0259375_66_830 230
1060 3300049742 Ga0501080_0055199 Ga0501080_0055199_830_1546 230
1061 3300049742 Ga0501080_0084313 Ga0501080_0084313_1275_1997 230
1062 3300049758 Ga0501241_006927 Ga0501241_006927_70_774 230
1063 3300049823 Ga0501044_0100473 Ga0501044_0100473_1470_2186 230
1064 3300049823 Ga0501044_0286077 Ga0501044_0286077_176_898 230
1065 3300050490 nmdc:mga03n38_3129_c1 nmdc:mga03n38_3129_c1_4365_5102 230
1066 3300050491 nmdc:mga00v17_51403_c1 nmdc:mga00v17_51403_c1_709_1446 230
1067 3300050491 nmdc:mga00v17_59417_c1 nmdc:mga00v17_59417_c1_1228_1929 230
1068 3300050491 nmdc:mga00v17_69035_c1 nmdc:mga00v17_69035_c1_385_1083 230
1069 3300050492 nmdc:mga0yw44_23081_c1 nmdc:mga0yw44_23081_c1_239_940 230
1070 3300050493 nmdc:mga0k408_14464_c1 nmdc:mga0k408_14464_c1_1714_2451 230
1071 3300050494 nmdc:mga06z11_138892_c1 nmdc:mga06z11_138892_c1_617_1315 230
1072 3300050494 nmdc:mga06z11_4688_c1 nmdc:mga06z11_4688_c1_2217_2918 230
1073 3300050495 nmdc:mga04h51_98496_c1 nmdc:mga04h51_98496_c1_39_734 230
1074 3300050496 nmdc:mga07m45_32567_c1 nmdc:mga07m45_32567_c1_1531_2268 230
1075 3300050507 nmdc:mga05p37_650235_c1 nmdc:mga05p37_650235_c1_324_1064 230
1076 3300050516 nmdc:mga0sz30_2586_c1 nmdc:mga0sz30_2586_c1_3827_4528 230
1077 3300053086 Ga0500578_0193464 Ga0500578_0193464_479_1228 230
1078 3300053087 Ga0500643_010845 Ga0500643_010845_2656_3348 230
1079 3300053093 Ga0500651_0014869 Ga0500651_0014869_3521_4270 230
1080 3300053094 Ga0500566_0003780 Ga0500566_0003780_3692_4384 230
1081 3300053096 Ga0500641_0054141 Ga0500641_0054141_138_830 230
1082 3300053108 Ga0500562_016473 Ga0500562_016473_1061_1762 230
1083 3300053119 Ga0500595_000553 Ga0500595_000553_17642_18367 230
1084 3300053130 Ga0500642_0133221 Ga0500642_0133221_21_722 230
1085 3300053131 Ga0500652_011638 Ga0500652_011638_867_1583 230
1086 3300053131 Ga0500652_083744 Ga0500652_083744_55_756 230
1087 3300053134 Ga0500658_0000793 Ga0500658_0000793_8516_9208 230
1088 3300053134 Ga0500658_0001085 Ga0500658_0001085_9069_9761 230
1089 3300053134 Ga0500658_0165245 Ga0500658_0165245_140_904 230
1090 3300053139 Ga0500568_0005756 Ga0500568_0005756_4645_5337 230
1091 3300053139 Ga0500568_0016371 Ga0500568_0016371_1921_2685 230
1092 3300053139 Ga0500568_0049176 Ga0500568_0049176_784_1548 230
1093 3300053139 Ga0500568_0084110 Ga0500568_0084110_71_787 230
1094 3300053146 Ga0500588_0059114 Ga0500588_0059114_133_897 230
1095 3300053156 Ga0500622_0001006 Ga0500622_0001006_14767_15465 230
1096 3300054114 Ga0501084_0254685 Ga0501084_0254685_338_1060 230

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08279

HTH_11

HTH domain

41

95

0.99

PF13280

WYL

WYL domain

172

269

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
4hob-assembly2.cif.gz_C the crystal structure of the zalpha domain from cyprinid herpes virus 3 0.9176 4 48
4hob-assembly1.cif.gz_A the crystal structure of the zalpha domain from cyprinid herpes virus 3 0.9095 4 48
5way-assembly1.cif.gz_B mgaspn protein, mga regulator from streptococcus pneumoniae 0.8969 2 52
3f72-assembly3.cif.gz_E crystal structure of the staphylococcus aureus pi258 cadc metal binding site 2 mutant 0.8852 6 61
8fi3-assembly1.cif.gz_B bifunctional ligase/repressor bira from klebsiella pneumoniae complexed with biotin (domain swapped dimer) 0.885 6 61
ID Description Score Start End Superfamily
4a0yA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9473 1 45 1.10.10.10
3v7sA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9456 5 62 1.10.10.10
af_Q2G258_1_64_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9359 7 62 1.10.10.10
4a12C01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9277 1 45 1.10.10.10
1j5yA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9275 3 64 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A7X3MD42-F1-model_v4 WYL domain-containing protein 0.942 136 212
AF-A0A3D2X3X3-F1-model_v4 YafY family transcriptional regulator 0.9318 138 201
AF-Q1WLE7-F1-model_v4 WYL domain-containing protein 0.9241 137 223
AF-A0A1F6PI14-F1-model_v4 WYL domain-containing protein 0.9214 138 212
AF-A0A2N2DEY2-F1-model_v4 WYL domain-containing protein 0.9205 138 212

Feature Viewer

pLDDT pTM Quality
84.47 0.64 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map